2IC5A

Crystal structure of human rac3 grown in the presence of gpp(nh)p.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
177
Chain Sequence
SMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related C3 botulinum toxin substrate 3
publication title Crystal structure of human RAC3 grown in the presence of Gpp(NH)p.
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 177
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ic5A00
3K0CA 4CEHA 2OHFA 1CR4A 2CCKA 4H1VA 3A1SA 3E1SA 4QC2A 1V43A 3MRSA 4DDTA 2MSEB 4A92A 5AJYA 1COWD 1Q0UA 1Z63A 1YKSA 5KOYA 4Q48A 4BPBA 4GI7A 4LJ4A 1XCPA 1FPMA 2X77A 3TR5A 1KGDA 1GL6A 2HYIC 4PHTA 4TSFD 3C4JA 5B64A 4NYIR 4GZMA 5KDDA 4MKIA 1TL7C 2KWIA 4HEJA 4F4CA 2YHSA 3R9IA 3ADKA 4HAYA 4NCKA 3U3JA 3U3RA 3GFTA 4QFMA 1M8PA 4GOKA 5EP3A 4JVSB 5KUTA 4C7OB 4ESHA 3M1IA 1YE8A 1I2DA 3OZXA 2QE7A 1J8YF 1RE0A 2IYUA 1I4LD 1PLLA 1CS4C 1E2FA 1KO5A 4GZLA 4LRWA 2EFCB 1FQKA 2J0SA 3ZVRA 4Q1BA 1Z0IA 4XWAA 5DO9A 4KBGA 5EXXA 5BW8A 2ZU0C 3U4QA 3RLFA 1LB1B 4Q47A 4M22A 1E0AA 2IWRA 2G83A 3B85A 3PV0A 1KDTA 3QXCA 4KV9A 4KSCA 3SZRA 5AR1A 4HI0E 2FFAA 1ESMA 2IYYA 3HPQA 3CIOA 2EYUA 4P32A 4KBFA 5HCNA 2ZRLA 3GJ7A 1IY1A 3QPUA 2F3RA 4DLVA 3A6PC 2CBZA 2GEVA 1F48A 1XCGB 2VP6A 4R7ZA 3SEAA 1DAEA 3TK1A 1IJEA 2NZ8A 1XTSA 3D31A 1Z8FA 4E5UA 2W2TA 1JBKA 3FB4A 1IM2A 1AQUA 1OYYA 4QOSA 4KODA 4PPGA 4DLUA 2PJZA 1E2QA 5FH9A 5F2EA 2RGXA 3AVVA 2YZ2A 3EIEA 1NVXQ 4JLDA 3VQTA 2VF8A 2BM1A 2WWGA 3CZPA 2AX4A 4ACAA 4XOIA 2G88A 3R9XA 2DYKA 4HAVA 1Z0JA 4KHZA 4Q5IA 5AWFC 3LBNA 3V4FA 4DCNA 1N5LA 3SU8A 1CR1A 1CR0A 5KO2A 5J4YA 2VHUA 3P1JA 1SGWA 3SHFA 3VHXA 1ZUNB 2BKEA 2FNAA 1OV4A 4IEIA 5EP2A 3IIMA 2IF2A 1ZRHA 4N0DA 2IT1A 2DY1A 5DLQC 1OYWA 2G1JA 2YOHA 2OAQ1 4Q1EA 5DHFA 3W34A 1QHSA 1OKKA 2J59A 1VYTA 3DO6A 1XTRA 2JIZA 4LJ6A 4BLPA 2WJHA 2E87A 1G4AE 1G3QA 2OBMA 1N5JA 2F43B 1K5GA 2YNMA 2REOA 4KI0A 3KXIA 1Z0DA 1SXJA 2B7CA 1WE2A 2WICA 2IXFA 4JVLA 2RGGA 4NYMQ 4DWJA 2B6HA 4GOXA 3BRWD 5DE3A 2QBYB 4BRWA 2QP3A 2Z4SA 4Z54A 2J0VA 3ZS9A 4AI6A 1AGRA 4Y0VA 3L0OA 2DHRA 4M1KA 4EUNA 4U5XA 4FWIB 4TLCA 2GJKA 4Q01A 2HF8A 2RGEA 3R7WA 4C30A 4WW0A 3TGPA 4I81A 1NJFA 1K5DA 4YXWA 4EJSC 1TF7A 2DFTA 4AKEA 2GBLA 4Q9LA 4NP6A 2XNDA 3ZVMA 2ZQ5A 2FGKA 3EA5A 2VSXA 3L0PA 2XTNA 3AKEA 4HB0A 3OE7A 1F3OA 2VRWA 2ZS8A 4IDHA 4LX0A 4B2LA 1W36D 2OSBA 3VAAA 5EE9A 4R71A 2AN9A 4ZIRB 3A4NA 5F98A 3DM5A 1JI0A 1P6XA 3QKSA 1EGAA 4FMDF 2ZETA 4Q1CA 5B57C 3SJCA 1TAGA 1ZW6A 3L0SA 4LJAA 5LD2C 5A4JA 1OIXA 2WSSD 4KFTA 2ONKA 3FE2A 5JCPA 1A2KC 4OQLA 2I3BA 4LHYA 1LNZA 5HKKA 4TZ0A 4IDQA 1GL7A 4WZBE 2CEAA 2ZE6A 1FX0A 1QHYA 4HAXA 2RGNC 3GQBA 1GZSA 1ELOA 4I1SA 4UNNA 4BFTA 5G3YA 1H8HA 4G01B 4MGIR 3CH5A 3OEHA 2V7QA 1KK1A 1TADA 4HDCA 1N6RA 3L8YA 3H0KA 1X1SA 4H1UA 1CJVC 4PANA 4PPQA 5IK2A 2QBYA 1XMIA 2YJTD 4DB2A 5P21A 1G5RA 3I8XA 1CRPA 1T0HB 2GESA 1E9EA 1T3LA 3W3ZB 5E3HA 1E2LA 3WRXC 1M34E 2JJ1A 3AF2A 1R6BX 5C2JB 4KLNA 2A7QA 3ONWA 3LLUA 3U61B 1N6NA 2J1LA 3KUDA 2H17A 2PT7A 4AD8A 3AM1A 3BB1A 4JLMA 1ZU5A 2CCGA 1VTKA 3L82B 4HAWA 4QJ3A 1GVNB 3T1TA 3T5GA 3OFND 2QY9A 5KSYA 2XX3A 1YR6A 2BMDA 1MO6A 1KMHA 2HDNB 3RDPA 3T06B 3KKPA 3ZD6A 1JXOA 1OH7A 2WWYA 3C41J 2CXXA 3MUFA 4URVR 3VFDA 5HTKA 4PSVA 121PA 4B44A 1GOTA 3GPLA 2SHKA 5TV2A 2VYFA 4IOKA 3LNCA 1N3BA 3HR8A 1G3RA 3M0EA 4Q1FA 4A82A 2A9KA 2IHBA 1Q1BA 3AQ4A 3AV0B 5JRZA 1ZM4A 5CM8B 3KX2A 4NHOA 4WZAE 2QRNA 3WRYC 2J7PA 1E2IA 4LHXA 3WNCA 2V8OA 1DTSA 2AD5A 2UZIR 4URYR 5CDFE 1PUJA 1OFIA 3MJHA 4OQFA 3RHFA 2WKQA 3LQQA 1OXVA 2PLFA 3MD0A 3RC3A 5IHPA 2YC2C 3ADDA 2BBSA 3KKMA 3BFKA 4IRUB 3LXXA 3IEVA 5J4KA 3K70D 2OILA 1FNNA 3LVRE 5FUXA 3PUVA 3IQXA 1CXZA 1XMVA 3AP1A 3M6AA 3PR1A 5JI3E 2ZE5A 1P9WA 5CK5A 1E9BA 1DBSA 1WDTA 3IQWA 2ZI9A 3REFA 3T5DA 1XB2A 1E96A 2GXUA 4M21A 3H2YA 4G5OA 4HAUA 1NL3A 2YWEA 5TB5A 3MFYA 4HLUA 1AA9A 2A5JA 3CF6R 1DEKA 1E9SA 1Q1EA 1CKEA 3PXGA 2ZTSA 2V9PA 3UANA 2ZRBA 3DZ8A 2JEOA 2XTMA 1E2DA 3EASA 2YWFA 2WPDA 2BJVA 2OT3B 3CLVA 3MG9A 2R62A 4UNSA 4NMMA 2WOOA 6Q21A 1QVRA 1R0WA 1WP9A 2YWHA 2GVDC 3QY0A 2O0JA 2FN4A 3W6PA 1DAIA 1UF9A 2EFDB 2B7BA 4OQMA 2XZOA 3CRMA 2Z0MA 1JECA 3AP2A 3I3SR 3EC1A 1GIAA 2REBA 1R5OA 5FFMA 4ARZA 4WXRA 4HB3A 2Q0HA 3AVQA 3TSZA 2AFHE 1YU9A 2AL7A 4LWZA 1EWRA 2G1KA 4QBGB 3CONA 3IO3A 1YZGA 1RKBA 3GEIA 4TL9A 3SNHA 4US0R 3EAQA 3ECCA 5HCIA 4Q66C 1D2NA 2H57A 5TMPA 4I1VA 2IK8A 3BC1A 1GAJA 1A4RA 3A1VA 4QJ5A 2FSIA 1JNYA 1HQCA 2X19A 2D06A 4PO9A 3T15A 2JLYA 4EQ6B 4LJ9A 1N5KA 2HV8A 2QROA 3GLHB 4MKGA 3TQFA 3FMFA 1YR7A 5FPYA 5SZJA 4D0LB 1P2SA 1UKEA 1A7JA 2ZREA 2CL7X 2OXRA 3AKDA 4NU0A 3ZD7A 4CVNA 2WKPA 3X2SA 1Q21A 1W0JD 4TYPA 1HURA 3GD7A 2RGCA 2ZSAA 5FR1A 3SQWA 4XVQA 3SI7A 1E3MA 5BWMA 3QSYA 4HUQB 1FZQA 2ZAMA 4ITRC 4WBSA 1GWNA 4EPRA 1R0YA 2D2EA 4N1AA 3FMPB 1UAAA 4G5RA 5KSZA 4BLRA 3KQHA 4MGYR 1TU4A 3OAAA 4D6PA 2TMKA 2BBTA 4O0MA 2DB3A 5CB8A 5SZHB 1OHHD 5EXSA 1OH8A 1HT1E 1Z83A 1Q20A 1NSTA 3V4RA 3IILA 3TMKA 4KFRA 3B1XA 4HDQB 2ZRNA 2Z43A 3ZS8A 4MUAA 2G0NA 2Q6TA 3A37A 221PA 3UXMA 4QGFA 2GXSA 1I4DD 4LSGA 1KO1A 3I32A 3ETLA 4OQNA 1XDBA 4KXFB 3TKLA 3DZDA 3LAWA 2W6JA 3GFPA 2OBLA 1ZMXA 4UXIA 3NBZC 2KI5A 2BDTA 2HLDA 4XTCS 4MYTA 1DO2A 1OIWA 4EFMA 4G5SA 4MRNA 3KXLA 1G6OA 1Z6TA 4NE2A 3T35A 4CT4B 4W9MC 1EFUA 2KJQA 4RFVA 1NLYA 3SHWA 5DNYB 4URXR 4AURA 2IX3A 1DG1G 1DO0A 3C15C 3C8UA 3KZ1E 5K8UA 3QPWA 3WNBA 4EPYA 1GDDA 4LYAA 4G5QA 3QXJA 1G64A 1UEIA 1G8FA 2OCPA 4PSAA 1XEFA 3RC8A 4A8JC 3QKRB 3SFVA 4PR0A 1NY6A 5DISB 2C04A 3VX4A 3F0TA 4JLPA 2EU8A 4A0FA 4A0RA 3PEWA 5CJPA 4Q9JA 1J7KA 1U90A 2GCOA 3I73A 1G5PA 4LBYA 1NP6A 2ZI7A 4A1FA 4DT1A 3WMFA 1PVOA 2GCPA 3R8CA 3WHKA 1DAGA 2ZRDA 5EP4A 2MMCA 4P33A 2RKOA 3GLHE 1M6NA 1A5TA 3GLIA 3JZMA 1X86B 3BE4A 4CIDA 4LPKA 2G0TA 1FMJA 2GTPA 1FMLA 3U3OA 1ZNYA 1RC8A 2ERYA 2ZRJA 1H8EA 2QPTA 1CLUA 2AR7A 1WB9A 4PC6A 5DHAA 2BMFA 1GITA 2WJVA 2RB4A 2Q3FA 1JQJC 4YDHB 2IC5A 1KTVA 2ODEA 2W00A 4AG6A 3BORA 4A0HA 1BMFD 1JEEA 4AIIA 4DJTA 1RRPA 4DUGD 4JSYA 2EQBA 3RS4A 4JJKA 3GJ0A 4B6FA 1XCMA 5GJCA 4PAMA 1NBMA 4R2IA 3KKOA 1OB5A 1XXHB 1CULC 1MABA 1JB1A 2ANBA 1KSJA 2RGDA 4IOMA 4C0AC 4MITA 2N42A 2X2EA 2Z4RA 2A3RA 2XXAA 2JLSA 3AVUA 3ASZA 1ZD8A 2GRJA 1YQTA 1FW6A 1MH1A 3PVSA 3WBKA 2QMEA 4Q9IA 1UPTA 2XEXA 1ZIPA 4NZYA 4Q7LA 2PH1A 1F2UB 1OB2A 2FGJA 2O52A 1KSHA 4R98A 4KJZA 1HE1C 2X2FA 1DELA 2JLWA 1ZNXA 2HT6A 1YZKA 1KSFX 2R6GA 3ND9A 4RD3A 4OI1A 3HR7A 4JS0A 1O3YA 3QXHA 3T12A 3C5HA 3EC2A 1OFHA 4WA7A 3WXMA 2ZJAA 3VU9B 1XD8A 4PHGA 5DIFA 1MO5A 1RJ9A 2DWOA 4QGGA 1IY2A 1TX4B 2WWWA 3JVUA 3ND8A 2QRZA 4P4TA 3ICEA 3ZQJA 1LTQA 2N46A 4MDFA 4GMXA 2QQ0A 3HDTA 5C18A 2GF9A 1YRBA 4UNQA 1IHUA 4B3FX 5EP1A 2WJJA 5F3WB 2OFXA 4HZUB 2MMGA 2ZJ8A 2QG6A 2XJ4A 5FL3A 1W5TA 3BFXA 2ZROA 3SOPA 4YMWA 5JHGB 1E4YA 5E7JA 1OXSC 2FX3A 1XXHA 1VYVA 3K8YA 4NCHA 2NQ2C 1E4VA 1OW3B 2Z6VA 3W8NA 1G9XA 1W44A 3MWJA 1GM5A 4RCYA 2Z83A 2ZS9A 1SQ5A 3LRPA 1Y63A 2IL1A 3T1QA 4Q4LA 2QGZA 3M4YA 4OK5A 1DE0A 1GNQA 1W5SA 3BS4A 4CEHB 5JEEA 4QRHA 1T9HA 2O5VA 2KBFA 5FBVB 1G7CA 1F2UA 3EZFA 1N25A 4D4MA 1ETUA 1PJRA 4L4UA 4PO1A 4MKHA 3PUXA 1IJFA 4JKIA 2QPOA 1HA3A 2OLKA 3QG5A 5AUOB 3KKQA 4PHHA 1VIAA 5KDOA 4BLTA 1X8KA 1TMKA 3HU2A 3WBJA 4ESVA 4HLQB 3VU9A 3I61A 2DPXA 2WZQA 4LZZA 4DB4A 1G18A 3P32A 1AKEA 3NKVA 2F1HA 2YVUA 2RMKA 3A4LA 2QEQA 3B1WA 4ZCLA 2C03A 3TSOA 1T3SA 5L8VA 1R5BA 4LCBA 1W36C 5DSZA 2XGJA 1CJMA 1L4YA 2GZAA 1Q22A 2DWQA 4IVQA 5G41A 2AWOA 4C3ZA 5ANRB 4G3XA 5HZHA 4JLOA 2NPFA 2WWXA 2ZJ2A 4HZUA 2CDNA 5KNCA 3Q7QA 3KQUA 5K8TA 1IN8A 1E2HA 1W2HA 1Q3HA 2ATVA 3FWYA 4MRVA 1KI8A 4X8HA 3MJRA 3U44B 1D9ZA 4C4PA 5EZ6B 4S35A 5IT5A 1H65A 3EZ9A 4BFZA 2BEJA 5LB2A 1NG1A 3U4QB 2ODNA 5KDLA 1UKYA 2VHTA 2P3SA 3VR1A 1UDWA 4LV5B 2CNWA 1G7TA 1G7RA 4X8LA 1UKVY 5D3MB 5FBRB 2GXQA 2VIIA 2ZJZA 1E9CA 1NI3A 3SBDA 4BLQA 4ZI2A 3VTKA 3NBFA 3CWQA 2F1RA 1LV7A 2G6BA 3KB2A 5FTJA 1Z08A 1CJKC 1KHTA 4JYBA 4YMSA 1P2VA 2WWIA 3TVTA 1A2BA 2ERXA 1UBEA 2ZU6A 1KI9A 3RSOA 1J99A 1US8A 3K0FB 4TWZA 4C0LA 1F5NA 4YQFA 2WTUA 2EW1A 2G3YA 4C9BA 2QE7D 3GFOA 2A2ZA 1E9AA 1AN0A 2R6DA 2V6IA 2WOJA 1HY3A 4D4LA 1MRNA 1AS0A 1XFAA 2OCYC 2H18A 3IDQA 3LQRA 3PUYA 4JLAA 4US2R 4IHQA 1LY1A 3CPEA 3K09C 3DDCA 1HQYE 4NKRA 1UBCA 3A4MA 3B2EA 3QOFA 4JLBA 4DLZA 1ZAKA 1XJQA 4ZCMA 1J2JA 1U9IC 2ZSEA 1GKYA 4ZKEA 2A5FA 3DL0A 4LV8B 3RANA 2FFQA 1EFRA 1DG3A 4BECA 3TAUA 5HR5A 3FMIA 4D26A 1G4UR 3NHAA 2ZRCA 2CE7A 4L9SA 4ZDWA 2IYRA 4E07A 1UEJA 4B47A 4L16A 1XZQA 4LBZA 4A15A 1Y3AA 4HSEA 5JRJA 3AB3A 2QT1A 2ODBA 3UMRA 2R8RA 2Q9AA 1KY2A 3U44A 4ZV4A 2QQEA 2JLUA 5FOWA 1Q44A 3LO5A 5E7MA 5K8IA 5AUPB 3W8RA 4DCVA 3AUYA 4B73A 5C1BA 4FINA 4YMUA 2J0QA 1SXJB 1OXUA 4Q7KA 5D3MA 3W90A 3LX8A 5FTKA 2C9OA 2QTVB 2CMKA 4P3YA 3THXA 2ZM5A 1JAIA 2GKSA 4IXMA 3PENA 2FSFA 2VHCA 2IHYA 2O8EA 1G20E 1Z47A 4IDOA 3FOZA 3K70C 5J40A 1L2TA 2RHDA 2C98A 4PHFA 4FN5A 3R7WB 3REGA 2QTHA 4GFDA 4DIDA 4F93B 2PL3A 2R9VA 4URUR 3CR7A 3K0FA 1UM8A 2X1VA 1OKKD 2F7SA 3CKLA 1F2TB 2NOAA 2JIZD 4PC3A 5H8WA 3SDZA 5JBQA 2Q3MA 1U98A 4AY2A 5BXQC 4WAUA 5JWRA 4M9ZA 1Z22A 3ASYA 1XJCA 3CX7A 1LS6A 1BOFA 2J0UB 4PSKA 4WXPA 3ZIAA 4RD6A 4D2IA 1PLKA 1SXJD 2BC9A 2GAAA 2O8BB 2FF7A 2XOKD 4RZUA 2RAPA 2ZJBA 3ZH9B 4UKDA 1ZIOA 3QKSB 2IUUA 3JZAA 3I72A 3O8CA 3MCAA 4DDVA 4LHVA 2VQSA 1L7VC 4TMKA 4HZIA 1QG2A 4FCTA 4TLDA 4W7SA 1Q12A 5CLLA 2FZ4A 1AZSC 2NTYC 4M1OA 3VMFA 4YXWD 1P60A 2BEKA 4Q03A 1FX0B 1B23P 3IBYA 3GJ8A 4KYUA 4C2UA 3H86A 1S3GA 2H7VA 1EWQA 1E2NA 4LJ5A 2GK7A 3OESA 1KNXA 1P73A 1S96A 1GKIA 2XNDD 1U81A 4TN1A 4W5JA 1TTTA 1IAQA 1P2UA 1UJ2A 4BUJA 4HB4A 3OE7D 1CTQA 5FI1B 1CJUC 1ZUHA 4B2IA 2D62A 1S8FA 3PIRA 1T6NA 4CYMA 2ZRPA 4B48A 4OHXA 4DBLC 1IXZA 5BYJA 3U7HB 2ZSFA 1X8LA 4W5WA 4QM7A 5TARA 2WMOB 3NWJA 3OF5A 4MQBA 5FPTA 1O87A 5DH9A 1ZBDA 1C4OA 3BH0A 2D3WA 2ZANA 4OI2A 5HKKD 1G1MA 3TLXA 1F2TA 3FFAA 2AKYA 1L4UA 1KKMA 1VMAA 2YWGA 4NYJQ 4V0KA 1QZXA 2JCSA 4V02A 1H8HD 1SVIA 2JAQA 4PC1A 1EX6A 4QHYA 3OEHD 2V7QD 1KMHB 3GEEA 2J0UA 1Q1ZA 3BGWA 1SULA 5C4GB 1DVRA 3I8SA 1AS2A 2O8BA 1S3SA 3FTQA 2PX3A 5IK2D 1SXJE 4FCWA 4EPWA 2O8DA 1XD2A 3THWA 3UMFA 3E5HA 4B32A 3RS7A 2IYTA 4QNMA 2JJ1D 4UQOA 1TUIA 2JJ2A 2BWJA 1MR3F 3BJIC 3T1OA 1G17A 1G21E 3K0AA 4OHWA 3RSLA 1GG2A 4D4KA 1GRRA 1KOFA 1T3HA 2GCNA 2W0MA 3B9PA 4Q1AA 3FHTA 2GWHA 3AEZA 4RCZA 3IPYA 4DEXA 5JS7A 3PITA 1CIPA 5JHHB 3ZGXA 2ECKA 5EXTA 1N6PA 4MGZR 1YZQA 4EFLA 1MRSA 3X1DA 1U8YA 3QBTA 2JLQA 3CWZA 4AYXA 4AKIA 5H70A 4M1MA 3O8RA 1MO3A 2QAGC 4LBVA 5JS8A 3AVOA 3BOSA 1ANKA 2DFKB 3LV8A 4BZXA 2ZYUX 5CIWA 1G8YA 3VNVA 1NF3A 2WMNB 3CNLA 3UKDA 2J45A 3KJGA 4P4SA 4ZO4A 1W48A 2P6UA 4NDZA 1GUAA 4FD2A 1LF0A 2DBYA 3GLGA 4JLVA 1GSIA 3BBPA 1E9DA 3PCRB 1PZNA 3NTUA 2ASEA 5FPHA 4GL2A 3CBQA 3QBVA 1SVSA 4IXNA 3SS8A 2PZGA 3IGFA 1GRNA 2J7PD 1KO4A 4TYNA 3T1VA 1YVDA 4A2WA 4M2LA 4D0NA 1U0LA 2IYQA 3CO5A 2CHGA 5BN3A 5E95A 1UKZA 3Q7PA 4M0LA 3GMTA 2W2XA 2CL0X 4TMVA 4CGZA 3VKWA 2V4ZA 1X1RA 1N6KA 2QM8A 2IS6A 3CNNA 4KCGA 3DKVA 5EXPA 2C77A 4ARZB 3PEVA 2FH5B 4A4DA 3RRYA 1DAFA 3D3QA 4XD7A 4DVGA 1A1VA 2ZRAA 2QAJA 1VG1A 1SVOA 1KO8A 1S1MA 1YR8A 2R44A 4B6EA 3FKSA 5CITA 1JQLB 1VG9B 4B34A 2ZR0A 5FR2A 2HUPA 2ZAOA 2WPDD 4LI0A 4Q1DA 3NDBB 4EKDA 4XWKA 3F3YA 4IOJA 4QGHA 4B33A 4DKXA 4PFSA 1NKSA 1Z5ZA 3W6NA 3MGCA 2FG5A 5FL7A 2D7CA 3ZZTA 3UIEA 4AWXA 2FMXA 2GK6A 4ILEA 4OJKA 2G9NA 1QF9A 2R6AA 1FTSA 1KAGA 4URWR 2JDIA 2QU8A 3I1FA 2VL7A 4NCNA 2OESA 4BZPA 3NBXX 3FHCB 3OHMA 4FI3C 3TUIC 3TUZC 2WVJA 4U7DA 2BCJQ 2ZE8A 2OFWA 4A2QA 5G3ZA 1G3IA 3L43A 2HEIA 4DZZA 2IUTA 5L3SA 4PZLA 1IY0A 1V5WA 1XMSA 3Q8XB 2GJAA 4MA4A 1NMZA 1EG7A 2XZLA 3NH6A 2XJ9A 3KB1A 2R6FA 4P0TA 2WSMA 4I1UA 4LV6A 5IDVA 5JI2E 4OL0A 4Q4HB 5TY0A 2C78A 1SZPA 1Q3TA 1M1YE 1ZCAA 4GRAA 2VLIA 1KI6A 4EIWA 2ZR7A 4OJQA 1ZUIA 3IO5A 1LW7A 3X1YA 5JEDA 3DMNA 2WKRA 3CNOA 3EA0A 4DHEA 3R9WA 2CVHA 2JLRA 3IPXA 2GEDA 1OSNA 4ZCIA 1EFTA 5UKDA 2O8CA 2BCGY 2F6RA 3BH7A 3QIAA 3VKGA 2PMDA 2V55B 1CR2A 4RSGA 2R2AA 1ODFA 4M4SA 3U7FB 4DLXA 1E2JA 3OAAD 3BH6A 2I1VB 2OCAA 1E69A 1RIFA 3P26A 1TQDA 5JWOA 2FEMA 4AG5A 3TRFA 4PPNA 1X8JA 2XSZA 4C0BA 4DLWA 1Z0KA 1GP2A 2BKUA 5SZIA 5AJVB 1KZ7B 2QM7A 3KFXA 1RPZA 4NYJR 1P4SA 2W6JD 5DYGA 3ZJYA 1N6HA 1T4GA 2IXGA 5JSZB 1JPJA 4QKQA 5LD2B 1IN4A 3BB3A 3QXSA 1W4CA 2HLDD 4JLNA 4BRUA 3VNUA 1R8SA 2QZ4A 1ZM2A 2GCOB 1HUQA 2HF9A 4LY6A 4DT1B 4IW3B 1XX6A 1HT2E 3BWDD 5EE5B 5B58C 1RRCA 4L15A 4X8OA 4MYHA 2I4IA 3VHLB 4Q4HA 1XRJA 1WXQA 1NJGA 2W6ID 1XD9A 2ZUBA 2ORVA 4M9SA 2W0SA 3K9LA 4HUTA 2IYZA 5GVSA 3GLIB 2CE2X 3N70A 3UPUA 4OHVA 1ZCBA 3EWSA 5FPKA 2B21A 3MMPA 3TUJC 4BASA 4B74A 3TW8B 1J90A 1S9HA 1GTVA 5DGXA 2K5UA 1XTQA 3LBIA 2REXB 4Z8YA 1T8UA 1N0VC 5L3QA 1RW4A 1QVAA 1R4AA 4DSUA 521PA 1Z6AA 1KI2A 2PLRA 3K0CC 4OHZA 3VR2A 4EJSA 3THYA 2PEYA 2QN6A 3KL4A 3LLMA 4OK6A 3AF1A 4TT3A 1P7CA 4F38A 2AK2A 1OFUX 3TR0A 1MABB 1KIMA 4RZ2A 4NTZA 3NC0C 2JLVA 5E7IA 5EE0A 4CDGA 2OM2A 3N2IA 1VECA 3QVVA 3WNDA 1YR9A 2XXAB 2ZRHA 3SQXA 1VHLA 1M7GA 1QHHA 2ZI6A 1TQ6A 1KI4A 4MRPA 1J8MF 1H8ED 1WCV1 1Z6XA 3LFUA 3HWSA 5JSZA 3KFVA 4OKSA 5CJ2A 4JT2A 3BB4A 3BXZA 3CR8A 3CH4B 4R2HA 721PA 1Z6GA 1XPUA 4MH0R 4JL5A 4XWOA 2VP0A 3ZYCA 2CK3A 2IA5A 1HYQA 1W47A 5AJWA 4DEYA 4ERNA 2LCFA 2RGNA 3WYGA 3KXKA 2OLJA 4FXPA 1WBDA 1AIPA 1E9RA 2ZE7A 3BK7A 3PG5A 5CIQA 3SN6A 2DR3A 3DPUA 2WWFA 2ZVQX 1RJ9B 2D74A 2PZFA 2OEPA 2QAGA 4V0MA 4M53A 5JMTA 4NCIA 4BLSA 2OV2A 5EJEA 4F92B 4OBEA 1E1QA 3U5ZB 3CB4A 4RVCA 2E1RA 3FFBA 1KSGA 3NC1C 1PLJA 2PCJA 4TLBA 3DHWC 3W5JA 5KYKA 1R7RA 4OYHA 1EFCA 1N5IA 1OT3A 3CZQA 1R0XA 2EYQA 1T91A 2QMHA 4L5BA 3UK6A 4NONA 3GJ3A 1CU1A 1FL9A 4PPFA 1UBGA 2JASA 5FUVA 2DFNA 4F4IA 5JCZA 1NNEA 3A36A 2VPPA 4RFSB 4J0QA 3B6EA 1SVWA 2QMOA 2ZR9A 2LKDA 4ACBA 3LWNA 3WYFA 1AS3A 2IF0A 3QNUA 4UJ3A 3GLIE 2J9RA 3W9YA 4PZZA 1IONA 2VP2A 4PO8A 4UXHA 3U3MA 3AVPA 1NKTA 1M2OB 2WHXA 1G6HA 1TQ2A 3O8DA 2CLDX 4GBMA 2XB4A 1WBBA 4LYJA 2HT1A 4TQ9A 2OBNA 4Q4AB 2HCBA 3RRZA 3ZZUA 4TYWA 2C5LA 4U02A 1TF2A 2IEZA 4K8OA 3QEJA 1OFTA 1S1CA 3OIWA 5GADl 3QUSA 1G16A 1N6LA 1Z06A 1G19A 3NH9A 1NBME 2QSZA 2PZEA 3UATA 1EXMA 3AF4A 1VG8A 4LHWA 4PQYA 3K9NA 1RVDA 3RRMA 5IRCD 1KI3A 1XEXB 3MWLA 2WAXA 1P2TA 1TEVA 2J46A 3CRQA 1TEXA 4ABYA 4XTRA 1SXJC 3G5UA 4AKGA 2VP5A 1NY5A 1TU3A 2QA5A 1T0JB 3Q5DA 2P6RA 1OLOA 4DSTA 1LF5A 4MGKR 1E94E 1IN6A 3P4YA 1M74A 4QXAA 4YDSA 4KFUA 5KPJA 2O0HA 4TL6A 1E0SA 2IYSA 3U6BA 4CEJA 3QKTA 1FOEB 5EZ5A 1BO6A 2WJYA 4B2PA 2NO7A 2W2VA 2IXEA 2QUZA 4A0GA 1E1RA 1NRJB 1Z3IX 1XTIA 2GBLC 1Q1QA 4RFSA 4D82A 3Q85A 1E2PA 4JVMA 1ZVQA 5JLJA 2YC4C 4M8NE 1FUUA 2AKAB 3GLFA 3F8TA 3ADCA 4DCSA 1E6CA 5JWHA 3A1TA 4B3DA 3AKYA 5KSPA 3V9PA 5FBWB 1YZUA 4IFBA 4KO8A 3H4MA 3LD9A 2PJRA 4N3NA 1E2KA 3L8ZA 2LKCA 3NIBA 4KSBA 2QP4A 1NMYA 3IIJA 4JBYA 1SHKA 4H9GA 1OE0A 1JR3A 1WRBA 5KU1A 1TPZA 5FUYA 1VCIA 1US8B 2NO1A 4FMBB 3QEOA 4YONB 4D0GA 4Q4AA 3CPJB 1D9XA 3MSXA 5LBIA 5KNBA 1DAMA 1DOAA 1JALA 1CBUA 1FP6A 1C1YA 4DRZA 5SZKB 1SKYB 3TIFA 5TDHA 5FOUA 3B8HA 1XXHE 4YC7A 4C0HA 3QKUA 5J5CA 2CNWD 2OUKA 3VKHA 1DAKA 1XEXA 1XTKA 2GJ8A 5AUNB 2HCJB 3I5XA 1KI1A 4NBSA 1PV4A 4CEIB 2ZI4A 821PA 1MOZA 2AHOA 3PQCA 3AGPA 3LY5A 4IEEA 4PC2A 5H1YA 3SJAA 3UMSA 4GP7A 3OIVA 4B43A 1EFHA 2V1UA 3A1UA 4TTPA 4RD1A 1FQJA 2GJSA 1AM4D 4OQXA 1MV5A 5DN6A 2FPMA 2FA9A 4BFXA 3FYHA 1KZGB 3B1ZA 2GF0A 4C0QC 4TQUS 3GEHA 4ZPXA 2XAUA 1UADA 5DYIA 3RWMB 4CF7A 4RD2A 4I1OA 1QDEA 3LVQE 2A5YB 2NG1A 4LJ7A 3UG7A 1DPFA 1G3MA 5ELXA 3OEEA 3RWOA 3THXB 3WY9A 5B2ZA 2PCLA 3AF0A 2IWHA 1EFRD 2VA8A 1QHXA 4LBWA 2O8EB 4Z1MA 4AK9A 1YJ5A 2KBEA 3UG6A 2PBRA 1XBTA 5B30A 2DCUA 3TH5A 2JLZA 3KJEA 4HATA 5J4LA 3TVDA 3GP8A 1SHZA 2GNOA 1U8ZA 2P5TB 2ZYTX 3V00A 2PT5A 4CRWB 1OH5A 1II0A 2QP9X 3PFIA 3VR4A 4ASUA 2ZI3A 1YHNA 3J81k 1NVVR 1SVLA 1VPLA 2NO9A 2RHMA 4B3GA 2P5SA 2VP9A 3KQKA 5FUWA 4B71A 3KJHA 3I4LA 4KYIB 2C95A 4KU4A 1K6MA 4HAZA 4IJMA 1QRAA 4KAXA 4CEIA 4PAOA 2J5XA 2C8VA 3NG1A 4XJXA 3SE0A 3THOA 4DLSA 1KJYA 1NIJA 2OO7A 3PUWA 4IKEA 4IFEA 2OFOA 5BN5A 3W5IA 4F7WA 4LOAA 4V0OA 1E79A 4L8GA 4O25A 2VO1A 4BGDA 4AC9A 4RKEA 1P9NA 1GNRA 4BWYA 2VTKA 1W0KA 1G3UA 2P0EA 3CUEF 4E22A 4A8JA 1II8B 1M7HA 4D80A 2ZEJA 3LW8A 5DI3A 3HPRA 3K0EA 4UNRA 1KMQA 1ZU4A 2GETA 1TQ4A 3EIQA 3UWKA 4HLUC 4PTLA 3C14C 5F9HA 3AVXA 3E70C 1Z0AA 1SKYE 3SJZA 3ZIAD 2Q9BA 2BOVA 4Q7JB 3BERA 2ZRMA 2QENA 5FOTA 3F5FA 3SFZA 1IXRC 1COWA 3PEYA 5FTMA 2IUSA 3K0SA 2QT0A 3BAFA 1W4AA 2VH5R 1D8TA 1NLFA 1E98A 3KQNA 3ZLJA 2ORWA 1Z6YA 1QHIA 2Y8EA 4ZI3A 4TSFA 4M9QA 3ZQ6A 1BYIA 4O3MA 2C99A 1U0JA 4DSOA 2QNRA 5LPNA 3DEFA 2PMKA 3QF4A 5AJXA 2V6JA 1SVMA 4BFYA 2UZ3A 4LJYA 2J7KA 4XH9B 3X1ZA 3LX5A 3CRVA 5FTNA 2OG2A 1G291 4DDUA 5CYPA 4KFSA 1W46A 3CM0A 5HE9A 3FDIA 3RNLA 1N6OA 4N0EA 5FTLA 1XD2B 3OIYA 2O8DB 3ADBA 4DXAA 3THWB 3WMEA 2E9SA 5A5GA 5HPYB 2OE2A 2BBOA 2VSOA 3K0AB 1W2GA 1OJLA 2BVNA 3KQLA 2J3EA 5EQTA 3GJ6A 4LC1A 3B9QA 4GT1A 2VP4A 1II8A 3BD9A 4Z8XA 5AK0A 1KY3A 1PUIA 1XTJA 2B92A 2FDCA 4A2PA 1YZLA 2BIFA 4GOJA 1R10A 2CLCX 2NZJA 5FI0B 2XB2A 1JAHA 2FSGA 4Z51A 3H1TA 1IN7A 4HLDA 5FPSA 2NO6A 3X1WA 5HZKA 3TJZA 4QGAA 4C7OA 2BJWA 2KSQA 3RVBA 4TQAA 4P4SB 4LK2A 2R65A 2FE4A 3RABA 1MT0A 1E0JA 2IBMA 1IOZA 1R0ZA 2VEDA 2ZSBA 3NEJA 4FMCB 3GLGB 2JJ2D 4XSHA 3L0IB 1Z28A 3QI2A 2GEUA 5KNDA 1KYIA 1LVGA 4U00A 1Z29A 4TTQA 3VX3A 1W36B 1G8GA 2ANCA 3Q72A 1YZTA 3QG1A 4B3CA 1IN5A 4QHSA 1HE8B 2O8FB 2XOKA 1WA5A 5CK4A 1RYHA 2AD1A 1C9KA 1KJWA 4TMZA 1W1WA 2IS4A 3K1JA 1AZTA 4A6PA 3G0HA 3HYRA 2CL6X 1E9FA 3IEUA 1VKJA 4V03A 3NVAA 3X1XA 3AKCA 2EWWA 4FIDA 1QBKC 5CM9C 3QQ5A 4M1YA 3SR0A 4OHYA 1G7SA 2LWIA 2XNSA 1X3SA 2GILA 3DVLA 1P62B 1II9A 3KKNA 2GZHA 2GJ9A 4JBXA 2IYVA 3RS3A 5J4HA 3B1YA 3ZVNA 4MRRA 1ZM3A 3RAPR 2Q9CA 1RRFA 1JPNA 1ZNWA 3LW7A 1NLZA 2WV9A 4JVNA 4EPXA 4C2TA 3OIUA 3GJ4A 2P2LA 4QG7A 2EVWX 4QBIA 1LFDB 3EZ7A 1EESA 3U3KA 1E2MA 3QXXA 4XVUA 1W4RA 1NVUQ 4LUCA 2X8AA 3B60A 3JVVA 3U7GA 2IEYA 3NEYA 4DLYA 2UVQA 4JIMA 1MKYA 1FP7A 3WYAA 2AFIE 2YYZA 1D2EA 4POAA 1HTWA 2P67A 3E2IA 2F43A 3SJBA 4B75A 621PA 3K9HA 4LJ8A 1NMXA 3QE0A 4RY2A 3CRW1 4XD7D 1AJEA 4AKHA 4RZ3A 3DOEA 2V54A 3FMOB 2O8FA 2A5GA 1CEEA 3FKSD 3EPJA 2OAP1 3AUXA 1IBRA 3TE6A 4B3BA 2GA8A 4US1R 2QTFA 4IDNA 4X8MA 1T5LA 1FUKA 4LGMA 2KE5A 4TLAA 1KJZA 3LH5A 5L3SB 2WSSA 3RYTC 3CW2A 1NG9A 3B5JA 2CHQA 3MAAC 3EXAA 1VDZA 1ZC3A 4TL8A 2C96A 1P61B 1OIVA 1OXTA 4Q9KA 5FL7D 1KK3A 1ZP6A 2NIPA 5CDFA 1WQ1R 2RGAA 1KI6B 3MWYW 2JDID 5KHOC 1IQPA 3EZ2A 1NIPA 2F1IA 2VF7A 3GLGE 2CCJA 4QJ4A 3U6KA 1TF5A 5K8LA 1X6VA 2O8CB 3D6TB 4ZIRA 1BKDR 4A9AA 3K70B 2FU5C 2ZUCA 1JXMA 3EPKA 1P5ZB 4G5GA 5FBQB 1KK0A 4PQRA 3AVWA 4OK3A 3SBEA 1UBFA 5TVKA 3K09A 3FHOA 5LB4A 2IYXA 2ZJYA 2JA1A 3EW9A 5GJVC 1KNQA 2FZLA 1S2MA 3OFNA 1U9IA 2FJUA 5DI9A 3C16C 3P4XA 3Q9LA 4MUBA 1DARA 2ZJOA 3QF7A 3S1AB 1KDOA 3Q3JB 2P65A 3EZ6A 4MYUA 1YZNA 2NPIA 3BFVA 2I1QA 5H68A 1HH4A 1CP2A 5F9FA 2BMEA 1L8QA 1XEWX 3DKPA 3Q5EA 4TTRA 4BZQA 5GJWC 2JJ8A 2QPAA 3T61A 1W49A 3CF2A 5AUQA 1ONBA 4BE7B 4M9XA 1P3JA 3TSWA 4DSNA 1NN1A 3N5CA 3P27A 1XP8A 2P6NA 4HB2A 3ZDQA 4PQFA 5BN4A 4RJLA 2JLXA 2DFLA 1TNDA 3B1VA 3I62A 4II7A 4GSYA 4ZDJA 3NBYC 4O2RA 1VYUA 3WMGA 3LDAA 1VHTA 2ZRFA 5FOVA 1GKUB 2XTZA 3HYTA 2XSZD 1G8PA 4HLCA 4WZ6A 2CJWB 2W83A 1DS6A 3KUCA 2H92A 3K53A 4BEJA 4FW9A 1R8QA 2YKGA 4MKFA 4WVFA 4ZDKA 3R20A 5TXGA 2H1LA 4RD0A 1KDPA 3U7EB 5L3QB 2GVZC 2IS2A 3D8BA 4PX9A 1XU4A 2GZDA 4IDPA 2ATXA 4TMTA 1E2GA 1XNJA 4I99A 2FOLA 2A78A 3FKQA 4EJSB 3THYB 3HJNA 4URZR 4MDEA 1FFHA 1QHGA 4JYCA 2WIBA 1GL9B 2B8TA 1RZ3A 2C2HA 4V0LA 3WHLA 1I2MA 2G77B 4JL8A 2H16A 1HV8A 4AYWA 4GDFA 4TYYA 1AK2A 4FCVA 1XPOA 3LA6A 4UXJA 1ZC4A 2F9LA 2ZIAA 4TZ6A 2YV5A 4TMWA 4LC0A 4Y0AA 4ZDIA 1KKLA 1TUEA 1XPRA 4M1WA 1QHHB 3RRNA 2BMJA 2GHIA 1VCMA 3S1AA 4B76A 4B3XA 3ICQB 1XMJA 3B78A 4NYMR 2RCNA 3O8BA 4LHZA 1G41A 3IBGA 1K8RA 4JZKA 5AJZA 1N0UA 4JJZA 2B8WA 1SKQA 3VR6A 3KJIA 5D3QA 4YLGA 5CYOA 3I92A 3UWOA 4B35A 1JR6A 2J41A 3IIKA 3H84A 2QGNA 4JLJA 3NXSA 5E4FA 1Z07A 2FPKA 1Z0FA 4TT3D 1ESNA 3TAHA 4BLOA 3NHBA 4Q9HA 2ODWA 4QM6A 4KLZA 2Q21A 5M04A 2OXCA 2A30A 2ZS7A 2QAGB 3CPHA 2QORA 1S4QA 3NDPA 1OPXA 2CJWA 4BFVA 2IS1A 2ONJA 3B82A 1ZINA 1VG0B 4QBHA 4LPSA 2QSYA 4MRSA 3WP1B 2GDJA 1N0WA 1RFLA 5FOSA 3WP0A 4EPVA 4EDHA 2IYWA 3VR5A 1S0UA 1E0KA 4QNRA 1QG4A 1ZJ6A 2CK3D 2ZITA 3T34A 1CJTC 3IHWA 3QENA 1U94A 3N2EA 3SYLA 3IKJA 4D4JA 1W0JA 2ZRKA 2ZJ5A 3PEUA 1J70A 4K81B 5J47A 1E32A 2D4HA 4FWTA 2FEOA 2ZRIA 5KPDA 4KVGA 4LYFA 2YINC 2F55A 1OH6A 4D81A 4JT4A 3SYKA 2N1BA 3CX6A 1Q57A 4BFUA 4S2EA 4BFWA 4QHTA 1VIYA 4JBWA 3VR3A 1E1QD 2MSDB 3HP1A 4CZ2A 1WMSA 4GPTA 4EQ6A 1OHHA 1BIFA 1NVWQ 2KB0A 4JL6A 4Q21A 3SC3A 3GLHA 2EFEB 2W6IA 4PC7A 1JEDA 4PXAA 4A6XA 2H5EA 3EWAA 2V3CC 1DADA 2ZYWX 2WWHA 1NBMD 3AH8A 4YMVA 2QI9C 4NCJA 2HXSA 5FBLB 2AK3A 5HE8A 1GILA 1NN3A 3AF3A 4PZYA 1NVVQ 1R2QA 5JECA 5CLQA 3U60B 2OZEA 1M7BA 4E03A 1XF9A 4V0NA 4HUQA 3FPAA 4BFSA 4Q4JB 2AWNA 8OHMA 1KAOA 4OI4A 5BYKA 1E2EA 2F1JA 2VBCA 2JGNA 3BIFA 3C5CA 1BS1A 4O2LA 3SYNA 2XZPA 2J87A 3AGQA 3IHLA 4FMDB 4CEJB 1P9RA 2ORIA 3L2OB 2BHRA 5EUQB 4DLTA 4KITB 3CRRA 1BYUA 2D7DA 2Z5FA 3EG5A 4NYIQ 3GJ5A 2GAOA 2WJIA 1AGPA 4W5HA 1RYFA 4UNPA 2AXNA 2FWRA 4IVPA 3GLFB 3HU1A 5EUMA 3KDSE 1E99A 4EPTA 2VHQA 1XJ0A 1YRAA 4JLKA 4DCUA 2ZSDA 3CX8A 4TMXA 2F9MA 4XIGS 3DM9B 3HU3A 4G0NA 4V0ME 4FMCF 3EIHA 4LYHA 5GJBA 2EWVA 2FFHA 1S9DA 4JSTA 3ZZ0A 1NN5A 2PEZA 5EE1A 4QL3A 4Q18A 2WAYA 5L3VA 5IF9A 2FFBA 4TLEA 3EARA 4EFNA 3PJRA 1AQYA 4F4JA 5EE3A 1GNPA 4GP6A 5FOXA 1ZYUA 2XITA 3C7KA 2Q3HA 2L0XA 2FPLA 1QHNA 3AP3A 3RS5A 2YOFA 3RS0A 4PAQA 5CB6A 1E1RD 2IW3A 3QKRA 4C0JA 2F3TA 1CRQA 3G82C 2V1XA 4DC9A 2VHJA 3AVTA 3A58B 1BMFA 2C9YA 2WM9B 4NPHA 4DUGA 4Q4JA 421PA 3DOFA 3QJYA 5J4VA 3QPVA 4QBFA 1KO7A 5G40A 2VSFA 1U0HC 3CF0A 4LDJA 1GRQA 1JR3D 2OCBA 4L9WA 2YOGA 4K46A 5JJIA 2MSCB 4DLRA 5KSOA 4RZXA 1FNMA 3LBHA 3TW4A 4DDWA 4M1SA 4DCTA 4XVRA 4CT5A 5JJKA 4Q02A 4F91B 1JJ7A 1P75A 1VCOA 1Z2CA 2BBWA 3DMDA 1U2RA 3P20A 2RH5A 2ZVPX 4IVRA 3KTAB 5C46F 1KDRA 1Z2AA 3A8TA 5L3RA 1EX7A 2PX0A 3FVQA 1MO4A 4MYCA 1N6IA 2AXPA 4AYTA 2ZPTX 4HYYA 2H8KA 2HYDA 1D5CA 2W58A 2RGBA 4A36A 4ZKDA 2JATA 4M1TA 1P72A 1EK0A 2QMUA 4JMPA 3TBKA 2O0KA 2EFHB 2FSHA 3B7GA 1G8HA 4Q7MB 1CF4A 4TYQA 1NSFA 5A0FA 1AKYA 1NN0A 3R8FA 5DN6D 4G1UC 2D2FA 5KTYA 1IXSB 1ZM9A 4D25A 4YMTA 1F6BA 1BH2A 1OF1A 3GJXC 4BEBA 4TL7A 1T8TA 1XZPA 1XEWY 4P4UA 3PUZA 2R6CA 2GXAA 1I4TD 3OEED 5LDDC 3TQCA 3GLFE 1OXXK 3EPLA 1SVKA 2ZXUA 1ZD9A 2CVFA 3A1WA 3O47A 3AVYA 4RKFA 2WBLC 3ZVLA 2NGRA 4E09A 4Z1MD 3MLEA 4CW7A 2EFGA 4RD4A 2BV3A 5JZVA 1HEIA 1ZNZA 2IYLD 4OI0A 2WJGA 4GNKA 1JR3E 4ON9A 4XSGA 4A8JB 1UFQA 3IUYA 4NH0A 2BM0A 2HJVA 5DI3B 1A82A 1ZD1A 2FV8A 3LXRA 4IOLA 2NO0A 2QL6A 3GCGA 3RS2A 1KK2A 4WIAA 4WOPA 1ZM7A 4UJ5A 4BQSA 4ASUD 4GMDA 1B0UA 2CHVA 3D7MA 5G53C 3K9GA 3MWKA 5C4MA 3KTAA 1D6JA 1LS1A 4JKYA 5GVRA 2ZYVX 4NL4H 1G5TA 1DAHA 4HDOB 4P31A 5JFGA 2HXYA 1W4BA 2UKDA 2NMVA 1WF3A 1N2CE 3TNFA 1GFIA 1XWIA 2HJGA 3FGNA 2ZRGA 3EX7C 3QVUA 4EAQA 2WIAA 3W6OA 1VCNA 4C0KA 4C0SA 3W3AA 2CLSA 1E79D 1D2MA 2ZI5A 1T5IA 4KVAA 4I4LA 4Q19A 4DIEA 3I5YA 1W0KD 1W7AA 3B13B 1JJVA 5BQ5A 5JJLA 1R5NA 1UDXA 1F60A 1FTNA 2A5DA 4Q00A 2DWPA 1U99A 1RRGA 2C9CA 3QF4B 3U2QA 3EPHA 1KI7A 2ZUDA 1U8AA 4R9UC
chains in the Genus database with same CATH superfamily
5L95A 4KPGA 3WZMA 2PBLA 3WIUA 3GZ4A 3NHRA 2CCKA 2ZUUA 5CTAA 3PPXA 4ABTA 3O4GA 4MR9A 3F6RA 4QOIA 2IOFA 5FWYB 3LT0A 3HBAA 3DL4A 4ZK6A 3GOQA 2PX2A 3PKJA 3QELA 2XCRB 1Z0SA 3HE3A 3PUJA 1YKSA 3IKLA 4I1IA 2BLLA 2YYYA 3KPJA 2OECA 5SICE 5KOYA 3IX7A 2OZKA 1JP7A 1SBCA 2AOUA 1FPMA 2G9QA 4LJ4A 3TR5A 3LA8A 1DMRA 1ATIA 1U1CA 1F5SA 1QH0A 2QYSA 1VPVA 2ZIGA 1PZXA 4MQEB 2P4QA 4I5DA 4HC4A 4L75A 2OD9A 3F49S 4HEJA 1JU4A 5KSWB 1Y42X 4HAYA 2R8OA 2W6QA 1T0IA 3BD7A 3U3JA 1IEXA 1CHDA 4IDCA 4J0HA 3U3RA 3Q7TA 2XUGA 1LJUA 1M73E 1OZAA 5B2FA 4JVSB 4UAUA 1AF4A 4ESHA 3HA5A 2PX5A 5AVVA 1YE8A 1JG7A 1VLZA 4GBGA 2ZSUA 2PRJA 2BEWA 1PLLA 1E2FA 3DO5A 3ES9A 3FPJA 4QSHA 4ZOLA 1LSUA 5AJUA 2HXGA 3EVZA 1IWOA 4H7PA 4MMZB 3I42A 1TRKA 1Z0IA 4MA5A 3T1QA 3V1NA 1WZEA 2SBTA 4YAOA 5GIOE 3PT9A 1MAHA 4EF4A 2PXAA 3KT0A 5ALHA 1VDMA 4NZMA 4NG5A 1QE5A 3IE2A 1P4GA 5HQ3A 2W4QA 1JHPA 3OO0A 3OTQA 5BW6B 1KDTA 2CJXA 1M2KA 1HDOA 2OVFA 3QTBA 1ESMA 3SKXA 1IZ9A 2ISCA 1U8CB 4AN0A 5GTDA 3WAJA 2EYUA 3KLBA 1JLSA 3H16A 5FBHA 4JCOA 3FGPA 1XHEA 5LMUB 4AJ9A 4N5LA 3C7TA 3TLMA 1DXOA 1X92A 5JAPA 1M0SA 2O7SA 2Q2QA 2QTRA 4IVNA 5IU6A 1CNFA 2GEVA 5GMOA 2VP6A 2VDWA 3VPGA 1B6RA 1DV2A 3R44A 1IJEA 1LH0A 5CNMA 3K1AB 2NZ8A 3E18A 3F7OA 1XTSA 1Z8FA 2UVPB 1AX9A 4E5UA 4Z4FA 1E3SA 3ZWYA 1D3AA 4ZGGA 1M6VA 5ICCA 3DR3A 5BV0A 3Q3VA 3HSKA 3DOOA 1IM2A 3K2BA 1CERA 1Y3CE 4QOSA 1V5GA 4IQ0A 1QGZA 2UUCB 4H2DA 3G0DA 1KMMA 5AP9A 3VQTA 1AQ6A 2X40A 3UV6A 2WWGA 3LIIA 1CC1S 1XO1A 3TECE 5CD1A 2G80A 4MPPA 4ACAA 1KRHA 2G88A 2XE4A 5AWFC 4DCNA 1K4YA 4R41A 2WC1A 1CR1A 1HZZC 2BZ0A 3OQNA 3LWZA 5F78A 1A9OA 5J4YA 1LFAA 1XLTC 2W9XA 4UNIA 4MW9A 1URPA 2FN3A 3GHYA 4N0DA 1P1JA 2DY1A 3HH8A 2DPLA 4NENA 3TCXB 4J0JA 3CX3A 3DV2A 2GSDA 5HVNA 1OR8A 1V8OA 1VYTA 2B1RA 1WP4A 2C59A 5JMPA 1FSPA 5LQJA 2ZAIA 2OK7A 3GQBB 2E87A 2PGAA 1G4AE 1LPSA 3M7IA 4Z9YA 2PT6A 1N5JA 3H1EA 5HW0A 4HGPA 5FRDA 4YV1A 1BVHA 4B1FA 3N05A 4PCVA 4P7BA 3E1KA 1DJLA 3DZJA 2H29A 3DBIA 3BD6A 3KXIA 2WICA 4XJVA 5FULA 4KV7A 3T3HA 4Z7JA 2CSUA 3RKSA 3TLCA 3LHIA 2D6FA 1NQTA 2P35A 3A9WA 1DCTA 3DTTA 2DHRA 4M1KA 3KZKA 1PK9A 4B3HA 3OU7A 5IFKA 4RDIA 1R4NA 1ZJJA 3S2GA 2H31A 4Q01A 1G21A 3NC4A 1PCXA 2X4LA 2XUFA 2FB9A 3QUTA 4U0JA 1Z5OA 5CX1A 4XFDA 1Y1LA 2UUPA 3JQBC 4OOEA 2DG2A 5DTQA 5EKUA 2WMDA 1OAAA 3VISA 2HRDA 3TDMA 4H31A 3KDAA 4LOJA 2XKAA 4Q9LA 1T2VA 3KUUA 3KYIB 1J9GA 3SZUA 3SD7A 8LDHA 4Y2YA 3EA5A 2FGKA 3UJ7A 1N0HA 2V7GA 3HLTA 4HB0A 1T35A 1F3OA 4Y30A 3NRBA 4IDHA 4LX0A 1UK6A 4JJ4A 4B2LA 4BNGA 3AYZB 2OSBA 3OG9A 1MVNA 1C14A 3QU4A 4OB8A 5EE9A 4R71A 2DR2A 2OVBA 4NJOA 2WUVA 2AN9A 3UOGA 4ZIRB 5F98A 3AERA 2NSDA 3QKSA 4NMXB 1HGXA 4RKQA 1Q91A 2DT5A 2IHKA 2FI1A 2ZETA 4Q1CA 1LEHA 1V16B 3JQAB 3K8QA 4IV0A 4TQGA 2M9MA 4BNYA 1XZAA 1VFPA 3FGZA 3U4GA 3WK4A 1P0IA 4BKPA 3EVCA 4FKMA 5DGCA 4FHDA 1SKAA 1ZX1A 4WZBE 2ZE6A 2V59A 3A6HA 1FX0A 1QHYA 2NN3C 2BKXA 4I1SA 4TWBA 3A0UA 4UNNA 5G3YA 3LCRA 2PKEA 4P86A 4WDQA 2WQ7A 4MGIR 3CH5A 3RODA 1ORVA 4FZRA 5KEIA 1BWSA 2A94A 4KQ6A 5KYGA 1EA5A 1GA1A 1OLSB 1A9RA 1N6RA 5K99A 1F0YA 3NHFA 3AOGA 5SY6A 4N41A 2CYCA 1O96A 2A84A 2G04A 4PPQA 3DE1X 1X70A 3G7NA 3OM9A 2YJTD 4G63A 1JHVA 2OO5A 3I8XA 4EGAA 1RFGE 3W3ZB 1UK8A 4PX5A 4D9HA 1WCXA 3PX3A 5JVDF 3G0OA 3G2MA 1E2LA 4ZGBA 1MIOA 2Q99A 3FDJA 1EXNA 2YRFA 2XVXA 5TJ9A 2RSLA 2WD8A 3PPWA 4KLNA 2B8NA 2O8BA 2FPWA 3C7AA 1NNUA 2IV2X 5KU7A 4ZEMA 2J1LA 3OLXA 1U0RA 4OB7A 3FNQA 5BRNA 2XCLA 1F38A 4HAWA 4QJ3A 1EZ1A 4R2WA 1GVNB 1ZOPA 2YMLA 2QY9A 5KSYA 2JIDA 2BMDA 1GDHA 1J0EA 3MINB 1TTHA 4P38A 4EHNA 3TXAA 2F3PA 3KKPA 4EA7A 1TGVA 1JXOA 2DMRA 2MYUA 4QYIB 1TTPB 2Z1DA 5I7OA 1XVUA 3DUFA 1W85B 1B8PA 5FF9A 3DV9A 4B44A 2JZNA 5E8RA 5CA1B 4C05A 2VYFA 3MJDA 4KQJA 3ZHUA 4ZI7A 1H2WA 2AF4C 4BUZA 3I9MA 3FWPA 1F14A 1N3BA 3AETA 3CCCA 4GLBA 5JDIC 5ICFA 4EELA 2A9KA 1VL6A 2HMAA 1Q1BA 3O1JC 3AV0B 2G40A 4O2AB 2HNKA 4U7PB 2ID7A 1XMQB 5CM8B 1FXWA 1HDGO 3E5RA 1Z7EA 1LPOA 1P6QA 2LZ0A 1A72A 2NTNA 5JY1A 1TUGA 3FDXA 3HI4A 1NKVA 3B89A 2AD5A 3NPMA 5CDFE 1YQXA 1PUJA 1KETA 3MJHA 4LE0A 3U31A 3I2HA 2WKQA 1OXVA 1A4UA 3EBOA 3MD0A 3ND7A 2X23A 2BLNA 2ZUWA 5DM1A 3GCXA 4HX5A 2VHXA 3LQ2A 1BQ4A 1QFMA 4K2HA 1PG0A 6ABPA 3KKMA 4RTQA 3IB6A 2VI5A 3U1VA 4YJDA 4YAWA 1QNFA 3WL3A 3IEVA 1ZCJA 5AFSA 1M1YA 2ECPA 3K70D 2H63A 2OILA 4NBUA 3MYYA 1C0EA 1CXZA 2X1MA 4MR8B 2VYCA 2ZE5A 1R6VA 5CK5A 5E6SB 1WDTA 3RTAA 3IQWA 4P54A 3W06A 5I7FA 2BAGA 5IJ9B 1E96A 1ABEA 1SUEA 3G2OA 4HR7A 4Y6SA 4EYOA 1KQPA 1R6DA 2DBZA 3H2YA 3KLPX 4R81A 4G5OA 3EQ8A 3TAXA 4AECA 3O26A 4EO4A 2VS1A 1MNAA 3L8MA 2PWPA 3PXGA 2IQ5A 4INOA 5KYTA 1C1DA 4U0KA 3RASA 5L45A 3N6RA 1I5EA 4IGFA 4V3BA 2D59A 1UQUA 5DN9A 4DQKA 3LLSA 2BFPA 2OT3B 2BFEB 3CLVA 2R62A 3PL1A 4RXMA 4NMMA 2JGDB 2WILA 3NGLA 2P8JA 2HO5A 1VIVA 1WP9A 2XA1A 4ADSG 2EZ8A 2GVDC 3QY0A 2H1FA 2IPNA 4AZTA 2PVPA 4KN8A 2GQ0A 2IYPA 1EUZA 2PUVA 2EFDB 5AHXA 3W6PA 1N33B 1E3LA 1NQOA 2AMLA 2ONCA 2Z0MA 5LZ5A 1A4IA 3I3SR 5TC4A 3HJHA 2Q3JA 2WE7A 4WOKA 3TSAA 1N7GA 2JRCA 1RP1A 3DEYX 4XWGA 3V7UA 3T5MA 1NVKA 3F97A 3EAGA 1L4LA 1CQWA 1ONSA 4M1ZA 3ND6A 4LRSB 4R6WA 1I3NA 4KQEA 2H1SA 1P1CA 4UUQA 2WMYA 2DSNA 3CVOA 1HWYA 4ZVSA 4YUVA 4D5EA 3QITA 4ENUA 3CONA 2ILVA 4KLRA 3OE4A 2X58A 1RKBA 3OZCA 4KXNA 4TL9A 3SNHA 4H4EA 2GD2A 1T9ZA 4KSYA 4QRDA 3ECCA 4JGBA 3IELA 4Q66C 1J9ZA 2AC7A 4G0OA 4QJ5A 1X87A 4X3OA 1HQCA 2REQB 3KJQA 3T15A 1SCAA 2QQGA 4I8IA 4CTNA 4P9NA 4QASA 4EHBA 1OX6A 2A1UA 4PNPA 1MU0A 2QROA 3WQQA 4YQYA 2PPLA 4MKGA 4AMYA 4XQ0A 3EEQA 1O6CA 2FZVA 5SZJA 2VQ3A 3VR5D 3VU8A 3EGVA 4S12A 1MF7A 4ECEA 2ZREA 3AKDA 2OXRA 3PC4A 2V7XA 2JGFA 5E4YA 2YR0A 3F5MA 1Q21A 2H5LA 3G1TA 1YMVA 2ZSAA 2G06A 3T7AA 3O4RA 1EVIA 1DQRA 2C2KA 2JLAA 3DAGA 2JIBA 1NI4B 3QFRA 4WBSA 1GWNA 1AQLA 4N1AA 1XTPA 3FMPB 1BE6A 2JFOA 5KSZA 1LWOA 5BSEA 4R2LA 4WCFC 1K6XA 5A7HA 4O0MA 3VR3D 4RGVA 4ES6A 3IYLW 1DIAA 2ZULA 1Z83A 2ZJFA 4E51A 3G5AA 2PQ0A 1JHYA 4L5IA 3SZOA 3CN7A 3PDJA 3B1XA 4HDQB 2ZRNA 3ZS8A 2G0NA 3A37A 4XWWA 1QIKA 4QGFA 4YAFA 4MUFA 4TKLA 2ZTUA 1UBTS 4Y7CA 2ZTHA 1LQUA 16PKA 1JLLA 1XDBA 2DH6A 4KXFB 5E1MA 3KVVA 2W6JA 3GFPA 2OBLA 3BAZA 2RHRA 3GGGA 4IEFB 2BW0A 4UXIA 2PMEA 3W9BA 3KQWA 1INLA 4TVBA 4UOQA 5G02A 4ITUA 2BDTA 2HLDA 1O7JA 4MYTA 2P9QA 4BCDA 3KPVA 1DO2A 1SCJA 1UXOA 1PR0A 3N6XA 3PXBA 3SKVA 4DYHA 4AY6A 3NW9A 2WB4A 3KXLA 1Q5PA 1X15A 1Z6TA 2VBFA 3LT4A 4HQRA 1AKVA 2Z9BA 1EK5A 5KMGA 2PSHA 2O0MA 4M98A 6LDHA 2JI4A 2GEFA 4Z1OA 1ZVVA 1FP4A 1NLYA 1V8FA 4MP3A 3BJEA 1X2EA 3RSGA 3WB2A 5FWXB 1OC4A 2HJRA 3DDWA 3IPCA 2FPIB 1RWVA 2OYCA 3C15C 3KZ1E 2B4KA 1R6TA 2BE7A 1B00A 1JDZA 1D1PA 5K8JB 4DJJA 2OZLA 3AR4A 3PQDA 4OXXA 1UKAA 3G8AA 3E3MA 5EQJB 3K9QO 4PSAA 4Y3UA 3LP8A 2VYVA 2P9BA 2VDQB 3A2NA 2CXQA 1Y80A 3A6ZA 3T4XA 2PGIA 6ADHA 5DISB 2C04A 3NVDA 4XX1A 4Y2TA 4KWCA 2X9NA 2QXTA 2I78A 4JLPA 3PHGA 4J4TA 4XPZA 4JP2A 2CDCA 4OX9B 1J7KA 1U90A 1E1MA 5ADUS 5CBKA 1ODKA 2TMGA 4EJMA 3WMFA 4JAVC 4DY6A 1IBLB 3A1EA 1TYEB 3EVTA 3PI7A 3FD8A 1LX6A 1RD4A 1YT5A 1ODJA 1M6NA 3GLHE 3IV6A 4BNDB 5CB0A 3C8DA 4ZQCB 3GLIA 1P2GA 2OCLA 3Q98A 2HIAA 3IH5A 4XFJA 5EKDA 2ACEA 4IRXA 5BNTA 1NF8A 2JFQA 2G0AA 2GTPA 1ISPA 1RC8A 2ACWA 2OHIA 4LMRA 3TW8A 3WGIA 3O9MA 2OMEA 4HAIA 1GITA 2DVMA 3JRNA 2WJVA 3RVLA 2V6MA 3MOGA 1BXZA 3OPYB 4RE6A 4YDHB 2W00A 4AG6A 1SD5A 5I48A 5JALA 3WJ1A 3ZNPA 5LOVF 3LFHA 2EQBA 1A8SA 4IHJA 3BGOS 3QUQA 3CX4A 1ZSVA 4MUKA 4B6FA 4E2FA 5KC8A 4BO2A 1XCMA 2C00A 5MN5A 4PAMA 1H2FA 4R2IA 3HJFA 1J1UA 1A8IA 2I2AA 1ISRA 3QEBZ 1RPJA 1OB5A 3EFOA 4G2TA 5B4UA 2BI8A 1RKQA 1JB1A 1KSJA 1IOLA 2KPOA 3G9ZA 2AN1A 4F5DA 4CM3A 4P8RA 1UMCB 2XXAA 2JLSA 1F8GA 3H7IA 4JBIA 5T6MA 4REQB 1YQTA 4MLDA 3BXFA 3WGYA 3BMCA 3GLVA 1MH1A 3PVSA 3G2HA 2Y0BA 1SIWA 3OUTA 4ARBA 3WBKA 1TYCA 4F3YA 4OFZA 1JT9A 2C7GA 5LJIA 4JI1B 4TRRA 2A6PA 3HJCA 4L0DA 4YJGA 1KSHA 5C3UA 1P4HA 4KJZA 4FNMA 1Q3KA 3V80A 3U39A 2AV6A 1A9ZA 1LPPA 1ZSNA 1AMUA 2HF2A 4DM3A 3U7QA 2Y76A 3LOQA 4YWHA 3S1LA 2VWPA 4XEUA 3T5TA 4HDMB 1YXMA 3Q3GE 9MHTA 2ZJAA 2X5JO 5IKPA 2C7OA 4PHGA 3BJRA 3LHKA 2LV8A 4BOYA 3INTA 1AGXA 3JVUA 3ZDFA 1QTIA 2C4HA 4F45A 5GGYA 3OTIA 3GCZA 4JQZA 4P4TA 2H7XA 3QVGB 5KB3A 5LQKA 4Z4GA 3ZQJA 2W5UA 4MDFA 1ZK1A 2QQ0A 2O2JA 5JZOA 1IHUA 1WD7A 4QDXA 4ZOCA 4KW7A 5JC8A 1UAGA 3TJMA 2FWAA 3LGSA 3WFZA 5EIBD 3R0JA 3FYUB 1EVKA 4HQFA 3S2FA 4DG9A 4UPVA 4LJSA 4R3NA 5B1HA 4EF6A 3BMQB 1P44A 1R6UA 4UPDA 4ESEA 1W5TA 4JA2A 4DZTA 2PQ2A 3AG5A 4XD2A 3OICA 5EWMB 2XD9A 1E4YA 4K1LA 3OHSX 5K1ZA 3SP1A 3A2MA 2PLWA 4NCHA 2Q8QA 1E4VA 3WZLA 3EMDA 4DANA 4E4TA 1GDTA 1W1UA 2OYSA 2XDQA 3MWJA 2PUTA 4XVCA 1E4OA 5FI5A 4EG1A 4K9PA 4RCYA 2Z83A 2ZS9A 3KALA 1E1KA 4Y9SA 5AIAA 3BSWA 4NG4A 3MXOA 4QQRA 2Q0XA 4GUAA 4OK5A 5E9JA 2AJCA 5E6RA 5ARCA 3SXJA 3KR1A 4TWRA 4CTMA 1TJ5A 4B6QA 3EGIA 1W5SA 4ZK2A 5JEEA 1PHRA 2G6TA 1O94A 2KBFA 5FBVB 2CV1A 3OLQA 1N25A 4EYSA 2NT3A 4PO1A 5MGBA 3PUXA 1PBNA 4BJ5A 1XEAA 5DULA 1YBFA 5EIHA 4PHHA 1VIAA 1Y6RA 3IESA 3G2JA 3KOOA 3WBJA 1TMKA 5I3ZA 3W3AD 2B0CA 4YRDA 1QHFA 2V65A 3DR5A 2JFWA 3GL9A 4FLMA 1YKFA 4DA7A 4OHMA 1NRWA 5LQMA 1UBMS 3IOYA 3IQZA 3OT4A 5DSZA 2ZW9A 5LYJB 4BJ6A 2QOEA 4CT0A 4UMEA 1Q22A 2AMYA 4IVQA 3UGTA 4COOA 2AWOA 1ZSYA 1RYYA 2VNJA 1Q77A 5AO9A 4Z4IA 4B82A 1HDCA 2PFSA 2F8MA 1WIWA 3JYHA 3JASB 1IM5A 2R68A 3Q7QA 4XQEA 5AXAA 4I3FA 3ZV6A 4QDTA 3V32A 4Z9FA 4G97A 5EJIA 4BP1A 5LBUA 1W2HA 3DOHA 4UTOA 4RJ2A 3U44B 1O97C 2X3YA 3UJDA 3AUUA 4PZDA 4HFMA 3EZ9A 1J4AA 1DSSG 3DAOA 1DTWB 1WXHA 2QSJA 5LB2A 1R18A 3ND5A 4ODIA 2YDYA 3WLJA 3U4QB 1YK1A 2P3SA 4NICA 4LV5B 3ZZNA 2CNWA 1G7TA 5FV7A 3FHTA 1UKVY 4LY9A 1RMQA 2JL1A 2ZJZA 1E9CA 1NBIA 4YK7A 3SBDA 4NXNB 4JKOA 1G2IA 3FZYA 5H5JA 3RGGA 4ZI2A 4CM1A 5AW2A 1J5EB 1TJYA 4Z0NA 3KB2A 3ZIUA 1UODA 4PM4A 1V96A 4DNOA 1CJKC 1KHTA 3PTLA 1P2VA 3D6JA 3JQCA 1UIRA 3PQ4A 1NNI1 2ZU6A 1UBEA 1WBJB 3DYIA 4HNQA 4NEHB 3RSOA 4D9BA 1SG0A 4XA8A 5DNCA 1J99A 4WN9B 2EKBA 4DMHA 1B0AA 4YJFA 2NVUB 2WTUA 3ONNA 1QPZA 2EW1A 4IINA 3RVMA 2V6IA 3WKBA 4UZEA 4YTEA 5TX7A 2H18A 1MOPA 3PUYA 1K86A 2BHLA 2UZAA 4JMLA 5F2KA 1BHSA 4L8WB 3DDCA 3VV3A 1KJQA 2O2HA 1UBCA 4DLZA 2DTXA 1AXRA 4N5NA 1THTA 4XB1A 3TOXA 1MHPA 1XJQA 3IODA 2CBGA 2CKDA 3LP5A 3JQ6A 3M9XA 4FZVA 5A4DA 2FF5A 3L1UA 1HTTA 2COUA 2H2IA 1ZLYA 3QW4B 1U65A 2DM6A 4R4JA 2A5FA 3DL0A 3KLMX 1NXVA 4OHCA 2ZT5A 3CLHA 4LV8B 2EZ4A 2FFQA 4R7GA 3GEPA 1JDBB 4JZYA 1KZHA 1G4UR 1NBEA 4IV5A 3ILHA 3MSCA 4E07A 4LMBA 4C0XA 1KPHA 4IX9A 1Y3AA 1Z15A 2PUJA 2R7AA 3NUQA 1YTUA 1KY2A 3N7AA 4FGLA 4GI1A 1KJNA 3A6FA 3IUMA 2IV3A 1C3OB 5K8IA 2D5AA 3W8RA 3AEQA 3ZVKA 1SOWA 3NTRA 4Q4DA 5K51A 3PWTA 4HXFB 4B73A 2NVBA 5C1BA 4ZYLA 2IY8A 4X7RA 1Y1SA 2AZMA 1SXJB 3D3KA 1V39A 3JPWA 4NAVA 3C4VA 1WZCA 2LP4Y 4BY9E 1QZ3A 4LVNA 5CMLA 4EI2A 4I46A 3EMVA 1DIOB 1EFVA 4C7BA 2E6KA 3H9GA 3LGXA 5LZ8A 1J8QA 2GKSA 3JD4A 1R16A 1DIGA 1ZH8A 2X6QA 3E4CA 3KSUA 4HFNA 3ZWMA 4CJXA 4JR0A 1JX6A 4C4XA 2O8EA 1AKUA 1G20E 3P2IA 3LQ4A 1C3JA 1LXCA 5J40A 1U3GA 3R7WB 2RHDA 3REGA 4PHFA 3E9YA 5LA6A 5JNSA 2DGDA 5AHWA 3EG9B 3I01M 3K0FA 4LRUA 1CUDA 1E20A 2BFAA 3V8EA 1NFRA 3ESRA 4WSOA 2OBFA 5EMMA 1EUCA 3DMRA 3V8NA 2P2CA 3QMPA 2QN7A 4BV3A 1EX1A 4D9JA 4ER6A 4KQFA 3ABZA 2ZJ0A 4MNTA 4X9XA 4RK7A 1Z22A 3HXKA 2VRNA 3R4CA 3M5WA 2YNMD 1L5SA 1BOFA 2J0UB 3L7BA 2FLKA 2Q3EA 2BKVA 5SY9A 1Y1QA 1YS4A 5JNTA 2DUUA 2ZBGA 3CJQA 3JRWA 5JCOA 2O8BB 4RZUA 5CJJA 3EEYA 2ZJBA 3WICA 3AHGA 5ADVA 5JT1A 2FW9A 1RQRA 5F4ZA 1LI7A 2BEVA 3OCXA 1JIVA 1QKIA 3MCAA 1D0SA 1U6JA 1B15A 2C7VA 3AEKB 3CHYA 1GHTA 4NI5A 4TMKA 4BIIA 1I2AA 2UU9B 4TLDA 5CIYA 1DBIA 2PWBA 2P0AA 1QCDA 1C3VA 1JIUA 1XGKA 2AEMA 3EOBI 4H4CA 1WWKA 1AZSC 4TPKA 4FJ1A 4Z4HA 5CVCA 3KJZA 2Y27A 5EZQA 3IALA 3GJ8A 4BMCA 1QF6A 3P5SA 1E2NA 4LJ5A 1C50A 2YN0A 4INJA 4QUIA 4CUZA 1HETA 1GKIA 2XNDD 4ZP1A 1P2UA 1GFSA 2RKBA 1V6SA 5K3EA 1NW8A 3R5XA 3OE7D 4LQDA 4AWBA 3SIPA 3PGJA 3TIXB 4V3CA 1RMTA 1TDJA 1T6NA 1RXEA 2QTVA 4CYMA 4AL4A 1E1YA 1IXZA 3PGLA 2VXBA 2XQJA 4ME6A 1AZLA 4ZAXA 4QVGA 1X8LA 3DHVA 1RBZA 2GPAA 3H7AA 3IBCA 5I9NA 1PFGA 4CLRB 2G7MC 2WMOB 3NWJA 1BNCA 4FYKA 4MS4A 5FPTA 5TMDA 1OWPA 1T9CA 4DREA 4K2AA 2UYCA 2RAFA 3CT4A 1H2HA 4OGFA 3RW9A 1T43A 1L8LA 3ISTA 4OHUA 1G1MA 5KQRA 4WX2B 1F2TA 3R75A 4NBNA 2AKYA 1KKMA 1KEPA 3HC7A 3RHTA 6GPBA 4RPLA 4O29A 1S2NA 4JLSA 4K86A 4EKYA 1TJ3A 1BCRB 4KQWA 4PC1A 4QHYA 3GUUA 1QB8A 2V7QD 1KMHB 2C2ZA 4OF4A 4BKQA 2BP7A 4P3OA 3OZWA 4PQGA 1XROA 1L4HA 3WLNA 1YVRA 4ARUA 5IT4A 4LNHA 2OY0A 3OKPA 3M89A 1X80A 3FUVA 3DD5A 4FCWA 4Y1GA 1L5NA 1XD2A 1HXHA 3KJFA 2V0CA 2UVDA 3FF4A 1A9QA 1L4FA 3WI7A 4BN5A 3SVLA 2CD7A 5ALUA 5B6PA 4R83A 4TM8A 2HW8A 2CBXA 1SHTX 1VFNA 3AI1A 4H1HA 4QNMA 4XAQA 2BWJA 1MR3F 3BJIC 3MS2A 1X9HA 2Q7OE 1UWVA 1CY2A 5FQNA 2B4AA 1GG2A 2QRMA 4PZEA 4YEDA 4BRSA 5CFZA 4K8RB 4FHCA 4FZ5A 5EHZA 3KCQA 1QP8A 4EHFA 3IULA 3COWA 2GWHA 4GMKA 1D7AA 1CIPA 1MH9A 5JHHB 3ZX4A 1EUQA 3UAXA 1Q7CA 1UQTA 1PD0A 4MGZR 1YZQA 4M7WA 4R2MA 5ESXA 2XCQA 2PZAA 1MRSA 4E2XA 4B3RB 5AKLA 1RM5A 2JLQA 2VHEA 4N03A 3ZGNA 4AYXA 4YMGA 4M1MA 5B4VA 4LBVA 5B58T 1TKRA 1BZYA 3TYXA 4L72A 4DKJA 3A28A 3AVOA 1JWAB 4MIKA 4G2NA 1O95D 2X2OA 2Y0CA 3VNVA 1NF3A 3CNLA 2J45A 4PNHA 3KJGA 3TTUA 1T3ZA 1W48A 3KUXA 3N2GB 4NDZA 1GUAA 3MCTA 4FD2A 2VHVA 2WG2A 1NQXA 1PQ4A 4I9NA 4A7PA 3DT8A 5ALXA 4B9AA 1NDQA 1PZNA 5EJFA 5KQMA 2H48A 3F1KA 1DXYA 2Y9PB 5L4SA 4QYWA 1Y6FA 3TRIA 5LNK1 3DV0A 1SVSA 2PZGA 1HMYA 3PVZA 5EXDA 3EEIA 1GRNA 2J7PD 2JS7A 3PD1A 4GZ6A 4Y6LA 4D4GA 4TYNA 1YVDA 5FHRA 2ZUTA 3L4EA 4FIZA 1SFRA 4XRRA 5EY5B 4D0NA 1ZGCA 4DABA 3ZK8A 3EOZA 1U0LA 1V47A 5JYBA 2ZRQA 4DHWA 4MCHA 2CHGA 5BN3A 5BQXA 3JV7A 4CN8A 3ZUGA 2NU9B 3HCAA 3JXEA 3M5CA 1PR4A 3GFRA 2CL0X 3GMTA 1M6HA 4G5YA 1WU8A 1X7WB 3Q88A 1KQ3A 1R0BA 2VBGA 3UY4A 5JNWA 5JTUA 3ZJVA 2ORED 5EWLA 1CUSA 2FW0A 3VKFA 3FTDA 3ZU6A 2P7HA 4FWBA 1T10A 3D3QA 1A1VA 4PCLA 2X6RA 4MXDA 1SVOA 2OSVA 1KXZA 1S1MA 1XTUA 5KAPA 2CV0A 4OMCA 4DG5A 2R44A 3AFMA 3B6JA 1JVBA 5I7UA 1WXXA 3QA3E 5GZ6A 2QVBA 2Z2YA 4MYSA 4C2BA 5AM1A 3GVIA 4FFMA 1STOA 3KDPA 2C31A 1Z36A 2POQX 2PGXA 1NW3A 3F1LA 4OMUA 2K6GA 3AJRA 4PFSA 5EL0A 4H1WA 4LGYA 1Z5ZA 2PZLA 4MLCA 3ILSA 3B48A 4JVOA 5ES3A 1YE5A 2D7CA 4K0RA 1YCGA 2W43A 3L6RA 3ZZTA 3UIEA 3ORQA 4AWXA 4BVGA 3O0DA 3L01A 2FMXA 2QNBA 3AR3A 4OJKA 4U4AA 2G9NA 4DJDC 1FTSA 1H85A 2IDJA 1SB9A 2QU8A 2WY2D 3I1FA 2HAEA 2VL7A 4G0XA 4G8BA 5ECGC 1YJ8A 2OESA 2EIHA 3HDQA 4L0MA 5KIAA 4ZOBA 2H59A 3VJRA 1KJ9A 2GD6A 3NBXX 1L5ZA 1JXAA 3BVPA 1TW3A 5JMOA 1C8LA 1JMKC 1YZHA 3TUZC 4BBAA 3QEAZ 4BAGA 4GPBA 2BCJQ 4Q93A 1JTEA 2O2GA 3IUPA 3LK6A 3ECSA 2E48A 1W88A 2FQWA 4NE9A 1G3IA 4G07A 3KOUA 3L43A 4MEBA 5KTKA 2IUTA 3OZSA 1X1BA 1VKHA 4OQEA 2WQZA 5BXYA 4DBZA 4B5LA 1QKJA 4HRXA 4BMVA 1CZOA 1K9VF 1GPNA 2EF1A 5E7QA 1C8VB 3F98A 2WSMA 4BZWA 2PSSA 2N3ZA 5JI2E 4J2OA 1Q14A 5TY0A 3FB1A 4YCAA 2HU2A 4ZO7A 1ZCAA 2OO3A 3CISA 1P4RA 1TYDE 1WHTA 4YWJA 2C8LA 3LQYA 1C9NA 3D2AA 1JSZA 3HYNA 4O4JA 1QQTA 4J7XA 4R6XA 1Z74A 3DMGA 5I9MA 1XDZA 4CLDA 4OJQA 1ZUIA 4LTDA 4JK3A 4BMDA 3U7IA 1BTOA 4LECA 4AWAA 5IN4A 3KHTA 2CVHA 1JIJA 1VJ5A 2IZ5A 1FA9A 1KQOA 4M36A 3QJGA 1UJ6A 5ALQA 4C7XA 3BH7A 3QKIA 3QIAA 3VKGA 5LXTB 4EO7A 3U7FB 1KYYA 1PJ4A 2FYTA 1I7NA 3JSXA 3V4ZA 4AF7A 5BY2A 4GKKB 5D7BA 1BGVA 3FXAA 5I7VA 2NV6A 4I6JA 2WKSA 3R8CA 4Z3KA 2O2EA 3QX7A 1PI3A 3WGQA 4FSDA 1A71A 1OLUA 3TKAA 3FUTA 3SEQA 3JZIA 4KP7A 3P26A 1TQDA 2AF3C 3AIIA 1G8MA 5JWOA 4RTJA 4NR0A 2FEMA 3AW8A 1ABBA 2R1TB 3TF5A 3QOXA 2QN2A 3RVOA 1QM5A 4CIWA 4FBLA 1WDKA 4G0PA 4GECA 1GP2A 1WVGA 5SZIA 1R9JA 1WXFA 3ZE1B 5HKLA 2HSJA 3AHJA 3HXLA 4NYJR 1P4SA 1AUQA 5DYGA 2NYUA 3P0IA 1JPJA 5G4KA 5LD2B 4B3SB 1IN4A 5FO0A 3DFUA 4FFVA 5ADHA 2PIAA 3HJAA 1W4CA 1NW6A 3B53X 4GYWA 4F04A 4ENSA 1K92A 1R8SA 3GMIA 3SAJA 4AZVA 1ZMBA 2WYUA 2FCRA 4IXWA 1HUQA 4YT8A 1EGVB 1VKRA 3MB5A 5IJXA 5BSRA 1MTZA 1OCEA 3KLOA 2C3MA 5EE5B 5D3KA 2QD2A 1PR5A 3MJ4A 5DNEA 3EDMA 4MR7A 4Q4HA 1SK8A 1XRJA 2WTEA 1S3FA 1N9GA 1XD9A 5AVKA 2HBZA 3I6YA 4IFIA 1L5HA 4M9SA 2W0SA 3AI2A 3K9LA 2IYZA 4TKUA 4FW8A 4KAAA 3DLHA 2IH2A 2C0QA 3AOEC 5IKOA 5C8XA 3WBBA 1OVGA 2RBEA 4OHVA 3ZCRA 3TL2A 1U80A 4FTWA 5FPKA 2B21A 2E89A 3EC7A 3TUJC 5CFQA 1Z35A 4MRMB 1S9HA 2AOTA 1GTVA 1USVA 1XDSA 2WRZA 5DGXA 3CZMA 2M1XA 3PC2A 3K9FC 2J9GA 2IBSA 1T8UA 1N0VC 2TS1A 5L3QA 2PKQP 4MPRA 4UCFA 2R85A 1TCCA 1QVAA 5DW3A 1R4AA 5FYDA 521PA 4ZJYA 5JXWA 1LVUA 5C1OA 2O0LA 1KI2A 1V8PA 3ZXSA 4EJSA 3THYA 2O19A 4XDYA 1PFVA 4BKRA 5A4FS 4OUKX 4TTSA 3PC6A 5F9MA 5DM70 2QE6A 3Q2KA 4E46A 2JK0A 4WBNB 2ZCVA 1B8OA 4D9GA 1MABB 3SQNA 3GVHA 5E7IA 4ND3A 1J8FA 1NQWA 5EE0A 3C1AA 2OM2A 4BP8A 4CDGA 1UOEA 1VECA 3CLRC 4WNAB 1YR9A 5DYWA 5B5SA 4WKGA 1M7GA 5K3AA 5FEUA 1XMXA 1KI4A 1CUYA 4B46A 1J8MF 1I2BA 4HS9A 1A5AB 1GZHB 1VBMA 1H8ED 2CZQA 4UHEA 3MHTA 1Z4JA 3HWSA 4XOUA 3KFVA 5CJ2A 5AHRA 2EKPA 4JT2A 3Q6NA 3BB4A 3H9QA 4ZCRA 2FMUA 3BXZA 5J2TF 2W8ZA 721PA 3RC7A 3ADPA 3G0IA 1XPUA 4MH0R 1Q2XA 3DMYA 3AESB 1C1XB 2JD0A 3ZYCA 1RC0A 1ZXXA 5AJWA 1HYQA 2A9PA 5IMSA 4ERNA 5IMBA 2G1UA 1B1AA 2Z6QA 1P3Y1 3KXKA 1RYNA 2B61A 3FUWA 5KTRA 5F64A 3FCAA 4OKNA 4OLHA 3SN6A 4RGBA 2QGFA 5CLGA 3IL2A 4AICA 3DPUA 1PT5A 2XXJA 1EAMA 1UEXC 1ZXLA 1J0BA 2ZVQX 3OZRA 1HEUA 1VLVA 2ZBDA 2D74A 3LK7A 4GPD1 1JMVA 3S29A 3V1MA 1G6KA 2Y4OA 4NJMB 5FJJA 3JD1A 3ZW9A 1S3IA 3SC2A 1GQRA 3NU1A 2HJWA 2H00A 3HKDB 4Y8VA 3KZOA 4U2GA 3AUTA 2VDPB 2WUWE 1E1QA 1X9GA 3CB4A 3ELBA 4MQMA 4Y6PA 5DM60 3ICPA 4UMVA 4ZV9A 1PLJA 4TLBA 5FKJA 5JYCA 2VOJA 2Y1DA 3DHWC 1HLGA 2DFVA 4GSLA 4ML3A 3MJSA 4YDRA 2HO4A 4ZQEA 3P9QA 1NYQA 4BFLA 4R8MA 5HYVA 2BFBA 2RJOA 2EYQA 1T91A 3CB2A 2XT6A 3CZQA 1J8VA 3DLTA 4NONA 3M83A 4M87A 1CU1A 1QE3A 5DCWA 1U4SA 4PPFA 4ZAZA 2DFNA 1QYWA 2V6FA 3GGCA 4ZMRA 1MCZA 3A36A 1GNSA 1FS5A 2VPPA 3H3FA 4UU8A 2XCTB 1NNEA 2OBXA 2VJDA 1DC8A 1MC8A 1KAMA 3K73O 4ACBA 3LKVA 3WYFA 1R6XA 1AKRA 5HZGA 2WF6A 1H93A 3W9YA 4PZZA 2VP2A 4PO8A 2HRZA 4UXHA 1O6GA 2BGJA 3I4CA 4UZSA 1PHPA 3F6PA 3O8DA 2QX6A 2VCEA 4UCXA 2Q49A 2R6ZA 4LYJA 1D6MA 4RAQA 2PL1A 4TQ9A 2P5YA 4TVSA 5IABA 5GOZA 4XUGB 1J42A 1R0KA 2PAAA 4KPFC 3WRYA 1IOWA 1X2BA 3I83A 3PYMA 5EHNA 3ZWVA 5CW1A 1C9JA 1VC2A 1OFTA 1S1CA 1AT1A 1T15A 1G19A 1GADO 3N1UA 2QSZA 1SWVA 1XJ5A 1J0CA 2WHQA 2NXEA 5T5QA 2XKKA