2IC5A

Crystal structure of human rac3 grown in the presence of gpp(nh)p.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
177
Chain Sequence
SMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human RAC3 grown in the presence of Gpp(NH)p.
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-related C3 botulinum toxin substrate 3
total genus 61
structure length 177
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ic5A00
1YZUA 2V7QD 3KQNA 5GJVC 3EZ2A 1SVIA 3PXGA 1OH8A 2BJWA 2XNSA 4TMWA 3T1OA 1ZM9A 2F3RA 1EXMA 5FL3A 1XPOA 3MLEA 4TLBA 3BB3A 2OZEA 4EQ6A 1XCGB 3A6PC 1IY2A 2GRJA 2ZE5A 5JMTA 3UMFA 2CMKA 4A6PA 1NNEA 1X3SA 2QMOA 2D4HA 4CDGA 1UAAA 1P9RA 3U3JA 1XXHE 3IKJA 2FSFA 1VCNA 3WHKA 1TL7C 3K0CA 4LJ6A 3S1AB 1JXOA 2WPDA 2ERXA 2A30A 2REOA 3LVQE 4Q48A 5FBLB 4YDSA 1YRAA 3O8RA 4C0LA 1A82A 1G6OA 4HEJA 2Q21A 5JWHA 1KI7A 1LVGA 2QMEA 1ZNXA 3RRYA 1OW3B 1KO1A 1A1VA 5FTLA 2AN9A 1S9HA 3CRQA 2OXRA 4DRZA 1RRCA 1E2GA 4P3YA 3ZD6A 1E4VA 4GDFA 5J4HA 4JLKA 5ANRB 1RYFA 1SGWA 1W2HA 3NBZC 3KJIA 4P32A 2OHFA 5FI1B 2ZVPX 2ZSDA 4DDWA 1W36B 4HDQB 3MGCA 1VECA 1PLLA 2JLYA 4X8LA 3QSYA 2QAJA 1Z5ZA 3ZD7A 3AB3A 3WBJA 2OLJA 2JLQA 2VA8A 4IKEA 4HLDA 3B60A 2HF8A 1LF5A 4GFDA 2JLVA 1VYVA 2LKDA 1IXRC 3DVLA 3C5HA 2J59A 4IHQA 3VHXA 4BLSA 2ZE8A 3WY9A 1GRQA 3KXIA 1IY1A 4AYXA 1VHTA 5CYPA 4JJZA 2IWHA 3T06B 2NOAA 2R2AA 1JECA 4TTPA 1TPZA 1F2UA 1D6JA 1G20E 3DEFA 4NYIQ 2D7DA 1IJEA 5EP3A 2V8OA 1KI8A 1H8EA 2P6UA 2GESA 2NO1A 4WXRA 2VQSA 421PA 4B3GA 3U3KA 1Q3HA 2ZR0A 4YC7A 3SZRA 1I2MA 2O8DB 2GKSA 4C0BA 4QM6A 2C98A 4GZMA 5HE8A 3IILA 1DG1G 4QGAA 2ATVA 3K0AA 2KI5A 4JKYA 3VR6A 4M1OA 3GFOA 4Q7JB 4LI0A 2D3WA 4US2R 5B2ZA 2H8KA 2VYFA 1TU3A 1ZU4A 2CHGA 121PA 2VSFA 2WKPA 3IDQA 4IEEA 1Q0UA 3KQUA 1R6BX 1ZBDA 4PTLA 4LC0A 3UATA 5L3RA 3JVVA 2OAP1 1CR4A 1PLJA 5JFGA 2J0UA 3ZS8A 4LV6A 4HATA 1XD9A 4I1OA 4NL4H 3T5DA 1Q1EA 2G1JA 3WYAA 3DPUA 5TXGA 1GUAA 4H9GA 3WNBA 3KKQA 1XMSA 1S9DA 2ZI7A 3THXA 3RC3A 1NIJA 3CUEF 1II8A 3BB4A 4M4SA 1BO6A 4PC2A 5FL7A 2D2EA 1CULC 4GRAA 1XP8A 5FOSA 5CB6A 1DVRA 1ZUNB 1HYQA 3QEJA 4KLNA 1SKYB 2V6JA 2HCJB 4I1VA 3OEED 2QTFA 3SJBA 2W6ID 5F9FA 5SZJA 3QXHA 4S2EA 1WB9A 5FI0B 2EVWX 1UEJA 1Z6GA 4WXPA 1NVVR 3BOSA 4M21A 1MRSA 1LW7A 2HJVA 3TAHA 1EWQA 4V0KA 1AGRA 3THXB 1ZM4A 1NLFA 3CIOA 2JLZA 5FBVB 4JVLA 1W4BA 2BC9A 4JJKA 3IPXA 3FHTA 1OIXA 2QBYB 5HKKD 4CYMA 1FUUA 1FUKA 1OFUX 2R6GA 3BORA 5FFMA 1A2BA 3GMTA 2WKQA 2O8CA 4QHTA 3SYLA 2FOLA 1PJRA 3QKSB 3B82A 4B71A 4PQYA 1NG9A 2IYXA 4ESHA 2OV2A 3SU8A 1MO3A 4D4LA 2P0EA 1KDOA 4DBLC 1U98A 2VF7A 4Q4AB 4XWKA 1ZUHA 1NN1A 3OIWA 1KI9A 1FQKA 2YJTD 3AKYA 4PPGA 1COWA 4Q21A 3UWKA 2FNAA 4EFLA 3D8BA 2XOKD 4B3BA 3K9GA 4MQBA 1SXJA 4UNNA 4CT5A 3T34A 4G5QA 1EGAA 5LB4A 5C4MA 1AQUA 1QRAA 2WV9A 5JSZB 2A78A 3W6PA 5LD2B 2ZAMA 3WRXC 3EPLA 4Q02A 1IN7A 2FPKA 3B6EA 1U8ZA 4LYAA 3Q5EA 4A8JC 5BWMA 4LHWA 1RVDA 1E2PA 3BE4A 1JNYA 4BFZA 5KSYA 2XB2A 4Q66C 1ZIOA 3C4JA 5J4KA 5E7JA 3JVUA 1ZP6A 4C9BA 4NMMA 1U2RA 4IOKA 4BUJA 4N0EA 2WSSA 721PA 2YC2C 4ZDIA 5G40A 2ZRBA 2OXCA 4OK5A 5FUXA 4V0NA 4KU4A 1K5DA 3D31A 3MFYA 4PHTA 3GD7A 1S8FA 4I1UA 3AVYA 4MYCA 3RRMA 1E99A 2WJIA 2B92A 4M1WA 1XPRA 1KO4A 2AR7A 4LBYA 4URVR 2A2ZA 1G18A 3I73A 3BH6A 1TQ6A 2XNDA 5P21A 1KMHB 3T61A 1KGDA 2JLSA 3KJEA 2BV3A 3QENA 4D81A 3GLFB 2JDIA 3EC2A 1W46A 2ZYUX 5J47A 1Z8FA 2ZJOA 2YOGA 4CW7A 3U60B 4LC1A 3EX7C 4M8NE 1E3MA 4FCWA 1XJQA 2ZSBA 1Z2CA 4B3DA 2YHSA 4B48A 3HPQA 3C8UA 3MUFA 2C8VA 4AYWA 5JS7A 5K8TA 2R6CA 3RC8A 2DFLA 1GWNA 3M6AA 3W6OA 1G8HA 4BFSA 3DZDA 1P62B 2J3EA 2CJWA 1XFAA 2B21A 2OG2A 1KHTA 2ZU6A 4DVGA 3A1SA 3I3SR 1KJWA 3BBPA 3HPRA 5JRZA 3U5ZB 4JZKA 4RD0A 3TKLA 2OEPA 3EARA 5DO9A 2R62A 2GETA 4A2QA 1NVWQ 3FYHA 4ESVA 1PZNA 3MG9A 3L0SA 2JJ1D 2RGXA 3HYTA 3ADBA 4TMXA 3IQXA 2PCJA 4FMDB 1W0KA 4UNRA 1I4TD 2IHYA 3CNOA 2QY9A 2ZYVX 1U0JA 3TH5A 1Z6TA 2GHIA 2WJGA 3I4LA 2GF0A 1S0UA 2J41A 2Z4SA 2QROA 4L8GA 4F91B 4UKDA 4L16A 3H1TA 1C9KA 2AX4A 3DOEA 4UXJA 3RDPA 1JALA 1E9SA 1XWIA 3VNUA 1GRRA 4U00A 1WRBA 4BFVA 3KTAB 4EPRA 3H86A 1SKYE 2QP4A 4RCZA 2AD5A 3Q7QA 2V54A 3OFNA 4BLRA 5B30A 5HPYB 4EAQA 1ZCBA 3UANA 4F93B 1N5KA 2ZSEA 4LGMA 1PLKA 5FBQB 2WWFA 1E69A 3RYTC 2F1IA 2ZE7A 1T8TA 3QPWA 4D4KA 4NCNA 5J40A 4MA4A 3KQHA 3WMGA 3T35A 2IUSA 2FF7A 1G8PA 1RRPA 1MO5A 3L8YA 3PCRB 1N6PA 3DL0A 3NHAA 2ZRAA 3RANA 1NBMA 4MUBA 2C03A 1XZPA 2Q9CA 1SVMA 3KUCA 1MRNA 2GCPA 5E95A 3LW7A 3AM1A 1UKEA 5HZHA 1DADA 3ONWA 2CVFA 4C30A 2V1XA 1XEWY 1E79D 1WP9A 2ZAOA 3HDTA 3T1VA 2RGCA 4HDCA 4LPKA 5SZIA 3BJIC 3SR0A 3AKDA 5FBWB 4KCGA 5IDVA 5HCNA 1S4QA 1ZMXA 1OB2A 1GKUB 2QUZA 3QF7A 1NMXA 1OFTA 2A5DA 1ONBA 3SYKA 4BGDA 1AM4D 4D25A 3B1WA 4BWYA 2WWGA 3MD0A 1LTQA 1ZCAA 2WJVA 3P4YA 5G41A 1MOZA 1Z3IX 2XSZD 2FFQA 5FTJA 2G1KA 1XEWX 4OI1A 1T3SA 3HU1A 2ZYTX 2BBSA 1UADA 2HJGA 2KBEA 1QBKC 1FOEB 3DM9B 4XSGA 4KSBA 4TMTA 5HZKA 5BQ5A 4C2TA 1J8YF 2V9PA 4ACBA 4C0SA 5EXSA 3VR3A 2A7QA 5G53C 2IW3A 2IA5A 2AKAB 4HLUA 2H17A 3LX8A 5EZ5A 4B6FA 1C1YA 2JJ1A 4ZCLA 4D2IA 2C9CA 2VSOA 4ZV4A 1G1MA 2UVQA 3RS0A 1DAIA 1EX6A 4TL7A 2GJSA 3DM5A 3ZVLA 4QBHA 2ZI4A 2FSHA 3DHWC 2CXXA 5E7IA 2QTVB 1GDDA 1NN5A 4UXIA 2QP3A 3FHCB 1W48A 1CRPA 4V0LA 1X6VA 1FL9A 2QT1A 5F98A 1N5IA 2GA8A 2XITA 2PLRA 2B7BA 2YVUA 2ODNA 4LCBA 1N25A 2OSBA 1JR3E 2G6BA 1RZ3A 2YINC 2C99A 3K53A 2P6NA 3ZZUA 2EFCB 4A0FA 4R71A 3EA5A 1XMVA 4RD3A 3U4QA 2QE7A 1UKVY 1LNZA 1NBME 1V5WA 3CWQA 4ILEA 4MGYR 2DFKB 3TUZC 3GLIE 1CLUA 4PX9A 1G8GA 2CDNA 1X1SA 1E9DA 2ZXUA 3AF3A 2CCGA 4N0DA 1E9CA 2X19A 4NPHA 1AS2A 2WMNB 2QQEA 1Z0JA 1DBSA 5CITA 5LBIA 3PJRA 1F2TA 4HZIA 3K0EA 1MV5A 3OIYA 4DIEA 4DUGA 1KI1A 4CF7A 1E0KA 3UIEA 1VMAA 1XZQA 1NIPA 1TEXA 2O8FA 3OIUA 4MITA 3SDZA 4GL2A 1GSIA 2Z83A 3W5JA 5TARA 1XEXA 4HI0E 4LYJA 1ZNWA 3EIHA 1DAMA 3GLGB 1IXSB 3EAQA 4P31A 3TRFA 2PLFA 2HF9A 3NWJA 1XRJA 2EFHB 5JSZA 3GEIA 4WZBE 1UBGA 5JCZA 4L5BA 4HUQB 1SULA 3WBKA 4BRUA 4LUCA 1II8B 1ZUIA 2HDNB 2VRWA 3C16C 1NJFA 3X1YA 2RB4A 4OJKA 1OE0A 4FCVA 1COWD 1ZJ6A 3I32A 3LXXA 4DZZA 4KFUA 5JEEA 1G3QA 2C5LA 3LLUA 5F3WB 1KSJA 2CL7X 1AZTA 2ZROA 4PANA 4Z8XA 1DS6A 3C41J 3T1QA 2R6FA 3C7KA 3OAAA 4OQNA 2ERYA 2QGNA 2HLDD 2OCYC 2ZRLA 2C2HA 2GBLA 2O8EA 5B58C 1I2DA 3PR1A 3OIVA 4PSAA 3DO6A 3I5XA 4TTRA 1GILA 4JSTA 2O8BB 4XWAA 5EXTA 2D74A 2FWRA 4URXR 4GT1A 4W5WA 2QAGB 5CIWA 3THOA 4OI4A 3L43A 5JWRA 1F48A 3SE0A 3VQTA 3ZJYA 3ZVRA 2AHOA 3P1JA 3NH6A 1YR7A 5JHHB 1Z6XA 4ERNA 1E79A 6Q21A 3U3RA 1J70A 1HT2E 1E2JA 1OKKD 3NBXX 2GBLC 3B1VA 1P75A 2CL6X 1DE0A 3CR8A 4NU0A 3N70A 5D3MA 2REBA 4XD7A 2ZRMA 5AWFC 2DWQA 4F4IA 4UJ5A 4A0GA 2ZRDA 1CS4C 4BZXA 1SVLA 2ANCA 4XVRA 4HLUC 2JA1A 1LB1B 4FI3C 4EFMA 2IUTA 4Q1CA 4B33A 3X1XA 1UBFA 3X1DA 4PHGA 1EFHA 2B8WA 3FOZA 2MSCB 2PEYA 2YZ2A 1ZD8A 4IDOA 4IDNA 3MWLA 1XEFA 1R2QA 2V1UA 1W47A 1KO7A 2EYQA 3NDPA 4QG7A 1VCIA 1MKYA 3TBKA 1MABB 4LX0A 2QZ4A 3QUSA 1E0AA 3Q7PA 1DO2A 1XXHB 4P4UA 1Q57A 1WMSA 4JLDA 4F7WA 2WWXA 3REGA 3K8YA 2ZANA 3EASA 4HAYA 3AVOA 3KUDA 3QE0A 4H1UA 1H8ED 2ODWA 4QHYA 1B23P 2XAUA 3ECCA 4G0NA 2BJVA 4BFYA 3FWYA 3ADDA 1X8KA 3WNDA 3IBGA 4RJLA 4IOMA 2FPLA 3F0TA 3KXLA 4GOJA 4NCIA 1ZIPA 3L8ZA 3ZIAA 4OHYA 4P4TA 5KYKA 4E5UA 4F4CA 1Q1QA 4NYIR 2REXB 1W0KD 4IDQA 1II0A 4QBIA 1OXVA 2ZRFA 2PL3A 4YLGA 5KSOA 3A4NA 2GXAA 2C95A 5A4JA 1Q12A 2XJ4A 2XXAA 4KVGA 4BEJA 3FMFA 2IEZA 5GJBA 1LV7A 3LBHA 1AS0A 1W4CA 1G5TA 1G7SA 1NP6A 2G3YA 4TMZA 4RFVA 3MJRA 1L8QA 4LJ5A 1UKZA 1KYIA 3R8FA 4HZUA 3HYRA 1QVRA 5IF9A 3M1IA 4A36A 2YNMA 4TQAA 4V02A 2J45A 2PZFA 3P27A 2F55A 4KVAA 2K5UA 2ZIAA 2GCNA 2GAAA 1Q1ZA 5CLQA 1KSGA 3QXXA 1G4AE 2CVHA 1U0HC 2N1BA 2IYQA 4RD2A 2E87A 4ZCMA 1U81A 2J1LA 1H65A 1KZ7B 1OFIA 2JAQA 3SJCA 1G17A 2Z43A 3VFDA 4DLZA 1E1QD 1JB1A 1E94E 3ZVNA 3VTKA 1OB5A 1CJVC 3CZPA 3GJ5A 4B76A 5E7MA 4BFTA 3GPLA 2VBCA 1OHHA 1X86B 2FFAA 5EXXA 1GIAA 4MUAA 4UNQA 1UM8A 2BWJA 2BIFA 1BH2A 1QZXA 5IHPA 2GCOA 2ZI6A 4PZLA 3KQKA 4G1UC 1U94A 1NKTA 4JBYA 4NDZA 3WYGA 1M6NA 2VHCA 1QG4A 2XGJA 3NH9A 3AP1A 1KK0A 4B47A 5KNDA 4TN1A 1TQ4A 1P6XA 1FNMA 2QPOA 2SHKA 1K8RA 2ZREA 2VF8A 4H1VA 1ZM7A 3AF2A 1XF9A 3QEOA 3UG7A 5DN6A 3QI2A 4YDHB 4QGGA 3N2IA 4HUQA 4A15A 1T8UA 1RJ9A 3W90A 4TQUS 1TQ2A 2C96A 1TADA 2NO6A 5AR1A 3P32A 2FJUA 2BCJQ 4PHHA 3SYNA 1RPZA 4TT3A 4JYCA 3K0FA 4NCKA 4Q4HA 4B2PA 1XD2B 1R8SA 5TB5A 5HR5A 3CRMA 4LJ4A 1R7RA 1UFQA 2WICA 4ZO4A 2IYTA 3HU2A 1PV4A 1TF5A 4ZCIA 4HLQB 2VP0A 4O0MA 1HT1E 3IIMA 1QF9A 3MSXA 1F2TB 3BH7A 3M4YA 2JJ2A 3SNHA 2OUKA 3BFXA 4CEHB 2CK3D 1Z6AA 1KAOA 4PXAA 4TL8A 4KXFB 4BLQA 1YHNA 2F43A 1D5CA 3R7WA 4XD7D 1OXSC 2GVDC 4RD6A 5FBRB 5CK4A 1X8LA 2ZUBA 4B32A 4M1TA 4OHWA 4TTQA 1U90A 4TQ9A 4B3XA 1DPFA 5CIQA 1OIVA 3AUYA 2GWHA 3GEHA 4V0MA 1E4YA 1R10A 1P2VA 3AEZA 5KHOC 3VR1A 4B3CA 3TVDA 1TTTA 3MWKA 4RZ3A 4XJXA 2UKDA 4D80A 3SBEA 1OJLA 4DLVA 2JDID 2FGJA 1YQTA 3VKWA 4B74A 4TSFA 2A5YB 1A7JA 1U9IA 1G3RA 1Z0KA 1IHUA 4YONB 3IPYA 3CPEA 3CRRA 1R0ZA 2QAGC 3Q3JB 3K0SA 1Y63A 3CF0A 2FEOA 1RW4A 2VSXA 3MWJA 4B2IA 1ZD9A 3QOFA 1CXZA 2IS2A 4J0QA 4D0NA 2GEVA 1KKLA 3CX7A 4Q9LA 2CE2X 2D06A 2W0SA 1EG7A 4FD2A 4JLMA 3PEUA 2J7PA 4Q19A 1S3SA 4M0LA 3BERA 1IM2A 4RD4A 4EKDA 4F38A 1V43A 1XEXB 2WHXA 4RKFA 4DLWA 5HE9A 4IDPA 1D2EA 3U4QB 1ZW6A 2QG6A 2XEXA 3QY0A 3B1ZA 1AK2A 4BECA 1ESMA 2Q3HA 3N2EA 4QFMA 3PEVA 5E3HA 1DAKA 1L7VC 1E1RD 3K70D 2W58A 2BMDA 3B2EA 2IUUA 3CO5A 1NVUQ 4LJAA 4Q4LA 2WSMA 4Y0VA 1HA3A 8OHMA 5M04A 1EFRA 4I1SA 3LXRA 3B9PA 3REFA 1WQ1R 2JLWA 4AG6A 2ZRNA 1G3IA 3L2OB 4W9MC 5EP1A 4OK3A 2B7CA 1O3YA 4TZ6A 4B43A 4CVNA 2F3TA 4A92A 4JLJA 3U2QA 4L15A 1KI6B 4V03A 2NO7A 3DDCA 4PC3A 1GNPA 3W8RA 2IF2A 5FOWA 4M2LA 5GADl 1KI3A 4G5OA 4PAQA 3Q9LA 1JI0A 2NO0A 1J7KA 4NE2A 1T5LA 2WWIA 4JLNA 2H57A 3P4XA 1CJTC 1XDBA 2ATXA 2YC4C 3K1JA 4EJSC 3MJHA 1KTVA 1HE8B 3U3OA 2NZ8A 5J4LA 3TJZA 3GJ4A 2GEDA 1GL6A 1OF1A 5DH9A 2NZJA 4E03A 3QG1A 2VHQA 1KO5A 2ZRCA 3OAAD 1G19A 2GF9A 3DMDA 1ZYUA 4A0HA 4JSYA 3EIEA 2GJKA 1EFTA 4XOIA 4IVPA 4DLRA 5G3YA 3TUIC 3BK7A 1QVAA 3GFTA 1B0UA 4TYQA 1II9A 4Q01A 3E5HA 2ZS8A 3CRW1 4DKXA 1KAGA 4O3MA 5BXQC 1IAQA 4M1SA 1N6HA 1JXMA 2PCLA 3ZZ0A 1DARA 5C2JB 2RGNA 4IW3B 1E98A 3K0FB 2VTKA 4Q4HB 2G83A 4RZ2A 3DKPA 4EPVA 1OH6A 1T0JB 1VHLA 4LRWA 4Q9IA 3X2SA 4JMPA 1XU4A 1VPLA 3QBVA 4MGIR 3U6BA 1T0HB 2BBTA 1KY3A 2Z4RA 5L3QA 3LQQA 4JT2A 1P61B 2FX3A 4XSHA 5AJWA 3I92A 1YJ5A 3J81k 1XTQA 3IBYA 1G9XA 3NEYA 3EZ9A 4PZYA 1OPXA 2H18A 2OBNA 1RFLA 4MYTA 1FP7A 4NBSA 1FMLA 1OSNA 3OEHA 4UNSA 2OBMA 1NRJB 1XTIA 4Q5IA 2GJ8A 2VHTA 1SVOA 4LHYA 2LCFA 2VIIA 1JQJC 3CR7A 4DXAA 3RWMB 1Z28A 1CIPA 1DAHA 1R5BA 2PMKA 4EJSB 3G82C 1S2MA 2QMHA 3NBYC 3THYB 4KV9A 1QHYA 4A8JB 2IS1A 1CJUC 3TSWA 1GFIA 1ZU5A 1E9EA 3ZIAD 1RRGA 4E07A 3A36A 3SS8A 5AK0A 4PPFA 3TQCA 2C77A 1VDZA 4IVQA 1AGPA 4B3FX 4D82A 3TLXA 1W44A 1Z06A 4FINA 3CF2A 3CLVA 4OKSA 1GITA 5AUPB 3A1WA 1G5PA 3WMFA 2IYUA 5EUMA 3I8SA 2ZS9A 1M74A 4B73A 4MDFA 1BMFD 5KDOA 1QHHB 1GG2A 4HDOB 4FXPA 3SBDA 4D4JA 4DCSA 4C0JA 3TVTA 1YRBA 4TMVA 3FHOA 1U8YA 2L0XA 3KL4A 4OQXA 4KFRA 3AKEA 2NPIA 5C46F 4C2UA 4NCJA 2CLCX 3DMNA 5FR1A 2CEAA 2OFXA 3B13B 3MAAC 1S1MA 1SQ5A 2DPXA 3E1SA 4R2IA 2FFHA 5D3MB 3UKDA 2O8FB 2O0HA 4TZ0A 4ARZA 2EWWA 2WM9B 3AVPA 4NZYA 3A37A 3FB4A 1XTJA 1IOZA 1RYHA 4PO8A 4QRHA 4N3NA 3QKUA 5JJKA 3ETLA 1G16A 2PX3A 4LJ8A 4ZKEA 3O8BA 4ZI2A 2I1QA 4LV8B 3GLIA 1G8YA 4K81B 1DAFA 4NH0A 5CJPA 1E2FA 1Z47A 2VP2A 4US0R 3QVUA 5BYJA 4L9SA 4LBWA 2ONJA 1G7TA 4A4DA 4Z1MD 2QSYA 2YOHA 1SVSA 2VP5A 3WYFA 3KKMA 3D3QA 4GP6A 1WF3A 2W2VA 3AV0B 3KKOA 4EPYA 2JLXA 1BKDR 4D26A 2O8DA 2O8EB 2HLDA 2IYVA 2Q0HA 1XB2A 2RGAA 4M1YA 4B35A 5EP2A 3OEHD 4AWXA 4CEIA 1KJYA 1Q20A 4US1R 1W0JA 2XOKA 3IHWA 2OFWA 4CEJA 4YXWD 2J0QA 2YWEA 4QNMA 1F60A 1E0SA 4CT4B 3GLHA 3IHLA 5LB2A 4FWIB 3I72A 2V3CC 2FMXA 1NLYA 1JAIA 1FQJA 5JECA 1P2UA 2FA9A 1RE0A 4Q4JB 4RFSA 1SVKA 1E2QA 3W8NA 5FPTA 3CWZA 5EE5B 4PSKA 3ICQB 3UMRA 4QJ3A 2O8CB 3NKVA 4LJ9A 2I4IA 1QHGA 2J0UB 5KNCA 1KI2A 3A1UA 1TEVA 1CR1A 2DR3A 1R0YA 3LH5A 1NMZA 4IRUB 1KMHA 5EP4A 3B8HA 3VU9A 1DAGA 4Q9HA 3TMKA 3FFBA 1UF9A 3NDBB 4W5JA 4M9QA 3A58B 2DWPA 3OHMA 3IIKA 4YMTA 1IXZA 1JEEA 3KKPA 4A0RA 4O2RA 3K70B 1XTKA 2VHJA 2Q9AA 3CNLA 1NVVQ 2B8TA 1Q1BA 1KSFX 2JIZA 3D6TB 3RRZA 4A1FA 1ZM3A 2JCSA 1HUQA 3DKVA 1JQLB 1YR8A 3AP3A 4IJMA 3RS5A 3ZVMA 2IXGA 1KOFA 3IGFA 4Z51A 3B1XA 2R44A 3LRPA 4LYFA 2DCUA 2P5TB 2WJYA 3BXZA 4YMUA 3I1FA 2FE4A 4WAUA 2AXPA 2Z5FA 3ZYCA 2A9KA 4PO1A 5KDDA 4JLPA 4ZDWA 1J8MF 4JLVA 4MRVA 5DHAA 3SQXA 4ZIRB 2CHQA 2J0SA 4DLTA 1NSFA 1DELA 4PPNA 3FKSA 3WXMA 4HZUB 1U8AA 1UKYA 1KNXA 4MKGA 4QM7A 3UWOA 2NO9A 2A5GA 1SHZA 1YKSA 4TYNA 4OK6A 4CEIB 5FTMA 2QMUA 4JL6A 2OM2A 3BFVA 1GTVA 1LS1A 4QC2A 5EXPA 2O0KA 1JEDA 3GJXC 4Q18A 1IONA 1FPMA 3TR0A 3SQWA 1GM5A 4G3XA 1T3LA 2G77B 5FUVA 4M1KA 4QGHA 1AA9A 2DY1A 2BMEA 3CM0A 3LAWA 2AK3A 3OESA 2NPFA 1EK0A 3LW8A 5GJCA 4DDVA 1SXJC 4C3ZA 3AKCA 2QBYA 2VLIA 2DFNA 2XZPA 1W4RA 4PC1A 2P2LA 2C04A 3AVTA 3QKRB 1P60A 4BLPA 3FMOB 3NXSA 4EJSA 5A5GA 5AUNB 4AY2A 1ZNYA 4PQRA 4FMCF 3WMEA 3I62A 1H8HA 3KB1A 4DLXA 3L82B 2IYZA 1G291 3MWYW 4OHZA 2CE7A 3EZFA 4AD8A 5BN5A 3X1WA 3EIQA 2V7QA 3GCGA 4JL8A 5LDDC 5KPJA 2ZRKA 3PUXA 5H68A 4AI6A 5HKKA 3HR7A 1JJVA 2RHMA 1OH5A 2VP9A 4MGKR 1MH1A 5FR2A 4DT1B 5KSZA 1QHHA 4Q7KA 3R9XA 4DSNA 5FPYA 4HB2A 4NYMQ 3ADKA 5DN6D 4M9ZA 3FFAA 3GJ7A 1IN5A 2WTUA 1YU9A 1N6IA 1YR9A 1JR3A 2QRNA 4DLUA 4HAXA 2JJ8A 2AD1A 2IYSA 3EW9A 2KJQA 3RS7A 4Z1MA 1R0WA 3KFXA 2Q3MA 4EIWA 2MMCA 3GLHE 3AF4A 1N6LA 3JZMA 2TMKA 1QHIA 3BWDD 1G64A 2XTZA 3IO3A 3PUYA 4IFBA 4AG5A 4JL5A 5AUQA 5A0FA 1GP2A 5HTKA 1N0WA 4QNRA 1OHHD 4YXWA 1E2KA 4R2HA 4JIMA 2IBMA 3VAAA 2GDJA 1OV4A 2HXSA 1X1RA 5KPDA 2ZUDA 2ASEA 1T5IA 2ZI5A 4YMWA 5FOTA 3RABA 4P4SA 1P9NA 3NIBA 5EZ6B 4L9WA 3BD9A 3GLIB 4DSTA 3GJ6A 3V4FA 2XNDD 3W3ZB 4W7SA 4DLYA 3ZS9A 1ETUA 5GVRA 2PZEA 4DDUA 1DOAA 1SXJD 5IK2D 2NMVA 4ARZB 2BEKA 3ZZTA 4M9XA 1OYYA 2O0JA 2ZS7A 2O5VA 3L0PA 4OQLA 4BPBA 2E9SA 5L3SB 4CEJB 2R9VA 4PQFA 3AVVA 5F9HA 4R98A 2CLSA 2F6RA 2PBRA 4BASA 2CHVA 1Q3TA 2X2EA 3P20A 3GLFA 4ZI3A 1GNQA 3QJYA 2ZRIA 2UZ3A 1K5GA 1X8JA 2EWVA 2YKGA 1A2KC 3CW2A 2OILA 3CH4B 3LFUA 2CCJA 4EQ6B 1KDRA 5CM9C 5DYIA 5DHFA 5F2EA 4UQOA 2FSGA 4PO9A 2AXNA 2Q6TA 5GVSA 5JJLA 2GTPA 4D6PA 2FEMA 3A4MA 1NG1A 1WBBA 1XMJA 3CPJB 2OE2A 4LOAA 4PAOA 2OCBA 2AFHE 3U7HB 4YQFA 4P0TA 1XD2A 4LK2A 4DCUA 1XPUA 1N5JA 2GXQA 1AKEA 3Q8XB 4LSGA 5CK5A 2BKUA 1FZQA 2ORIA 2C9OA 5BYKA 1P2TA 3KKNA 2XJ9A 4O2LA 4TLAA 3ADCA 5JJIA 4LBVA 3T12A 3PVSA 5CM8B 2WOJA 1GAJA 1CR2A 5K8LA 1E2HA 2AWOA 4PFSA 3CPHA 1U9IC 2J5XA 5FTKA 1IN6A 1CJKC 4TLCA 1TF7A 2NQ2C 4QOSA 2ZRHA 3M0EA 3SFZA 3O47A 5L3QB 3QPUA 2J0VA 4OBEA 2W6JA 2X1VA 1VG8A 4DCVA 4MGZR 4C0AC 3PG5A 4NYJR 1E96A 2GVZC 3QXCA 4XVUA 1W0JD 3MCAA 5DI3A 1M2OB 3KTAA 3THWA 2ORVA 1RC8A 2J46A 5TY0A 2ZJAA 4W5HA 3RAPR 2GJAA 5FPSA 4Q7LA 1KO8A 2XB4A 4OI0A 3CZQA 4Q1EA 4Q4AA 2ZI3A 1M7BA 2OAQ1 3AVXA 5TVKA 2RH5A 4MDEA 4FIDA 5KU1A 3VR2A 3PUVA 3U7EB 3U44B 1IN4A 2ZSAA 1GL7A 4OQFA 1P9WA 3LBIA 4POAA 5J4VA 3K09A 4G5SA 4QL3A 2QL6A 4TL9A 2MSEB 4GOXA 1R4AA 4RKEA 3H84A 3AF0A 4Z8YA 521PA 1T9HA 2BBOA 4XVQA 1L2TA 4ZIRA 2FSIA 3IIJA 3AGPA 3B9QA 2LWIA 1J90A 3R9IA 2F1JA 3FDIA 4YMSA 4C0QC 1T4GA 1NBMD 4KODA 4G01B 1N0UA 1IQPA 4II7A 4B6EA 4ZDKA 5K8IA 1G41A 1NF3A 1W36D 1G6HA 3TW8B 1E2IA 2KE5A 1HH4A 2ONKA 4WZAE 2ZUCA 4QJ5A 1HURA 2CL0X 1ODFA 4GOKA 1Y3AA 2JLRA 3TUJC 1YZGA 4BFXA 5DLQC 3WP1B 5JZVA 2G9NA 3CKLA 3FTQA 1AJEA 1UEIA 1E2LA 2AL7A 2GXUA 5EUQB 1ZNZA 3RS4A 3V4RA 3TNFA 4DDTA 1NY5A 2IT1A 3QF4B 4NP6A 2WSSD 3F8TA 5IK2A 3KX2A 4Q1AA 4JT4A 3U7FB 1UDWA 4BZPA 3DZ8A 1GKIA 3RSLA 4OL0A 2ZE6A 5AJVB 2IXFA 1OYWA 4OJQA 3U61B 4MRNA 1BOFA 4I81A 1E9BA 2GJ9A 1DO0A 3HWSA 2QM7A 3HR8A 1SVWA 4NCHA 1W7AA 3H2YA 2VP6A 3D7MA 1HV8A 4C7OB 4DJTA 1CJMA 1FTNA 3LWNA 1YZLA 4C0KA 2X2FA 2QE7D 1N6RA 621PA 3AVWA 5TMPA 3FMIA 1KKMA 2G0TA 2NG1A 3EZ6A 5KTYA 5B57C 1CEEA 1P3JA 2WBLC 5FOVA 2VH5R 4TYPA 3ZGXA 4IVRA 1EX7A 4KO8A 2OFOA 4E22A 1KK2A 3QG5A 2D2FA 2F9LA 2ZJBA 3BH0A 5C4GB 4P33A 3UK6A 2QU8A 2BEJA 4DB2A 3R8CA 3LY5A 1P7CA 3LBNA 3FGNA 2AKYA 1XCPA 1KI6A 3OEEA 4FW9A 5CDFA 5IT5A 3QKTA 4Q1BA 2W2TA 1PVOA 2BM1A 5JEDA 4G5GA 2WIBA 3VKGA 3V00A 1H8HD 4LZZA 1W4AA 2QAGA 2D62A 3QQ5A 4JVMA 4QHSA 2DWOA 2FGKA 5D3QA 4EUNA 5JS8A 3NC1C 1TNDA 3TIFA 3ZQJA 1VIAA 2IYWA 3CONA 5AJXA 1BYUA 2P65A 1KDTA 1YZNA 5BN4A 4WW0A 3IQWA 1E1QA 3QKRA 4RVCA 4QKQA 1G4UR 2NIPA 2WIAA 2HT1A 5L8VA 1JR3D 2W0MA 4V0ME 3RRNA 1QHSA 1J99A 3W5IA 5KUTA 1OXUA 2ZQ5A 3TW4A 1HTWA 2FZ4A 4BE7B 3BRWD 1S96A 3ASYA 3B7GA 3SN6A 2EFDB 4DSOA 4URZR 1XD8A 3TSZA 1KK1A 3OFND 1RJ9B 2FDCA 4C4PA 3LV8A 1NLZA 2WMOB 4B34A 5BN3A 1Z0AA 4OHVA 3PENA 4ZDJA 2WJJA 3W9YA 3QXJA 3TE6A 2HEIA 3U7GA 5DIFA 2YYZA 2DB3A 1M8PA 2H92A 2IXEA 4ABYA 2OCPA 3IUYA 4RSGA 4LPSA 3GLFE 1P2SA 2ZPTX 4KI0A 1F6BA 1E2MA 3SJAA 4GPTA 3NG1A 2QP9X 4Q47A 3Q72A 3OE7A 4A2PA 2IWRA 3KQLA 3MMPA 4QGFA 2VO1A 4OQMA 3ZQ6A 1VIYA 1F5NA 1EWRA 1PUIA 1JAHA 4BLTA 1F3OA 4ON9A 2JATA 3LQRA 3IEVA 3K0CC 4NHOA 2GNOA 3LLMA 1HY3A 1SZPA 2JJ2D 3RWOA 2G0NA 4EPXA 1OXXK 3PITA 1LY1A 1UDXA 1AIPA 1HQCA 3R7WB 5AJZA 1QG2A 3QF4A 4U5XA 1Z29A 5FPHA 2EYUA 4D4MA 3CX6A 1PUJA 5JCPA 3LNCA 2VP4A 4Q1DA 3ICEA 1UJ2A 5TDHA 2CNWA 2F1RA 4BLOA 2N46A 4HUTA 2H1LA 2HUPA 2FH5B 1LFDB 1VYUA 4M1MA 2PEZA 3EWAA 4MRRA 4HAWA 3AH8A 4UNPA 2YWGA 3EG5A 2AK2A 3UG6A 2JEOA 1Z0IA 1SHKA 2DBYA 4AKIA 3SHWA 3KJHA 3RS2A 5UKDA 3GP8A 3C15C 4WZ6A 5DGXA 5JRJA 4HLCA 1US8B 4MKFA 1E2EA 5CJ2A 2I3BA 3RHFA 1AKYA 3SC3A 1R5OA 2YV5A 4UJ3A 2WWYA 1M1YE 4B75A 4DT1A 3LD9A 1CR0A 1T3HA 2X77A 4KAXA 1Q21A 4X8HA 3I5YA 1LS6A 4RD1A 4URYR 4DCTA 1VKJA 4GMDA 4YMVA 3HJNA 2Q3FA 1FX0B 1N6KA 1NJGA 4QXAA 1OXTA 3GEEA 2P3SA 4IDHA 3QPVA 1DEKA 3QKSA 1GZSA 4LHZA 1P5ZB 4IOJA 2RMKA 2I1VB 1MO6A 4LHXA 2CCKA 4KSCA 1TU4A 1QHXA 2BMFA 1R5NA 2XTMA 1NL3A 5CLLA 5EQTA 2GAOA 4FMDF 4EFNA 1GRNA 4I4LA 2ZM5A 2A5FA 4QBGB 3X1ZA 4CIDA 1OT3A 2AFIE 2QN6A 4AK9A 2ZJYA 1GKYA 2ZYWX 1GL9B 1G7RA 1OFHA 2QA5A 2W6JD 4MKIA 5EE0A 1JPJA 4GZLA 2KWIA 1RRFA 3BAFA 4DB4A 3OE7D 3GLHB 3UXMA 3NHBA 3PEWA 4OI2A 2FZLA 1QHNA 4JBWA 2GZAA 4QBFA 1IY0A 1FW6A 2UZIR 2OCAA 4BRWA 3VU9B 2N42A 3CH5A 3NTUA 3B78A 3O8DA 2FV8A 4Z54A 4LV5B 3U6KA 1NKSA 4JLAA 3FKSD 1A4RA 3PV0A 4B44A 3ZH9B 3E70C 4NYJQ 4BQSA 1WBDA 4TMKA 1JBKA 1WCV1 2RGEA 4KFSA 4EPWA 3FMPB 2OT3B 2E1RA 5EE3A 1J2JA 4Q4JA 1F2UB 2O8BA 1FNNA 4LWZA 3VHLB 4DSUA 1FTSA 3HP1A 1XTRA 4BZQA 4E09A 1AZSC 2R8RA 3AVUA 2ZVQX 2HYDA 4IFEA 3I8XA 1RKBA 2CK3A 1KY2A 1XJCA 3EPJA 3VR4A 2OESA 2IYLD 2F9MA 4TLEA 5J4YA 1W1WA 1NVXQ 1E9AA 2WWHA 4R9UC 2IK8A 2OBLA 3ND9A 4Q9JA 2BVNA 2P6RA 4FN5A 4KITB 1YVDA 2CLDX 4M9SA 1BYIA 1E32A 1E2DA 3QIAA 5IRCD 1NSTA 4GMXA 4Q9KA 2QQ0A 1HEIA 2F43B 2RKOA 1FX0A 3N5CA 1EESA 4X8MA 2ZU0C 1OIWA 2Q9BA 4LDJA 2P67A 1NMYA 2JGNA 1N6NA 2QT0A 2PZGA 5CB8A 4CZ2A 1TUIA 2PT7A 4A9AA 3WRYC 1NN0A 4ZKDA 3BIFA 1TF2A 4D0LB 4D0GA 2BM0A 4DLSA 3GLGA 1GOTA 2W83A 2Y8EA 1T6NA 1GVNB 1ZM2A 2VPPA 1KDPA 2IF0A 3H4MA 4L4UA 4HSEA 4M53A 1KSHA 4LBZA 3K70C 4FMBB 3ND8A 1E9FA 4GNKA 4TLDA 1Z0DA 1CP2A 4NONA 5KNBA 4ZPXA 1W5SA 1TUEA 2KSQA 5DNYB 1HE1C 4PR0A 3K09C 2A5JA 3FE2A 3AQ4A 4IEIA 5TV2A 3U3MA 4KHZA 4MYUA 3G0HA 1CRQA 4HB3A 2BBWA 3HU3A 4P4SB 2H7VA 2VL7A 3ZLJA 3BFKA 3NVAA 3NBFA 1VTKA 1AQYA 1XX6A 4ASUA 1OLOA 2DYKA 3Q85A 2HV8A 2ZEJA 1NN3A 1ZRHA 1Z0FA 1Z2AA 2IL1A 4HYYA 4U7DA 3TQFA 2Z6VA 5SZKB 1DTSA 1GNRA 3BS4A 2ZTSA 1G8FA 4PHFA 5H8WA 3FKQA 1VG1A 2QM8A 3FPAA 5JHGB 3LO5A 5H1YA 1C4OA 2J7PD 2QSZA 2WVJA 3S1AA 1L4UA 3B1YA 1ZC3A 5ELXA 2W6IA 1JR6A 3RLFA 5K8UA 5FOXA 2WJHA 2D7CA 3RVBA 1Z6YA 2YWFA 1HQYE 1MT0A 1QDEA 2GXSA 1E9RA 2ZITA 4TYYA 3QNUA 1E0JA 1SXJB 2DHRA 2ZSFA 4K8OA 3F5FA 2P5SA 1ESNA 2WKRA 3A1TA 2MMGA 4JYBA 3W34A 1YR6A 4XH9B 5JBQA 3LDAA 1DG3A 1D2MA 1Z83A 2RGGA 2YOFA 1VCOA 2IC5A 3LVRE 3LX5A 2XZLA 3VKHA 4CRWB 221PA 2GCOB 4F4JA 1RIFA 4WVFA 2QRZA 1G3MA 2QI9C 4A6XA 4TWZA 4ITRC 2PH1A 1S3GA 4BEBA 1FFHA 2R6DA 2IX3A 4AKHA 1I4DD 1VG0B 3JZAA 1Z22A 4C7OA 5SZHB 2F1HA 5EE9A 2AWNA 4LYHA 1R0XA 3PIRA 1VYTA 1AN0A 2RCNA 3THYA 4XTCS 5H70A 3CNNA 5FPKA 5DE3A 2C78A 4IXNA 1U99A 1JJ7A 4LHVA 4MRSA 5JI3E 5AUOB 1TX4B 5GJWC 1VG9B 1YE8A 2XTNA 2GILA 3EXAA 3IEUA 4KYIB 2C9YA 3AF1A 2ZRJA 3KZ1E 3KXKA 5FH9A 1ZVQA 2ZR7A 4HAZA 2WPDD 3SOPA 4AKEA 1WXQA 2WZQA 2HXYA 1P73A 5DISB 4BFUA 1Q44A 2QGZA 2VHUA 2OLKA 5AJYA 2ORWA 2HT6A 1D9XA 5J5CA 2DFTA 4CGZA 1NI3A 1XNJA 3BB1A 4A82A 4TT3D 4KBFA 2PMDA 3P26A 4GBMA 1T91A 2CJWB 5JI2E 2GEUA 4KYUA 1N3BA 2F7SA 2FN4A 4LJ7A 4DC9A 1FMJA 3R9WA 5EJEA 3K9NA 4TYWA 2W00A 4XIGS 2OO7A 3V9PA 2GK7A 4MRPA 3K9LA 3CRVA 1BS1A 3ZDQA 4OYHA 3CF6R 4JBXA 5JWOA 2QENA 2KB0A 1K6MA 4DEYA 1WDTA 2ZJ8A 2JLUA 2HYIC 3KB2A 1KIMA 3I61A 2QPAA 4IOLA 1YZQA 3K0AB 4I99A 1LF0A 1W49A 4KBGA 3H0KA 5HCIA 3VMFA 3EA0A 4UXHA 5G3ZA 3GFPA 4NYMR 1W2GA 3OZXA 1MABA 3A8TA 1XMIA 5DYGA 3EC1A 4DUGD 4B2LA 1Z07A 3E2IA 4N1AA 4RZXA 4Y0AA 1DAEA 4RZUA 2WWWA 3WHLA 2ZJ2A 1TMKA 4JLOA 3Q5DA 4Q03A 2QTHA 4RFSB 3BC1A 3PUWA 3VR5A 5C18A 1WA5A 2B6HA 1M34E 2ZR9A 2ZJZA 1IN8A 2IEYA 3W6NA 3GJ8A 2GK6A 3CB4A 2WOOA 4KFTA 4F92B 4MYHA 3PEYA 4HAUA 2ODBA 1IJFA 4AC9A 4HB4A 4AURA 1N6OA 5C1BA 1Z63A 4NKRA 3SFVA 4PPQA 4WBSA 2EFEB 2WAXA 3AUXA 4M22A 2W2XA 1Z08A 4KJZA 5FUYA 1CU1A 3AGQA 2EU8A 2HCBA 3CBQA 4JKIA 1W5TA 3KDSE 1M7HA 4URUR 3TR5A 3G5UA 4FMCB 3SJZA 2PX0A 821PA 3A4LA 2EQBA 3O8CA 2A3RA 5L3SA 1A5TA 1IBRA 1N5LA 1P4SA 2BCGY 2FPMA 2H16A 3PUZA 4JVNA 4MH0R 4Q1FA 1ZC4A 2FU5C 4FWTA 3PFIA 2IYYA 3K9HA 1EFRD 2GZDA 1BMFA 5KSPA 1G3UA 4R7ZA 3KJGA 4O25A 5KDLA 3SI7A 4U02A 1EFCA 1XCMA 5FL7D 4Q7MB 4WOPA 1E1RA 2EW1A 2QORA 1D2NA 3VX3A 5DI9A 3WP0A 4WA7A 1TQDA 2CBZA 2ZETA 5KOYA 1XJ0A 1NY6A 2QEQA 4A8JA 5CYOA 5DSZA 3T5GA 3QBTA 1G5RA 2J7KA 2YWHA 5JLJA 2NGRA 4GP7A 4HAVA 1KI4A 3PQCA 2KBFA 3T1TA 3A1VA 1E6CA 2PT5A 1P72A 1OKKA 3C14C 4ACAA 3SEAA 1KJZA 2BDTA 3RNLA 4Q00A 3RSOA 3IO5A 1KK3A 2R6AA 4AIIA 2LKCA 5LPNA 1R8QA 2ZRGA 1AS3A 3KFVA 2WAYA 1D8TA 4URWR 5FOUA 5FUWA 5CDFE 2BOVA 2EFGA 3GJ3A 1I4LD 1CF4A 4RCYA 4FCTA 2V55B 2IS4A 4LY6A 2FG5A 2BKEA 2BHRA 2RGNC 4XWOA 2QPTA 1Q22A 4PC7A 4PAMA 4DWJA 1XBTA 2XSZA 3BGWA 4NTZA 4AYTA 2IS6A 1SXJE 4JLBA 1YZKA 5E4FA 1KNQA 2IHBA 2MSDB 1S1CA 1ZINA 1ZD1A 3LA6A 1XTSA 1SKQA 2G88A 3GLGE 4MKHA 2J9RA 1OH7A 3EZ7A 2ANBA 3VX4A 3EPKA 3B85A 3F3YA 3OF5A 1EFUA 4XTRA 2V6IA 2IYRA 3GJ0A 2BMJA 4DHEA 4CEHA 3R20A 3ASZA 4X8OA 2GZHA 5B64A 2J87A 2PJZA 1KMQA 1N2CE 3DOFA 2NTYC 1XXHA 1WE2A 3QXSA 4AKGA 2ECKA 1L4YA 3EPHA 1CTQA 4GSYA 4K46A 4DIDA 1W36C 3NEJA 2XZOA 2JIZD 2RGDA 1ANKA 2H5EA 3UMSA 4ASUD 1CKEA 5BW8A 3AVQA 2RGBA 4JS0A 4QJ4A 2XXAB 3C5CA 3MRSA 1US8A 4IXMA 1UBCA 3RS3A 2JASA 3L0IB 3SHFA 2ODEA 4C0HA 1G21E 3FVQA 3W3AA 1JPNA 1UBEA 4LJYA 4PSVA 5EE1A 3T15A 1MO4A 4WIAA 3L0OA 1ZAKA 2V4ZA 4PZZA 5FTNA 1U0LA 3GQBA 1FP6A 1G7CA 4RY2A 3TSOA 4S35A 3B5JA 1E2NA 1O87A 1N0VC 3VNVA 3UPUA 3TGPA 4V0OA 3U44A 5KO2A 1ELOA 3WNCA 1CBUA 2ZRPA 1UPTA 2VEDA 4BFWA 2FFBA 1D9ZA 5LD2C 4G5RA 2RAPA 1M7GA 2ZJ5A 3NC0C 4TSFD 2X8AA 1KZGB 4PC6A 4EPTA 2PJRA 2QNRA 4A2WA 3EWSA 3TAUA 2ZI9A 5L3VA 4JVSB 1VCMA 5DI3B 2R65A 2RHDA 3THWB 3AP2A 4OHXA 1MR3F 1TAGA 2XX3A 4TL6A 2O52A 1BIFA 2CNWD 2Z0MA 4KLZA 4HB0A 4DCNA 3QVVA 4DEXA 3CX8A 1YZTA 4EDHA 4GI7A 3TK1A
chains in the Genus database with same CATH superfamily
1E7QA 3UAXA 3HZRA 4L5YA 4DCOA 3Q9UA 3A7EA 3EHDA 4DQXA 1ZY2A 1ICEA 3SJ7A 1YL5A 2BJWA 2XNSA 3FGOA 5JECA 1UBUS 2F3RA 1WZNA 5FL3A 2IODA 4I6JA 2WLSA 2LBPA 3BB3A 4EJ2A 2ATEA 4FFSA 5BSVA 2X22A 3C7TA 1WVGA 3CZ9A 3L7LA 4K28A 1IY2A 2M2IA 2GRJA 1QO9A 3O74A 1FS4A 1QB7A 3BCHA 4O08A 4UM8B 4GOOD 1ZI6A 3UMFA 4GLLA 1WZUA 3ZD9A 5AVRA 1HLGA 5K4AA 5AM5A 1NNEA 1CX9B 2F8MA 1P7ZA 1H1LB 4KOEC 3S5JA 1M83A 1EFPA 3ZI7A 2HMTA 3EUEA 4CDGA 1WWKA 1WM1A 1XXHE 4H6VA 1CC1S 3IKJA 1TD1A 1UJCA 3JU3A 4G0QA 1ECFA 3K0CA 5EPEA 3S7TA 2QKYA 5JMOA 1T0PA 3TTVA 2J4CA 2NQ8A 1M6WA 4PLYA 3RVMA 1QH8A 1M6VB 3N8IA 5AKJA 3ZUPA 1PHRA 5FBLB 3OZWA 4KQXA 4OH1A 3ZE2B 1NQOA 5JS6A 2MINB 1GT91 2H3EA 4HEJA 1X7HA 1Y89A 2Y6VA 1OD6A 2QMEA 1PT6A 1EUDA 1J97A 1KFEB 1O5IA 2HMWA 3EXHA 3RRYA 4H7PA 4A5OA 5D86A 3WMWA 1R9NA 3CRQA 3PC7A 3GRVA 3LBFA 4PRKA 4CV2A 2FZKA 5MGBA 3FDZB 3HMQA 1RYFA 2Q7XA 1QO7A 4DM3A 2PE5A 2P6PA 4CF6A 4P32A 3CVYA 5T8KC 3R6GA 1R4MA 2ZSDA 4DDWA 3MZ0A 3L5KA 1TW2A 2N9UA 3H11A 4HDQB 1ZRMA 3TCNA 1CUYA 2ID8A 4WVLA 2OHIA 2XUAA 1NFQA 5BSMA 1JR4A 2Q0SA 5HRUA 2AS0A 4P93A 2HR1A 1B4DA 1J23A 2C57A 2JLBA 3FWZA 4RF5A 1DX9A 5DYWA 3QU9A 4DMLA 6ABPA 1VYVA 5DM60 2J59A 2BFBB 3H2HA 2EX1A 1GRQA 2JVKA 1IY1A 4CQLA 3A05A 4Z3KA 1SHTX 1TPZA 4O4IB 4OMDA 4I9NA 1RFGE 4A2CA 2NU9A 4ZVMA 4DAEA 5EIXA 2D7DA 3ZNNA 1E1YA 3OCJA 2Q5FA 3DR3A 3GIWA 2YWDA 4QEZA 1BU8A 3UMBA 1KI8A 1C8VB 2JIRA 4L74A 2YJ3A 5ITSA 3QLTA 3TQOA 421PA 1X7YA 1C0EA 5I8WA 4XM2A 3GRPA 5EWLB 4YC7A 4PG6A 4YALA 3ZWAA 5JNRA 2EGUA 3PI6A 1P0CA 3GLTA 4NU8X 1I3KA 4OHKA 2P9BA 4GVXA 1C7QA 4G36A 3MYYA 2ATVA 3I09A 3TPCA 4BV2A 3L01A 3SMQA 4F9EA 3LY9A 4C3UA 4CG0A 4QTXA 5KTKA 3VR6A 5JDCA 3GFOA 3EAGA 1I2AA 1U5CA 4LI0A 4ZREA 1AMNA 3IVAA 2HMSA 3DXFA 5B2ZA 5A7GA 2H8KA 3IDQA 1SWVA 2WKPA 3KQUA 3HUDA 1B6TA 1R6BX 1KR2A 3CJQA 3KOZA 3MT9A 3ABRB 4RPCA 4RSHA 2RHOA 4RZHA 5CD1A 3AUUA 3F9RA 3SP1A 5A5VA 3R6TA 1QKIA 1IHOA 1FIUA 4BKQA 3JVVA 5DM0A 2XCSB 3LJKA 4QUHA 2IPLA 3DGEC 1UT8A 4ZRDA 4I1OA 4NL4H 2AE1A 4XDZA 2VJQA 5DCUA 3KVOA 2G1JA 4R31A 1L9XA 5CT5A 3WYAA 3GXBA 5TXGA 3I5MA 2P0YA 1C1DB 1GUAA 4H9GA 3RC2A 3WNBA 2ZI7A 2C7QA 3THXA 5G1OA 4X44A 4EAAA 2SICE 3OZAA 1II8A 1QFSA 1N8NA 3BB4A 3NTRA 1U4NA 2C58A 5CB6A 3BG5A 1OTXA 2NACA 6GPBA 3TX2A 2NV2B 4XZ3A 4DR6B 4QDOA 3SXUB 1I13A 1S3IA 2DY0A 2GD1O 5F9FA 4KAFA 2YV4A 3FCCA 5IT0A 3LUGA 1UEJA 1TK9A 1KFBB 1NXTA 1NVVR 1OT5A 1RYNA 1PEYA 2MR5A 3BOSA 1P33A 4PYLA 4WOBA 2HJVA 2JFBA 1KEKA 3EVAA 5BOSA 1AGRA 1NW8A 3THXB 1UJBA 5JARA 1NLFA 4IIUA 3AY7A 3B38A 1F6WA 1SB9A 2FTKE 3NI2A 4JVLA 2Z5VA 3RO7A 3ZG6A 2BC9A 1DBVO 1EX1A 2L2QA 1T3ZA 2HPAA 1OIXA 2YWJA 5CYGA 4CYMA 4U7TB 4LZOA 4WERA 5A1TA 2R6GA 3T0FA 5K6TA 1AUVA 1UBTS 1A2BA 4M6WB 2HJHA 4XXHA 1OXMA 1EA7A 1Y8CA 4PFQA 2O8CA 4LMAA 3VVLA 2HWXA 1YDHA 1JHOA 1OI3A 4AW9A 5AQ1A 3QKSB 5AOBA 4B71A 1V16A 5K3EA 1PN3A 4BBZA 3EQ2A 4EX7A 2IYXA 3M1LA 4OUKX 4UPVA 3ZBUA 1QU2A 3WZLA 2OV2A 3H75A 2VZEA 3HVHA 4M54A 3VU8A 3RAFC 1GZHB 1N2ZA 2G36A 1SG0A 3IMFA 4KPGA 2YHIB 3LUDA 1R0KA 2P1ZA 4Q4AB 1WW3A 2WHQA 4CU2A 4WBNB 4PPGA 4Z7NB 3B3QA 3F8WA 4DZTA 1B0PA 3UWKA 1J8QA 3B6ZA 4IWYA 3IE1A 1R6VA 2XA9A 4UHDA 4EG5A 1TM1E 5GONF 3QX9A 4PV7A 1L5RA 3VR4H 3COJA 3ILXA 4CT5A 1HNXB 4UBIA 1EGAA 1R0SA 1A5ZA 1V35A 1AQUA 2FZCA 4HAOA 1SH7A 2R48A 4HGOA 4MW5A 5C4MA 2CF5A 5DWQA 1L5QA 3B89A 2ZAMA 1TZJA 3WRXC 2O2SA 3EPLA 4RXUA 2AI2A 3MJEA 1X7ZA 4U7GA 5KQPA 1DJQA 1T5TA 1RVDA 1E2PA 3RTCA 4D42A 1VJ0A 3P9PA 3BD7A 4MUHA 2XB2A 3QE2A 4M0CA 1ZIOA 1VJGA 2VJLA 3BHIA 3HCEA 4MW7A 3ILVA 2WJZB 4FTWA 3K96A 4KK3A 4C7KA 1ZP6A 4DQ0A 4ZVPA 5GTDA 4WOJA 1U2RA 4QWWA 5IBRA 5AK6A 2YC2C 3OPQA 1GEGA 3IP8A 1WXWA 3ZWWA 4BP9A 2OXCA 4OK5A 3ZDDA 4MDYA 5AXCA 1NRXA 1TDJA 2HQOA 4KQEA 4PHTA 1FFDA 5T6BA 4NATA 1JMYA 3OCZA 1NJ5A 1TRHA 2GAJA 3NPAA 4MYCA 3E3MA 3FTDA 5B3JC 3TEJA 3RTGA 1QZZA 2Q50A 4M1WA 1ZJWA 1VPVA 1KO4A 4N3CA 3QU7A 1PW5A 1Y3FE 1XTZA 2RHBA 3BH6A 4MMXB 3VR2D 2IYEA 3ZR4B 4NMLA 3WYBA 1KMHB 5GIOE 1XXLA 4KWHA 5AXDA 2JGLA 4O4HF 2O9JA 3QENA 3H9EO 5D7NA 3GLFB 2RIRA 2DTXA 1WCWA 3JR7A 5DV9A 4AZSA 4ZOAA 3M2TA 3OZUA 3UV3A 4FLMA 2BMAA 2EJCA 4M8NE 3EX7C 3T1NA 2QXYA 4TMYA 1L3CA 3CMCO 2I3ZA 3RUAA 3FLEA 3JWEA 4R7GA 1F0YA 4GF5A 1JG3A 1LW6E 2B6NA 1TTPB 4QVKA 2CBXA 2ZXEA 3RU3A 4PYKA 3ZY6A 5BNWA 1MJNA 3SSOA 2Q5CA 4EG1A 1NF9A 2R6CA 4OATA 4WACA 5JS7A 5K8TA 1XTTA 2I2WA 3DH0A 3QV1A 2UUCB 3DZDA 3QYAA 4U8HA 4BO6A 3I3SR 4PLWA 2WF8A 3EIFA 1FY2A 1X80A 3BBPA 3ZDZB 4LZAA 4PAWA 3IC5A 3AUAA 4ISCA 5JRZA 3TCXB 2DPMA 1BGWA 3FOBA 3CNQS 3EARA 4NMWA 2R62A 3R7AA 1Z5OA 4U5QA 3HABA 4ESVA 1ODTC 1PZNA 3MG9A 1YBMA 3L0SA 4L4YA 5EWJB 2JJ1D 3HYTA 3IUJA 4L2IB 3RD5A 2PCJA 3OC0A 5E6SB 1RHJA 3BSSA 4YIHA 4LF7B 2IHYA 1C7ZA 4D3YA 4C76A 1U0JA 2JAUA 2D5AA 5E0KB 5ICEA 3U4CA 2CHUA 2DAPA 1EP2B 2X6QA 3SPXA 3PXBA 5FYDA 5BW5A 5K8CA 4NRDA 2J41A 1X19A 2Z4SA 4ITVA 4F91B 2IEDA 3CZMA 3D43A 2ZSUA 5JATA 2QE6A 3KCQA 5FUMA 4FFNA 1JALA 5ILQA 1E9SA 5F2OA 1L1RA 5DMXA 5DNEA 1XLUA 3VPAA 4BFVA 1M2OA 3KTAB 4EPRA 4NS4A 4LYEA 4B85A 1RLJA 4CDNA 2VPTA 1REQB 2NW6A 3UK1A 1RLTA 1M33A 2QW0X 1QR6A 2E5WA 2JF0A 3V4OA 2XRZA 3OJOA 1UL1X 3NV9A 3Q5GA 3UANA 1R9JA 5BOSB 4PGHA 2ZSEA 4LGMA 1PLKA 5B2EA 5JASA 1ZUD1 4Q3NA 4QPPA 2ZE7A 4YRQA 4G5FA 5DLEA 2FN9A 2O7NA 1E66A 3FPEA 4C7BA 1M5TA 3CJRA 3IEIA 3KQHA 4JXZA 1RPNA 3T35A 4P2GA 2D5LA 3OO1A 2YN4A 1U4SA 2FF7A 1J9GA 3R0QA 4J0HA 1MO5A 5DPMA 2CUTA 4TXJA 3UMCA 2FPOA 4UE6A 1JVBA 1IFXA 3V7WA 3JD1A 1GTJ1 5FLEX 1JDJA 2C03A 3BD6A 4QUGA 1BXGA 3U09A 2VQ6A 1BMQA 3ZDEA 3AR9A 3AW9A 2GCPA 1AKVA 2Q5IA 1YVRA 4QSMA 4E3WA 4JD5A 1TEZA 2EZ8A 1BE0A 1W4ZA 1UKEA 2A59A 2FHPA 3ONWA 2CVFA 1JIIA 3O2SB 1JN0A 1XEWY 2D5IA 1U7DA 1WP9A 2Q5QA 3JQAA 3KZVA 1XTBA 1XCLA 3EH1A 4HDCA 2EKBA 4MQUA 3BJIC 4NOMA 2VDPB 3CC8A 1I7LA 1IB0A 4QYIB 2QUZA 1C4WA 3AETA 4MYDA 5IEJA 1NMXA 2A5DA 3H2KA 4M46A 4LN1A 5KQRA 2DMRA 4YHBA 4TM7A 1ZCAA 1EWYA 4GAEA 1D1TA 3O75A 4RMHA 4X92A 3LHSA 3C3AA 4H17A 1TO2E 3ZHUA 3KZCA 1K06A 3MERA 4OI1A 3HU1A 4AJOA 2BBSA 2YFQA 3PCXA 4Y2PA 5HZKA 1H6DA 4KSBA 5JTUA 5BQ5A 4YAUA 1Y48E 2XDYA 4JJ8A 4NBVA 2OTCA 2Z8YA 3KEFA 1KEPA 3ELUA 4MW2A 1MW8X 2GM4A 2M9MA 4ZHQB 4OXYA 2IA5A 3DZKA 1ZRSA 2J0EA 5D8DA 3ROZA 1Q19A 2H17A 3Q40A 3RRJA 3GOQA 4ENQA 1F3LA 1JLLA 2DFVA 5AM3A 1C1YA 2JJ1A 3TLGA 2O0LA 5JSQA 5K0CA 2C9CA 4ZV4A 4OLAA 1HORA 4W63A 2UVQA 1DAIA 4XRGA 2ILVA 4J90A 1RQXA 1XVTA 3G0DA 3SCZA 2ZI4A 4FXOA 1RWXA 5EIBD 4FT4A 4DJAA 1HFJA 3DHWC 2CXXA 5E7IA 4LY9A 3ZGZA 3KOXA 2J9GA 4KUHA 4C89A 1W48A 1MW9X 5L7WA 3GV0A 4FB4A 5E6RA 3H1FA 2PLRA 2AZ4A 3K72B 1GV0A 3M6LA 1QK4A 4ND2A 3RJMA 4YECA 4EG4A 1RZ3A 2P6NA 1VL0A 3ZZUA 3H8VA 4AS3A 2EFCB 4A0FA 4R71A 3HYNA 4RKQA 3OG9A 1UKVY 2HHCA 4HNAB 3QBJA 4H6WA 4UATA 3ZE6A 3SEZA 3LCRA 3TUZC 2Z2KA 2FW6A 1ECCA 1QJCA 2C8LA 1X1SA 1E9DA 1FRQA 3GELA 3PUHA 4JOBA 2DHCA 4PPYA 4FYYA 4IGFA 5ESXA 3IA7A 4ZO9A 2A9FA 1SBNE 3ECAA 2CCGA 4N0DA 1G9TA 1ISGA 1CUAA 3AB8A 3PDCA 4X97A 3ST7A 4YLYA 2FLKA 1XZHA 5EHNA 2P9HA 1YE3A 2QQEA 4HMOA 1UXIA 4B8YA 2Y1XA 3I9NA 5LBIA 1Y9ZA 1GPLA 3A1DA 1F2TA 1P77A 3AI7A 5A1JA 1XRQA 5ELLA 3PJRA 4ZQCB 1OLXB 4N0QA 1ISPA 1KI1A 1TJPB 2DHEA 1XZQA 3RSGA 1DT3A 1X87A 4CMAA 3SDZA 4YASA 4GR4A 5LZ5A 1RAEA 2Z83A 4H15A 2XDQA 3QHQA 3CUVA 4W1SA 5TARA 4D1YA 2HDOA 1CY2A 2QUIA 4LYJA 3SBOA 2C3UA 2JFVA 1R3DA 3GLGB 3LMKA 1FFGA 1F38A 1RP1A 2Z1DA 4PZEA 4I2NA 4CODB 1EK1A 4RY8A 2PLFA 3GUZA 2HF9A 3F67A 3RUDA 5KX5A 3MWEA 1TKBA 2EFHB 3QE9Y 3DEYX 4IBOA 1UBGA 3DBLA 4RULA 3NMUF 1EG2A 1EZ4A 1M8GA 4GX2A 1RJGA 1J0XO 4MQLA 5LC1A 3TL6A 1ZUIA 4OQQA 5D00A 3AFIA 4L5AA 2HDNB 3HV2A 1OWLA 3D7KA 4L0MA 2XA1A 4XYLA 4ZGBA 4AFNA 2HK6A 4K6KA 4BBJA 4TXMA 1ZGJA 2IOYA 3N8KA 1G6Q1 2AHRA 5JBIA 5DBOA 4BO3A 4OXRA 3I32A 2R8YA 2WU4A 4NCXA 4WQMA 4ZPJA 5KJ6A 4BY9E 4KFUA 1DZ3A 1F8FA 1L5FA 2AVNA 3T1HB 2DJ5A 5HX7A 5J5AA 2AOWA 2J3LA 1NVAA 3C41J 3C45A 1Z7WA 3C7KA 4AJPA 5IT9A 2QGNA 3ZOZA 3ZK9A 1M2NA 4D97A 2GBLA 2BR3A 2EFYA 2O8EA 2LR0A 4JYPA 5C1PA 5JW6A 1QIIA 3ZBPA 3EOZA 3IQEA 3I5XA 3H2BA 5EXTA 4OXKA 5FO1A 3G68A 3PQEA 4N7JA 1FXWA 4MWBA 4R3UC 1YOVB 4H3VA 5GAJA 3HDGA 1H22A 1MEJA 5TNXA 3DZFA 4X1IA 1H5NA 4KPYA 5JHHB 1Z6XA 4ERNA 1FFYA 3JQEA 6Q21A 2RGYA 4WOKA 4BBPA 5F5NA 5K01A 1RXWA 3DMGA 1HT2E 3CCCA 3ZE1B 1ZGAA 3L9WA 2GBLC 1GEEA 3I58A 4XWWA 1C1HA 1V1MA 2VH1A 3QVKA 4Q6BA 2OO3A 5D3MA 2BKAA 5KAPA 3UOWA 4DCJA 1STOA 4KQIA 4F4IA 4LXUA 5FULA 3QI7A 4UEWA 4Y9TA 2F4NA 2Q2NA 5LYYA 4OUDB 3CW8X 4D5EA 4IGIA 3CNEA 3DXYA 5ICCA 1LB1B 3C4VA 1LBTA 3QK7A 2H2HA 2IUTA 4JASB 3X1DA 5I5EA 5B1IA 1EFHA 2XKAA 1HYBA 3WLFA 4I66A 4IDNA 4UE2A 2V1UA 2HADA 2N3ZA 2EYQA 2ZKIA 3AHFA 3N0TA 4NK5A 4QATA 5AMXA 5DW3A 4ZGWA 4R2LA 4PG4A 4IHAA 2QZ4A 3QUSA 1JFSA 3FDJA 1NM5A 4HADA 4YJFA 2H4HA 3PHGA 1E77A 4JLDA 4P4UA 1DJMA 1FQOA 3AESB 3P0JA 3HKBB 2COEA 2ZANA 2R79A 1TGYA 3QE0A 1DG9A 4H1UA 3SXPA 2AYXA 2XXJA 4QHYA 3WIBA 4KV7A 2YH2A 4BFYA 2HSEA 3FWYA 5IEBA 5KKNB 2O3RA 1D5WA 2FPLA 2OP1A 3F0TA 4GOJA 3ROXA 1ZIPA 3ZY2A 4AULA 4BNDA 1KFJB 4PG7A 1CZRA 1Q1QA 4BVHA 3LM8A 5A02A 1W0KD 2DM6A 2WHEA 4OQEA 3N8DA 1A9YA 3HYCA 1ZD2P 4L3WA 1DIOB 5KSOA 3A4NA 1H0HA 2V7BA 2VBIA 3IBFA 4PU0A 4RVHA 3FETA 3V8BA 4JR1A 2XXAA 3PXDA 5KYWB 3I2GA 1RXIA 2IEZA 3R3JA 1IHXA 1LV7A 1Q5PA 1XDWA 3MTDA 3WB0A 1W4CA 2P3OA 4JJGA 3KVYA 2G3YA 3AEXA 3MJRA 3O26A 4R1UA 1L8QA 2BF4A 4GMGA 4JMLA 4LJ5A 3R8FA 1BKSB 2XE4A 1QVRA 2GN1A 2IDJA 2QLFA 2ZQYA 3M1IA 1JLKA 3TXXA 5EJFA 1MB4A 2HREA 3P27A 1N33B 4AZWA 1AQ6A 2ET6A 2K5UA 3BK1A 1DV2A 3PNKA 3P2YA 1IBKB 1YFJA 1UZUA 1G8KA 2GDZA 4OO3A 2ZTUA 3QXXA 2Q2OA 2I6FA 1GGVA 3HXKA 1RJDA 1DIGA 4GM0A 3K9WA 3A10A 3UKJA 5DOZA 4RJTA 3PFBA 1M8FA 1N9GA 2CT8A 2H9AA 2DX7A 1HF3A 1HM5A 4GMKA 4CUZA 1IPHA 1X2BA 1DEOA 2YN2A 3OWXA 3WWOA 3DLBA 1E94E 4UDYX 3RE1A 3ZVNA 3GP3A 3CZPA 4ZYVA 1QFXA 2VBCA 1E4EA 5EXXA 2OQ2A 2GD0A 1VI6A 2BIFA 3DL2A 3PFNA 4F5DA 4PZLA 5EKSA 1NUTA 2YY6A 1MAHA 4NDZA 4DCCA 2AI3A 5IYZA 2XGJA 4IZHA 2L82A 3C3KA 4G6ZA 4X95A 5EL0A 3U9LA 2BLNA 2EARA 3OZRA 4KPUB 4LK3A 1TQ4A 2XIJA 3U13A 4YJ3B 3AWIA 1D1SA 5A9SA 3FI9A 1MA0A 3JYLA 3FY4A 1FBTA 2A4KA 4H1VA 1XF9A 3QEOA 4OHPA 1EPUA 3O83A 1EQUA 2QQ5A 4A15A 3CUSA 1RJ9A 3EFEA 3EVEA 3DF7A 3IPAA 5E1BA 2AFHA 3L4BC 4BWVA 1CEQA 3D0OA 2O2XA 5EMMA 4TQUS 2O2DA 4MVJD 4TOIA 2C96A 1TADA 5IP5A 6YASA 2P8SA 5AK4A 3E03A 4PHHA 3T6KA 3G6WA 4DMRA 3AOGA 3HRIA 4LDRA 2Q6IA 5TB5A 3W06A 1YQDA 2XD4A 3I8OA 4EG3A 3H18A 5HR5A 4EUKA 4EY7A 2R8OA 3B3FA 3FTEA 3ZE7A 3UZUA 1A8SA 1U6KA 2I2DA 2P4EA 3EXEB 1TF5A 5HGJA 4ZCIA 1PV4A 4RZSA 3DPIA 1BJRE 4O0MA 3EGIA 1HT1E 2Y1OA 1VSTA 3U4DA 4Z1OA 2XGOA 3HCCA 3SNHA 2YN0A 3BFXA 4QQKA 2J5QA 2CK3D 4UTXA 1Z6AA 1VIMA 2OGTA 1KAOA 4HDSB 4TL8A 3TBHA 1QPBA 4KXFB 2FQYA 1X1AA 4ND8A 2AUNA 3R7WA 3ANSA 5FWNA 1OXSC 3I04M 2VSYA 1C3OA 2WP8J 5JBNA 5CK4A 3PNOA 1M0WA 2X9NA 4B32A 3ROEA 5DSTA 16PKA 3QMVA 1DPFA 3H05A 4BC0A 2G9UA 1SELA 4AWAA 4YMGA 1RHRA 1ZH8A 1V8FA 1P2VA 1ODJA 1LJUA 3VTZA 1N0HA 3SF8B 1ZGGA 1GADO 3VKFA 4B0PA 4I55F 3TZLA 1TTTA 4RZ3A 3E9ZA 4RL4A 4RVGA 4J1SA 2I71A 2Q5OA 4L73A 4D80A 5JCXA 1GD1O 3ZCTA 2FGJA 1YQTA 4B74A 1PQUA 2G9ZA 1I10A 3ICWA 1A7JA 1TQHA 1FP4A 1U9IA 1GTZA 1RXSA 1OA1A 3KLBA 3V34A 4RMNA 3FOCA 3IPYA 1DNPA 5DFAA 2YV3A 4CTOA 2QAGC 3E05A 3GJTA 4CMHA 1FZTA 4KVZA 1K6XA 1GYPA 2FEOA 3PFHA 1RW4A 1VMIA 1YUBA 2AC7A 4GLOA 1UODA 1JB9A 2AFIB 2Y0BA 2HJRA 4ZO6A 3MRVA 4ISBA 3V1YA 2X4IA 3VVCA 4HNRA 4L8YA 1ST3A 4LGCA 5KTMA 1VOTA 3PDHA 2C5GA 1O96A 1QFZA 4D0NA 5K0GA 4R5MA 4U2GA 3CX7A 3QIVA 1P4AA 4Q9LA 3Q10A 2B83A 2FK8A 3RQSA 3V3TA 4DDMA 2D06A 3DULA 2W0SA 1EG7A 4CCAA 2XNJA 1B15A 4WFQA 3SD7A 2DC1A 3WTCA 4CM9A 2VTDA 3DL7A 1N2IA 2H4FA 2JAOA 2Y68A 1S3SA 3N87A 1F9AA 1IM2A 1N0IA 3PRYA 2BFNA 4RD4A 3S40A 4B6QA 2IPNA 2QZSA 2GN6A 4IDPA 4R81A 4YUWA 3ANNA 2YRWA 3DE1X 3O82A 2XNCA 1A9QA 1JAYA 4BN0A 3CFYA 4TUYA 3SHQA 2Q3HA 1L1EA 4H3KB 3N2EA 3EXEA 4GRIA 5E3HA 3TINA 2WG0A 2HMVA 3H2IA 4IJVA 3NUQA 5T41A 1L4HA 3D02A 4URHA 3VSCA 1E1RD 3EZGA 5EI5A 5KYUB 1KS9A 3HN2A 2BMDA 1YHZA 2GFQA 2UYGA 3IURA 5A3SA 2IUUA 4Y0VA 2WSMA 4GI1A 4QUEA 1EFRA 4I1SA 2OD7A 2OHXA 3I9V6 2W2PA 1N92A 4BC1A 1LQTA 2CJPA 2E2WA 2PXCA 2XMZA 2I1LA 4JLWA 4XIIA 3U7RA 2B7CA 1O3YA 1GXSB 1JU4A 3DHNA 1M1YA 3M49A 3EVDA 4JLJA 1EU1A 4UUMA 2BKXA 1EM6A 1A72A 1EM8A 1E1LA 2RH8A 3L46A 4LJKA 4YWHA 1LRKA 1MT3A 2DOKA 3QKWA 1IOLA 2ALJA 1W75A 5I6DA 2IF2A 4M2LA 1Z5UA 4PAQA 3WAJA 3GJSA 2D6FA 2NO0A 3LL7A 1TT7A 2FOIA 4NE2A 4G89A 4MYSA 2LD4A 4MTLA 5GQSA 2OFFA 1EUZA 3VJKA 2Q5LA 1M0EA 1HT0A 4OIFA 1N2GA 4QIHA 5K09A 2JK0A 2Q27A 4X7BA 2XYGA 4KXLA 2GEDA 4FIZA 4AZTA 3ND5A 1YB4A 4D8TA 1REQA 2P41A 4BQEA 3I39X 3UHFA 1A88A 1BD4A 3NTXA 2ACEA 3P9KA 1XJ5A 1KDVA 4CV0A 3FSEA 2ZRCA 3OAAD 5I8PA 1G1AA 4BEWA 2I03A 3IX7A 5JAOA 2PUJA 1U7OA 4GPZA 1PD0A 1GFSA 1QX4A 2HWYA 2PZLA 3QVGB 1ZGHA 1WW8A 1KR5A 3AXSA 2YBDA 5IBQA 1D2RA 3GGOA 5CFZA 4RPLA 2L17A 2NU8A 2PFSA 2QXUA 1QYIA 3TUIC 4CLXA 2YWXA 1QVAA 3LT5A 3QVGA 1B0UA 4TYQA 3T3GA 1FA9A 3GGCA 3RFXA 5EWJA 3HDHA 4KZKA 4CI0B 1IRIA 3SS9X 4A26A 1EVQA 1YK1A 4M6WA 5AVYA 2PCLA 5DVZA 1OA0A 3ZDCA 1NXSA 2I67A 1P7VA 2VT6A 2WHRA 3MAJA 1E98A 1KXJA 1N1MA 3BMQA 1HC7A 1DKLA 2G83A 3DKPA 1OZAA 3JD4A 4IH4A 4LNHA 3TTXA 1SU4A 4GLFA 4LRWA 4ER6A 1QGUA 2V5VA 1F0PA 1LC3A 5KVVA 1FW6A 4WK0B 4E5YA 4DV1B 2ZIZA 1KY3A 4P3PA 5L3QA 3D9QX 3OZFA 3CT6A 4MHTA 2FX3A 4XSHA 2CDBA 4JI1B 3K1AB 1XTQA 4N3GA 5FFFA 3NEYA 3G9UA 4JV5B 3VOAA 4MWCA 1OPXA 3DT8A 5A9SB 2GSWA 3EFOA 5ESWA 2G4LA 1NW7A 5F35A 3VNAA 4ZVUA 5B5SA 4A6EA 1NRJB 3INYA 2ORED 1ZS9A 3IP7A 4HDRA 4PBRA 4IXDA 3SX4A 5CFMA 4BAZA 4OX9Y 4KMSA 2AC2A 2LCFA 1FRNA 3OIDA 2PMBA 5CXSA 1WW2A 4ESOA 5JPIA 5B6JA 1OCEA 4DXAA 1IVNA 1Z28A 1R5BA 5AKZA 4RM2A 1NVFA 1H5UA 1SHLA 1V3TA 2BW0A 2VJMA 3NBYC 5IJXA 3TLBA 1F8YA 2D54A 1W34A 3LWBA 2O06A 2YY5A 4YAKA 2IS1A 5EAIA 1QDLB 3FAZA 3ZWYA 4PLTA 2ENWA 9LDTA 3ZIAD 5CVJA 4E07A 3SS8A 3HDJA 4AXBA 1ATIA 4HH0A 4RK0A 3T94A 4N6NA 4U2KA 5HDQA 2FRDA 3GFVA 4PPFA 3CYFA 3K7EA 4MV5A 1VIDA 2AX3A 3AI1A 3IT3A 4D82A 1CT9A 1V26A 4AZ3B 4WLEA 3YASA 3ZI0A 1W44A 1KA9H 3L4BA 3CF2A 3CLVA 4BJ5A 1Q6ZA 3FTPA 1GPKA 4DQVA 1TIKA 4XLLA 3A1WA 3FSGD 3GVCA 1GQSA 1RACA 4RS3A 3DFMA 4F8JA 1IBSA 2IZ1A 3DF9A 3ANMA 3I8SA 4MRMB 2ZS9A 3H2JA 2P1RA 5JSUA 4U3JA 1LDEA 1QHHB 3WYDA 4ZJZA 3DHVA 4C0JA 1E3LA 1O97D 1N2JA 1T2CA 2CXNA 5E1MA 4B0OA 4CF5A 4KHPB 4TMVA 1U8YA 2WUFA 1IIRA 2C31A 4NESA 1UJ5A 4PM4A 2N47A 4J9UE 1D2GA 3MGBA 3HJGA 2RHCA 1F8GA 2GT1A 3FCSB 4WMLA 5G0TA 2G63A 2PUGA 1JQEA 1S1MA 1SQ5A 2D8AA 4R2IA 4JA0A 5D3MB 3EBPA 3ZE0B 1XJWA 1KP9A 2O0HA 1QK5A 4ARZA 4JCOA 4HPXB 2WM9B 3A37A 2JAXA 1XTJA 3U3ZA 1IOZA 1L8XA 4NBNA 3WOHA 2B8NA 3EDCA 5F7ZA 5K3FB 3VOTA 1XYGA 4II3A 1WOYA 4Y2HA 1LDNA 2I1QA 2H08A 1G8YA 1UBKS 4K81B 1DAFA 4MGEA 3NTQA 2BP7B 2Z2ZA 2QYOA 1IK4A 5BYJA 2YVLA 2X0RA 1YOVA 4LBWA 5LZ7A 3JQBA 3K0BA 3Q7IA 4LMBA 4ZI7B 2VPYA 4IV5A 2QSYA 3PC6A 5LSAA 2YOHA 4RJ2A 3OQVA 1MFPA 3KEOA 5MDHA 1LPAB 3T7DA 4EPYA 1DCFA 4JP5A 5A6VA 4N6OA 3V7YA 4D26A 5E2AA 2Q0HA 4JQOA 2GEJA 3A11A 4M1YA 4R8VA 5BWLA 5IC4A 5JJCA 1XKTA 1WUIS 1SCJA 3H5VA 2FRXA 1W0JA 3GF4A 4PINA 5ERGB 2OFWA 1JDSA 5JXJA 3KZMA 1R6TA 3OZBA 4YXWD 4YRRA 2HRDA 3BXOA 3JARB 3I04A 3D2AA 3KVVA 1DC8A 5LB2A 3RREA 2I78A 1OLUB 1KETA 3NCHA 4MPJA 1JAIA 3P4UA 4TMFA 5FP0A 4YACA 2FA9A 1RE0A 4Q4JB 3TLMA 3WRWA 2YXNA 3EVFA 4Q3CA 4BWGA 4DVJA 4PYRA 3CWZA 2AQKA 4QOHA 2IHTA 1NXVA 3QWIA 1NNLA 1FJ2A 4DUPA 5EIBC 3TR6A 4BO9A 1UOEA 1CY6A 1OBHA 4YRLA 4AP9A 2J0UB 3AK4A 3M6FA 2UVPA 1AUQA 1TEVA 3D3WB 2A86A 3LH5A 3GRAA 5GGXA 2MT9A 1TCUA 3N6XA 4LY3A 5EP4A 4PWYA 2J5KA 1HFWA 4C4RA 2IXDA 4IMJB 4ZZ1A 4GIBA 1DAGA 4Q9HA 3TMKA 1JIVA 1MAVA 1UF9A 2WKSA 4ND4A 4W5JA 3IV9A 3NDBB 5FWYA 1EFVB 3HWRA 3TQQA 4M9QA 4LKRA 4TYYA 2DWPA 2G0AA 1TYZA 5G1NA 4MV6A 1JEEA 3BKXA 3DOOA 2VAVA 4PEVA 3K70B 4A23A 4ROTA 3T7EA 3E7PA 3UM9A 2VHJA 4CQJA 3CNLA 4IUCS 1NPDA 1LPPA 2RARA 5G2OA 4CMJA 2JIZA 2Q41A 2QLMA 3MWGA 5DHSA 5FRDA 2ZUTA 2GNPA 5LQUA 3H8JA 3MMXA 3NHJA 3CXUA 4LKOA 5DHPA 5D51S 4KE8A 5CVCA 1HUQA 4C3OB 3AP3A 4IJMA 3RS5A 3M3DA 4CT0A 1RE1A 3ZW9A 3VAAA 4L6AA 3JATB 3HN7A 4ETMA 4LYFA 1IHDA 1CYEA 1HK7A 3DL4A 4EHJA 1ACLA 3K4HA 5SY4A 1ISJA 4IJKA 4NHEA 2DBQA 4WAUA 3B48A 4B1FA 3L4SO 2OXTA 3DAGA 1QH1B 3PKZA 3ED1A 4JLPA 3GPIA 4R8LA 1T35A 1B8UA 3Q0EA 3USES 4V1CB 3MILA 1TYEB 3LCCA 4FZVA 4GMHA 4II2A 1EFLA 5JG7A 3UJ8A 5MN5A 1O94D 2V9ZA 1V1MB 1XAGA 2FRDC 4OL9A 3CVOA 4AMZA 1IM8A 1C30B 1DC7A 3PQ8A 5DGDA 4K2HA 3S68A 2DG2A 1YKSA 1VLQA 1SQGA 3AJ9A 3DT9A 4OK6A 4P54A 3F9CA 5DNVA 3N7TA 4D6YA 2OM2A 1GTVA 4KJXA 2HU2A 2FR8C 3E82A 1W6RA 2XUIA 1KDYA 1SD2A 2JFZA 3IDOA 4G3XA 5AXBA 2G77B 3RC9A 4ZYWA 3SWWA 2H1OA 4HDNA 1C9YA 4QGHA 3K71B 5I9TA 3CM0A 3LAWA 4FSXA 2AK3A 4IEFB 4M0PA 3FUUA 3SLKA 3ZOKA 4YYZA 5GJCA 4C3ZA 2GMWA 1PBTA 5E1OA 2DFNA 1PP4A 2XZPA 3ECSA 4PC1A 4R6WA 4RXMA 3ZJ4A 4BGEA 2C04A 4IJ6A 2REQB 5D1NA 2XRFA 2Z3ZA 3NXSA 4BLPA 3OD5A 1FK8A 3ES9A 5ARCA 4ZHQA 5AUNB 4ZV9A 2WTBA 3P2OA 1V3QE 4IPTA 3I62A 1G291 1RYDA 1VB3A 3MWYW 1CFJA 5FNZA 1P5HA 1TZMA 2CE7A 3D59A 5BN5A 3X1WA 3EIQA 5J2TF 1M6VA 3G5MA 3WK6A 3DBRA 3PKIA 3UWMA 3K92A 4DJDC 1R15A 2VP9A 1U0RA 4MGKR 1OFVA 3EK2A 5A3QA 2WM3A 3CVUA 5HJEA 5KSZA 3CISA 3NJ4A 4NC9A 1CVIA 3G2QA 1VLLA 3U16A 4TSKA 3R9XA 5FPYA 3DQQA 1K0UA 1CZKA 4DYVA 1I3CA 3FFAA 3ZU3A 1M2KA 2YZNA 4ZOEA 2DULA 1YU9A 1JR3A 5EHIA 4LVNA 1Y3CE 2GFHA 2R4TA 1NVKA 2Q3MA 1L8AA 4E4RA 2POCA 3K5IA 2WYUA 4YRTA 2XLBA 3AF4A 1N6LA 2F3SA 4EVRA 2TMKA 3CZAA 4ZOBA 3IALA 3IO3A 2XTZA 2YICA 3D1JA 2I4LA 4EEKA 1EDOA 5ENVA 2OHJA 3WLTA 3SY8A 3N2LA 3L05A 2Q2WA 4KQMA 3ILHA 2IXAA 4V1CI 1O95D 4LJSA 1IWOA 3SR3A 1NVMB 5EJMA 1E2KA 3IAS1 1WIWA 3C5VA 1KEUA 2BTQA 2C8JA 3O4FA 1QGED 4HVTA 4QOEA 3OC6A 3P9ZA 3HKEA 4RAQA 2JPDA 1LQUA 4WGFA 1ZD5A 2QRGA 1Q0ZA 2Z8ZA 3IUSA 4Q3EA 1CDEA 4OQYA 1UOQA 4YMWA 2IV3A 5KCZA 2YW9A 3L7NA 3SX2A 3V1TC 2YUTA 3ZZMA 1P80A 3BD9A 3L0YA 4L9WA 5GM1A 4OYYA 3SM3A 4BB6A 4YT4A 3GJ6A 1UP6A 3V4FA 1O0SA 1FRZA 1QWOA 3FOEC 2GAIA 4Z86A 5GVRA 1K5PA 1TCAA 4RIGA 2PZEA 3S29A 5U4QA 4DDUA 1DOAA 4MPTA 3C6QA 2R5NA 5C8VA 1UZLA 5CA1F 1NVBA 1KC1A 1OYYA 1IH8A 4KNWA 1B0ZA 4F97A 4L78A 3KT8A 1JIQA 3JSXA 3TI9A 4YRSA 1V4VA 2VNJA 3KOUA 3MK31