2IC5A

Crystal structure of human rac3 grown in the presence of gpp(nh)p.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
177
Chain Sequence
b'SMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related C3 botulinum toxin substrate 3
publication title Crystal structure of human RAC3 grown in the presence of Gpp(NH)p.
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 177
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ic5A00
2C03A 4WZBE 4LGMA 1RYFA 2O8DB 1OE0A 1KI8A 2IYZA 4QBIA 1GUAA 2V1UA 2RCNA 3UIEA 2HYIC 2PX0A 1CJTC 4V0OA 1MH1A 3W9YA 3IGFA 3ONWA 3ETLA 1ZM9A 1KNQA 4I81A 4LJYA 1UBCA 1GKUB 4JJKA 4AKEA 2AD5A 2WAXA 4LHYA 4DC9A 1JPJA 1GILA 2A5GA 3AKYA 1ZMXA 3IIMA 4O2RA 4D82A 1ZIOA 4U02A 2J59A 4A2QA 4ASUD 3QKRB 2EYQA 2GK7A 4QXAA 1E96A 1Z8FA 5J5CA 1TAGA 1CRPA 1SQ5A 2VP9A 3HU3A 3OIUA 3SI7A 1AIPA 3KQUA 1CIPA 2QP9X 4HYYA 1QDEA 5FOTA 1T0JB 3QKRA 2FF7A 3O47A 4Q1EA 1XMIA 4RFSB 4DT1A 3U3RA 2P6RA 2RGXA 1KO5A 4P31A 4QRHA 3WBKA 4PSAA 2RGAA 5FL7D 4B3FX 4OI4A 2CEAA 2YNMA 4MRSA 2VSFA 1U0JA 3RLFA 2UZ3A 5JEEA 2AWNA 3OZXA 1JR6A 2V7QA 3PUZA 4G5GA 3F5FA 4XD7D 4V0NA 3PJRA 2D7DA 1P2TA 5L8VA 4FMCF 3PUXA 2YC4C 1IY1A 1CBUA 3C8UA 3QXJA 5TVKA 2YINC 4C0KA 2AFHE 1MKYA 2FH5B 4DSUA 2OLJA 4DUGA 5B64A 1Z6GA 1GITA 1Q21A 1XTKA 3QENA 1VCIA 3BBPA 4NYJQ 4JL5A 1ESMA 2HUPA 2IEZA 4E07A 3H2YA 2NTYC 1VCOA 1E9AA 1YRAA 3DOFA 2V9PA 4BASA 3EZ6A 1OJLA 2NO0A 2P3SA 3CX8A 4OI2A 4IDHA 3JZMA 4TL9A 1B23P 4EIWA 1VDZA 1R0YA 1TPZA 1ZVQA 2GJ9A 5SZKB 3WYGA 4XOIA 3KQLA 1I4DD 3IBGA 1U2RA 2OAP1 2BEKA 4JVNA 2D74A 2BMDA 5J4LA 4HLDA 1FQKA 1QZXA 4PHFA 4I1OA 2PT7A 2WJVA 4ESVA 2G1JA 4C0BA 3QF7A 3A36A 4IDPA 1W2GA 2GETA 4IOLA 1M6NA 1AQUA 5H68A 3EWSA 4PAOA 1XF9A 1WBDA 1UKVY 4A0GA 5JRJA 3C4JA 4TQUS 3AM1A 2JAQA 2QGNA 2ZPTX 4XTCS 2QTHA 1GFIA 4PO9A 2PZEA 1PLLA 4DCVA 2IXFA 1KAGA 4NYIQ 1JEDA 4D4MA 1D2MA 5F9FA 4MDEA 1M7BA 2GTPA 2ZI6A 2PJRA 4I1UA 3LW8A 1COWD 1G20E 2JGNA 3DPUA 3VFDA 3OEHD 2RGEA 2ZAOA 4Q9JA 4B2PA 3KKQA 2YJTD 3WMEA 4Q66C 2A5JA 2BVNA 5EXPA 3G82C 3FWYA 2FSFA 2C99A 4RY2A 3ADCA 2WOOA 3BORA 3IBYA 1IN6A 1WRBA 2V7QD 3QVUA 4PZZA 3RS0A 2QP4A 5KDDA 4AY2A 2XZPA 4PC7A 3FMOB 1VYVA 1N5IA 3KUDA 2ZTSA 2GA8A 2WMOB 4BWYA 4DEYA 1KI1A 5AJYA 5E7MA 3B1WA 3GEHA 3RS5A 5HZHA 1TEVA 2AK2A 3PR1A 3I5XA 2IYWA 3GFTA 4NZYA 4P32A 1V43A 4ITRC 3ND9A 4LHVA 1YR6A 1Z6AA 3TLXA 1OB5A 2QM8A 4EFNA 3U6BA 1M2OB 4X8OA 3UMFA 2WSMA 1P9WA 2KI5A 1UADA 2IEYA 3OFNA 5KNCA 1DTSA 3EIEA 1XFAA 1ZUNB 2ZRPA 5TARA 4K81B 3LFUA 1I4TD 4S35A 2CVFA 2P6NA 4GZMA 4KSCA 1M74A 1QG4A 1AS0A 3WRXC 4LV8B 2BM1A 4NYMR 4QOSA 2QA5A 4D4JA 2J0UA 4RVCA 3GD7A 2WWXA 1OYWA 2B21A 4G01B 5F9HA 1KDPA 2CBZA 4PR0A 1G9XA 3CF0A 3TMKA 3KB1A 4KXFB 5FUVA 1ZW6A 2OM2A 4JL8A 4TL7A 3SZRA 2ONJA 3U3KA 1KZ7B 1DO2A 1XCGB 3EWAA 2FSGA 4OK3A 4PQYA 5E7IA 3KJHA 4KODA 1ZC4A 1VG0B 2CNWA 3AV0B 2RMKA 1NLZA 3KQHA 4FMDB 4IDOA 3CO5A 2ZJ5A 3CZPA 4BFVA 4MDFA 3LXXA 2DR3A 3KXLA 3OF5A 1E1QA 1HH4A 3IQWA 4NH0A 3L2OB 1NVXQ 3VU9B 3MSXA 4TWZA 5J4HA 4QFMA 3PEUA 5C46F 2CMKA 2GWHA 3THYB 5SZJA 2JIZD 2WV9A 1ZINA 1NN1A 3L0IB 4BFZA 1YZLA 2GEDA 2H5EA 3RRZA 3VMFA 1E2QA 3AVXA 3VU9A 1N25A 4AKGA 5EP3A 4KI0A 2QBYB 1U98A 4PSKA 4GPTA 2W2XA 1S9HA 5CJ2A 2BCGY 3ZGXA 3THYA 3ADBA 2XNDA 2ZREA 2DFNA 1R4AA 4MUAA 2R62A 3QF4B 1E32A 4JLPA 1QHXA 2IYLD 3CPHA 3I32A 3REFA 1E2MA 3DM9B 2WMNB 3BS4A 2RGNA 4YMVA 2F1JA 3EARA 1NVVQ 3X2SA 4NP6A 2EFEB 3QF4A 1W4AA 1GNQA 2QN6A 2ZI7A 5E95A 3VTKA 2OLKA 4EPXA 4YLGA 4IJMA 5CYPA 3THOA 1IY2A 1DAMA 4TMXA 3K53A 3U3JA 1J90A 5DI3B 5EXTA 2ATXA 1G5RA 2C78A 4QG7A 3WP0A 3OFND 5CB6A 1Z63A 5F98A 2EFHB 4QHSA 5B57C 3UWKA 3BXZA 1FMJA 1Z07A 1FP6A 4HB2A 5DLQC 1WMSA 3MAAC 1MABA 4R9UC 3BFXA 2JLXA 1LS1A 1DOAA 2BMEA 4FMBB 3X1WA 5CK4A 5DI3A 2AKYA 3W3AA 4D0LB 4YDHB 3TBKA 1GWNA 1YZGA 2CXXA 1LNZA 1OIWA 1ZCBA 4WXRA 4R7ZA 4B75A 5G3ZA 4ZV4A 3BGWA 2NMVA 1ZM2A 4LV5B 2IBMA 3Q85A 4EPWA 1MT0A 2A78A 2QAGB 4B3BA 4IOKA 1XTSA 2BMFA 4AG5A 1UPTA 3UXMA 1N0UA 4TMZA 1NBMD 2A5FA 5AJWA 1E1QD 1NJGA 3R9WA 3KJEA 2HJGA 1KSJA 2VP0A 3T1OA 1HQCA 1U8AA 2QAGA 3GLFE 3PIRA 3FB4A 1JXMA 5GJBA 3R9IA 1XTQA 4RKFA 3CBQA 4LUCA 1F48A 1U81A 3A6PC 3CUEF 1Q57A 3A1UA 4U00A 3SN6A 5CK5A 3AEZA 4PC2A 4MKGA 5BQ5A 3MMPA 3TNFA 3B1XA 4CEJA 3E70C 4CIDA 4LI0A 4D26A 2XNDD 1FTNA 1E94E 4DDTA 5BWMA 4YMUA 2B92A 2AR7A 2WOJA 3AGQA 4TTRA 3U7FB 4L8GA 2IYYA 4GL2A 2N46A 421PA 1M34E 1XPOA 1SVSA 3I3SR 2PCJA 1N5JA 2FEMA 4A6XA 5JBQA 4PC3A 2YZ2A 3NWJA 1GL7A 3LX5A 1MV5A 3LD9A 4QHTA 2GJ8A 2EFCB 4JBYA 4LJ9A 2JLYA 1AJEA 2PZFA 3SOPA 5DIFA 1QVAA 1F2UB 1G19A 1NY6A 1E0AA 1AA9A 3OEED 3W34A 1E2EA 4PTLA 1JECA 1ZNXA 4AURA 2GESA 3P4YA 4BRWA 3IO3A 5FTJA 3SBEA 4ZIRB 4KLNA 5CDFE 1E2IA 4XH9B 1YU9A 3Q3JB 4CEIB 1E6CA 1H65A 2H7VA 3NEJA 1EWQA 3N70A 2A2ZA 2DWPA 2E87A 5CM8B 5EZ5A 3V4FA 1KAOA 2QP3A 2Q3HA 1E9RA 4JSYA 1UEIA 4URXR 4ZIRA 3GFOA 2GF9A 4DEXA 1OV4A 1N6RA 1TQ6A 3AH8A 4KFSA 2GKSA 1FQJA 2FSHA 2FEOA 4KHZA 1JAHA 4CEIA 1RW4A 1D2NA 5C4MA 4M1KA 4B76A 3CR8A 3GLGB 1T4GA 2QM7A 3K09A 3ZS8A 1UKYA 3EG5A 4DZZA 2H1LA 2H8KA 4KAXA 3U44A 3PVSA 3TQCA 3CNOA 2W6JD 2WWIA 3CONA 3D31A 1G8FA 2ORIA 1FMLA 2QU8A 3U3OA 3AP3A 4ZCIA 1QVRA 1UDXA 2J0VA 1J7KA 1N6IA 4X8LA 4LX0A 2H16A 1HV8A 5F3WB 4Q4AB 2OO7A 5HR5A 1IXSB 1LW7A 5IRCD 3GJ7A 4DRZA 1KI6B 2BIFA 2DWQA 1IXRC 3IILA 1CXZA 4PHGA 1IM2A 3Q72A 3PUWA 3UG6A 3LWNA 4MH0R 2ZYWX 4HSEA 4MKFA 1XMVA 1Z2CA 2K5UA 2O8CA 4Q4AA 4ZKDA 2IYSA 1R8QA 2HF9A 4EJSB 2IS2A 1KI6A 3T15A 1P9RA 1S9DA 2BHRA 1MO5A 2QSZA 2YVUA 3N2EA 4MGKR 1RRPA 2QPTA 2I3BA 2IW3A 2ZRJA 4BZPA 3HYRA 2HT1A 5HE9A 5E4FA 1KDTA 2AL7A 3ND8A 1Y63A 2F9MA 3TW4A 5CB8A 3QPWA 2V4ZA 4JYCA 4P0TA 4EJSA 4TLDA 2WAYA 1XWIA 3UANA 5FOWA 4QJ5A 1XXHB 1XMSA 1IOZA 1JB1A 1NKSA 3MCAA 5L3VA 2OXCA 4HZUA 4HAXA 3K9NA 2ZXUA 2D3WA 2J1LA 2PCLA 4WIAA 2GBLC 3TUJC 2LWIA 1OSNA 1XXHA 3VR1A 1W47A 4V03A 4PO8A 4JBXA 2ZSEA 2RGNC 1NN5A 2YOFA 3EPHA 2OZEA 2VBCA 4DWJA 1P61B 2DFTA 1EWRA 1WCV1 4F92B 1NF3A 1UKZA 4ZCMA 1R0XA 3FOZA 3FFBA 3K0EA 2ZS9A 2VHQA 4OJKA 3PXGA 5L3SB 3NH9A 2C9YA 3A58B 2CVHA 1T3HA 3B1ZA 3NC0C 1EFRA 1KSGA 4WW0A 1CLUA 1KO1A 1RFLA 4EQ6B 2O0JA 3FMPB 4A0FA 3D6TB 2ASEA 2P5TB 4H1UA 2QTFA 1IJEA 2XNSA 4BUJA 5L3SA 3U61B 1OW3B 4Q02A 4UQOA 2XTZA 4JVSB 3NVAA 4Q00A 4Q1AA 1NG9A 2ZANA 3Q7PA 4X8HA 4MYTA 4D4LA 1NSTA 5BYKA 3M0EA 5HCIA 3GLHB 4QNMA 1NG1A 2GXAA 2VL7A 4TYPA 5G40A 2F3TA 4OQNA 2YWHA 5FBVB 4WZ6A 1XMJA 2JLUA 1U90A 2ZRAA 4P4TA 4FXPA 3HPRA 4RD3A 3GJ8A 5DI9A 2J0SA 4TZ0A 2BBOA 2F43B 1G21E 2P0EA 2CCKA 4PX9A 4JS0A 3SEAA 1TEXA 2Q21A 2TMKA 4KV9A 2OXRA 4EPTA 4L9WA 2EU8A 2HXSA 4QNRA 1YZTA 3K0SA 2ZI5A 2FGJA 2G88A 3QPUA 1CULC 2VIIA 2F43A 3DZ8A 4JLNA 3WHKA 1PLKA 2UVQA 4BFYA 4ABYA 1F2TB 1L4YA 3PEVA 5B30A 3RRMA 1SVWA 4URZR 1XD9A 3LBIA 2QAJA 3SQXA 1Q3HA 2J41A 5EE3A 1EFTA 2GCOB 5JSZB 4AYWA 3B7GA 3WNCA 1KO7A 1F2TA 2IA5A 1G4UR 2PL3A 2QMHA 2ZE6A 3BD9A 4C0LA 5AJZA 2VSXA 4C4PA 4CYMA 4LYHA 2QT1A 3QBTA 5KU1A 4GFDA 4Q4HB 2ZS8A 4Q9LA 3A4NA 2HEIA 1W4RA 1G7TA 4RD1A 5JZVA 4G5OA 4AYXA 3LBNA 5JCZA 3IDQA 2R6CA 4HAZA 1G3RA 2OFWA 4PANA 2IYTA 5CDFA 4TMKA 3SJAA 4ZDIA 5CITA 3EPLA 4LV6A 1EFRD 2IYUA 3L8YA 1KYIA 3DKPA 1E9FA 3EAQA 4LHXA 2GJSA 4BE7B 4DLRA 3WYAA 3EX7C 4KFTA 4NCIA 3PENA 1KI3A 1MO4A 3C16C 1FZQA 3B1YA 5LB4A 1X8LA 3TSWA 4A9AA 1DADA 1G6HA 1Z08A 1VHTA 3IUYA 5KHOC 2WWHA 1LY1A 2ZRFA 1PV4A 1XD2B 3I8SA 1ZC3A 4N0DA 1R5NA 1GG2A 3IIKA 1E2DA 2QEQA 1KDRA 5BW8A 1D6JA 1Q1EA 1IY0A 1O3YA 1SVLA 3DZDA 1XD2A 521PA 1OIXA 4WAUA 4IVRA 1ZNWA 2HF8A 5CLLA 1P4SA 1XB2A 2KSQA 3FVQA 5KSPA 4F7WA 2VF8A 3VX4A 4EFLA 5H8WA 2F9LA 2FOLA 3AVQA 3KJGA 5CIWA 3CX7A 1ZM4A 5D3MB 2HCBA 4KYIB 1NNEA 3BH6A 3EASA 3GP8A 3K09C 3ZD6A 2FGKA 2VP2A 4V0KA 4A82A 2J7PD 1EX6A 1S3SA 2EYUA 2QZ4A 3ZVMA 4MKIA 1BOFA 2UKDA 1IHUA 2HDNB 5D3MA 3RYTC 3AKCA 5EXXA 1NP6A 2IUTA 4GP7A 4KJZA 4TMWA 2OSBA 2WM9B 1CR4A 1Z83A 3L8ZA 4IXMA 3PG5A 1GSIA 1KK2A 1Q44A 2WBLC 1YRBA 1R7RA 3E1SA 4ON9A 4QM7A 2F7SA 2F6RA 1XBTA 1NI3A 2N42A 2N1BA 2X8AA 4ZDKA 2ZUDA 3AUYA 5DGXA 1AZSC 4KO8A 4NMMA 3B78A 4PXAA 721PA 5LD2B 1L8QA 4KFRA 3U60B 4ZCLA 4G0NA 1D2EA 1P2VA 4JMPA 4B44A 1N6OA 3QKSB 2KE5A 3RANA 3SNHA 5GJCA 4BECA 5D3QA 5EUQB 2Z4SA 3HYTA 5FPSA 1AGPA 5LPNA 4F91B 4JLMA 4TMVA 1LB1B 3G5UA 4BPBA 1SXJB 2I4IA 3T34A 5FR2A 2EW1A 3NHAA 3NBXX 3QKSA 3K0CA 1FL9A 4MRPA 1NSFA 2ZJAA 2VHCA 4A36A 3BFVA 5FPTA 1ESNA 1TTTA 2FNAA 4TL8A 1R0WA 1SXJA 5JS7A 3K0FB 1DEKA 2O8DA 1NIJA 3HR8A 5JWOA 4MRNA 4BQSA 4NYMQ 2D7CA 3AVOA 3KKOA 3R7WB 3T35A 1NBME 3TJZA 2GCPA 2G77B 4PHTA 5ELXA 1DARA 3PEYA 3LA6A 2MMGA 2D62A 4GNKA 1YZKA 4JLVA 4LZZA 4LYAA 2CE2X 3R7WA 2AXPA 3LQQA 2FFQA 4CW7A 3OAAD 2NPFA 1W7AA 1ODFA 2FE4A 2JJ2A 1GIAA 2D06A 1COWA 2ZRLA 1KJYA 4TSFA 1XDBA 2B7CA 2PBRA 1SKYB 3OEHA 8OHMA 5GJVC 3PFIA 3FHOA 2QQEA 4RZUA 1KK0A 3SBDA 1XD8A 1XX6A 4RFSA 2P5SA 5C2JB 1WE2A 1CF4A 1S2MA 2P67A 4ZI2A 1G7RA 1P62B 2RGBA 2V1XA 3RHFA 5G53C 2UZIR 2VTKA 4LJ8A 3DOEA 1X1RA 4PPNA 5BYJA 4NHOA 3B82A 4IDQA 1IN8A 4M1OA 2O0HA 2OHFA 4FMCB 2BKUA 2EFGA 2OE2A 2ORWA 1PLJA 2ERXA 3CF6R 1RYHA 4CT4B 2OCAA 1E4VA 4OQXA 3VKGA 3A1SA 1EFUA 4GP6A 4A8JC 4GT1A 3CNNA 2VYFA 1Q12A 4O2LA 3ZVLA 3KTAB 1XJCA 1N0WA 1BKDR 2FZ4A 4W5HA 3BC1A 2XITA 2ZM5A 3VR6A 2BV3A 1JPNA 2ZUCA 1G17A 3GMTA 1G8GA 1W4BA 1M7HA 3K9LA 4I1VA 4MITA 4BLSA 1CP2A 1P7CA 1GAJA 5KO2A 4HAYA 1NLYA 2IWHA 3TUIC 1SXJD 3A4LA 3A8TA 4TTPA 1PUJA 3W5JA 2HCJB 2QGZA 2OCPA 1KTVA 1ZD8A 3FKQA 4C9BA 2ZRNA 4YMWA 2Q3FA 3K0AB 4QGGA 1JEEA 1D5CA 2HJVA 2VHTA 3K70C 1N6LA 2NO6A 2Z5FA 1XTIA 2O5VA 1QHHB 1KSHA 5J40A 2YOGA 4AG6A 5K8LA 4Q21A 4NU0A 4G3XA 1D8TA 1J2JA 2QMOA 4LBZA 4B47A 1W5TA 2QPOA 1KMHB 2C5LA 4B74A 1CEEA 2JJ2D 2VHUA 1QHHA 1OFUX 2ZI9A 4LJ6A 4TSFD 2XOKA 1ZM3A 2ZJ8A 3LW7A 1TQDA 2AWOA 2ZU0C 2JIZA 4LBWA 1YHNA 2OILA 3UWOA 4MQBA 4YDSA 4AK9A 2YV5A 3T5GA 4W7SA 3UG7A 3AVPA 4DIDA 1KMHA 2Q9BA 4JLJA 2C95A 2FPKA 3EZ7A 4DB4A 5J4VA 2PEZA 3THXB 4B3GA 4PPQA 2H18A 3SYLA 2GILA 1FTSA 5FPYA 5AJXA 2R6AA 4ZDJA 2GVZC 3AB3A 1KNXA 2VHJA 2XTNA 4F4CA 1PUIA 1E2KA 5EQTA 1YR7A 4NCJA 1J8YF 3RSLA 4JKIA 1E3MA 1CJVC 4ZDWA 2W2VA 1CR1A 1QHYA 2C2HA 5JEDA 2IS4A 1P72A 4DCTA 5FTLA 3AVVA 1BH2A 2JLSA 4B48A 2NO7A 3HP1A 4QBGB 1G5TA 3RWMB 1OIVA 1S4QA 2F3RA 1TU4A 1DELA 2Z6VA 4FINA 4TLEA 4UJ5A 1ZD1A 5FTNA 4A4DA 4IFEA 3DHWC 2G0NA 1HE1C 4URUR 1RRCA 2O8EB 3P1JA 5EP2A 4UXJA 3DMDA 3C41J 4FCVA 1IN5A 5IT5A 4C7OB 4KBFA 1JQJC 3AF4A 2ZR9A 3T12A 1Q1QA 1BS1A 1H8EA 1K8RA 2BJWA 4EUNA 5FUXA 2PX3A 3QJYA 2G3YA 5DHFA 1KDOA 5E7JA 1WQ1R 3V9PA 2O8EA 2ZETA 4FWTA 3ZZ0A 4L16A 4C7OA 1L7VC 1SVOA 3TUZC 2GAOA 2WICA 5HZKA 1C4OA 1DAFA 3BB4A 4CVNA 2X2EA 1E9SA 2RB4A 2OFXA 1K5GA 2E1RA 4UXIA 4WA7A 4GSYA 1XPUA 1N6NA 3NDBB 1NBMA 2ZI4A 4IHQA 1AGRA 1CKEA 2J0QA 3LX8A 4PPGA 2NOAA 3FFAA 1NRJB 3K0CC 5AJVB 3AVUA 3GLGE 1F3OA 4TYQA 4W5JA 1HUQA 1Z29A 4KLZA 4XWKA 2IS6A 4OK5A 3PUVA 5DNYB 2XOKD 4D81A 2GCNA 3HJNA 3SQWA 1NKTA 5KDOA 2ZROA 4UNSA 1OFHA 5EJEA 1OLOA 1VPLA 3BE4A 2G9NA 2ORVA 4F4JA 4ERNA 4X8MA 1G5PA 1R5BA 2CHGA 5EE5B 4CDGA 3NBZC 4MRRA 2ODEA 1KOFA 5J47A 4B32A 2C9OA 5JFGA 2FG5A 1GTVA 3EZ2A 5AUOB 4J0QA 2FWRA 4UNRA 5TY0A 1X8KA 2CJWB 1V5WA 3ZS9A 2QBYA 3ICEA 4DLUA 1T5LA 1US8B 4K8OA 2KB0A 2Y8EA 4B71A 4TQ9A 2XAUA 3TW8B 3LDAA 1D9ZA 1DS6A 1UJ2A 5FOVA 5TV2A 1L2TA 4B43A 4B6FA 4R98A 3KQNA 3ZZUA 1US8A 5JWRA 3VR3A 1R5OA 3V4RA 4Z51A 1EK0A 1AQYA 1XXHE 1JJVA 1GNRA 2JATA 2BM0A 1F5NA 3AF2A 2XB4A 4Y0VA 5KYKA 4F38A 3OEEA 2FDCA 3AVTA 1TMKA 1OYYA 3CPEA 1GVNB 1DE0A 4DHEA 2J45A 2Q6TA 5BN3A 1H8ED 4TTQA 2F55A 1FX0B 3N2IA 2XJ9A 1E2GA 4RD0A 3VX3A 2JLZA 1OH7A 1E9CA 4TMTA 4Q1DA 4WXPA 3NHBA 2OBMA 2PZGA 4NE2A 1II0A 2ZJZA 3MUFA 1FX0A 1VG9B 4DSTA 3WXMA 1HURA 2NO1A 4UKDA 3SDZA 1VG1A 4BLRA 5KOYA 1UEJA 4LPKA 1MR3F 5FR1A 3RABA 4WBSA 2OUKA 2W6JA 2YOHA 5FTMA 2MSEB 3SJCA 3L82B 4OHZA 2CE7A 4ESHA 4B35A 1L4UA 2Z43A 3I92A 4Q5IA 2WJIA 2V3CC 1P2SA 2LCFA 4Z8YA 1YZNA 3GLHE 2Q9CA 3Q5EA 3QPVA 3R20A 2AKAB 4JT2A 3SU8A 5FOUA 1E69A 2IXEA 2GDJA 3RS4A 1Q1ZA 1NJFA 1KGDA 1M7GA 2CLCX 4MYHA 3B9QA 3RVBA 1Q3TA 1W46A 3QQ5A 1XZQA 4IEIA 1DAKA 1W0KA 3M6AA 3UPUA 2V6IA 4OK6A 4P4SB 4E22A 3CRRA 1R10A 3C15C 4TT3D 1U99A 3BK7A 4KYUA 3WY9A 2PLFA 2J87A 2IK8A 4O0MA 1I2DA 5EP4A 5AUNB 1OB2A 3KX2A 4P4SA 4D0NA 4LJAA 3IEUA 1HY3A 1TNDA 3KUCA 4UXHA 3TK1A 3EC1A 2DY1A 4TLAA 1OH5A 4OHYA 2IYRA 1YE8A 2C96A 3DKVA 4NDZA 4DLTA 5CM9C 2YKGA 1U0HC 3VNVA 4IOJA 1N6PA 2IHBA 5B58C 2RHDA 1MO3A 4Q1BA 1W2HA 1JALA 5JLJA 3Q5DA 2MMCA 1U9IA 3NEYA 4YMSA 4O3MA 1FW6A 3H84A 5G3YA 4ACBA 4LC1A 1F2UA 2A9KA 5H70A 1XPRA 1EESA 2IYQA 2OT3B 4BLPA 3L0SA 5CIQA 4TLBA 821PA 1N5KA 2WJYA 1GNPA 4Q7MB 4DLVA 1WA5A 4DJTA 2JLWA 4QGAA 2ZEJA 4FCWA 1D9XA 3MWYW 4QGFA 121PA 3B1VA 4DXAA 3GJXC 2ZQ5A 3RWOA 3CIOA 1R0ZA 4QJ4A 5SZIA 4B34A 5EE9A 1W36B 1IONA 2NO9A 3GQBA 3VR4A 4AI6A 3O8DA 3AKEA 4RKEA 3OE7A 1TQ2A 5TXGA 4A0RA 1BYIA 3MRSA 5HE8A 3X1YA 3SE0A 2CLSA 3QY0A 5K8UA 3K1JA 4ZPXA 6Q21A 2CCJA 5KSYA 3GLGA 2GK6A 3SJBA 4BFSA 1ZCAA 2ZS7A 2B8TA 1RE0A 3BB1A 1Z0DA 4GMDA 2EQBA 1DAEA 2ONKA 4M1WA 3B60A 4URVR 2ZVPX 4PPFA 1RRGA 1W0KD 3KXIA 4E5UA 1IBRA 1KKLA 3K9HA 1S0UA 4MGZR 3RC3A 1GKIA 1W1WA 3FHTA 3FMFA 2WTUA 4TQAA 4RCYA 3Q9LA 3WHLA 1FFHA 3FGNA 2OCBA 4TL6A 1QBKC 1LVGA 3P26A 1S3GA 4LJ4A 2QMEA 4IXNA 3GJ3A 2BBWA 5HPYB 4LBYA 3IEVA 3T06B 1RPZA 1NVUQ 1T0HB 1DO0A 4DDUA 3CKLA 4BLOA 2PMKA 3IQXA 3VR5A 3AF3A 4G5QA 4M9SA 4LHWA 1DVRA 3ZJYA 2Z0MA 4URWR 3R8CA 4HLUA 3AF0A 5JI3E 2XX3A 4MYUA 2A5DA 3TGPA 1B0UA 2B7BA 1YJ5A 3NBYC 3ZVRA 2Z83A 3MWKA 2WPDD 3I4LA 1XEXB 2C9CA 1G291 1EGAA 3FE2A 2YHSA 4DLXA 3T1QA 1S8FA 3AUXA 4DCSA 1T3SA 4C0AC 4Z54A 1Z3IX 3C14C 4L15A 1SXJE 2BDTA 2WSSA 3KKNA 3GJ4A 2GXUA 3MLEA 1E2LA 5EXSA 3OE7D 3GLIB 2MSDB 5L3QB 1R2QA 4GRAA 4IW3B 3QVVA 1P60A 1KI7A 4PC1A 3A4MA 2QRZA 2IWRA 4EQ6A 2H92A 1I4LD 1XZPA 4M9XA 1OXSC 1W36D 4FW9A 4M22A 4XIGS 2VA8A 5G41A 4D25A 5JCPA 5J4KA 4YXWA 5TMPA 1NL3A 5L3QA 2AD1A 3LBHA 1G18A 4FI3C 3QBVA 1JAIA 1GRNA 1ZYUA 4P4UA 1K6MA 1XP8A 3GLHA 1YR8A 3CR7A 1SVIA 5H1YA 4HB4A 3J81k 3KJIA 2YYZA 1ZIPA 4QHYA 3E2IA 4NBSA 4DLZA 4DKXA 1ZP6A 4W5WA 4R2HA 1GRQA 3WMGA 1F60A 2I1QA 2ZR7A 3R8FA 1LS6A 2CDNA 5FTKA 1SKYE 2J7PA 2QAGC 4RZ3A 1K5DA 2EFDB 2IXGA 3KDSE 2AXNA 2FFHA 2Z4RA 3NC1C 4Q9IA 1N6HA 3NH6A 1CS4C 4GI7A 3TE6A 4JIMA 4QBHA 3CRMA 4LJ5A 2O0KA 3ECCA 2VP6A 4AC9A 2PJZA 1C9KA 2DHRA 4DLYA 2W58A 2WKRA 2KBFA 2ZE5A 1VHLA 5KPDA 1DBSA 3ZLJA 4BFWA 3FDIA 5KDLA 4B3DA 2GCOA 1RC8A 3BOSA 2BEJA 1OFTA 3I73A 5JSZA 5K8IA 2LKDA 1FNMA 5JJLA 2NZ8A 2BC9A 3ZYCA 4BGDA 1KI9A 2Q3MA 1OXUA 4HDCA 4P33A 3T5DA 5DO9A 1T3LA 2ANCA 2ZYVX 4M9ZA 5FI1B 4MKHA 2ZRGA 4KU4A 4OHVA 2VPPA 4Q4HA 4GOKA 2WIAA 2J9RA 3OIWA 3AP2A 4PC6A 5DSZA 1G3QA 2OEPA 5FFMA 1RZ3A 1Q22A 2WSSD 1N2CE 2GJKA 1N5LA 2OFOA 1JBKA 5EE0A 1P75A 4B2IA 1NN0A 2R65A 5IF9A 1EX7A 1P5ZB 1VIAA 4BFTA 2C98A 1ZAKA 1IQPA 1E98A 4Q1FA 2DFLA 2ODNA 4YXWD 3RNLA 2R8RA 1G7CA 3QSYA 4YQFA 1U8ZA 5K8TA 3L43A 4GMXA 4TLCA 3G0HA 3X1ZA 2GF0A 1G8HA 2RGGA 2ZRCA 4OI1A 3THWB 1N6KA 2YWFA 2XEXA 1G1MA 3CB4A 2GHIA 1T91A 3ASYA 4DSOA 3W6OA 1A4RA 1H8HD 1ZNYA 4A92A 4YC7A 3OAAA 5DHAA 1AKEA 4B73A 5C4GB 4ARZB 1XTJA 1N0VC 1GL6A 1W0JD 1WDTA 1XNJA 2OBLA 3KKPA 2V6JA 4Q47A 5FUYA 4HLCA 3RRNA 3THWA 4N0EA 3SS8A 4GDFA 2B6HA 3DEFA 4FN5A 2EVWX 3KZ1E 1XCPA 1HT1E 4LY6A 3LNCA 1Z0JA 1A1VA 5JJKA 2L0XA 4LCBA 2BBTA 3N5CA 3QI2A 5AWFC 1G41A 4HATA 2D4HA 3A1WA 4Q03A 4MA4A 1GRRA 1GKYA 4Q4JB 2XSZA 1GM5A 4A6PA 1JR3A 4RJLA 2VP4A 4JJZA 3U6KA 4DCUA 4M9QA 4HUQB 3DMNA 3WP1B 1II9A 5JMTA 1IJFA 1Z06A 4C2UA 2WWFA 1HQYE 4R2IA 1SKQA 3B9PA 3VQTA 1NY5A 4HB3A 3TKLA 2WJGA 2E9SA 4OBEA 4Q4JA 2ZU6A 1NMYA 1Z2AA 1ZBDA 2HYDA 2RAPA 3NDPA 1P2UA 2FV8A 4FIDA 4EJSC 4Z1MD 3WNDA 3P20A 2XZLA 1KY3A 1CR0A 1QHGA 1ZUHA 4BLQA 1FOEB 3AQ4A 1E2PA 3LRPA 4RD4A 3L0OA 2RGDA 2RKOA 3O8RA 3UKDA 1Z0IA 3HWSA 1G8YA 1A5TA 3U7HB 1XEWX 4JVMA 3FTQA 4V0MA 4XVQA 5DH9A 1GL9B 3MD0A 5FBWB 3VKWA 3K70D 3EPKA 3ZZTA 1QHSA 1XCMA 1E1RA 3IHLA 3BERA 1VYUA 2CK3A 4H1VA 2GZHA 3DDCA 5L3RA 3A1TA 4W9MC 1W48A 1Z0FA 3K0FA 1T8UA 3LQRA 4TYNA 3VHLB 3SJZA 2PMDA 2J7KA 1VCMA 2BMJA 5A4JA 3RS7A 2PLRA 4DLWA 2X1VA 4Q9KA 2NG1A 2J3EA 2KWIA 3CX6A 4EDHA 3QOFA 1OH6A 4LHZA 2ZJOA 1OPXA 1T8TA 3BH7A 3TVDA 1E2JA 1QG2A 4P3YA 2ZRMA 3CWQA 3RS3A 1P9NA 1ZRHA 3TSOA 3W6PA 4DT1B 3MGCA 1UF9A 1AM4D 5J4YA 1MOZA 3B13B 3I5YA 4RSGA 5IDVA 2P65A 1FP7A 2QNRA 1E4YA 4I99A 4Q18A 3A37A 2R9VA 4BEJA 1RKBA 5KUTA 3S1AB 4CGZA 2IHYA 4PSVA 2ZRDA 1TF2A 3IIJA 2IT1A 1UKEA 2XSZD 4Q1CA 1JR3D 2BKEA 2IX3A 3PV0A 4TYYA 2NIPA 4ZKEA 3LH5A 3S1AA 1XJ0A 1EG7A 4Q01A 1Z6YA 4WVFA 4BLTA 4JYBA 1SZPA 5AK0A 4AWXA 3RC8A 1KI4A 3C5CA 3I1FA 3NBFA 3MJRA 1BMFD 5AUPB 2REBA 4KVAA 2FJUA 2W0MA 4US1R 3EIQA 1DAGA 3P4XA 3NTUA 4HAUA 2QI9C 4GOJA 3WYFA 2RHMA 3SYKA 2W6ID 3KTAA 2FFBA 3OHMA 1G3MA 3DL0A 4DSNA 1ONBA 1P6XA 3KL4A 4LJ7A 5JWHA 1E1RD 4UNNA 3DO6A 4M1YA 3HU2A 2CK3D 1U0LA 3NXSA 4BRUA 4C0SA 4HDQB 1YVDA 1CRQA 4M2LA 4Q48A 3GEIA 2F1IA 2QENA 2C04A 1GZSA 3AF1A 4QGHA 3K0AA 3U2QA 2IF0A 2BJVA 4C0QC 2F1RA 1BIFA 4M4SA 3QXXA 3REGA 4GBMA 2ODWA 1IN7A 1TUEA 3MWJA 4RCZA 1LFDB 2WZQA 3ZIAA 5FH9A 1HTWA 2A30A 4BZXA 2DCUA 1LV7A 3RRYA 4AIIA 2AFIE 5EUMA 1KJWA 2KJQA 4US2R 1XEFA 4JBWA 2V54A 4E03A 1X1SA 2XXAB 1X6VA 2QL6A 3A1VA 4DCNA 3SHWA 4AD8A 3B8HA 5F2EA 4YONB 3SYNA 2QORA 4QBFA 4LYJA 3TSZA 3GJ6A 5FI0B 1XRJA 2CLDX 3GJ0A 2XXAA 2IUUA 5AUQA 1UBEA 2D2FA 3THXA 4C0JA 5BN4A 1PZNA 1P73A 3BWDD 1NMZA 3WMFA 3HPQA 3P27A 4LOAA 4B3XA 2A5YB 3HR7A 2WKPA 3BB3A 2ZE7A 4OQMA 4DDVA 1QF9A 4FCTA 2A7QA 2ZYUX 4ZI3A 4D2IA 2VRWA 2IYXA 3LAWA 4PAQA 2O8FB 4JLKA 3GFPA 1JJ7A 3W90A 4U7DA 3H0KA 1AKYA 4AKHA 2P6UA 4KFUA 3ICQB 4LRWA 2ECKA 3JVVA 4DUGD 2FFAA 4QKQA 1Z6XA 3FHCB 3FKSA 1UDWA 1CJUC 3FPAA 2NQ2C 3T1TA 3AVWA 2O8FA 3MFYA 3B85A 2FU5C 1BO6A 3D3QA 4KSBA 2QE7A 1PVOA 2VSOA 1OXXK 2AX4A 1Z5ZA 2AK3A 4PHHA 3MG9A 2J0UB 3LLUA 2WWYA 2GEUA 2QRNA 5KSOA 1KMQA 2QG6A 4DIEA 4YMTA 1GOTA 2PH1A 2ZJ2A 5LD2C 3CH5A 3QKUA 4N3NA 3SHFA 1ZJ6A 3QE0A 4TYWA 2OBNA 5TB5A 3W3ZB 2JA1A 2D2EA 3AP1A 1Z47A 4U5XA 1HEIA 2QTVB 2DPXA 4A0HA 4BEBA 1KO4A 3ZIAD 3VR2A 4IRUB 5FOXA 4QJ3A 1SXJC 4FMDF 1XTRA 4PFSA 2R2AA 5TDHA 2DFKB 2IC5A 4Q4LA 3ZVNA 4EKDA 1Z22A 3VKHA 3BAFA 4A1FA 4M1MA 5M04A 5KNBA 3RDPA 1RJ9B 4HI0E 2ZITA 1E9EA 4FD2A 5JS8A 1A7JA 2GNOA 4POAA 1MRSA 5HCNA 1JNYA 2WIBA 4LSGA 5FBRB 5HTKA 5JECA 1NMXA 5KNDA 4UNPA 3EXAA 1G64A 3IO5A 4RD6A 4TT3A 1RVDA 2ATVA 1Z0KA 4H9GA 1RJ9A 1AN0A 1AS3A 1KI2A 1ZD9A 3EIHA 3LO5A 3TRFA 1KY2A 3TR5A 3ZD7A 2XGJA 3RS2A 1ZNZA 2GAAA 2FN4A 2AHOA 2CJWA 3TIFA 1WBBA 1OFIA 1X8JA 4NPHA 5FBQB 3U4QB 4I1SA 3VAAA 4BFUA 4URYR 2V55B 2V8OA 2GBLA 4A2WA 1DAHA 4NCKA 1E2FA 1SVMA 1M8PA 2VQSA 4NYJR 4N1AA 1E2HA 2XTMA 1FNNA 2WJHA 3Q8XB 2CL6X 3FKSD 5B2ZA 5BN5A 3U4QA 2JLQA 2WWWA 1G6OA 1Z0AA 2GZAA 4D4KA 1TUIA 2ZRHA 3IHWA 4V0LA 5DYGA 1KO8A 1MABB 2QE7D 2ZJYA 2G83A 3D7MA 4G5RA 2NPIA 4L9SA 1WXQA 3U5ZB 2O8BB 1IXZA 1ZM7A 2QMUA 3H1TA 2W0SA 1MO6A 4JLDA 3LY5A 1IAQA 4LK2A 4OYHA 1TF7A 1U94A 2ZSBA 5FOSA 2GXSA 3IKJA 3BRWD 4OQFA 4PAMA 2O8BA 1YQTA 1HE8B 2FSIA 4NL4H 2JEOA 4JVLA 1KIMA 3QXCA 1Z28A 4Q19A 1RRFA 1P3JA 5GJWC 1JI0A 4S2EA 3TR0A 5KPJA 3GLIE 3C7KA 4L5BA 2REOA 4Q7JB 4DB2A 1VYTA 2YWGA 4EPVA 1A2KC 4JKYA 4PQRA 4EPYA 1TX4B 2FZLA 2BWJA 4NCNA 3TQFA 1N3BA 2VLIA 4NYIR 1SULA 2ANBA 2HLDA 2CNWD 4JLBA 3T61A 1DPFA 1R8SA 3I62A 4A15A 3QNUA 2F1HA 3OIYA 4RZ2A 3KQKA 1Q20A 1UAAA 5GVSA 1TL7C 2R6DA 3IPYA 4DLSA 3SFVA 4PO1A 4CEJB 1WF3A 1G7SA 4HAWA 3NIBA 1G3UA 4D6PA 2NZJA 1QHNA 3M4YA 4NCHA 3I72A 2BBSA 4TZ6A 221PA 1GDDA 5CJPA 4RFVA 3X1XA 5JHHB 4R71A 3UATA 4Q9HA 3QUSA 1LF5A 3B6EA 1Q1BA 4LPSA 1SHKA 1KSFX 2ZE8A 4EAQA 3BFKA 4EFMA 1XJQA 3EA0A 4G1UC 3BJIC 3UMRA 3WBJA 4XWAA 1VCNA 4OI0A 1EFCA 3EPJA 4L4UA 2G1KA 3H86A 4JSTA 2WWGA 5LDDC 4HZIA 4IKEA 3KXKA 4F93B 2OESA 5IK2A 2WVJA 5KTYA 3QIAA 3W6NA 2WPDA 3JVUA 5SZHB 1E2NA 5FPHA 4QM6A 4BZQA 4M0LA 3WNBA 4C30A 1EXMA 5CLQA 4LC0A 4C3ZA 2JJ1A 1AS2A 3KFXA 2QROA 4HLQB 2C77A 3GCGA 1ZUIA 2IUSA 2ZSFA 4XJXA 3RSOA 5LBIA 5KSZA 2ERYA 3T1VA 1Z6TA 1TU3A 4IEEA 4OKSA 3GEEA 2ZRBA 5EE1A 4O25A 2C8VA 1Y3AA 1OH8A 1E79A 1S1MA 4B3CA 3OIVA 3PQCA 4C2TA 4JLOA 1A82A 4ILEA 2YWEA 2G6BA 2HXYA 4DVGA 3QG1A 1E99A 3U44B 2CL0X 2VO1A 5HKKA 4GOXA 2R6GA 2HLDD 1ZU5A 4OJQA 2NGRA 4Z8XA 2XZOA 1ZU4A 5DN6A 5IHPA 4ZO4A 4UJ3A 3B5JA 3CW2A 1YKSA 1KJZA 2GXQA 3PCRB 2JDIA 4JZKA 2BCJQ 3L0PA 1VKJA 3CF2A 1G16A 2QPAA 3HU1A 2JCSA 4JLAA 1DG3A 1WB9A 3EZ9A 1OKKA 1DG1G 2OAQ1 3FYHA 2GEVA 2W2TA 4JT4A 5C18A 1T5IA 4QL3A 5C1BA 3QKTA 1QHIA 2O8CB 1W5SA 3NKVA 3PUYA 3F0TA 2FX3A 2J5XA 1DAIA 4OHXA 4HAVA 1LF0A 4OHWA 3ZH9B 4G5SA 5DISB 3H4MA 4B2LA 4MGIR 1AZTA 2R44A 2DYKA 3QG5A 2QUZA 1JR3E 4XSHA 1NVVR 2ZSAA 4LWZA 3CH4B 2KBEA 3I8XA 2ZSDA 2GVDC 3RAPR 2FA9A 1HA3A 3EC2A 1E0JA 4HEJA 4V02A 1CU1A 4IVPA 3W8RA 3LVQE 1G8PA 4MYCA 1E9BA 3MWLA 3ADKA 4HZUB 5IK2D 5FUWA 3U3MA 2FMXA 3VNUA 3CRQA 4GZLA 4EPRA 2ZAMA 3WRYC 3X1DA 3CM0A 3JZAA 4XSGA 2IL1A 3VHXA 2ZRKA 5DYIA 2FPMA 4LYFA 4KCGA 2JJ1D 1X3SA 1YR9A 4V0ME 4NTZA 4LBVA 1PJRA 3SC3A 1NN3A 1XEXA 4ACAA 2GJAA 2VEDA 3U7EB 3ADDA 4M1SA 4DDWA 2HT6A 1LTQA 4XVRA 1J99A 1E79D 1U8YA 1TQ4A 1ETUA 3FMIA 4JL6A 1KZGB 3TH5A 2RH5A 2H17A 1E9DA 2VF7A 1BYUA 1UBFA 3QEOA 4IOMA 4DBLC 3PITA 4D80A 1T9HA 1KK3A 1FUUA 1KK1A 1NVWQ 5JI2E 1UBGA 1GP2A 1VMAA 3GLIA 4AKIA 4IDNA 3Q7QA 621PA 3ZQ6A 4RZXA 5HKKD 1EFHA 4OL0A 2X77A 2GZDA 5DN6D 4I4LA 3AVYA 1YZUA 1H8HA 3GLFB 1J8MF 1AK2A 2G0TA 3W5IA 2JDID 5AR1A 1W0JA 2PT5A 3LVRE 4TN1A 1RIFA 3M1IA 1CJMA 1OKKD 2IYVA 4II7A 4XTRA 3GLFA 4HB0A 3CZQA 1HT2E 4WOPA 4MRVA 4Q7LA 2ZI3A 1II8B 1C1YA 4A8JB 2P2LA 4MUBA 1FPMA 4XWOA 1WP9A 4KVGA 3LXRA 5ANRB 3KB2A 2VH5R 2IS1A 1OXVA 2Q0HA 3NG1A 3SFZA 3I61A 1O87A 1A2BA 1II8A 1OXTA 4XVUA 3QXSA 1QRAA 4A8JA 2XB2A 1R6BX 4HDOB 4LDJA 3AKDA 5GVRA 2BOVA 2W83A 4Q7KA 2R6FA 4CZ2A 4C0HA 2ZYTX 5DE3A 1OHHA 1XEWY 4NKRA 2JLVA 2B8WA 5A5GA 1VECA 4D0GA 1W4CA 1CTQA 4BFXA 3ZQJA 1MRNA 1UFQA 1F6BA 5P21A 1CJKC 3QEJA 4Z1MA 2A3RA 2ZJBA 3UK6A 4WZAE 3TAUA 3CWZA 3EZFA 3K70B 1T6NA 2MSCB 3GPLA 1JQLB 5JRZA 2CHQA 2DB3A 2DBYA 4M21A 4HUTA 4FWIB 2ZRIA 2AN9A 1NLFA 1W44A 4A2PA 1I2MA 1S1CA 1VIYA 3F8TA 3CNLA 2VP5A 3CRVA 1U9IC 4KBGA 3D8BA 1JXOA 4M53A 1IN4A 3V00A 5FPKA 3DVLA 1SHZA 1FUKA 2WHXA 1ANKA 1W49A 3LLMA 2CL7X 3F3YA 5GADl 3OESA 5FBLB 3MJHA 2QQ0A 3CPJB 5E3HA 4PZLA 2HV8A 3TVTA 3O8CA 1YZQA 5EZ6B 3K9GA 1VG8A 4CF7A 2ODBA 2CHVA 2WKQA 2QT0A 1OT3A 1ELOA 2GRJA 4CEHB 2X19A 2OV2A 3KFVA 2IF2A 1Q0UA 5JHGB 1CR2A 1S96A 2REXB 4ASUA 1VTKA 3AGPA 4B33A 3U7GA 1W36C 1M1YE 2WJJA 2XJ4A 4ARZA 2CCGA 2QSYA 4IFBA 3W8NA 4NONA 2LKCA 2JJ8A 1J70A 2OG2A 2RGCA 4CEHA 1G4AE 3ZDQA 3DM5A 3HDTA 4E09A 1TADA 2ZUBA 3SR0A 3UMSA 2FPLA 4AYTA 1HYQA 1NIPA 1X86B 2ZR0A 5FL7A 1E0KA 1E0SA 1KHTA 2EWWA 2H57A 2JLRA 5EP1A 4QC2A 3LV8A 3QXHA 3K8YA 2ZIAA 3EW9A 3PEWA 4Y0AA 3C5HA 4IVQA 4US0R 1OHHD 1SGWA 3ASZA 3E5HA 4RD2A 4XD7A 4PZYA 4F4IA 4UNQA 4OQLA 2EWVA 3BH0A 3BIFA 4CRWB 2X2FA 1G3IA 5A0FA 2QY9A 4HUQA 2YC2C 1KKMA 3IPXA 1BMFA 5UKDA 2W00A 2Q9AA 5JJIA 2ZVQX 3B2EA 4KITB 2OCYC 3GJ5A 3EA5A 3CLVA 4CT5A 2W6IA 4M1TA 5FL3A 4B6EA 1OF1A 4HLUC 4PQFA 4M8NE 3KKMA 1SVKA 3P32A 1XU4A 2O52A 5CYOA 2PEYA 5BXQC 3O8BA 4MGYR 1UM8A 3TAHA 5LB2A 2DWOA 2SHKA 3CRW1 4K46A 2JASA 2J46A 2I1VB 3R9XA 1TF5A
chains in the Genus database with same CATH superfamily
2HD4A 4E30A 3LHFA 1OE0A 3VBCA 2MHCA 2C9BA 5A4AA 1K7SN 3UIEA 5I3CA 3A4VA 2QN3A 2WUEA 2DT5A 3BXEA 4TRNA 2I91A 3B9RA 1O4VA 3ONWA 3JQ8A 3ZHVA 4CTJA 5EJ7A 4Z1OA 1EUDB 4AN1A 4I81A 4G0ZA 5A03A 3V2GA 4GP9A 3UZUA 4AKEA 2AD5A 3WSTA 1VI6A 2C20A 2R1UA 2I7CA 2OHVA 4RHUA 3Q8LA 4PLWA 3IIMA 4O2RA 4WK2B 5F21A 1F14A 3NWOA 1NI4A 1X14A 1V2GA 3KPUA 5T67A 4U02A 1Y1PA 3GT4A 4FFDA 4ASUD 5KOHA 3QKRB 3F2IA 1ZOSA 3L1HA 3M6VA 1N33B 3EQ8A 3PGKA 1TAGA 2IHVA 2VHZA 3VNBA 1IVSA 1R0BA 3KQUA 5EESA 1G21B 3CJTA 4EARA 1UIMA 2COEA 3DWEX 4RDIA 2HO5A 1QPGA 2B4YA 2A84A 1HGXA 5CA1F 2PX6A 1KO5A 4P31A 2JHAA 2JK0A 3SS9X 3WBKA 4B3FX 5IARA 5EHNA 1RABA 5AIBA 1JU3A 1T1EA 4NBVA 2YNMA 4Z9BA 3C3MA 3HCWA 2VSFA 1I1OA 2C57A 4KGVA 2AN3A 3KSMA 5DULA 5AXCA 5B1DA 3CB2A 3FTCA 3IAS1 4HXGA 4NPAA 1RRMA 1JDPA 2UZ3A 5DBIA 1ZZGA 1B15A 5JEEA 2AWNA 2VG8A 1JR6A 1RU3A 2GZRA 3AJEA 1MX3A 3PUZA 4G5GA 4EBFA 3F5FA 3I52A 3HM9A 3ZWAA 3HDYA 5AKLA 1AE1A 4J2HA 5A3RA 3RSZA 5ITWA 4FMCF 5KOJB 4ALJA 1RLIA 5IJ0B 4JXZA 1IY1A 1XE3A 1OYOA 4KXMA 4MW0A 5TVKA 2HSGA 4DQUA 8AT1A 1JZTA 2FH5B 3OF2A 4YLEA 2Q2WA 2O5EA 1Z6GA 4OKNA 5FKJA 3V33A 2PUBA 1XTKA 4ZC8A 1APBA 3WRWA 1NPDA 3BBPA 3L07A 2DFVA 1HF3A 1ESMA 1RQ2A 2IEZA 3EXHC 4MVYA 4QXRA 4MWDA 1Q14A 5IABA 5BV2P 2VOJA 5DT9A 1YRAA 4H6PA 3IBCA 4UBIA 3K6SB 1UWVA 4GI3A 4U7TB 2OVFA 4IF6A 2JCXA 2NO0A 3CX8A 4DJ5X 5TIIA 5FT9A 1U63A 1WHTA 5LYJA 2DQ4A 1QORA 3DCNA 4IP0A 1R0YA 1TPZA 3D4LA 5SZKB 4HLNA 3QVGA 1U2RA 3T5BA 4H3VA 3WLRA 1GTG1 2PXAA 5IULC 1ADCA 4S0XA 1QU3A 2C1ZA 1YD7A 2IDMA 4BP8A 2I29A 3JQPA 5IJXA 3R7NA 4QD3A 2WJVA 4JGIA 1DC6A 5I45A 1KFKB 1Y9DA 2BH9A 1K0UA 2VKQA 3A36A 2ILVA 3KU4A 3MW8A 3QF7A 2O06A 3EEFA 4IOLA 3TTTA 4TRMA 3W2GA 3RIEA 3ZHXA 5BR8B 3EWSA 5AXAA 2PS1A 3CVWA 5JRJA 5G0WA 1EE9A 2LBPA 3VNRA 4EAAA 5J5VA 3RVSA 2QTHA 4OEHA 4P36A 1GUFA 5HKOA 3ZCTA 4BFLA 5ALDA 2E6UX 3NIGB 2PZEA 5IC6A 1USGA 3B36A 4RVNA 3QEBZ 1OVGA 3E7PA 2C07A 3L9WA 3HADA 4MDEA 1QGDA 3FAKA 2OZLA 1G20E 4HPJB 3DPUA 3SIXA 3VFDA 1XN1A 3QU7A 4EUFA 2I3DA 2OWEA 3KZOA 4B2PA 2IOYA 2X40A 1JG7A 1RJEA 2YJTD 1FIUA 1SBTA 2XYGA 3GXOA 1PE0A 2R97A 1XNQB 2FSPA 3E53A 1Q0SA 4DDKA 4S24A 5GONA 4FHCA 2C99A 3GJRA 4RY2A 1EFKA 1UINA 1QYDA 2QMQA 2V96A 2V7QD 2WOOA 1GNTA 2W6OA 3BORA 3H8WA 4PSDA 1D3AA 4PZZA 3RS0A 4BKPA 4EYOA 3QX9A 1D6MA 5JAHA 4YMLA 3FMOB 5KDDA 4RTRA 4CLOB 4HPXB 3KUDA 2FTKE 2GA8A 3LF2A 4M8SA 4R8KA 5BOSA 4MUGA 1RPTA 2C0CA 5AJYA 2GO1A 2NSJA 4I50F 1S3FA 3K5WA 5BW4A 3PPIA 3RS5A 2W93A 4LYGA 3RPEA 2A59A 1UXJA 5F51A 1YTUA 4LDPA 2CDBA 3GOHA 1VKHA 1D6SA 2BE7A 1CIVA 2QSJA 2QZ9A 4G0QA 4BB6A 4DDMA 3GG9A 4NZYA 5LWHA 3FI0A 3L41A 4ITRC 3UMVA 4I50B 2V0GA 3QE2A 1XA4A 3U4DA 4X3CA 1A27A 1P4GA 1OB5A 1M2OB 1TVKA 5C34B 1KERA 3LX6A 3LLVA 1KEWA 4QUBA 1P9WA 4ZAGA 3EF0A 3R2JA 2LNDA 1V9CA 3B12A 3LQ2A 4H7DA 1GZHB 3CXUA 3UHAA 1DTSA 3ZHTA 1XN4A 1WUKS 2ZRPA 1CEXA 2YV4A 3VR6D 1M5TA 3KEQA 3G02A 5FO1A 1DDOA 4YUXA 2AG5A 4A5SA 4CKXA 1SKAA 1WUJS 3FWZA 4LV8B 4N18A 1BXRB 2MWMA 2FZGA 4CMJA 4IICA 3CLSD 4F6LA 3AX6A 4MZDA 4KUHA 3EY4A 1JG3A 3PGMA 1U2ZA 1ITZA 1JKFA 2NT4A 5FUVA 4DRXB 1ZW6A 5GQSA 4TL7A 2RH9B 3E7WA 1HZZA 2C7GA 4OK3A 4PQYA 4JI1B 3KE9A 5B4UA 3AR8A 1SBZA 4F7DA 3KVNA 2XV1A 5CT4A 1FRNA 1U7HA 1VG0B 3AV0B 2RMKA 1NLZA 3L4BA 4FMDB 4FQ8A 3CO5A 3JAKA 2QUJA 3ZTWA 4EYSA 4JYZA 1FFEA 2DR3A 3KXLA 4CR7A 4MDFA 1C7JA 1ZH2A 3EODA 1E1QA 4ZMBA 2EJWA 1RHKA 4V38A 3DBOB 3JYHA 5J4HA 1LJUA 1TZMA 4QFMA 1BWQA 1YCDA 2CL5A 2R5FA 5JYEA 1CZOA 4JX8A 3RODA 2GWHA 2ID9A 4N9QA 2LUOA 2I78A 3K1AA 1ZINA 5IVDA 2GEDA 2RH4A 4F3TA 1O54A 2PMFA 3VU9A 4JQCA 2NQTA 3ZDFA 4KI0A 3FZQA 3L1KA 4IJ6A 4PSKA 1BZYA 4U1RA 3V3TA 2W2XA 1PHRA 2MIIA 3HCNA 2D3TA 4IG4A 4N12A 3ADBA 2H8GA 2PUCA 1P44A 3QF4B 1E32A 1R18A 2XTAA 1LUAA 1QHXA 4AZ0B 1I80A 3BAZA 3H3JA 5CP8A 1FDSA 2ACEA 1E2MA 1WU8A 2WMNB 2ABWA 2ZIEA 5AM0A 3EXFA 2Z8YM 3NHWA 3G2JA 3OY2A 1SBQA 3PHBE 4J49A 2OYRA 3WLEA 4N03A 3VGJA 5A7GA 4BNIA 3HP7A 1JDSA 1GNQA 2O3JA 2YCBA 2EF1A 4YRIA 3AJAA 4IJMA 2OHGA 5CYPA 1OTYA 4TMXA 5DYTA 4GWKA 4ZQCB 3SQLA 3THOA 1YT5A 3U3JA 1EDOA 1WM1A 1O03A 5EXTA 3Q4GA 1G5RA 4UVIA 4Y1RB 4BC0A 3LTNC 4U8HA 1TJNA 2PG3A 2JFPA 1TGYA 2Q4DA 3OZCA 3ZCQA 4FNMA 4YIKA 5B57C 2EDCA 3BXZA 3BK1A 1FP6A 4HB2A 1WMSA 4QTXA 1MABA 2GN6A 4R9UC 2JLXA 1T24A 1DOAA 2BMEA 5HKAA 2R8PA 4NECA 2Y05A 5B7NA 2E4YA 2QTTA 2G36A 4Q6WA 1NRIA 1GWNA 1NX9A 1P9LA 1T5SA 1YZGA 2YFHA 1LNZA 2YJ3A 3MTDA 4MW4A 4INPA 5MN4A 4P58A 4UEKA 1I30A 1BA3A 1HYHA 3GRZA 4WXRA 3RJMA 1GCGA 5HJ2A 2IPLA 3LT0A 3J80A 4B75A 1R4MA 4ZV4A 2XA1A 2V6BA 4LV5B 5EMKA 1MT0A 3TOSA 1M8KA 2JEZA 4IOKA 3TJRA 4BKUA 3P9PA 4AG5A 4JB0A 1YQWA 4IDBA 2IHJA 1VHQA 2A5FA 4GRIA 3IQZA 2Q07A 4ZRDA 5M3BA 3WGQA 4UE3S 4JBGA 4G0WA 3GL9A 3PNBA 1BRMA 1BDHA 4B46A 2HOQA 1R12A 3FB4A 3E4DA 4J0CA 4LK3A 3TW6A 5LQJA 4R1PA 1PFVA 1XRQA 4Y6QA 1I7PA 4RKFA 5ER6A 1ODTC 1QGZA 4KOEC 3A6PC 1ATIA 4QU5A 4EB6A 5JVDB 4KYTA 3ZU6A 3SN6A 3PQDA 1T3TA 3LUDA 2BTEA 3AEZA 3U31A 4MKGA 3MMPA 3OQBA 3KSAC 3E70C 3JQFA 1UMBB 2YMLA 3S68A 2A0FA 2XNDD 3M82A 2VPYA 4DDTA 2QD4A 3FRHA 4POOA 5HYVA 3AGQA 3CLRD 3WWEA 1AKWA 4QDTA 2IH4A 4EJ0A 4UVEA 2D2XA 5KTOA 2JD0A 1KP2A 3U7FB 5DP2A 2IYYA 2P27A 2FQYA 2HI0A 1HMPA 3JQAA 5BSKA 1BFUA 4BQEA 3FPJA 2C5EA 4FE7A 5F78A 1VHJA 1U3WA 1SVSA 3I3SR 2FFJA 2PCJA 1KP9A 3GLVA 3WGMA 2WSYB 4A6XA 2YZ2A 1OWMA 1T8YA 3NUGA 3NWJA 2A9OA 2XUFA 1MV5A 3LD9A 3LX5A 2GJ8A 4QHTA 5EWMB 3RU3A 5KVAA 5KTSA 2PZFA 3LQFA 3SOPA 4P3NA 5B7PA 1P45A 1H2WA 1NY6A 3EFHA 4QECA 1E0AA 2WFLA 5AOVA 3DAGA 4D9BA 5KKNB 2FETA 2IU3A 1T4BA 5B58T 5EMJA 1NM5A 3DE0X 3HO6A 3R5SA 4RY9A 3W34A 1ZNXA 2DSNA 1NXWA 2WNHA 3QKWA 4HTFB 4N82A 1PO7A 5LR6A 3RV3A 4F06A 3IO3A 3O4HA 3PVCA 4ZI7A 1AO3A 4J1TC 4BO7A 2WJPA 1GFZA 3L0BA 4XASA 3VDXA 2VNHA 1U2EA 3DHYA 4CMAA 4F1KA 3Q3JB 3V4ZA 3K31A 4OAPA 1E6CA 4WCFB 3NEJA 4PTZA 4D74A 1WCIB 1GN9A 6AT1A 3R3XA 4OQPA 5E1DA 3GQBB 5HRAA 2FB9A 3QVJA 1YQEA 1GZ7A 2C2MA 4KAJA 3BWXA 4JSYA 1ORDA 1ZEMA 3KM0A 3OZAA 1QTNA 1NHGA 1PR1A 3FB1A 3O1LA 3GFOA 4M54A 2GF9A 4OTZA 5FHRA 2R85A 4WACA 1N6RA 1TQ6A 3AH8A 4KFSA 2FEOA 2GKSA 1TRHA 5LVAA 1JAHA 2HNAA 1CUUA 1D2NA 2VJAA 2CD7A 1GXSA 3CR8A 3ZS8A 2J32A 3K09A 1UKYA 3O2SB 4CV0A 5K4HA 1WR8A 4TS3A 3K1ZA 3PVSA 1S2DA 3H65A 3G7SA 4RK1A 5HHTA 4I8DA 2QU8A 3U3OA 5JSUA 1T8SA 1L3CA 1Z2DA 3MTGA 4J03A 1UDXA 3OSUA 2PZAA 3R23A 3R5KA 3ELYA 4X8LA 4LX0A 4X90A 3VGPA 2ZUFA 3L02A 1HV8A 3LUAA 2RE8A 4YY3B 2XXJA 3S70A 2OO7A 3MXTA 3ZLUA 5CB4B 2E82A 2Q45A 3ZEAA 2WUVA 4DR7B 5KQLA 4M46A 1KJJA 1QQ5A 1KPGA 2QJOA 2P4EA 3DW1X 3NANA 4IIVA 4QPNA 3WIDA 3BMQA 5K2MA 1GTMA 3HBNA 2XBLA 2XMZA 3CLKA 1AQIA 3AM5A 1TM5E 3MMZA 3HKEB 3E22A 1U3DA 3OF3A 4M0EA 3DEYX 4Q15A 4MI6A 2VXCA 4UEJA 3RUDA 5LMUB 2I2BA 1L1QA 5GMOA 2B8JA 4MGKR 4XDHA 3V7UA 1FY2A 3E9YA 2YRFA 3CV3A 2ZRJA 2HT1A 3MGGA 1FSSA 4UVGA 5L7TA 3RWBA 2AL7A 3ND8A 3TW4A 4ARBA 1Z37A 4E5DA 1XZCA 4JYCA 1IM5A 5ALPA 2M1XA 3DFIA 3GXBA 3UANA 3WICA 5BUQA 2C5HA 1JQKA 4NLLA 4L0QA 5K6TA 3BXXA 5SICE 1ZEJA 4HZUA 4HAOA 3C5WP 4B87A 1HRDA 2D3WA 1JU4A 2PCLA 4DWOA 3MINB 1DFGA 5K3FB 1EH5A 3FZEA 4WERA 3PC8C 4RH0A 3EDCA 3D7SA 5K3EA 2LWIA 2UYQA 4ND6A 3VR1A 4PO8A 3DLTA 5H5JA 2IXDA 1IC6A 1TA4A 1XKQA 4KO1S 2YOFA 2XMBA 3GR6A 1E3EA 3PHIA 4JC8A 1UKAA 1FRFS 4LMAA 2XZDA 3AM4A 4OL9A 4BAGA 2DFTA 2VI5A 3ZZMA 4F92B 2VQ3A 2OTCA 2PPLA 3DUFB 3INGA 4OJKA 4ZO7A 2C9YA 1E4OA 2AYZA 1T3HA 3A58B 1H2AS 1EFRA 2HPZA 3B1ZA 3HP4A 3LUHA 3O91A 4RLSA 4WW0A 5FWXA 1PKEA 2HRQA 3H5OA 3LC2O 1K7XB 2ZWMA 5IKXA 3FJ1A 2CUTA 3LPNA 3GDGA 3IAEA 4FFPA 2NP6A 1VL1A 3SX0A 4BUJA 4BO6A 3IJ5A 1OW3B 1U2GC 1XK6A 4Q3NA 4RV5A 4UQOA 4Y2JA 4ER3A 1A71A 4J8PA 1JDJA 2VF5X 3AHFA 2HCTA 4QFDA 1NG9A 3HBMA 1GR1A 2ZANA 4PZEA 2VJOA 4R8LA 4MYTA 4TMFA 4D4LA 4N01A 1MX1A 3QUTA 1UBKS 3T41A 3VPAA 3X1JA 1J8FA 3LYUA 3D59A 1NG1A 2GXAA 4LVNA 2YV3A 5IYZF 1YMQA 5G40A 1UKCA 3IQFA 4G1FA 5B1SA 3UXHA 1UDRA 5FBVB 3ILYA 1XMJA 3RRXA 3BSYA 3GUCA 1U90A 2ZRAA 4I5GA 4C2BA 4FXPA 3A7DA 3HPRA 4R84A 3SF0A 2F3PA 4XUEA 5DI9A 1VC2A 4NMWA 5DWQA 3I76A 2F43B 2B1QA 4EG1A 4B6PA 1SQSA 2I99A 3DV9A 4FBLA 5AHWA 1JQAA 2UAGA 4IIHA 4MUYA 5F1OA 1TEXA 2Q21A 5ILGA 4D9EA 4DMHA 2B1RA 1RKUA 4JR2A 4A6EA 3M5CA 1QLHA 3C6QA 1QRRA 2FGJA 1DRUA 4PSCA 3PEYA 2PKQO 2WD7B 2ZIZA 3ETGA 1EXNA 4IXDA 4UTRA 2VXBA 3DZ8A 2IQIA 2A7XA 4JKOA 4R5MA 3UUEA 4ABYA 2YBEA 3H42B 2ZYRA 3DGFC 1SVUA 2CC2A 4AW9A 2INGX 3PEVA 4UHEA 4LFCB 4C1BA 3RRMA 5EJ6A 2IYFA 1ENOA 2ZB8A 1F9EA 1YZFA 5HKLA 3K1TA 1NJ8A 1XD9A 4URZR 1Q3HA 4DVJA 2G82A 4AYWA 3VR5D 3UJ6A 3WNCA 2YFKA 3B2NA 3KELA 5LFAA 3BD9A 2V6FA 3I2HA 1P19A 4J0FA 4J1NA 3NJ4A 3Q7SA 4X1KB 4WLUA 4C4PA 3FTFA 1LCIA 2AFVA 4R7TA 3KLMX 5KYVA 1Y48E 3DVAA 4PAWA 3OZ7A 3C5EA 4BLVA 4G5OA 5KVSA 3L1IA 4K9LA 4CM4B 1IBMB 4MJXA 1K6IA 2OFWA 4R1UA 2B36A 2IYTA 1K8XB 5CDFA 4KLAA 4ZDIA 1P77A 4JD5A 3EPLA 4D8TA 2XOXA 4ALMA 2R86A 1M83A 1R4ZA 2L18A 3F6YA 3DT6A 2E7ZA 4QQFA 5FFNA 3AYXB 4B7ZA 3EX7C 3JATA 3B1YA 1JZQA 2OR3A 2FPUA 2HEGA 1U7DA 3HHEA 1HRKA 2VDOB 1PV4A 2BEWA 2J30A 3KOWA 4OBXA 4N0DA 1R5NA 2RC5A 2TS1A 3V46A 1UBHS 1CVLA 1BE6A 3SIPA 4B7CA 4KQJA 5E4YA 1KL7A 3EGDB 3MNFA 2RGYA 1VGVA 2G17A 2QEQA 2XDYA 4MRMB 1F0KA 3SLKA 5HKBA 1IY0A 3BTVA 4M0FA 1QOZA 1J1IA 3MZ0A 2QVLA 2Z6QA 3PX7A 3NHKA 521PA 1SJ9A 2OYSA 4KTVE 4M7RA 5I9LA 1Q0TA 2YZGA 2YVLA 3H5VA 3LP5A 5IN4A 1I7LA 4AP6A 3RUPA 1GAEO 4C6SA 4DA6A 3HJHA 2OHIA 1ORVA 4MCAA 5D01A 2HCBA 2X0FA 2B6NA 1JHYA 2AJ8A 5JR3A 1DEAA 1U28A 3M6FA 4ND8B 4E5YA 2JGLA 1VRWA 3PDIB 2F1OA 2VP2A 4UEWA 3B6MA 1C9DB 1EX6A 3HYCA 1ACJA 3DPSA 5AOAA 1ODJA 4DZRA 3IUMA 1USIA 1M0SA 3LHIA 4MKIA 1SUEA 1M73E 3EQ9A 4O4IA 4URHA 4CL3A 5MN6A 1C4WA 1LNSA 4GP7A 3QU9A 3G2HA 4IXMA 4P2BA 3PG5A 1IOVA 1KK2A 4IIYA 1XZHA 4G56A 4DNXA 4HMQA 5HDBB 3LM8A 4XJSA 1BKYA 1EQAA 3ZBPA 1UWKA 2ZDQA 1TW3A 1JIJA 2F7SA 2G1AA 2W6CX 4G4SP 3IL2A 2HRDA 4TTJA 1QVWA 1V1RA 2RD2A 1I5RA 1AZSC 5DGXA 3WLFA 3B78A 4MVJG 721PA 5JJIA 4L8FA 4G0NA 3HLKA 4KZPA 5D5PA 5DYWA 4R01A 3VPGA 3QKSB 3L8EA 4BQIA 4IV0A 4OCZA 2Z09A 4Y7CA 5GJCA 5BPFA 5BVGA 2XT0A 3P71T 1L7PA 4ZAFA 5JCOA 1LB1B 3G5UA 3EDQA 4MI1A 1MLDA 4OQDA 3UUWA 5H3LA 4BNXA 1SXJB 3T34A 5DMXA 1KJIA 3A05A 3HA2A 3NLLA 4YCBA 4YAIA 1RE1A 3HCOA 2QDKA 2ZJAA 3LE8A 2VHCA 3S27A 1MEEA 3PCXA 5TJHA 1GNSA 3OTHA 2X2PA 5FPPA 5FPTA 2XLBA 2IOQA 5T6BA 4EMSA 2QKYA 4XGRA 1K6JA 1MPXA 2VYNA 3Q3EA 4XWGA 3B9BA 4X1OA 4MV1A 2C5AA 5C1PA 3K0FB 1JJIA 2BE9A 2M6SA 3SOZA 1XPJA 4Y2QA 3HR8A 4MRNA 4NQZA 2AGVA 2YV2A 3HDGA 5I3ZA 4BV3A 1GGHA 3NUQA 3PHGA 5J1SB 3R7WB 1NBME 5F3DA 3M6LA 5FDFA 1F4VA 2Q3BA 4LTDA 2C3PA 3P94A 4R0MA 1AOXA 1EB8A 1I24A 3LA6A 5K0FA 4GNKA 3P2MA 3QA3E 2HJWA 4JLVA 3I64A 4JEMA 1PJBA 3BBLA 1LTHR 4D02A 4U2BA 4UDNA 2AXPA 4E6EA 4I1YA 3OAAD 2IIPA 4FU0A 2NPFA 1O5OA 4RGBA 1W7AA 2Z8YA 3FGZA 4MO2A 3I6BA 1GO2A 1XDBA 4G4IA 4TGLA 4XIFA 4DXAA 2XPCA 5ILOA 1Z56C 1LFAA 2YZMA 3FWNA 1X2BA 4E2XA 3PXXA 5ECYA 4EJ6A 4YRFA 1XD8A 2QU7A 1IHOA 1WSDA 3NBQA 5D00A 3D6MA 3HS3A 1ZFNA 3ND5A 4WXHA 2I2FA 2IZ5A 2MINA 3B8EA 1S2MA 2P68A 3OP1A 3QV1A 4GPD1 2P67A 4IPTA 2I34A 4H3SA 4LDZA 4WKNA 3TWOA 2D1QA 3CWCA 1P62B 2RGBA 3MTJA 3RHFA 4D3XA 5G53C 3A3NA 2UZIR 1Z16A 5CA1A 1JSRA 1VSQA 4YXFA 4LJ8A 1E6KA 1CFJA 1X1RA 4I55F 1NI5A 1TJPB 4NHOA 4P54A 4P1ZA 1DDGA 4J3NA 4DUYB 2AMJA 1U6KA 2R79A 3BX1A 2GEBA 2O0HA 2W2LD 2OHFA 4M1OA 2Z6AA 2ATIA 3ISJA 2JCVA 1GGMA 1PLJA 5KOJA 5C8VA 3GA0A 4FE3A 3CF6R 5I51A 1E4VA 2H0AA 3DV0A 2C5GA 1KRHA 5K51A 4S0ZA 3PXAA 4GX0A 4GD3Q 2LGJA 4TROA 1X1AA 2IXTA 4O2LA 3IT3A 3RKRA 3ZUGA 3QE9Y 4W5HA 1CY1A 3BC1A 4L72A 3CZAA 4OAQA 2ODQA 5ECWA 3VR6A 5HS6A 2GM4A 1JEYA 1K9SA 1RI2A 2IPAB 2NZVG 1G17A 3L77A 1M7HA 3K9LA 4MITA 1M2VB 1UPFA 1CP2A 2AIRA 1VZ2A 3H6HA 2BZSA 2W90A 3IAHA 4QYTA 2XBUA 4B7AA 5I4IA 1SEVA 3NAZA 5JANA 4P3OA 1SXJD 3A4LA 2PIAA 4TTPA 4AY6A 3TBHA 1ICIA 1PUJA 1ZS9A 2LZ0A 1PFKA 3TLAA 2HCJB 3W2FA 4N7RA 3W5JA 1RKXA 4DMKA 5JC8A 5BVHB 1O95D 3I9FA 1WXEA 4LY0A 4M55A 4ZEVA 3WIOA 3LPCA 3OM1A 3CINA 3FCUB 2Q1SA 1XLTC 5FD8A 3MXOA 3PT5A 2Q3FA 3K0AB 4XFJA 1GUBA 2ZXEA 4AS3A 1Y9ZA 1QQAA 2NO6A 4MQ5A 5EIBC 2GPTA 3R3UA 1CDOA 2XOEA 3OUZA 3ZE2B 2PGLA 2WIGA 4PFQA 3UJPA 5K8LA 2AOWA 5M7EA 2B78A 2XCSB 2W8BB 4Q82A 4CUJA 3EUWA 3FYDA 1A69A 3TLMA 2P2SA 5MDHA 3QXGA 2QMOA 4XGNA 5H9WA 5HTOA 2VQEB 1O58A 2JGDB 2X0JA 1T9DA 2VUHB 3AK4A 4GICA 2ROQA 4MINA 4FCCA 3CW8X 3ANTA 2G07A 1QHHA 2ZI9A 1SHJA 4LJ6A 4Z6KA 1P5JA 2AOUB 3KL2A 2ZU0C 1Q7EA 2GPBA 1N1DA 3BXHA 3FZYA 1FYDA 3VZBA 4WTOA 4X95A 2YIMA 4YDSA 1L5GB 2V03A 4HGNA 4H31A 4W7SA 4CQLB 4R8VA 3MYRA 3QLJA 4DIDA 1GUYA 1UJ4A 4HFMA 2QK4A 2Z3ZA 4O4JF 3B6IA 2M6LA 2NTVA 2PEZA 2HIMA 2ST1A 3A2LA 1Q95A 4B3GA 1O9GA 2PD6A 2RIRA 2GILA 1HG1A 3K05A 2I6FA 3MT8A 2GVZC 1KNXA 4O4LF 4MWCA 3B5EA 1PUIA 4M76B 5B5SA 3T4UA 4NCJA 1E3MA 3PUKA 4IGFA 4WQMA 1MIOA 1CR1A 3U80A 2Y0DA 5JEDA 2IS4A 2OCXA 1Z6QA 2OUIA 2DKNA 1CY7A 4JJGA 1XQ1A 2YTZA 3ZD9A 4CLOA 4Y9RA 1F0PA 3OQIA 5TVGA 4C05A 1OIVA 1S4QA 1GZVA 4XVCA 5EC8A 5K0SA 1SQFA 3AFGA 3IBFA 5DNVA 4CPDA 2Y76A 1UDCA 1Y8AA 5CD1A 3UCEA 1KZ6A 5E6RA 4XIJA 2VJKA 2XRYA 2VZ8A 4X64B 4I50A 4BQOA 2XWJI 1HE1C 1KZ1A 3NTVA 1WVIA 4AMBA 1SU6A 3BCUA 5I7UA 4N48A 1DC5A 2HA7A 4HQRA 4OGGA 5EP2A 4PGFA 3DMDA 3C41J 5IT5A 3I9V6 1CUBA 3AF4A 4F1JA 1ZSYA 2CD9A 3ZWWA 3T12A 2VBIA 4EA7A 4GKKB 1A8QA 5AVJA 3TAXA 3QJYA 2ATCA 4YS6A 3VAYA 1T13A 1C1DA 1KDOA 4NJMB 3V9PA 1I8TA 1KIFA 1XDWA 3OCYA 3HL0A 4PF1A 3ZZ0A 4L16A 4N0MA 5KYNA 4TXJA 4RGYA 2NNLD 4C7OA 1CYDA 3NORA 1Y7IA 2GAOA 1BXRA 2WA2A 2HNKA 1L7NA 4PYIA 5GPBA 1I4OA 1E9SA 1ZGJA 4JJIA 4TV8B 5DOVA 1U0FA 2BFCB 4DPLA 1J2RA 4UOEA 1MFPA 3IE2A 2ZI4A 1ML3A 2CUNA 3CU5A 3FTPA 4IHQA 4UULA 4DRXA 1RHJA 1ZHOA 2J0QA 1DKUA 2IDKA 1NRJB 3FFAA 4V0SA 4YCJA 4QDOA 2HKIA 5CUQA 3GLGE 3DMYA 3JAWB 1V11B 1Z29A 2GYYA 2Z9CA 4NULA 2VWPA 1CQWA 4O02B 5A9SB 1TDJA 4BATA 3DLHA 4KNYA 1NKTA 1QB7A 3AI3A 3LDFA 1OFHA 2J3LA 4UNSA 4Z9XA 5BNFA 1OLOA 1ZD3A 1JN0A 3H2HA 4DHWA 5LQAA 2C7RA 2ORVA 5DHSA 1Z3CA 2CHGA 1R5BA 1NUQA 3OZVA 4CDGA 3NBZC 1XZIA 1OFUA 1RWBA 2ZBEA 4MRRA 1GPWB 2ODEA 2QMYA 1KOFA 1WJGA 3TINA 3FNBA 3JTMA 5J47A 1R6AA 1T5OA 3DFKA 2YVQA 4JJFA 3W3AH 1TMOA 5ALLA 2ZJ4A 2YY6A 1Y1RA 3LRXA 1JXQA 2L19A 3BGSA 3D1LA 3EDRA 3PQEA 4IV8A 1PI3A 2EHJA 2FWRA 2IEIA 2Q50A 4J0QA 5IEBA 4UNRA 3ROXA 2CJWB 3ZS9A 4F97A 3QFCA 4TTVA 4ZI5A 3C0KA 3F97A 1GY8A 4K8OA 4JP5A 5EWLA 4B71A 4CF6A 4HFRA 4GPAA 1YJBA 3MBOA 3RUHA 3LDAA 1W94A 5TV2A 1L2TA 4P7GA 4M7OA 3LUGA 3W9SA 3T3IA 3BA1A 3A3YA 4ZZ2A 2JCYA 3VSDA 3SIWA 3I30X 2NWQA 1DWPA 2IE8A 2NN3C 2NSDA 4IG9A 3IT2A 3I0MA 4HUJA 4RK7A 1QQ6A 1JSXA 1JJVA 1GNRA 2BM0A 4LZWA 5AXBA 4EVQA 5DBFA 5KYKA 4HNUA 2DBZA 5JXGA 1KQOA 1UFRA 1X39A 1TMKA 2FDCA 4I5FA 1OYYA 4DR5B 1MBZA 3NYWA 1GVNB 1DE0A 1WMDA 2Q6TA 2R8EA 4Y1RA 3SEZA 4WK0B 4XQ0A 2Q5QA 3E3NA 1FX0B 3P0HA 4TUYB 3INRA 1Q7RA 2XJ9A 3Q9SA 2HX1A 3KR9A 2QN2A 2EERA 1K75A 3INNA 4TMTA 3ZCUA 1I51A 4Q1DA 4FHFA 2AEFA 4H7FA 4TMYA 4EWLA 1OBHA 4NE2A 3ZY4A 3ETDA 2DUNA 2PMCA 3MB5A 4AJPA 4BMOB 1Z68A 2APJA 3DOOA 5FNVF 3BL6A 3E0XA 1LPBB 2EG9A 4H1HA 2WG1A 1N9GB 2NACA 3A1EA 3NKFA 1YOVA 4LPKA 4BNWA 3RVRA 1MR3F 3IB6A 1RWOA 2JIQA 1P7VA 4QFCA 3MLAA 4EG7A 1WKCA 1TM2A 3PTZA 4FR5A 5HIIA 2RK4A 1CZUA 4OLBA 3L82B 5HEKA 1WBJB 2AFIB 1U1CA 4LQ4A 1U3UA 2ZYHA 3NHUA 4BMZA 3FMVA 1Z5PA 2OKGA 3TR6A 4D0RA 3I92A 5I7FA 3EH2A 3FOFC 2WJIA 2K87A 1P2SA 2RGRA 1WD7A 2YWDA 4J3JA 1SH7A 2CXUA 2FVXA 2GDJA 2ZBFA 3OCCA 2G76A 3G1WA 1EP9A 3O38A 1M7GA 4LOLA 1UK8A 1QIIA 2QQ5A 3DEJA 3B9QA 5D51S 1YGPA 1QO0A 1VBKA 4IEIA 1XZQA 3F90A 1DAKA 1W0KA 4M1QA 4XB1A 4DPKA 2IBTA 4P4SB 5JVDA 4R3NA 4B6RA 2I80A 2R8BA 3GFGA 5KNDD 1CS0B 4TT3D 1RQ7A 4OXQA 2GWRA 2FR8C 3EG9B 1NRWA 2C1XA 3DNPA 4V0QA 3KVYA 2JEYA 2IK8A 2WZCA 1I2DA 1UJBA 3NZEA 2DHEA 4D0NA 4LJAA 2Y68A 3IEUA 3DTTA 5I6DA 4UXHA 3EC1A 3AUTA 1P2GA 5E9JA 3UWMA 1CY2A 2HNBA 3OOYA 3RFTA 3OCJA 4J0EA 1XZ8A 2VSNA 5AI4A 4R0VA 1N6PA 4G5XA 1YS7A 5CCEA 2CHFA 3KB8A 3WLAA 3HBAA 1MO3A 3JR7A 3DE7X 4J29A 4LGVA 4GF5A 2ZB3A 4QDKA 3NEYA 1GSOA 4TKUB 1QONA 4ACBA 2R7AA 3UJHA 3F6RA 3C3BA 4LC1A 2A9KA 3WB9A 1IQUA 5H70A 1EESA 2VSQA 1Z35A 4W5OA 1H4QA 3IX7A 1IVNA 3IKLA 3NAMA 2QG4A 4P4LA 5SYNA 5BRJA 5CIQA 2Z1DA 4D8UA 2FRDA 3E4CA 821PA 1N5KA 1KMNA 3S1LA 4Q7MB 3O4JA 4DJTA 1D09A 2FUEA 2QR5A 4BJ3A 1EZ1A 4E2FA 1D9XA 3KT8A 1HPLA 3GJXC 1QCDA 5D85A 3BRCA 4DJFC 1YQGA 1R0ZA 4CKWA 1E18A 1GQFA 1IONA 2I76A 3CT4A 3GQBA 3GUVA 2V9ZA 3VR4A 4FR2A 3WWDA 2ODTX 3HVKA 2CB9A 2J3JA 2P78A 2QUBA 2VJNA 4AO6A 5HM8A 3N0TA 3MRSA 1AMUA 1ORTA 4JYMA 3IRUA 4OXIA 3RREA 4I6EA 1JG6A 1UBNA 1Y81A 2QL9A 1H2BA 3SE0A 4F12A 2XWPA 2IZ1A 4R05A 3INYA 2AXEA 1PDWA 4E5MA 1KJNA 1V9LA 5FA6A 3OOSA 2JZCA 1JHZA 2W2PA 3HWX1 3SJBA 2JIRA 3DLCA 3QHPA 4LC9A 4XUCA 2ZS7A 5JCXA 1V8DA 3TFOA 2B8TA 1RE0A 2W8ZA 4JWKA 4II2A 3SLGA 2ZWVA 1Z0DA 2YS7A 1OI4A 2ONKA 1DAEA 3G2MA 1YJ8A 2YIJA 1RRGA 2Q29A 3F78A 2IFTA 3AY6A 3KXIA 1BFDA 1DT3A 2G4LA 2W4IA 4RHTA 5DXFA 4BIIA 2NO5A 3KYIB 1TM1E 2H1FA 3P0EA 5GINE 4JEHA 2Q2OA 1PYDA 1W19A 4Q9DA 3G17A 2FHSA 3DB1A 4O5AA 4BKMA 2R0QC 3W78A 3Q9LA 1FFHA 3CVOA 3FGNA 2OCBA 3KPYA 1QBKC 3PQ2A 4IIGA 5DN9A 3IV9A 3RYHA 2R87A 1S3GA 2IU0A 4GOOD 4LKRA 4YUYA 6LDHA 3HKEA 4E14A 4IXNA 4OIMA 4MQEB 2P1ZA 3ZKWA 4QTYA 1JWAB 1M2FA 1RPZA 3OTOB 1QFXA 3W1EA 2AEEA 3A2KA 3UV7A 2PMKA 3IQXA 1XU9A 3VR5A 4FLMA 1Y9JA 3AF3A 3BTOA 3QBJA 4MKRA 5HMLA 2QV7A 2BGWA 2LTAA 1BXKA 2BONA 2JFOA 1EVZA 3WWPA 4BJ6A 5J43A 5JI3E 4I9UA 3FPFA 4UDYX 3DLAA 2YJ5A 1W35A 3OQPA 1XL1A 2HMWA 3TGPA 1V5FA 5FF9A 3ZVRA 3ZWKA 2LV8A 1KOLA 1U8FO 3AR6A 4XW2A 4X24A 3W8FA 6GPBA 1EGAA 1T6BY 2OV8A 3FVTA 3N2ZB 3HWRA 4FGZA 4J4HA 5F76A 3Q0TA 5K3FA 1I7NA 1S8FA 1SC6A 2FMFA 4J0HA 4LOJA 4QQ8A 4Y0NA 3DS8A 2Y93A 3H5LA 3DEHA 4X6XA 4PXSA 3N2LA 3HB1A 1Z3IX 1P7WA 4BMYA 4M49A 1ESEA 1IZZA 3G2NA 5CHYA 1W4LA 1ISJA 2WSSA 3KYCB 2RAUA 5EJ9A 1J6UA 4YUWA 4LJKA 5AQ1A 1GV1A 1E2LA 1U4OA 5EXSA 3LCUA 1FFWA 4HQFA 1C14A 5E2IA 5TEWA 3TFQA 4E5SA 5BYBA 2MSDB 3PC4A 1IIRA 1MC4A 1NPYA 3QVVA 1RXYA 4D43A 3A4MA 1I4LD 4LZLA 1Z39A 2JANA 2I6QA 3FCXA 4GOLD 3HL4A 1TVEA 4PX5A 3W5AA 1ML4A 1SCBA 3QJ5A 5JCPA 4D25A 1ID8A 4YXWA 4JP2A 5JMPA 3ZNNA 4ITUA 5L3QA 2AD1A 5BSRA 2OC9A 1SBIA 1V9SA 4BRZA 5L9AA 2YX1A 5DGDA