2IC5A

Crystal structure of human rac3 grown in the presence of gpp(nh)p.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
177
Chain Sequence
SMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-related C3 botulinum toxin substrate 3
publication title Crystal structure of human RAC3 grown in the presence of Gpp(NH)p.
rcsb
source organism Homo sapiens
total genus 61
structure length 177
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ic5A00
4Y0VA 2OO7A 4I81A 1AGPA 1ZBDA 1WP9A 3F3YA 2WZQA 1KAOA 1OJLA 2IC5A 1DAKA 4YC7A 1J70A 4TMXA 5BQ5A 4DC9A 5JS7A 1NI3A 4DDWA 1LS1A 2CXXA 3VNVA 2AL7A 3QBTA 4PC6A 4TSFD 5EZ6B 4C4PA 4JIMA 1F60A 2GWHA 2QPAA 4OK3A 2GBLC 4JL5A 5FUVA 4RY2A 3T06B 1KDOA 4A6PA 3GJ4A 2VSFA 4P4SB 4DZZA 4V02A 3IPXA 2XSZA 3PG5A 1TX4B 4I1VA 5KO2A 2CL0X 4TT3D 4EQ6A 4MRVA 5JWOA 4C2UA 1ESMA 1YJ5A 1VYTA 4B2IA 4LJAA 1FPMA 4AKHA 2AR7A 3MD0A 3UK6A 4E03A 2GXAA 4B34A 1G7CA 1JAIA 3CRQA 4AC9A 3DKPA 1KZ7B 1IJFA 2A5YB 2UVQA 3IO3A 1TU3A 3QVUA 3TJZA 5JZVA 1N2CE 5CDFA 3CZQA 4BZQA 4EFMA 2YZ2A 4M21A 3U61B 2JAQA 5GVRA 3N70A 1NL3A 3SYKA 221PA 4Q47A 1TU4A 3VKGA 1XJCA 4DCUA 4PQYA 1NG1A 3IUYA 5FUYA 3AKYA 3EG5A 2YJTD 5AK0A 5FBRB 3BD9A 2Q3HA 3RHFA 3WY9A 1KI9A 2GNOA 4NCKA 1JR3A 2R44A 2FZ4A 1E94E 2B7CA 4LBYA 2R6CA 1FOEB 1U98A 2GCOA 1DAFA 3EIQA 2VBCA 3HDTA 4M1MA 2NO1A 4LOAA 4QM6A 4OI4A 1XEWX 1OV4A 4OQLA 3U7EB 1BS1A 1TEVA 1AZTA 4FMDF 1YZTA 5L3VA 2XEXA 4Y0AA 4TLEA 4B3GA 1T9HA 4PPNA 3X1DA 5EUMA 1SKYB 3IBYA 1DAGA 1FTSA 2V1XA 3PUYA 3NHAA 4NCIA 1KO8A 5E7MA 4KBFA 2VP2A 4WZBE 3GQBA 5JCPA 4TYPA 1C1YA 3FKQA 3D8BA 3S1AA 4A0GA 1CR0A 2VP5A 2XOKD 2Q6TA 1Q0UA 4CEHA 3K9NA 4LHWA 1FW6A 1MABA 1NMYA 2PH1A 2VH5R 3NC0C 3SBEA 1SVLA 3UWKA 4JLNA 3ZVRA 2CHGA 2J46A 2IS2A 1IN7A 3T1QA 1E2IA 2NPIA 4DB2A 3KXLA 3OAAD 4URZR 4C0HA 1GTVA 3IHWA 1DAHA 1R8SA 3HR8A 5J4YA 2HT1A 3TSZA 3EZ2A 5GADl 4TTPA 2P3SA 1KOFA 1PJRA 4W5WA 5H8WA 2WKPA 5IK2A 4DSUA 5FI1B 4KVAA 1XPOA 1VCIA 3B85A 3FMIA 2ZJAA 2CLDX 3A1TA 3O47A 4QBFA 3CO5A 1PV4A 1WCV1 2D2FA 2YVUA 1LF5A 3C5CA 1HA3A 1EK0A 2QQEA 3GLHE 2FG5A 3I32A 2HJGA 2F6RA 3F8TA 4DCTA 2GESA 5A5GA 1XTRA 4CEJA 2N46A 1RW4A 1UBEA 2FPMA 2ZQ5A 4AG5A 4JLPA 2GJKA 4V0OA 2Z4RA 4M8NE 2I4IA 1F2TB 3KQNA 2QL6A 2Z4SA 4FCTA 5EP2A 2PZGA 3TW4A 2WKRA 1II0A 3QI2A 1SXJA 1G8GA 4Q03A 1VDZA 2GF9A 4ACAA 2AN9A 3K70C 1YKSA 1JJVA 3CH5A 4LJ4A 1GNRA 5JJLA 1XDBA 2NTYC 4HB3A 4O3MA 3I5YA 1E79D 1KY2A 4NYJQ 4FWIB 4AG6A 5B2ZA 4W9MC 3GEEA 5CYOA 2ZE5A 2GXUA 4QKQA 1CF4A 1YZLA 1Q1ZA 5G41A 3SDZA 4JBYA 3ZIAA 1G7RA 2AWOA 1XPRA 4Q9JA 3AF0A 2XXAA 2V54A 1KJZA 1KNQA 2D62A 3IDQA 2V9PA 1OF1A 4LRWA 3EWAA 1NSFA 4JBXA 3OE7D 2WWHA 2V1UA 4QGGA 1AGRA 2GXQA 1G18A 1W0KA 2E1RA 3SJAA 2ZE7A 4F92B 2GDJA 2CJWA 4WXPA 5JEEA 3ZZTA 4BPBA 4HAWA 4V0MA 3TQFA 3BFKA 1ZUHA 2WAYA 4LJ9A 2GJAA 1XMIA 2BKEA 5FBWB 3VTKA 1UEIA 4LX0A 2ZI3A 1XMJA 3C8UA 3QPVA 2ORVA 1L8QA 3EZ6A 3FVQA 1X3SA 4GT1A 4PSVA 4TMZA 4WXRA 5CM9C 5CB6A 1W7AA 4OJQA 4H9GA 3UG6A 2XAUA 3WYAA 3THXB 5LDDC 1KMHA 1M2OB 2FGJA 4ON9A 4QG7A 4MRNA 2O8BA 3SE0A 2BMDA 2J0UB 4Q7KA 121PA 1G17A 3EPKA 3LVRE 1XZQA 1YR6A 2ZRPA 1QRAA 1BMFA 2ZI4A 1T5LA 1FUKA 2J7PD 3W3ZB 3T1OA 3I1FA 2IYUA 1I4DD 2PEZA 1OIXA 3UG7A 3GCGA 2B8WA 5L8VA 4PC7A 2ZYTX 2DYKA 2QMHA 2J41A 3K09A 3THYA 4PHGA 1US8A 1U9IC 3T1TA 1QHYA 1OH6A 1FX0A 4OK5A 4ASUA 5JI3E 3Q72A 1J8MF 2OCBA 5SZJA 3SQWA 3AUXA 1G8HA 3GJXC 1U0JA 4X8LA 2ZR0A 4HLUA 2GK7A 3RANA 1QHHA 5GJVC 2VA8A 3TE6A 1YR8A 2IX3A 2A5FA 1ZM4A 1LF0A 3AKEA 2OLKA 3JZMA 1KTVA 3SZRA 2IUUA 1Z6XA 4OHZA 2CNWA 2P5SA 2GCPA 1U90A 4A0FA 2BM1A 4NL4H 2EWVA 3KX2A 4WAUA 3BS4A 3BOSA 4OHYA 1XXHB 1DG3A 3IBGA 3E70C 5KNCA 1U81A 4QXAA 1NJFA 2VTKA 2ZUBA 3QF7A 3VHLB 4F4CA 1CEEA 3RRZA 5KUTA 1G21E 2OT3B 1HT2E 2VEDA 3PUZA 4Q7LA 2JLZA 3IQWA 1F2UA 1G3MA 4P4TA 2J59A 3NBFA 3Q5EA 1GM5A 5G3ZA 2JASA 1NMZA 2VHUA 1VCNA 3Q85A 3HWSA 1WBBA 3NEYA 3AQ4A 1D9XA 1AKYA 1KZGB 1S3SA 1VG9B 3RS5A 4AYWA 4Z8XA 2QI9C 2XX3A 4IVPA 4D81A 1QBKC 4C7OB 2OFOA 1NKTA 3L0OA 3HU1A 3ND8A 4N1AA 5JECA 5FI0B 3ZZ0A 1QF9A 2IXGA 2AD1A 4OI0A 3P4XA 3G5UA 4KVGA 2RGDA 3H2YA 4ZIRA 2X2FA 4GRAA 1G1MA 3AVPA 3VR1A 4G5SA 1YR7A 3X1WA 4UNRA 2IYSA 2NG1A 2IF2A 4B6FA 1Q3TA 721PA 4KSCA 1G20E 4DHEA 2ZAMA 3BB1A 3B1ZA 3A58B 1U8AA 4TMVA 1OKKD 4HUTA 1Z2AA 2GA8A 5BN5A 2RGNC 2XTZA 3DM9B 1VIYA 3OIUA 4HB4A 3TVTA 3U44A 2ONJA 1AJEA 3IIKA 2YC2C 4NP6A 1R7RA 4JLMA 1PVOA 1QHSA 1S4QA 1HURA 1YZNA 2XTMA 4E07A 1CU1A 1HQCA 1JEDA 4TMKA 5B58C 2G1KA 1FFHA 3MMPA 1ZYUA 4JLDA 4HZIA 1Z8FA 4US2R 2ZITA 4JL8A 2P6UA 2O8EA 3GLHA 5JSZA 2R62A 3ZQ6A 1I2MA 2O8DA 3L0IB 2PT7A 2ZPTX 5DI9A 4OQFA 1U94A 4Q9IA 1T8UA 3AP2A 3GJ7A 4TLCA 3PXGA 1M7GA 1PUJA 5H70A 4LHZA 3D3QA 2H8KA 1GNPA 2C9YA 1FMLA 3FB4A 3CR7A 2CCJA 3ASZA 1NVVR 2H16A 1EG7A 3RVBA 4JLBA 4TN1A 1J8YF 4G3XA 4RZ3A 1ZVQA 3LW8A 4NE2A 2QNRA 3R9WA 2G9NA 2IBMA 1XD9A 2QM8A 1OLOA 2QU8A 3OF5A 1UDXA 2EFGA 4FIDA 3RSLA 3BH7A 4PQFA 2R65A 3EPHA 2OAQ1 4BRWA 2JJ1A 1HUQA 1IN8A 5AUQA 3OESA 4NMMA 1ZP6A 3KJIA 1P2TA 4L9WA 1E0KA 1PZNA 3NC1C 4KITB 2F1HA 2OBNA 4RFVA 1NJGA 4C30A 2V55B 2ODEA 3SJZA 3WMFA 1KI6B 3A1WA 4HAUA 1LFDB 1G5TA 2VSXA 1SKQA 2CCKA 1OFHA 2RCNA 4MYTA 4RVCA 4Q9LA 3TUZC 3PFIA 4MDFA 4EDHA 3V4RA 3LDAA 1Y3AA 2ZYVX 1W47A 1XPUA 3SHFA 2V6JA 2ZM5A 2ZVQX 4Q4JA 4ZO4A 5KDDA 1G8YA 4IEIA 1E9DA 5C18A 2ZJOA 1KDPA 2KJQA 1R8QA 2FFQA 1RRGA 1UKYA 2BMEA 5FR1A 5FPYA 5L3RA 2DFLA 4EFNA 4MGZR 3TRFA 1S0UA 5A0FA 4QL3A 3UMRA 2Q3MA 3ADCA 2JLSA 4EPXA 3CW2A 2PLFA 1QZXA 5DE3A 2FE4A 1Z28A 2XNDD 4NZYA 1EWQA 1P2VA 2BVNA 1EFHA 2BV3A 2C9CA 4BE7B 2HF8A 2HYDA 4XWAA 1NP6A 4TMTA 1T4GA 3TSWA 4FMDB 1WMSA 4GDFA 1XTQA 3KL4A 4GSYA 3QKRB 3CRMA 1W5TA 1OHHA 4NTZA 3SC3A 4CIDA 3K0CC 4D0LB 4KV9A 3TUJC 1IQPA 4DCSA 2PZEA 2WSSD 2ZI5A 5AJYA 1D2MA 1YZGA 5EXTA 4CEIB 1D2EA 2OFXA 3TH5A 3QXHA 3TNFA 1RE0A 3RRNA 2JA1A 1ZNXA 1Q1EA 3CPJB 3KB1A 2JDIA 3PUWA 2F43B 1IN4A 1N6HA 3KJGA 1EWRA 3X2SA 1OXSC 2EQBA 5CM8B 1OH8A 4B3CA 2MSCB 3IEUA 2J3EA 3DMNA 2VQSA 2CBZA 2QEQA 4B6EA 1YZUA 4TLAA 4V03A 2PBRA 1VIAA 3RAPR 3I61A 4JYBA 2P6RA 4CF7A 5KOYA 2WMNB 1FMJA 2OXCA 5IF9A 3MUFA 4LC0A 2W83A 2P2LA 2W6IA 3E1SA 5E4FA 2AX4A 2HUPA 2HYIC 1GFIA 3QJYA 5D3QA 3SN6A 4HUQB 2OAP1 2ZI9A 3P4YA 1P2UA 2QE7D 2HJVA 4BFVA 3LRPA 1N5LA 1SHZA 2PJZA 4Q4LA 1G41A 1MO4A 2IXFA 4HLCA 1JNYA 2FZLA 3A1SA 1OH7A 4Q7JB 2WIAA 4OK6A 1JPJA 3VR6A 4AKEA 1CIPA 1GUAA 3KUCA 1DO2A 4O25A 1MO5A 2ERXA 4ACBA 4D4KA 5J4HA 1DO0A 1GKIA 2WMOB 1E6CA 3G82C 3SJBA 4M9XA 3CUEF 3QEJA 2A30A 4OI1A 1AZSC 3QIAA 1OW3B 1OXVA 3WYGA 5C46F 2GF0A 4ZDKA 4B71A 2O8FA 2G3YA 2VO1A 2QA5A 2KBEA 4EQ6B 1D6JA 3WBJA 2ZRFA 1I2DA 4P0TA 3KXIA 2ZRKA 4Q5IA 3G0HA 3QKSB 1CRQA 3L8YA 4EIWA 1KKLA 2A9KA 1Q3HA 4NH0A 5AR1A 4I1SA 1BH2A 1YRAA 1GAJA 2JCSA 3FWYA 1G7TA 2O0KA 2XNSA 2F1RA 4KFUA 5HPYB 4N0EA 1ZJ6A 3CM0A 4JBWA 3T5DA 1P75A 1RJ9A 2WJHA 4L8GA 4Z1MD 1E2MA 1KO5A 3LBIA 3QKTA 2GEUA 1NNEA 3A8TA 1A5TA 4LYAA 1NN5A 4Q9KA 4KFRA 1N6OA 4PAQA 2BMFA 4IW3B 4TTQA 5CLLA 2QGZA 2ZEJA 3ZYCA 2OEPA 1WXQA 1T5IA 1FL9A 2R9VA 4XD7D 2GRJA 1NRJB 1KJWA 1OYWA 2F9MA 5SZIA 1GRQA 3GJ8A 3VR3A 1M7HA 3PEUA 1XTSA 4NDZA 1E1QA 5FR2A 4LYHA 3REFA 1E0AA 4LUCA 5IDVA 2Q9AA 5FTLA 1Z0AA 2ZUDA 4TWZA 3QKUA 3WMGA 1E9RA 4YMTA 4Q19A 1XCPA 421PA 3LY5A 4F93B 2GEDA 4Q1BA 1SGWA 3CPHA 4KU4A 4QGFA 3FOZA 1R6BX 2DHRA 3RS4A 4KSBA 4LJYA 4JLKA 1OXUA 2XZLA 4DEXA 3ZD6A 1G6HA 4L15A 3P20A 4QHYA 3H0KA 1MABB 3OIYA 1Z0JA 3N2EA 4JT4A 3R9XA 2XGJA 3ND9A 1NLYA 1WDTA 2RGBA 3ECCA 4YXWA 1A1VA 2FN4A 4UJ3A 2HLDA 1YR9A 3AF3A 3VQTA 3DVLA 3R9IA 5LBIA 3KJHA 4F91B 3EIHA 3KQHA 1EFUA 4XJXA 2W2TA 4S35A 5F98A 2X8AA 2ERYA 1U8ZA 2ZSBA 3PEYA 3UWOA 1Z06A 2DWOA 2ZRHA 4DLYA 4PC1A 1E4VA 4DRZA 1W36B 2OUKA 1ZMXA 2YWEA 2BEKA 4JSTA 1E2DA 2D74A 3OFNA 2PX0A 4A4DA 4EPTA 2RGAA 1UFQA 1J2JA 5KTYA 1Z08A 3DOEA 4V0ME 3LX8A 3ZDQA 2FU5C 2HV8A 4CEJB 4Q1FA 3MWLA 4BFUA 5KSZA 3NBZC 2D7DA 5JRZA 5JFGA 1EESA 2VHQA 2R6GA 3AP1A 2QN6A 3LLUA 2ZXUA 1N0WA 2OBMA 3C5HA 5FOTA 4M1KA 5EE0A 2F3TA 1PLJA 4PAOA 3SQXA 3K0SA 1OIVA 2JJ2A 4MKFA 2IXEA 1EFRA 4PTLA 3ZD7A 1E9SA 1Z0KA 2R6DA 2CL6X 3OIWA 3KDSE 3VFDA 4O0MA 4PC3A 4PR0A 3VX3A 4IEEA 3UXMA 3CX8A 5AUNB 2KWIA 4MYCA 3EX7C 3DL0A 4OQNA 4LBZA 4UNPA 2ZSFA 4XVRA 5CIQA 3UANA 4UQOA 2ZSAA 2PL3A 2GHIA 3CNNA 4BQSA 4QNMA 2ZYWX 1N6PA 3PJRA 4DDUA 2B7BA 1TTTA 1SKYE 3ZQJA 2VP0A 4US1R 4RKFA 4W5JA 1GRRA 3MAAC 4P33A 2CMKA 5DN6A 2XXAB 4EPVA 1KK0A 2ZR7A 3L0PA 5ELXA 5E95A 5BYJA 4ESHA 1ZUIA 2WWIA 1A2BA 1OT3A 3F5FA 2GEVA 5M04A 4UNNA 1BYUA 1MR3F 1EXMA 3TQCA 2UZIR 2ZANA 2YV5A 1IY1A 1JR3D 1S1CA 2CJWB 4JJZA 2IS1A 3RRYA 3WP1B 1N5IA 2C9OA 2B8TA 5FBQB 3I3SR 4GMXA 5DO9A 3QPUA 1T6NA 3NH9A 3K9LA 3LWNA 3DZDA 3AVTA 3P26A 2QAGA 1Z3IX 2ATXA 2YOFA 2C78A 2FV8A 1MKYA 4DLUA 2PJRA 3MLEA 1AS2A 1S9HA 4DUGA 8OHMA 5CITA 4NONA 2KI5A 4E22A 4JJKA 2J1LA 2P65A 4IKEA 3QG1A 2O8BB 4AYTA 4U5XA 1K5GA 2H1LA 1JB1A 5CLQA 4I99A 3AVVA 4HLQB 2AKYA 2ANCA 2OZEA 2UKDA 5UKDA 5AUOB 2IYXA 1XFAA 1GWNA 4PHHA 1L4YA 5JBQA 4U7DA 4UJ5A 3THYB 4IDPA 4I1UA 3A1VA 4O2RA 1OB2A 1XNJA 4RD2A 1XZPA 3D7MA 1NN0A 2H17A 1J99A 1UJ2A 1ZW6A 1CJMA 1TL7C 4NYIQ 2YWHA 1CR1A 5FPSA 1A4RA 2CE7A 3HYTA 4E09A 4AKGA 4M2LA 2EVWX 3L82B 1RC8A 2RMKA 1QHHB 1M34E 4PO1A 1W36D 3IIJA 2J45A 2VYFA 4M1WA 2WKQA 1FP7A 4FW9A 2BBWA 1PLLA 2ZRGA 1XP8A 3GFOA 2GAOA 1FTNA 2RHMA 2P0EA 1FZQA 2C5LA 1II8A 1GKYA 4POAA 1G5RA 4B76A 5EXPA 3ASYA 1G8FA 2OFWA 2PEYA 2QRZA 5CK5A 5DYGA 2FSHA 4ZI3A 1X8JA 2X1VA 4L9SA 1XBTA 5C4GB 2C95A 5KSYA 3OAAA 3TLXA 5JWRA 2KE5A 2F55A 1C9KA 2RGGA 3GJ6A 4KO8A 1K6MA 1XTKA 3QF4A 5EZ5A 2XTNA 3K0FB 4KBGA 2G83A 4C0KA 1OFIA 4CVNA 4UNQA 3GLIE 3F0TA 3AKDA 1RZ3A 2WJYA 1GL6A 1SULA 5KHOC 5DH9A 1B23P 5J4LA 4D4MA 3W3AA 5C1BA 1N3BA 5BXQC 4TYWA 1XEXA 2O8CA 2I3BA 4WVFA 3LV8A 4LHYA 1UKEA 3BJIC 4Q01A 2ZETA 1G3UA 3M6AA 4K46A 1GL7A 1YZKA 2FFHA 1HYQA 1JEEA 3QBVA 3KJEA 4A6XA 4LHXA 1DAMA 4A2WA 2CVFA 5L3QB 3ADDA 1VECA 1XMVA 4ZIRB 2CCGA 4IDHA 3TMKA 5GJBA 4LPKA 4TQAA 2WJGA 3ZIAD 4R98A 3RS0A 3SFZA 1WBDA 2A2ZA 1R0WA 2QY9A 4HYYA 4X8OA 2C2HA 4Q7MB 4ZV4A 1IBRA 4EJSC 4BZPA 4BFZA 3LH5A 4JVSB 5FTNA 4ZCLA 2O52A 2BJWA 4RD6A 1MOZA 1M7BA 1E96A 1DOAA 3PR1A 4DSNA 3CLVA 4P4SA 5FOVA 1NF3A 2WAXA 2W6JD 4GP7A 1X1RA 1AN0A 3MWYW 3OIVA 4HDOB 4MYUA 3IIMA 1E79A 3EA5A 3DDCA 1OFTA 2VIIA 1UPTA 3B82A 3DEFA 4GNKA 1ESNA 4Q48A 2O8EB 1NBME 3GLHB 4AYXA 2FSGA 3RSOA 1G291 3GEIA 4IOJA 5D3MA 5JSZB 4G5OA 2O8DB 3WNCA 4HAZA 3LW7A 4CW7A 5B57C 2BWJA 4OBEA 5HCNA 4IXMA 4ZKEA 4M1YA 2HDNB 2G1JA 2OCYC 2H5EA 4HB0A 5FBLB 5FTJA 3SYLA 6Q21A 1TQ4A 3BK7A 2J5XA 1E9EA 1VG8A 1E2JA 1W0JA 1JQJC 5LD2B 4EUNA 2FMXA 1CP2A 1VYVA 3QY0A 3QXXA 1XD2B 3C4JA 2ZRDA 3KKPA 1E69A 1GIAA 1MRNA 3CWZA 4MQBA 4TQ9A 3TK1A 4A8JC 2ZE6A 2X2EA 3C16C 1XWIA 4LCBA 3UKDA 4URVR 4A36A 1II9A 5JWHA 1C4OA 1N5KA 4JMPA 3SI7A 4PPQA 1DG1G 3SBDA 4BEJA 4ABYA 1ODFA 3QE0A 2W0SA 4GP6A 2H92A 3WP0A 1Q1QA 4B43A 4RFSA 2X77A 5TDHA 2V6IA 1KYIA 4N0DA 3HYRA 3VR2A 1E3MA 1FUUA 3B9PA 4GBMA 4PPFA 3BIFA 2CNWD 5DISB 2DCUA 2IYQA 2FOLA 3QENA 2J7PA 4YMWA 3TKLA 4C0QC 4DDVA 2EWWA 3QUSA 4Q4JB 3U7HB 1E9AA 1T91A 5JJKA 1RPZA 1H8EA 4D0GA 2YOGA 4HSEA 1W2HA 5JHGB 1LNZA 1CR4A 2J0QA 4BZXA 4PQRA 1Z6GA 3B2EA 4WIAA 1MO6A 4MKHA 1R2QA 4NYMQ 1E2KA 4II7A 4PO8A 3BFVA 4NU0A 4TQUS 1LB1B 4LGMA 1Z47A 4D4JA 3CZPA 4Z54A 3MJRA 4MYHA 2Z0MA 3D31A 4LJ7A 4PSKA 3NKVA 2QBYA 3OEHA 1E32A 2G6BA 3GLFE 5KNDA 5E3HA 1DBSA 5FOXA 3HU3A 4JLAA 2GAAA 1BIFA 1Q20A 2ZR9A 4HATA 4QRHA 5EQTA 3THWA 1P9RA 4BUJA 2C96A 4ESVA 1T0HB 3SEAA 3NVAA 2VRWA 4BLRA 1W4CA 4U02A 2A5DA 1DAEA 4NCNA 2NO6A 2GVZC 1X1SA 1ZM2A 1UADA 4DDTA 1SVWA 4TYNA 4R9UC 5TMPA 4ITRC 2DWPA 4YQFA 2OCPA 1D5CA 3VAAA 5GJCA 3PUXA 4IDNA 3B1XA 3DKVA 3K9GA 3IHLA 5TARA 3QVVA 2YWGA 2CL7X 3C41J 1YU9A 3MCAA 4JKYA 4CGZA 2QTVB 1JXOA 3REGA 3ZVNA 4HAYA 1KMQA 2J0VA 2N1BA 4KHZA 3PCRB 4UNSA 4V0NA 3BC1A 4HAVA 2W2VA 3ADKA 1Q22A 5KNBA 2BBTA 1NVUQ 3AM1A 4DJTA 2BC9A 2WOOA 3GLGE 3CF0A 1UDWA 1HY3A 3U2QA 4LY6A 4C0BA 4ARZA 2IT1A 2ZRMA 1QHIA 4PSAA 2FH5B 4Q4AA 1LY1A 2UZ3A 4TLBA 2VF7A 2B6HA 3FHOA 2VSOA 1RRCA 3EIEA 5HKKA 3RWMB 4DXAA 3EZ9A 1QVRA 1KI8A 5HZKA 5BN4A 1ZNWA 1IN6A 1KDTA 4DEYA 5EP3A 4KXFB 5DHFA 2AFHE 4ZKDA 4AI6A 4A0HA 3U60B 1L7VC 1JAHA 2PX3A 1E2FA 3AEZA 2IYYA 3GLIA 3BH0A 1M8PA 3KKNA 4TL9A 5B64A 2V8OA 3LVQE 3VU9B 1G3IA 3WYFA 2WWXA 4BWYA 3X1ZA 4DCVA 1DAIA 1B0UA 3GMTA 1I4LD 3B5JA 3GJ5A 3GP8A 5C2JB 3RC3A 1X86B 3CX6A 2QT1A 1F3OA 3FKSD 3LA6A 2O8FB 2GJ9A 3IGFA 2FPKA 2JJ1D 1Z07A 1M1YE 3PUVA 1ZIPA 2QSZA 3K9HA 1TADA 2OV2A 3FFBA 4OHWA 3B1VA 4W5HA 5FL7D 4AD8A 2BMJA 2ZS9A 2JIZA 1W36C 4ERNA 4KI0A 2PCJA 1KAGA 1W48A 4J0QA 2D2EA 4Q00A 1ZCAA 1VHLA 3W8NA 1L4UA 2CLSA 2J9RA 3X1XA 3PVSA 3IKJA 1ELOA 2ZJYA 2NQ2C 4G1UC 2V7QD 1KGDA 1MV5A 4IOMA 1COWA 4WZ6A 2H57A 3AGPA 2GZDA 4GOJA 3M1IA 1SVKA 3AGQA 3FHTA 3QXJA 4EJSB 1KY3A 2DR3A 4I4LA 2E9SA 2C77A 3GD7A 1NBMA 2ZRJA 821PA 1MH1A 3MWJA 4CZ2A 1ZNYA 3BRWD 1SXJC 2GBLA 2IEYA 3L8ZA 1NMXA 4X8HA 3GPLA 2IL1A 4A2QA 4BLOA 3VX4A 1LVGA 1HTWA 2YYZA 4P4UA 1VCOA 2RGXA 4LSGA 1RFLA 2O5VA 1BO6A 4JKIA 3AP3A 3NH6A 3M4YA 4KYIB 4DIEA 5P21A 1G9XA 3LBNA 3RYTC 2QRNA 1QG2A 4B47A 4B74A 3H84A 1E2QA 2IEZA 3T5GA 1TMKA 3NIBA 5AJXA 5CK4A 1P72A 3SJCA 5K8UA 1AS0A 2RH5A 4DT1A 3AVOA 3GJ0A 4QM7A 5IRCD 4LJ6A 1QDEA 3H86A 5EXSA 5JRJA 2XZOA 5HE9A 3W6NA 2QMOA 1CJVC 3R7WA 1FNNA 1QHXA 5SZKB 5K8IA 3LX5A 4Q9HA 1K8RA 4QBHA 4TZ6A 3SR0A 5TVKA 2MSDB 4L4UA 1S2MA 1KIMA 3Q7QA 1KJYA 4AK9A 2R8RA 2BCGY 2XNDA 4HAXA 5HCIA 2FEMA 1UEJA 3PITA 3TW8B 1WRBA 3EW9A 4JYCA 4BEBA 1KSJA 4WOPA 3U3KA 3DPUA 1N6IA 2J0SA 2NGRA 3EPJA 2QZ4A 4MITA 4A8JB 2ZVPX 2W6ID 1Z0FA 1XD8A 1J7KA 2QPTA 2IWHA 2W0MA 1H8HA 4QJ4A 3JZAA 1NIJA 1VHTA 5LPNA 1SQ5A 4K81B 1S3GA 1AIPA 4QHSA 5GJWC 2EFEB 1GVNB 5L3SA 3IEVA 4GFDA 1W46A 4M9ZA 4AKIA 1S96A 4PANA 4YONB 2YINC 1AM4D 4B3DA 3ZGXA 1ZRHA 4F7WA 2AK2A 2ZS7A 4GL2A 2A5GA 1R0YA 2EW1A 2QENA 3KKMA 2CHVA 5AJVB 1EGAA 2W2XA 3O8BA 4OHVA 4C9BA 2GJSA 1DVRA 3T35A 1I4TD 4TYYA 5TY0A 1P73A 4FINA 3GLFA 1GILA 2VP4A 2QROA 1ZNZA 4ILEA 1AK2A 4JLOA 2IWRA 1XF9A 3K09C 2EFHB 3EC2A 5KSPA 4MKIA 3A36A 1NLZA 2CK3D 3FTQA 2JLXA 3QSYA 3VNUA 4OQMA 3W90A 3I73A 3K8YA 2R6FA 5LB2A 2C99A 3U3OA 1E2LA 3Q5DA 5F9HA 2RGEA 4FCWA 1CXZA 2EYUA 4HLUC 3B1YA 3RABA 3V00A 1KSFX 4TL7A 5CIWA 1RVDA 4Q1EA 3FPAA 1W1WA 1E9FA 1UBFA 1VYUA 2QSYA 1R4AA 3I92A 5BN3A 4LYJA 4EPYA 4C2TA 4TZ0A 1KI4A 4MRSA 1P62B 4B2LA 1YVDA 1Z6AA 4OL0A 2ODNA 4JT2A 4P3YA 5E7IA 2GCNA 2XITA 4A1FA 1T3HA 3GLGA 2ZI6A 1TUIA 5C4MA 2F7SA 4ZDWA 1F48A 5EP4A 3BGWA 1Z22A 1QVAA 3IO5A 2AWNA 4C3ZA 5AWFC 1S8FA 3E5HA 1G19A 1ZD8A 3BORA 2WBLC 1Q57A 3CRRA 3KZ1E 1OE0A 3QOFA 2ZU6A 3ZVMA 2JJ8A 2OBLA 1P9NA 1ZUNB 4L16A 3RS7A 3FFAA 3AH8A 2FEOA 4M9SA 1ANKA 4OHXA 1U99A 3OEEA 3Q8XB 621PA 3CF6R 3B60A 2GCOB 4D4LA 5AUPB 1E1QD 2QAGB 4R7ZA 1JECA 1SVOA 4MRPA 2A3RA 4G5QA 1ZD1A 1GITA 4Q1DA 4HB2A 4M1SA 1KO7A 3W5IA 2AK3A 3ZS9A 1E2NA 4R2HA 2WOJA 1V43A 4A2PA 2ATVA 2REXB 4RZ2A 2GETA 3KTAA 1R0ZA 5J4KA 1YE8A 4JLJA 3BE4A 4B32A 3S1AB 1P4SA 1OB5A 5CYPA 1OH5A 2ZROA 5B30A 1W5SA 2H18A 2N42A 4CEHB 3I8XA 2NO7A 4XD7A 2XB4A 2HLDD 1Z6YA 2ZRNA 2IA5A 4GMDA 1HE1C 3KFXA 2ZI7A 2FDCA 2WSMA 2GXSA 1QG4A 2Q9CA 4US0R 3CONA 2PMKA 3RWOA 2GVDC 1E1RD 2JLRA 2QP9X 5JMTA 4K8OA 5FTKA 2X19A 2OSBA 4Z51A 3LD9A 4MUBA 4GOKA 1OPXA 1W2GA 1TQ6A 4Z8YA 1IM2A 4DLZA 1CBUA 4BFYA 3LQRA 1GNQA 1HQYE 2GZAA 3PQCA 3K53A 3LBHA 1W4BA 1II8B 2F1IA 4C0AC 2HCJB 3P27A 5LD2C 2WPDD 3FMFA 4LDJA 2A78A 2IYWA 4RZUA 5EE5B 1JR6A 1UBCA 3TBKA 5G3YA 3I8SA 3VHXA 3U3RA 4ZPXA 4DSOA 3AVXA 2Z6VA 1U9IA 2JJ2D 1IXZA 4XTRA 1F6BA 2FWRA 3LO5A 3DM5A 2OESA 3QF4B 2RB4A 1GL9B 3EZ7A 5CJPA 1NIPA 2CHQA 1DTSA 2NZ8A 3MG9A 4JVLA 1SXJB 2ZRIA 2QP4A 5JEDA 4NBSA 4B35A 1XEXB 1OFUX 2GZHA 2O8CB 4QNRA 3T1VA 2XSZD 3WNDA 3AV0B 3GFPA 2ZIAA 5DI3A 1ZM9A 3R20A 4WW0A 1TPZA 1CJTC 1G8PA 1R5BA 4RD3A 2GKSA 2QPOA 1JALA 3BH6A 1M6NA 3TUIC 4P31A 1QHNA 2P5TB 2WICA 1RKBA 4CDGA 3CWQA 2IUTA 2WIBA 4URWR 5DN6D 3UMSA 2ZRBA 4LV6A 5BYKA 3H1TA 1CR2A 5TXGA 4D0NA 2DFNA 2HXSA 1P2SA 4AIIA 4TSFA 4PC2A 3KUDA 5K8TA 3BXZA 3U6KA 2BHRA 5H68A 1VMAA 3U5ZB 1XB2A 4B75A 1N6NA 2RHDA 3B13B 3I62A 1XMSA 4TT3A 3W8RA 3CIOA 1GP2A 1RIFA 3QKSA 4I1OA 4LBVA 3QXSA 3O8DA 1CLUA 3EA0A 4IOLA 2FJUA 1ZAKA 3A4MA 5D3MB 5SZHB 2OE2A 1DEKA 5FTMA 3KB2A 2W58A 4DUGD 2DB3A 5FBVB 4IVQA 1KI2A 2WWYA 1UM8A 4CRWB 1TAGA 2OHFA 2BBOA 1LS6A 2ODBA 1ZC4A 3IILA 4U00A 1ZM3A 1TUEA 2IHYA 1KMHB 3UMFA 2QUZA 3EPLA 2HXYA 3BWDD 3E2IA 1G4UR 2L0XA 3ADBA 1UKZA 3U4QA 3HP1A 3WMEA 2RGNA 3SOPA 4FMBB 5DGXA 1RRPA 1UKVY 4HDCA 4QFMA 4G0NA 1M74A 3ZLJA 1IHUA 4B48A 2QT0A 4MRRA 5JHHB 4BLSA 3SU8A 2B21A 2DFTA 3CRW1 1W4AA 1DE0A 1NN1A 1US8B 4LV8B 3FHCB 4A92A 3HPRA 2O0JA 4KLZA 1E0SA 4BFWA 1BKDR 1FX0B 2RKOA 5JS8A 5K8LA 1Y63A 4DKXA 1N5JA 4RD0A 4BASA 4UKDA 4DCNA 1P7CA 3B1WA 2JLVA 4RFSB 4Q18A 4QHTA 4W7SA 1N6LA 4B2PA 1TQ2A 5IK2D 4HZUA 3PEWA 3QPWA 2BJVA 2IYVA 1NVVQ 2ORWA 2FNAA 1JI0A 4FMCB 2GILA 1IXSB 2XJ4A 2XOKA 1G64A 2EU8A 1KI3A 2MSEB 4UXIA 1XCMA 4N3NA 1E2EA 3K0AA 1HE8B 1IN5A 1NG9A 2IS6A 2VHCA 3Q3JB 5AJZA 3B8HA 4QC2A 4BLTA 2PT5A 2ZS8A 3QQ5A 4G01B 4EAQA 2B92A 3WHLA 1Z29A 2C8VA 3QXCA 1SXJD 4EKDA 1IY2A 3EC1A 1F2UB 2QBYB 3DHWC 4TYQA 3TVDA 2GJ8A 3THWB 2IHBA 2QG6A 1NY5A 4BLQA 2DY1A 2WHXA 4HDQB 3ZZUA 1P9WA 2XB2A 2BIFA 3EXAA 5CB8A 1EX7A 1VG1A 2P67A 2NIPA 4Q4HA 5FH9A 1WA5A 5DLQC 1R5OA 4PAMA 4KODA 2NPFA 1SVIA 4IHQA 1IONA 2VPPA 2QQ0A 4DLRA 2Q9BA 3RDPA 1SHKA 2ONKA 2ZJZA 1G3RA 1NY6A 2VLIA 5FUWA 3UATA 2ASEA 1E0JA 3JVVA 1GG2A 2LCFA 3C14C 3FGNA 4IXNA 1W49A 4KJZA 3C15C 4M1OA 3JVUA 1W0KD 4PHTA 4DLWA 3VR4A 3U44B 2MMCA 2IYRA 2ZAOA 4ARZB 1D9ZA 2WJVA 4H1UA 4EPRA 3B9QA 4Q4AB 3CNLA 2AFIE 2AXPA 4BGDA 3B78A 4V0KA 4JVNA 2TMKA 3K0CA 1VTKA 2BBSA 2FF7A 3MJHA 3TAHA 1CS4C 4LWZA 4QGHA 4X8MA 1KKMA 3RS3A 2QGNA 3PV0A 2BEJA 1T0JB 4KFTA 2Z43A 2NO0A 2D7CA 3KFVA 4RD4A 3LQQA 5H1YA 2WJJA 3NBYC 2DFKB 1MT0A 4QOSA 3GLIB 1W0JD 4NPHA 4C0LA 3OE7A 4FD2A 4RJLA 4PFSA 2HF9A 1BOFA 1BMFD 1YZQA 2W6JA 1VKJA 4Q1AA 2JEOA 3HU2A 5DNYB 3EARA 1XJQA 4JZKA 1XXHE 3WHKA 5HR5A 1FQKA 1OSNA 3I72A 2K5UA 1NSTA 2YNMA 5KDLA 2BOVA 1T8TA 3OHMA 1KSGA 3CB4A 1BYIA 3I5XA 5TB5A 1Z0IA 4ASUD 2FFBA 1DADA 2YOHA 4FN5A 4D82A 1ZCBA 4DLVA 3MFYA 4BFSA 5KSOA 4LHVA 1E2GA 2AHOA 5EUQB 1ZM7A 1N25A 5DHAA 3EAQA 3OZXA 4A9AA 4OI2A 4B44A 2JATA 4F4IA 3I4LA 2RAPA 1P61B 2F3RA 4HEJA 4EFLA 5KPJA 3NXSA 3BAFA 4XSHA 1J90A 2EFCB 3RRMA 4PHFA 2DPXA 1NVXQ 3SS8A 3UPUA 1H8ED 4UXHA 1G7SA 1E99A 1LV7A 4XOIA 3KQLA 4L5BA 2PCLA 3CPEA 3CX7A 3EWSA 4YMSA 1R0XA 1D8TA 1DELA 4FXPA 4QGAA 5DYIA 1Q44A 1P60A 2VL7A 3RLFA 2BKUA 5FPKA 5IHPA 4OJKA 1N6KA 3NBXX 3AVYA 1KI1A 3OEHD 1H65A 3ICEA 3K1JA 3K0EA 2C03A 2G0TA 4IRUB 1XRJA 3ZVLA 4PXAA 1E2HA 4TL8A 2QAJA 2CEAA 4URYR 1XCGB 4PO9A 2ZREA 1CJKC 3SHWA 5AJWA 4AWXA 1E9CA 2J7KA 1KO4A 2RGCA 4DT1B 3VKHA 1IJEA 2FSFA 1EX6A 1U8YA 1KI7A 3PIRA 4KLNA 4M22A 2WV9A 3R7WB 3RC8A 1G5PA 1D2NA 2C98A 2G0NA 4A0RA 4NCJA 4GPTA 4YMVA 1T3SA 1WB9A 3HJNA 5DSZA 1F2TA 2Z5FA 3K0FA 1A7JA 4WA7A 3CNOA 3AUYA 4LI0A 4PPGA 2GK6A 3L2OB 3NTUA 4Q21A 4YLGA 3KQKA 1WF3A 2CLCX 2YHSA 4BRUA 2FX3A 2KBFA 1G3QA 2WWFA 2OILA 4KAXA 2D4HA 4WBSA 5EE3A 4CYMA 5FPHA 3A1UA 2WVJA 2PMDA 2ZYUX 3NWJA 2XJ9A 4LPSA 1PLKA 2QAGC 3P1JA 5L3QA 1KHTA 5HKKD 4ZCIA 4RKEA 1UAAA 1RYHA 4WZAE 1CJUC 1Q1BA 5L3SB 3EZFA 2MMGA 1GRNA 1P6XA 3HR7A 4IVRA 3T61A 2FPLA 1Q21A 3LXRA 1NKSA 5FUXA 2FSIA 4M0LA 4FWTA 4YMUA 1ZC3A 2LKCA 1G4AE 2SHKA 4F4JA 3CBQA 3DO6A 4QBGB 1NVWQ 4PZYA 1OKKA 2FGKA 3O8CA 5J4VA 2H7VA 2BM0A 5TV2A 1TF7A 3GLFB 1YQTA 1R5NA 4G5GA 2P6NA 4BLPA 5EP1A 1N6RA 1YHNA 5FFMA 4F38A 4AY2A 4LC1A 3A4LA 1HT1E 2IW3A 2QTFA 1AKEA 4LZZA 4DLXA 1U0LA 3LFUA 2F9LA 2AD5A 3SYNA 5GVSA 5J5CA 1Z6TA 3P32A 3U7GA 1XU4A 2W00A 4DWJA 3VKWA 4BFXA 4NYIR 3B7GA 2JIZD 4Q02A 4DLTA 2JLYA 4RZXA 1Z83A 2CE2X 2G88A 5FL3A 2OXRA 3FYHA 1U0HC 3AVWA 2I1QA 1AS3A 3THXA 2YWFA 4S2EA 5LB4A 3U7FB 1PUIA 4XWKA 5EXXA 4NCHA 2J0UA 3TR0A 1FQJA 1ZINA 1K5DA 2IYLD 4GOXA 4D25A 1IOZA 3GJ3A 1UF9A 1O3YA 4FI3C 4TTRA 2QM7A 4CT4B 3D6TB 2V4ZA 4FMCF 3GLGB 1COWD 3ONWA 1XD2A 2IYTA 5F2EA 3BBPA 1RJ9B 3T34A 2IYZA 4MH0R 4IDOA 3CH4B 3C7KA 2ZUCA 3O8RA 1NBMD 1XX6A 3FKSA 3QNUA 1LTQA 1Z5ZA 1ZU4A 2CDNA 5J47A 3K70B 4MDEA 4OYHA 1KSHA 4NHOA 1VCMA 1DS6A 5FL7A 1GZSA 4P32A 4UXJA 3LLMA 3LXXA 3Q9LA 1KNXA 1OYYA 4M1TA 4JLVA 4OKSA 5EE9A 1P3JA 3KKOA 4R2IA 4M4SA 3VR5A 1XEWY 2ORIA 4M9QA 5JI2E 1OHHD 3V9PA 5BW8A 2V7QA 3ZH9B 4JS0A 4HI0E 4NYJR 5JJIA 3W6PA 4IFEA 3KTAB 2AKAB 2JLWA 1KO1A 1XXHA 5FOWA 1A2KC 3NEJA 2EYQA 3HPQA 5JLJA 3X1YA 3N2IA 2REOA 1X8KA 2JDID 4YDHB 3CRVA 3AKCA 1DARA 1T3LA 1KDRA 4DIDA 3BB3A 3TR5A 3TSOA 4DVGA 4IDQA 1ZU5A 1TF5A 2Q3FA 3A6PC 4B73A 2CVHA 3FDIA 4XSGA 1JXMA 4PX9A 2LWIA 1OXTA 4URXR 4C7OA 4JSYA 5F3WB 3TIFA 2OCAA 3DOFA 1H8HD 1GSIA 4H1VA 2QP3A 3R8CA 2ZJBA 3LNCA 3PEVA 2OM2A 1RYFA 2IF0A 2QTHA 2WSSA 4D80A 3T12A 3AF4A 1NN3A 2QMUA 5ANRB 2ZE8A 1L2TA 2OLJA 3W6OA 5BWMA 3QEOA 3QG5A 4GI7A 3NDPA 4MGYR 2WWWA 2Y8EA 1E2PA 2A5JA 1G6OA 1VPLA 1WE2A 1Z63A 3UIEA 2NOAA 1GOTA 4JL6A 1RRFA 5FOUA 1KK3A 2A7QA 1V5WA 5CDFE 3L0SA 1HV8A 3LAWA 5HE8A 4D2IA 1E98A 1TNDA 2BCJQ 2NO9A 3W34A 1F5NA 3EASA 2KSQA 4QJ3A 4D6PA 2IUSA 4MGIR 4XIGS 2ZJ8A 5KU1A 1XJ0A 4LJ8A 4AURA 2Q21A 2VP6A 4LYFA 4O2LA 3THOA 4LK2A 4B3XA 5A4JA 1SVMA 1NLFA 4TMWA 1X6VA 3N5CA 4GZLA 3W5JA 2IK8A 3WRXC 2ZU0C 1JR3E 2QE7A 1DPFA 5DI3B 3TGPA 1IXRC 2ZRCA 2Q0HA 3A37A 3KXKA 4ZDIA 4DBLC 1VG0B 1Z0DA 2VP9A 3SNHA 3W9YA 2PZFA 5G53C 4C0JA 5CJ2A 1YRBA 4URUR 1N0VC 4KCGA 1U2RA 2JLQA 1JQLB 5G40A 4EPWA 4DB4A 4RSGA 2VHTA 4XVQA 2HT6A 3WRYC 2ZJ5A 3ZS8A 2FA9A 3VU9A 2NMVA 3NG1A 2OG2A 2WWGA 1G16A 4ZI2A 2R2AA 1UBGA 1CKEA 3R8FA 4A82A 1QHGA 1CRPA 4C0SA 3GEHA 4MKGA 4RCZA 5EJEA 4DSTA 2CK3A 3MSXA 1S9DA 1LW7A 4D26A 2I1VB 4MA4A 3MWKA 3WNBA 1ONBA 3T15A 3K70D 4NYMR 3BB4A 2V3CC 3DZ8A 1GKUB 4RD1A 2ZTSA 1TF2A 3V4FA 3OEED 4DLSA 2FFAA 1FNMA 3DMDA 2KB0A 1OIWA 3MRSA 3CR8A 3WXMA 1JPNA 1TQDA 3AF2A 3Q7PA 5DIFA 4MGKR 1EFCA 3VMFA 4RCYA 1AA9A 1EFTA 1KI6A 2BDTA 2ECKA 4PZLA 1SZPA 3SFVA 2D06A 1MRSA 2VF8A 5JCZA 1A82A 5KDOA 1GDDA 4R71A 2AXNA 4BFTA 2DBYA 2LKDA 4IFBA 2ZRLA 3BFXA 4PZZA 4LJ5A 4EJSA 4LBWA 5J40A 4Z1MA 1TEXA 2HEIA 2NZJA 3FMOB 1XEFA 3U4QB 1HH4A 2ZSDA 2Z83A 4IOKA 4ZCMA 4FCVA 3ICQB 1R10A 4HLDA 4XH9B 4B3BA 5HZHA 1CULC 1WQ1R 2G77B 2J87A 2WJIA 4XVUA 1E9BA 1CTQA 3U3JA 4YXWD 4MUAA 2E87A 2REBA 1X8LA 4CT5A 2O0HA 2D3WA 2R6AA 3IQXA 1KK2A 1XTIA 1FP6A 1O87A 2YC4C 4QBIA 1SXJE 3QKRA 3J81k 5F9FA 1S1MA 4GZMA 3M0EA 3GFTA 4E5UA 1AQYA 2ODWA 3PENA 1XTJA 1ZIOA 4YDSA 4G5RA 4CEIA 4HZUB 3AF1A 4V0LA 2VHJA 2HCBA 4KFSA 2WTUA 1Z2CA 4OQXA 2YKGA 4TL6A 3OFND 1JJ7A 2ZJ2A 3H4MA 5HTKA 1MO3A 3KKQA 5KYKA 1HEIA 1IY0A 3AVUA 3IPYA 2F43A 1ZD9A 3U3MA 1W4RA 3U6BA 3K0AB 3BERA 3FMPB 2IS4A 3L43A 3A4NA 3KQUA 4XWOA 5IT5A 3B6EA 3RS2A 4IJMA 4Q66C 3TAUA 2C04A 1SVSA 3ZJYA 3ETLA 1KK1A 3NHBA 4QJ5A 5E7JA 3RNLA 4A8JA 4LV5B 2F1JA 1Q12A 2JGNA 1JBKA 2WM9B 1W44A 3AVQA 4NKRA 1E1RA 4KYUA 1EFRD 5EE1A 2ZSEA 4TLDA 2ANBA 3WBKA 4HUQA 4Q1CA 1P5ZB 2QORA 1E4YA 5FPTA 5KPDA 4A15A 4B33A 4JVMA 4B3FX 3FE2A 1OXXK 1N0UA 4M53A 2QMEA 3NDBB 3CF2A 521PA 4BECA 2JLUA 4ZDJA 3AB3A 1ETUA 1AQUA 2XZPA 2ZRAA 1IAQA 3CKLA 2GTPA 4XTCS 2DWQA 5FOSA 2PLRA 3MGCA 4Q4HB 2EFDB 2WPDA
chains in the Genus database with same CATH superfamily
3A7EA 2CJFA 4PZ0A 5L51A 1ZBDA 4QTYA 4Y2UA 2EDAA 4FYVA 2ZT6A 1KAOA 2B69A 5A7FA 5DWVA 5DASA 2MINA 1DAKA 3C3XA 3OLYA 1NBOA 4TMXA 4DN6A 3I6MA 2O8NA 1NI3A 3P0IA 4ZT2A 5ICSA 5JS7A 5JYBA 3NJRA 4R8RA 3VBEA 3IQZA 4PC6A 3VNVA 1NW6A 3BVPA 1PEYA 1ZG3A 1MB3A 3KQTA 3EZGA 1F60A 4OK3A 5HS4A 4RY2A 4HVCA 4TSRA 5A3JA 3KQVA 3L06A 4FCCA 1HZZC 3RYHB 1PZEA 5HUJA 5KTNA 5HSGA 4C0XA 1AUQA 2XHZA 1L9XA 1QGYA 1JUDA 1QZUA 2CL0X 4R8SA 4EQ6A 1YS7A 2XMRA 3MT0A 4BVJA 5L9AA 1ZWLA 1KR2A 3UMBA 1TM2A 3DNMA 4LJAA 1Z4PX 3TD6A 2RE8A 2OCDA 3BGIA 2FCRA 1R0SA 3MD0A 3UK6A 1Z3CA 2D6FA 1JA9A 3CRQA 1JAIA 2OV1A 3TWOA 3DKRA 1KZ7B 3V8BA 3WJ7A 4G8BA 2A5YB 1Y1SA 1WMEA 2UVQA 1TU3A 3ETEA 2XVYA 3LT4A 3QVUA 4F72A 1N2CE 3E0XA 5CDFA 4EFMA 2JAPA 5DSXA 3EH1A 2JAQA 3L3BA 2ZBFA 2A0YA 1RQNA 4YO7A 2IHNA 1GQRA 3DYBA 4PX5A 3C3JA 2R6ZA 2R7MA 1TU4A 2D0DA 4U9HS 5C35A 2ONCA 1V39A 1ZD5A 2GD1O 3IAEA 1Q50A 5IU6A 5FUYA 3WA7A 4EQZA 2YJTD 5AK0A 2ES4A 3DO8A 3WY9A 1Q1GA 2X7XA 1FRFS 2GNOA 1DCMA 1KVTA 1V16B 3C3PA 3ESAA 5H3CA 1V11B 5U1PA 2VNIA 4LBYA 1JB9A 1W59A 1FW6A 1IOVA 1DAFA 1KA9H 3HDTA 3GY0A 3LWDA 3I0ZA 2NO1A 4QM6A 1JHVA 4ZQGA 3IBCA 3H9EO 1XEWX 4HDNA 4OQLA 4FGZA 4G24A 5DW0A 1AZTA 1XYVA 4FMDF 1YZTA 4UVHA 4AO6A 1T9CA 2XMDA 4FBMA 3I34X 1D0SA 4PPNA 3ZWPA 1C1DA 4B0PA 2IPMA 2FI1A 3LKBA 2V1XA 2X3YA 3L8FA 4QDJA 2Y0CA 3MZ0A 3NHAA 2C2GA 2FQ1A 5H4GA 4LNAA 1C0IA 1QZTA 4JWKA 2R8YA 1KOJA 4KBFA 4BQFA 1SOVA 2H5IA 1SIUA 2R5NA 3IEKA 2HK7A 1Q7EA 3FKQA 5DWDA 4RHTA 1T6XA 2OV4A 4LVOA 5DDIP 4OH1A 3HFJA 3Q40A 1PW7A 2IIPA 1T2VA 3H9QA 1SD5A 2BR4A 2HA4A 2VDVE 2XMPA 3K9NA 3L02A 3X1JA 3KWMA 5L7TA 3TI9A 1RACA 2VH5R 1NUTA 1SVLA 1QNFA 4JLNA 3ZVRA 3HSSA 4D9CA 1FDOA 1E2IA 2ZZKA 4BAZA 1VQ1A 3LPLA 4DB2A 2I4LA 3KXLA 2UZAA 1GTVA 2H1RA 2Q2WA 3EQ8A 3GOQA 1R8SA 1GPYA 4TTPA 2P3SA 4W5WA 1SG9A 1U3CA 4L8LA 2BFEA 4FMPA 5H8WA 2F64A 5I47A 4I50A 1ORWA 2DR0A 3W3AD 5DTEA 5FI1B 2FPIA 4KVAA 2P9YA 4GBJA 5ALJA 1ZMRA 2CLDX 1UC9A 2X4DA 1EP9A 3V1YA 2CB0A 4CXMA 2PGAA 3V8VA 4BWFB 4EFDA 1T26A 2BRUA 4FZ3A 3Q3HA 5T3YA 4UHFA 3GGCA 5A05A 1EK0A 3GLHE 2ZIZA 4GX2A 3MOIA 4YV0A 1OILA 1B42A 1L4MA 2GESA 2X0IA 2GPBA 4W6QA 4DY6A 4JZYA 3MAGA 1C8VB 1UBEA 2FPMA 3MJVA 2Z4RA 5B3JC 5LKRA 4L9RA 1F2TB 1MH9A 4JJEA 1V6SA 1PR9A 4L72A 5E2AA 3UFBA 4FCTA 5MHTA 2E7ZA 2LR0A 3EGVA 5SYMA 2WKRA 4HEA6 4E88A 3QI2A 1Y8RA 3AXSA 1G8GA 3ANXA 2DAPA 2XIJA 3QFCA 4EMSA 3ND7A 2IYOA 5K5EA 3CG0A 2WW8A 1AA6A 2JLAA 1UK6A 1YKSA 4GVPA 1TJ3A 3ZCQA 2WIFA 5ADUS 5A9SA 5JJLA 3FYSA 3VR0A 1YASA 2NTYC 1U2SA 3PFKA 3BGDA 4BRSA 4O3MA 4DOMA 1F0YA 3H04A 4O59O 1CUGA 3N86A 5ITZB 2IXAA 2XA9A 1KY2A 1MU0A 2BONA 2EKZA 3QP9A 3TI7A 3U0BA 1H2XA 4KO2S 2E1PA 3KHSA 1WCIA 4RESA 4ZTBA 5B2ZA 5CYOA 1EVQA 1RI4A 3PJDA 3W1WA 2ZE5A 1S2DA 3H1AA 4IKOA 4RIFA 2J3JA 2DUNA 4KRGA 1OCEA 5J2TF 1XPRA 3FMVA 2PYZA 3IDQA 2DQ4A 2YV3A 2ZQYA 2AN3A 1ISSA 4IIDA 1NSYA 5IAAA 1JE0A 1GQQA 3H2IA 3EWAA 3I9LA 1Y9ZA 1NSFA 3RNOA 3OE7D 5JCJD 2N9UA 1QB8A 3D2BA 4FNMA 4QGGA 3L1VA 4CI9A 2VK4A 5EERA 1XVAA 1W0KA 4K5QA 4KIUA 3UM9A 4P35A 5F1OA 3HCPA 4PLCA 4D96A 2FPWA 3NEAA 3TOXA 3ENZA 1DBVO 4AU1A 2O5CA 3JR3A 4OXXA 5JEEA 2FRDC 3WJ2A 3JYLA 4OPMA 4G5FA 3WLJA 3LYLA 4BPBA 5JSQA 4Z3DA 4E2WA 2CFSA 1Y5NA 2QTBA 4RELA 3T8YA 3WMXA 4LJ9A 2CFRA 2GJAA 2BKEA 4IINA 3AU9A 4TGLA 4ESEA 4KQ6A 5DTRA 4C43A 1UEIA 1XQYA 4BV9A 2ZI3A 3NHPA 1DXYA 1SKAA 4H7IA 1DBPA 5LYJF 3DCYA 5CM9C 3VNBA 1DUVG 4E2FA 5B3LA 4OJQA 2FPUA 2ZULA 5EGSA 5K1ZA 3V1UA 2XAUA 4YCAA 1U4SA 3PEFA 4IV0A 3KRTA 4ZFNA 5LCXA 4ON9A 3EGOA 4MRNA 5EIFA 3SF0A 1UOOA 2YR0A 5KS2A 2J0UB 1FNBA 4Q7KA 4RK0A 5DULA 2WHRA 1BDMA 3COWA 2H51A 2IVFA 1RWNA 4CG1A 3LQ4A 3PE3A 5FNVA 2ZI4A 2C3PA 1MQ9A 2J7PD 3T1OA 3A11A 2OQRA 3I1FA 3NAGA 4Z0NA 4HXGA 5FEUA 5I9LA 4LXYA 3GRZA 3UG7A 4CM7A 4E51A 4IUBS 4M98A 4R1SA 1EZ4A 5AJUA 1ZA2A 4LJSA 1QDUA 4LGVA 1MAWA 3SC6A 3THYA 4WBNF 3OM0A 4HS9A 3T1TA 2JJQA 2GM3A 3C2QA 3LGSA 3MGKA 1BA3A 1K86A 1PJ8A 1USGA 4DMUB 4ASUA 4ZCSA 3Q72A 1EVKA 3GGDA 5TPZD 1W5BA 3HA7A 3AUXA 3EB9A 1RQRA 3GJXC 1MJGA 4X8LA 1RTTA 2ZR0A 1KAMA 2P6MA 3AR7A 3EFOA 4HLUA 3H8SA 1ZX1A 1P1BA 1NYQA 3NV7A 4YDRA 1EJBA 2NW6A 3MUEA 4PLZA 1BX0A 4KDFA 5GJVC 5LZ9A 1YR8A 2DE0X 3TBFA 5KNDD 1YZVA 4B8WA 1EEHA 1DP4A 5KCMA 2IX3A 1NUAA 1LF0A 1T9BA 3HVUA 1X1EA 2KPOA 3JYQA 3ABIA 3WZ2A 3L6CA 2DWCA 2JRCA 2PBLA 2PSSA 2Z8YA 3CF4G 4ZOAA 1BE6A 4OHZA 3UOGA 4DWWA 3DMTA 4QRDA 3DBVO 3GA5A 3R6WA 4GOND 4NDAA 1UKCA 2P7IA 1ZUWA 3BS4A 1L7OA 2BUCA 1PNTA 3ZK9A 2GLTA 5D1HA 3BOSA 4R2JA 1J09A 3IBGA 3E70C 1V3UA 3O2NA 4GU5A 4I1YA 3WYBA 3CKKA 3I05A 4L73A 4ARSA 4QXAA 5KNCA 1IZ8A 1NJFA 1SBNE 5GIPE 4B3SB 2DJ5A 5AI5A 5BSRA 3VHLB 3EZXA 4F4CA 2G71A 3I53A 5DMXA 1T35A 1SBIA 2VEDA 3QK7A 3DHNA 3S8YA 4IFTA 1X2EA 4Q7LA 5K2MA 4ETMA 5A04A 4BXOB 2JKVA 2IP1A 1G3MA 2QRVB 3WK8A 3NBFA 3Q5EA 4TRNA 2YJGA 5B7PA 4YQEA 5C3MA 4CKCA 3G9TA 3NEYA 1WBBA 1U0RA 2ZPUA 1ID1A 4WZBA 1D9XA 2P41A 4W7HA 4AYWA 4RLQA 2A9PA 3OQIA 1XZBA 3GLSA 3RSFA 4MI1A 1PZFA 2FMHA 1I1OA 1AKRA 1NKTA 1WY5A 2OFOA 2IOYA 2CXPA 4LOIA 3ND8A 1QKIA 2DOKA 5FI0B 3WWCA 3ZZ0A 3JQAA 4L02A 3OOSA 1ONSA 4KVGA 1UJCA 2JZOA 5DJ5A 3H5LA 4Q16A 4ZIRA 2X2FA 4JR0A 3KNZA 1QP0A 1B74A 3A2NA 1L4NA 4UNRA 2IYSA 2NG1A 5A1JA 1KEPA 1Q3TA 2G8NA 3NS7A 4KSCA 4QFBA 1OC4A 3BB1A 4I5GA 3B1ZA 3WIDA 4PYQA 3WB0A 1NF8A 3LT5A 4IEFB 1DMRA 1U8AA 4MICA 5IAEA 2Y77A 4OQQA 3REOA 3DONA 2H2AA 4I6JA 3G6WA 4OQDA 3HDGA 1IUPA 1VIYA 1RBZA 5JARA 3AB8A 5HHTA 3QBEA 1SBYA 3IIKA 1RYMA 2JFXA 4NP6A 1SCAA 1X7XA 2HX1A 4JLMA 2GNPA 4H0CA 4BMPB 4NMWA 3SSAA 4CQMA 3DT9A 1I24A 4RKQA 1JEDA 1KMMA 1KVQA 2XODA 3QVKA 2G1KA 3SKYA 5B58C 3TRIA 2J9YB 2XD9A 3MMPA 4E11A 4OUKX 1EFLA 4HZIA 5K3OA 5KYGA 1Z8FA 3FLEA 5CA0F 1HX7A 2CLKB 5JJ5A 3UMVA 4HFMA 1XA3A 2OZVA 2ADMA 4RV4A 3ZQ6A 4TRRA 4ZGGA 1I2MA 1ML3A 3CNBA 4MEAA 3V9AA 4BP8A 3DV0B 1LBIA 3KEOA 3Q1KA 3Q2OA 1CRWG 4IIVA 4JX9A 4Q9IA 4JUFA 3UWMA 3FOAA 3AHDA 4F4DA 5CFZA 3H87A 1QOPB 1HEUA 2Q5FA 4J0KA 1UIRA 2WHQA 3TR6A 2WM8A 3CJQA 3WSVA 1GNPA 1NOIA 4CM3A 1ZOSA 3IP3A 3MTQA 3LXMA 1G38A 2F8SA 3RVBA 4H16A 2GN1A 3B52X 4JLBA 4KQJA 4TN1A 1EIWA 2YX1A 5IKXA 1ZVQA 4LRQA 4WSOA 5EPEA 3TZ6A 5KC9A 4B5KA 3ER8A 1DIGA 4RY0A 4V0RA 4S1NA 1KYQA 2IBMA 5H83A 4LZNA 2ZUTA 4WCFA 3R7DA 4V24A 2CSUA 1D07A 3R3ZA 2EKQA 2ZPAA 3H97A 1LBHA 1WMDA 3R7SA 3RSLA 3OZFA 5I7FA 1FYDA 1TVMA 4K8RB 4M7RA 2IV2X 4BRWA 2BUAA 2Z3ZA 1HUQA 2XE4A 3LU1A 3WO1A 4CLHA 1SELA 3OJXA 2XT6A 3T5BA 2ATCA 4NMMA 1PEKE 1P2TA 3GMIA 4N40A 2D5LA 2GEKA 4L9WA 2O2DA 4KITB 5KTRA 3HDVA 1Y1TA 3DZCA 1NJGA 3OD5A 3P2MA 4RFVA 1D3AA 1R6TA 1XZLA 2V55B 2QSUA 3E8SA 2OCXA 2ODEA 3WMFA 1AUXA 4DCGA 5GINE 3A3KA 3EIUA 1KE2A 1SKQA 2RCNA 5FT9A 4F96A 1C9EA 3PFIA 5JBNA 2X4GA 1W47A 1HE3A 2MSWA 4WN9B 2IH2A 2V6JA 2HMUA 3VZSA 4RORA 1ITZA 2O6LA 2HDWA 2HO4A 2ZIGA 1H1DA 5ALKA 1KDPA 1M66A 1R8QA 5EKTA 5JAIA 2BMEA 2EX4A 5K8JB 4UU0A 1REQA 2DFLA 1RHKA 4U7TB 2QN1A 1V8BA 3PPVA 4CLRB 1FSPA 1DZ3A 2VA9A 3EDYA 1S0UA 3TRFA 3UQZA 1ZMOA 3GUUA 3BRWA 5IM5A 2JLSA 3CW2A 3QU2A 5DTJA 5I3ZA 2FE4A 2FZWA 2PXHA 2VXYA 2XOXA 4NZYA 1IZ9A 3JPWA 4G67A 5GQSA 5KYVA 3VKVA 4B0OA 4B6JA 2BVNA 2C9CA 1ZI8A 1RHRA 1P1HA 4YAUA 1R50A 3NU1A 4L6AA 1MAAA 1CUJA 2YXEA 3W77A 5DNAA 1G55A 1MB4A 2B25A 1WMSA 3UAZA 4PN7A 2J85A 3QMWA 3G13A 3N74A 4AUNA 1JQKA 4OYLA 1W5TA 5HBRA 3VV3A 2YRWA 3SC3A 3K0CC 4MEJA 1JW9B 4LTDA 2PZEA 3BSWA 1ZZGA 3L8DA 1D2MA 4MINA 1B6GA 4Y18A 4E6EA 1D2EA 4AW9A 1MB2A 2ZLBA 3R44A 1G2PA 3TNFA 4BWVA 2PRYA 2DR2A 2JA1A 3JYHA 1M2HA 1MFZA 4DYHA 1ZNXA 3WXBA 4DR2B 3KQSA 4CIXA 5LU8A 4TS4A 1M0SA 1UDBA 1V5EA 2F43B 2XXJA 3HACA 3ZY5A 4L27A 3L49A 1EWRA 4FDAA 2Z6AA 1M5TA 3B3AA 3U1VA 4Y8VA 4YUZA 3OOYA 5A4DA 1OXSC 4UU8A 1OH8A 2P2GA 2W42A 1ZOIA 1XHFA 4GO1A 3T9DA 2J3EA 4MPDA 3BCRA 2QEQA 1M0TA 2VWHA 1J0BA 3MNFA 3LOQA 1QZ3A 2J9GA 3WGVA 1NYLA 1VIAA 3IAXA 4JYBA 4I3FA 4HSGA 3VHXB 5ARDA 2Y2VA 4RLHA 2YHAA 3USES 4IWNA 5IF9A 2YQ4A 4LC0A 3H3FA 4H4EA 4AWBA 2YCLA 3BTOA 3E1SA 4D41A 2Z08A 3KELA 4K87A 4REQB 3SYRA 2HUPA 3EQ6A 3RFUA 3L1KA 4BMDA 3G8AA 3DOOA 5D3QA 3DTVD 1KERA 4KB5A 4EL5A 2BEUB 2ZI9A 4U5QA 3UKOA 2WYWA 2QE7D 3GGSA 1O5OA 2Z1DA 3R0VA 4BFVA 3KCQA 1N5LA 4M38A 4FGUA 2HV9A 2QTTA 4YJDA 3R5HA 2L19A 2IXFA 1GZDA 4HLCA 5I9TA 5BUCA 4NCAA 1PJQA 4IWYA 4LMAA 1OH7A 2HNBA 5BQ3A 1JEOA 3IERA 4J0JA 4Q7JB 3FYCA 3HYNA 2HAEA 1W87A 4C21A 4X1YA 3UPTA 4ZU6X 2ZZNA 2X0KA 2OD7A 2Z98A 3MT7A 2ERXA 4JLUA 4ACBA 4D0RA 2VYND 1MA3A 4WX2B 1ZSNA 1E7WA 3AY3A 4HPWA 4ZXPA 4RW0A 4FOPA 3SJBA 3QEJA 4AF6A 2ISCA 3U56A 1AZSC 3C5WP 2BFOA 5HIMA 3SC2B 4BNYA 1RKXA 1B2LA 3I01M 3ZHTA 3DE4X 2O8FA 4F6LA 3G0OA 1LC0A 2YRFA 1K6IA 2IQ5A 3T3DA 1Z56C 4F4UA 2G3YA 2Z2ZA 2QA5A 3DW1X 3TTYA 4EQ6B 2PO7A 2HRRA 3Q11A 2XWSA 4U3JA 4Y6GB 4KE9A 3W5SA 4MMYB 1TOAA 1N1EA 2GLUA 2ZRKA 4Q5IA 3WE7A 3DVQX 1HQKA 3Q6IA 4EIWA 2WSYB 1L1RA 3IHTA 5IKMA 2A9KA 2W2OA 4KIGA 4KRXA 1E3QA 2AJTA 2C2BA 2PMCA 2Z2IA 3FWYA 1GAJA 2JCSA 2PGNA 2ZBPA 4KFUA 1WKVA 1ZJ6A 3GAZA 1A7AA 1SURA 2ZT5A 4XWWA 3T5DA 1P75A 1O77A 1VBFA 1E2MA 2DBRA 1KO5A 2Q6VA 1D7OA 4DUPA 4EH1A 2IYNA 2Z9CA 1N33B 5HX7A 3A8TA 5A4AA 1NNEA 1H69A 4MV9A 4IIJA 4Y2SA 2RHJA 3C98A 3BILA 2Z4TA 2I2XB 2V4MA 5EZYA 1QTRA 3ADPA 5CURA 3ZHZA 4E12A 1QRUA 1CUEA 1DIAA 1TCUA 1E9VA 3WZLA 4BN0A 5ERGB 7REQA 5LZ4A 1G6Q1 1JXQA 2VF2A 5LQAA 3LCJA 1ONPA 2IFTA 3OZEA 4HDNB 4NAVA 2MHCA 3IKVA 3PWSA 4WLVA 2QVXX 5MGNA 3DGEC 4OFXA 2UYYA 4J16A 4LYHA 1KBOA 1Z15A 2WZBA 3DEIA 1C1DB 1E0AA 4NENA 3ZDYB 5FTLA 1Z0AA 4BO1A 4NSNA 5EXDA 3U1BA 4CPDA 3AMVA 2IYEA 3I2GA 1CZLA 5TMDA 4YMTA 5LQSA 3G49A 2PE5A 5C5DA 4BE4A 4CWAA 1QBGA 1UWKA 2IQIA 2WE8A 4HHEA 4Q1BA 4QEZA 4WK6A 2HREA 5LIPA 1MFPA 5DRYA 2R6JA 4JLKA 3ZIDA 5IAGA 2Y66A 1D03A 1EFVB 4Y3UA 4LXGA 4L15A 4DLAA 2E6KA 5DCYA 4QHYA 4EI2A 4M6WA 3OIYA 4JT4A 1Z0JA 2NZXA 4PLPA 2CNDA 5ILQA 1I0LA 3KYCB 2RGBA 3P0HA 4FYPA 4PZDA 1N8SA 4UEKA 3BT7A 2FN4A 4WEOA 2HLDA 5FJIA 4EW1A 3ETDA 3H3JA 1PJCA 3DVLA 3U9TA 3NHUA 5LQNA 3E58A 5LBIA 1U1DA 2RHCA 3DE5X 4IHAA 3CS3A 2HRCA 3FHJA 3IDZA 1Q0LA 4XJXA 4AQYB 4ZYLA 5FKJA 1JSCA 3HB7A 4S35A 4Y2PA 2XOEA 2DHCA 1U8XX 1U8ZA 1JPUA 2BFEB 2VLBA 3QOXA 3G85A 4JR1A 3NKFA 4HH4A 3CG4A 2DWOA 4B7UA 2EHJA 1W36B 2OGUA 2OUKA 1GV1A 3G2QA 4UMVA 1F9AA 1WV0A 2FPIB 4YUVA 3DLIA 1TKCA 3IAM6 3ZNPA 1G9TA 1FBNA 2PX0A 3G79A 5CH5A 3LGXA 5LMCA 5TJ9A 1NAIA 4FD3A 1QVZA 3T3IA 3V5NA 2PS0A 3NM6B 3LX8A 3ANLA 4YCSA 5JC8A 2WAAA 3G9ZA 1GNTA 3L5OA 4Q1FA 3MWLA 1GGJA 2AMVA 4BFUA 4CQLB 2LCQA 2D7DA 4Z9XA 3A1CA 4HRXA 4EVSA 4RMHA 5JFGA 1M6YA 1RR6A 2L17A 1EESA 1TAHA 2WUWE 3VNQA 2R6GA 5JQGA 2ZXUA 2EIHA 4HFJA 4PNEA 4QPCA 1PR3A 4BPRA 3OZWA 4G41A 4BOYA 3A3YA 3WLEA 2AN5A 1SHUX 5E8JA 1Y8RB 3QW2A 4H08A 4HEHA 3E3NA 3G2LA 2IXEA 4OA5A 2V1UA 2E5LB 1H85A 3H19A 4YV1A 2Q6LA 1RXSA 3N1UA 3IVXA 4YRGA 4HDRB 2O7NA 3OX4A 2CYBA 2QN2A 2PH7A 4J7AA 1N7GA 4PR0A 3U7IA 3DUFA 5EWMA 1ND5A 2XMGA 4YBZA 5L6LB 2QTAA 4MVJI 4FGJA 1P0QA 5AFSA 5AUNB 2R1TA 3DL0A 4OQNA 3T5CA 2C7VA 3PXUA 4LBZA 4XVRA 4C87A 1WCIB 3UANA 2ZSAA 2PL3A 3CNNA 5I8WA 4ZU3A 1KY4A 2M32A 2SCUA 3PUKA 4QNMA 3NAZA 2ZYWX 3UWPA 4DLPA 4G25A 4E1VA 2YIMA 4AP5A 1TTTA 4UREA 2Q1XA 3OOWA 4US1R 3MGBA 4RKFA 1BU8A 2AB0A 2OAGA 4W5JA 5ALIA 5BNFA 3ZHOA 5LN1A 4P33A 1TYEB 1L5KA 3E9CA 2PAAA 4HQ0A 1Q16A 3FFTA 3BXXA 5ELXA 5CM2Z 4AMUA 4D3YA 4ESHA 3G2JA 2I87A 3SK0A 4RTMA 4X7PA 1FNSA 3T3EA 3IOEA 1P7WA 4GQIA 2UZIR 4QQ8A 4BNZA 3GPIA 1LWNA 2H4HA 2YV5A 3NALA 4UCFA 1H05A 2PPLA 3L04A 4EMTA 4FE4A 4QUEA 3GGPA 4X1KA 5DEOA 3V2HA 2HR1A 4OLBA 1N5IA 1CDEA 2B8TA 1R12A 2GYVA 4F71A 1ZBQA 3Q8WA 1ZOLA 4X1IB 2BYTA 5DO9A 3AYZB 4TXJA 2NU6B 3GXOA 4C7MA 1N2XA 3K9LA 1Z2PX 2QAGA 1Z3IX 4MPPA 4I3HA 4BKOA 2FV8A 2OP1A 3I6ZA 4BS9A 4DLUA 2Q3BA 3ROKA 3HJGA 5IH7A 2B2XA 3KQQA 1AS2A 5CVTA 4DUGA 4N03A 4GI1A 1UK9A 4NONA 4E22A 2XZDA 3DLCA 3E22A 4F2PA 1P1CA 1DRVA 5ICGA 3E27A 5IVHA 3LHIA 5EHNA 1NJ5A 2PSFA 4U5XA 4Y1RA 5E1OA 5FJJA 2JD2A 4J90A 4W99A 4Y2TA 1H3FA 3DMFA 2GM4A 4Y2YA 2CMFA 4EP1A 5J63A 4LRXA 4A23A 2IHTA 5HP4A 2VDQB 2JZCA 2VJCA 4Z3KA 1JP7A 2FY8A 3BK2A 1L4YA 3HKDA 3PGA1 4KQFA 2O06A 4XB2A 4UM9B 3THYB 3BJZA 1E18A 1PDWA 3PNQA 4I1UA 4O2RA 3ROGA 4AMVA 3SZLA 2DVMA 3MJDA 3LWZA 4TMYA 4XXHA 1NW5A 3KU1A 5FOQA 5JW6A 1NN0A 2H17A 1J99A 1RCFA 1UJ2A 3L6OO 2QYTA 4WY5A 3TEJA 4UE3S 5A3RA 3ZJVA 4NYIQ 2YWHA 2BMVA 3DB1A 4YRAA 2CUTA 3L82B 3K5IA 3EFOB 1YDMA 1DTWA 4IIGA 5LLTA 3IIJA 1T4CA 3TPZA 4BB0A 2OTCA 1EE2A 1ISHA 1SD1A 2J45A 4RTPA 4M1WA 4UPVA 4C6SA 1HNZB 2VSYA 2C4MA 1FP7A 1ZGBA 4KQCA 4XI9A 4YCLA 3ZWVA 1WHSB 4AMYA 4C4XA 4TLMB 5I7UA 2AR0A 5BUZA 2ZRGA 3E5RA 1XP8A 3GFOA 3MPUA 3OKCA 3D4LA 1SHJA 2AEMA 3BIWA 4Q39A 4WTOA 4DWVA 1OI4A 4KBYA 4P38A 2VDUE 4EI9A 3CH6A 2WWRA 1F3LA 2FZKA 1XCOA 5CK5A 1SUBA 5DYGA 4MPRA 4JB8A 2FSHA 4QEKA 4RO0A 1D6NA 3EZNA 1Q6ZA 5C4GB 4C4RA 1P5RA 3DDZX 3OAAA 2X1HA 3OE4A 2KE5A 5ESDA 5JWRA 2F55A 4KH0A 4YRJA 3PPXA 1E60A 2XMBA 4QASA 5CVCA 2D1TA 2JGLA 4OUDA 1Z12A 4CKCB 1GCGA 1N3BA 1YACA 1L3BA 3F67A 4WZBB 5AM0A 1XDUA 4F5DA 2XECA 3LV8A 2UZ1A 2I1WA 3BJIC 3OQIB 4PGHA 3ZCUA 5CFMA 1GL7A 3LI2A 4KIFA 4MQUA 4C08A 1B8PA 3D59A 3IIIA 4N0MA 1JEEA 3JQAB 4R7TA 4W1QA 4DR5B 4A2WA 5L3QB 1LD3A 1EGVB 4ZT7A 3HCOA 4P7GA 2Y76A 5C34B 4BGVA 3C1OA 4ZIRB 4XW2A 3JZFA 1Q7BA 4DXHA 3GLQA 4TQAA 4NU8X 4R98A 3AI2A 1R6AA 5DYYA 5EIOA 1WBDA 2A2ZA 5A6SA 1LCIA 1LWOA 4Q7MB 1GG8A 1A7KA 1TT7A 2YV4A 2LE0A 1WTCA 3JATB 1IEVA 1K7EB 1VBNA 1HG1A 2Y9MB 4QOIA 3G88A 2HCRA 3OHSX 4FHDA 4PU0A 3SHVA 3HJRA 1M7BA 2H3HA 2HJ9A 2V7XA 4FYJA 4NXMB 1RHMA 4TUYF 3MYRA 4E3WA 1NXPA 3AY0A 3MCTA 3TPCA 3EDOA 1X7WB 1VBKA 1X7XB 5JCOA 1X1RA 3N59A 4HDOB 2ZJFA 3N6VA 4MHOA 3M6VA 3TSCA 3HI4A 1VMDA 1TZBA 1WPRA 1BRTA 1Y9DA 2QR5A 3DAHA 1OFTA 3DDCA 3CV3A 4J4TA 2ZKLA 2PMBA 2VIIA 1UPTA 2D2XA 2OC4A 2OQ2A 2YJ3A 1ACMA 1PQ4A 1PTKA 1YR3A 2O57A 1NBME 4WOCA 1ODCA 2FSGA 1JMVA 4UCWA 1G291 2G9VA 2H1VA 5D3MA 4CCSA 1W85B 2O7RA 4G5OA 2OECA 3PRYA 5H7XA 3CBGA 3A9TA 5JMPA 4X54A 3ZOZA 3AU8A 2HFKA 4RA6B 2GTHA 1QPGA 3R3UA 3CVUA 4UZFA 5HCNA 2O50A 3DAYA 4ZKEA 1E8NA 4OMCA 4EJFA 3ITKA 2OCYC 6Q21A 3GARA 2H4FA 2ZOSA 1RXEA 3HEAA 1TQ4A 3G1WA 3BK7A 2QL9A 3NIFB 3O4FA 3VYUB 1E9EA 1VG8A 3JASA 4EUNA 3BFPA 3A14A 3FWZA 1HFEL 1UC5B 3EQ9A 1XE3A 1W25A 3ZY3A 5CCEA 4D5EA 2CV1A 3AHJA 5AI4A 2Z5GA 3VO8A 1QVWA 4EI7A 1KR5A 4WCFB 5BQXA 1GZUA 3RC1A 1GIAA 3BEOA 4ZVQA 4MQBA 1D4AA 1ZKMA 2LXNA 4QAQA 2ZE6A 5J59A 4AY3A 4DZRA 4DSZA 4LCBA 4ROTA 1NI5A 2XCLA 1HDGO 4PFJA 3N0XA 4E30A 3IXMA 4BC0A 3RBAA 1C4OA 4RTSA 4PPQA 1AB5A 3O9VA 1WQ3A 4PZPA 4BEJA 4I1PA 5F7OA 1ODFA 1K5PA 3QE0A 1MMFB 4ZT3A 2GZ3A 3N76A 1CD5A 1CIJA 3OPQA 1K27A 4MI9A 4I50F 2C2XA 2P2NA 4HX5A 4ND5A 4UUQA 4G1MB 4IVNA 2BN4A 5F2OA 3VNRA 1KYIA 3ZY2A 1C7QA 3V8RA 4N0DA 4BO5A 3VR2A 3T0GA 3B9PA 3TLCA 3V8NA 2ZUFA 4B3RB 2HN9A 1LSJA 4KL8S 2WR8A 2B9VA 1NFQA 3RI3A 2IYQA 1O0CA 2FOLA 3AHIA 1SRQA 1X7GA 3PA6A 4YMWA 4DDVA 1QO9A 1QYRA 3A1NA 3C6YA 4UUNA 4D9KA 4IH1A 3OQPA 1NOKA 1ZD2P 2XDYA 3FVRA 3JSAA 1CP3A 3DKIA 2I6FA 3PWKA 4ZJPA 1REQB 4WKBA 1IK6A 3BTVA 1LKZA 2TMYA 4BZXA 3OZCA 5JNLA 1AKWA 4II7A 3BFVA 4MS1A 4TQUS 1HDZA 1ZL2A 1JIIA 3FOEC 4UE6A 4D4JA 3CZPA 4XGRA 1BS9A 2R1VB 1WW2A 1DO8A 1ZMTA 3ELUA 3D31A 4XYMA 1LJUA 4LJ7A 5DHTA 3WLNA 4HRYA 1HRDA 2VZ9A 2BTQA 4OFWA 3WQQA 4LJLA 1KMNA 2NU7A 3FPKA 4KOEC 3S3TA 3VTZA 3IAM1 2JARA 3B48A 4JLAA 2GAAA 1Q20A 2SKDA 2ZR9A 3B3JA 2VNKA 1KMIY 4LVNA 2VXCA 3EMDA 4BUJA 3THWA 4ESVA 1LXCA 3AETA 2IY7A 1T0HB 3JZDA 4C7KA 4BLRA 1FUYB 2A6PA 1PQUA 2WNSA 4E5NA 3EBOA 4Y0NA 3KV3O 3QELB 4FIZA 4R51A 4TV9A 4A27A 4YAIA 4DDTA 4BNWA 3TE7A 4ZHQA 4JC8A 2VJMA 4J2OA 1G2QA 3WDKA 1D5CA 2ZVDA 5FQOA 1K7FB 3T9EA 1HDCA 2P9HA 2XA2A 3B1XA 3PUXA 3PS9A 4ZO7A 3S4YA 3IE0A 4LY3A 5TQ0B 4EI8A 5J23A 4TYMA 3MCAA 1YU9A 4JKYA 4P5PA 2LNDA 2Q4TA 2XVXA 3EULA 1KMQA 4OXQA 4V0NA 1M34A 7GPBA 3EEOA 4Z4IA 1A8QA 1J2EA 3NDJA 4FR5A 1A9XA 3GLGE 1VP9A 1Z34A 1TM7E 3CF0A 2YV2A 3H1GA 3GNSA 3W3AH 4BMSA 2IT1A 3I2KA 5FFFA 2FH5B 1LY1A 3T1HB 2VF7A 3PFCA 4QICA 5IABA 2I3GA 4QQRA 4INZA 1W1IA 3MWEA 1IH8A 1TLFA 4Y9DA 3UJCA 3PFNA 3ZWKA 4F6CA 3RRBA 3N6XA 3AB7A 4E21A 4IXTA 2G9UA 3D8UA 3EZ9A 4NMLA 1KI8A 3ECSA 2GS9A 2K4MA 4RVFA 3CEJA 2E2WA 4XDZA 1ID8A 3D02A 4QUDA 4QRIA 2DFPA 5CNMA 1KDTA 1K8XB 3BWMA 4IGAA 4KXFB 3KZMA 2QLFA 5DHFA 4EY3A 2ZIVB 4OKNA 1BXKA 5AOCA 3T41A 5CFLA 4RTJA 1QIKA 1TKBA 1DWPA 4NE9A 2RI1A 5JVDF 3PTAA 5K0NA 3D0QA 4NFYA 1AKQA 4FVTA 3M5CA 2IYYA 3GLIA 3BH0A 4X1YB 1U02A 2BHLA 4U9IS 2OA0A 3X3HA 3K6KA 3RVKA 5B64A 4G4GA 3SF8A 3PUJA 4CN8A 5I48A 5FNVF 4QPNA 1Y48E 4MUXA 2IV3A 4YAJA 4BWYA 3X1ZA 1A9RA 1QMGA 3WIEA 2ECFA 5EJ8A 1FLDA 3B5JA 3OMLA 2F48A 3GL9A 3AR9A 3SSMA 5C2JB 4PTYA 2C00A 1X86B 1RXCA 2QT1A 3GWGA 2O8FB 1Z9BA 1I1QB 1CJSA 4UBIA 3PUVA 3JWGA 1PJBA 4JXKA 3H0EA 3BRCA 1J0XO 4MRAA 2HSWA 2CHUA 3LLCA 3B1VA 5E4TA 4U3JB 4RYDA 4AD8A 2UU9B 1W36C 4ERNA 4KI0A 3RIHA 4P82A 4LF7B 1LLUA 1KAGA 5E1MA 5D3KA 4IFIA 3OZVA 5HF9A 1PFYA 4JUIA 1C3LA 1KDVA 3HXQA 1SKUA 3O6VA 4QXPA 5BQFA 1L4UA 5D1NA 3IJ5A 2BRUC 4AQ7A 4ZK2A 3PVSA 1WMBA 1ISJA 1KVUA 4HMPA 4BEVA 1OX4A 4MAAA 1KGDA 4IOMA 1COWA 2Y1WA 5E38A 1O97D 4GOJA 1SVKA 3PKZA 3QXJA 2IZ0A 4OO3A 1X1AA 4I4LA 4IIJB 3R5XA 3IFSA 4WMLA 3GD7A 4FZJA 1MH1A 4CZ2A 5EZYB 2GBLA 2IEYA 3FZGA 3L8ZA 1NMXA 2XNCA 4QVKA 3JTEA 5AK3A 4A2QA 4MLZA 1U8TA 1GGVA 1HTWA 3VV2A 1W9MA 2YYZA 1N36B 1PR6A 2RGXA 4RHYA 3L8MA 1H2YA 1Z5NA 2RAFA 1MLDA 2O5VA 1WXDA 2P3LA 2YMQA 3OM8A 2DCMA 2PXXA 1R9MA 3AP3A 3OJCA 2BGWA 3NJ4A 2A1IA 2JGIA 4WOJA 3EIWA 1AV7A 3CNQS 1P0FA 4L0CA 3RYTC 1QG2A 3LLSA 3JXEA 2IUYA 3H05A 1GHTA 3H84A 3IEIA 3NPAA 5EJ4A 3T5GA 5CK4A 3S5JA 1P72A 4MV8A 5K8UA 2ID8A 2RH5A 3LC2O 5ALEA 5EHIA 3AVOA 1D04A 4HS4A 4ZC8A 4D8XA 4QM7A 5JRJA 3EXG2 4YAFA 2XZOA 2IH4A 1YZHA 1QHXA 2L82A 3OPNA 4Y9TA 5SZKB 4QX6A 3A2LA 3BQ9A 3N0WA 3M2TA 3WNVA 4BN5A 3I4CA 4I14A 2AG0A 2NZWA 1K8RA 4QBHA 2PSJA 2KM1A 3STWA 4M6WB 4CTOA 4EGFA 1GU0A 2IUFA 4L4UA 4Q3DA 3OJEA 1KJYA 4DCPA 2QVBA 2BCGY 3DBOB 4HAXA 2WD8A 4NBVA 1UEJA 3V4OA 5IT9A 1TC2A 1H9AA 1WRBA 3EW9A 2TS1A 4OGGA 1I8TA 1K92A 5EG5A 1I3CA 5CLFA 3AR3A 1HQDA 4ZT6A 4WE3A 2J0SA 3PGMA 5IASA 4E32A 1CJBA 1TCBA 3I1YA 4HQFA 2ZVPX 4MROA 2W6ID 5KNDH 1XD8A 4K7JA 5IZ4A 3D43A 4GECA 1E8MA 4LECA 3LF2A 1NXTA 2QPTA 3NYWA