2ICEC

Crig bound to c3c
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
307
structure length
296
Chain Sequence
TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3 beta chain
publication title Structure of C3b in complex with CRIg gives insights into regulation of complement activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 51
structure length 296
sequence length 307
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2iceC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2iceC01
2A74C 1BR9A 3G6JB 2TMPA 5JPMC 5FO7B 4FXKC 3HS0C 2XWJB 3MA2B 2A73B 4D94A 3I70A 5FO9B 3L3OC 3T4AC 2I07B 1UAPA 1D2BA 1EDYA 1JB3A 3CKIB 3KLSA 2PN5A 2WIIB 5FO8B 3FRPB 1OO9B 3OHXC 4FXGC 1BV8A 2ICEC 4LNVA 3HRZC 1UEAB 2E2DC 4ILWA 2B39A 3V96A 2J0TD 1GXDC 5FOBB 1XWEA 2WINB 1AYOA 1JC7A 1BUVT 3CU7A 2QKIC 1BQQT 2XWBB 5JPNC 1PXUA
chains in the Genus database with same CATH superfamily
3C6LD 2F15A 1DDHB 1MFAL 1OSZA 4QCIA 2WGXA 4TXVB 3ZKSD 4R96B 5I6XC 3C8HA 4R0LA 2FT8A 1HH6A 1UWXK 3GZQA 1BVKB 4BQ9A 3C2AH 1ZIAA 3IJYB 2BNUA 3AQYA 2MQGA 4FQ1H 1PYWD 4PJ8B 3BN9C 1JVOA 1U4PA 2F0JA 3MV9E 3F12A 4U1IB 4MXVE 3PCYA 3GMLB 2B5IC 1KCBA 2HJFA 1EO5A 3P2TA 4LF4L 4WCYH 4B0MB 2BHUA 3EYUL 3GMQA 4L1LA 4NQEE 3ZZLA 5IGGA 3O3UN 3K2KA 4X8JB 3ZRSA 1SMAA 3QORD 1GW6A 2A6JB 5IBLD 4P3CH 2XV3A 4OLVL 1PH8A 3BP4B 3DJSA 1VHPA 3QJHB 1WWAX 4XNXL 5C3XA 4GKZA 4NCC2 4PPTA 4Z3EA 3ULVC 1EY5A 1LGVA 2IQ9L 1MRCH 2MQCA 4G7VL 4RZKA 1KN4L 1P9MA 1INDL 5DEFA 3EVQA 1IGYA 2L4NA 4MNGE 2GTZA 4LMQI 1EHXA 4HD5A 2FIKA 5LL6X 4GKSB 2OXPA 1KYUA 5LG1A 4UTCA 4I1RA 3QIUC 2F0IA 1V7NH 2W65A 3HOVG 4MA1C 4ORGA 1J12A 1DQKA 2EOTA 1IT9L 3TBWB 5A6LA 5JXED 1PTOD 4TNVF 5E6ID 3IS1X 3I02B 5LQBL 1KD1C 1XH0A 4IMKA 3MVVA 1Y1VH 2YJLA 4JM4L 3GIVB 1I4FA 4WNQB 5DS2A 2UXDL 1TENA 5F7HA 2G2NA 2X1WL 3TBCA 3QXWA 4KRMB 4ODBD 1H15A 1S9WA 2W8CA 3PO2G 2UUBL 4HJJL 3RUGF 3WEAA 3EDJA 3OR7A 1XB3A 2BNQA 3LKSB 4FJYA 3NSWA 4UOJA 1URIA 4G9FA 1PZ5A 3FQWB 1C9OA 4XC3H 3NRQA 1ANUA 3CCMA 4IHOB 1I1FB 3IGAB 5H8DA 4G5ZL 1G7QB 1AR1D 4OV5A 2K50A 2WPGA 3UGUA 5KVGL 1FVIA 3MLVH 2VDQH 2A83B 4IUVA 3QS3A 4QXUH 4YR6A 3UDFA 5DGQA 4C2MB 2QSVA 5IB1A 4FXKB 1MCRA 5D4QA 4B9CA 1MFVA 3OV6A 3HG1B 4RCAA 5DFWH 4E9XA 2V17L 2VQFQ 2WXRA 3OB8A 4ULLA 4X4YB 5JOPE 1WZAA 3VXRA 2F53A 4DA2A 2K6WA 1S4ZA 3M17A 3QI9D 4GQ9H 1C9SA 5HY6A 2B2WA 3FQUA 4OCYL 2ID0A 4KI1A 1X5MA 5BOJA 2ATPA 2KZKA 2EDKA 4H88L 1U36A 4JFED 4R7NB 1KNOA 2WWKO 3I3DA 3PGFL 4UP7A 3MRLA 1IQDA 3QUMA 3RFZC 5EEZA 1EIHA 2IGFL 1ZEAL 1S5BD 1DVSA 1I85A 2FH6A 2VDLH 4BKLA 5FYLL 2ZOLB 5I6MA 3W39A 1MDTA 3H0TA 5D7IA 5TDPA 1HEHC 2J8UA 1MQKH 2X7LA 4G7SB 3NA9L 1NJ9B 1WEJL 4FQXA 2CO6A 5CR8A 2P80A 1KN2H 2K3HA 4U3CA 2NY4C 2D7TL 2EIZB 4MJ5B 1PF3A 4PS3A 1WGOA 3GSUA 1U3NA 1GKHA 3QUYC 3V4UH 2H45A 4PRBB 2YRBA 1QWYA 1CFQB 5E4XA 3PO3B 5GJTH 2WCPA 4IRJB 1J0ZA 1ZXTA 2W80C 4HXBH 2KOLA 4J28A 3UTZA 4HKJB 1AIFB 1RK1B 2BPBA 2L7UA 1GHFL 1I6VC 1WCQA 2SNMA 4DR2Q 1RPKA 1DJXA 1CBVH 1VQNA 2BSBA 3P40A 4X9YA 3VGBA 3BRDA 1TTCA 2FVNA 9PCYA 1JNJA 1CI3M 3FB7B 4XN2A 4ZKBB 3SB3A 5I1HL 1AYOA 3VR2A 1FL5A 5CP7B 3GT6A 3J81j 1WCBB 4EIZC 3HI1A 2CO2A 3S4SG 1UYWL 3TOPA 4ZUUA 4FLHA 5MEOB 5E4WC 2YUVA 4MHEA 4P5TC 4C3JG 4MAUL 1SYBA 2YQBA 1XAUA 3MJ7A 4M00A 3S16H 5I1JL 1DONA 1AD0B 1RZKH 2GJ6A 4YFLI 5INDB 2XQYA 4YBQC 3CFNA 4PRDB 1WWWX 5DC4B 3X1BA 2VQFL 5EJWA 3MFFA 4K94C 5GS2D 1ZT7A 1RPQA 4A3LG 4DPBX 2QVMA 4U6YA 1WCMG 4Q7DA 2AJUL 4OCNC 5D55A 3VDCA 3EJYD 5IGCA 2YD5A 1AGDA 5J1ZA 2HFFA 3R0NA 3EYFB 4QHUB 5EIIB 1SEBD 1RHHB 1LO2L 5FWRA 2XTLA 1F3RB 3JTSB 4WGKA 4A2GA 4AGPA 4A3BB 5CUSL 2DBLL 3ZDYB 4DN4L 3N40P 2AQ2B 4RISH 2ZP0T 5TF1H 3UXFA 3O11B 4HISA 1JNNH 5DD3H 2OK0H 1MVUA 1C16B 1HILB 5EU6D 4BZ1A 1KCWA 3U9OA 2AXGB 2OM5A 2W60A 3QEUA 3KPOB 3F7VB 4MCYA 5AVQB 4J6RH 3VDAA 2XWXA 1VQFA 4WY7L 4Q89A 3N43F 3DVFA 4I9WE 4JK0D 1CT8B 3LS5L 3C08H 2XPYA 4X80H 5I9QC 1BMWA 4QRTA 2JA5B 5SWQB 1PDQA 2W5PA 5GISH 1VA9A 2CNYA 4AYBA 4HS6B 1MUJA 4NP4H 3ZTCC 4GUPB 4X98A 4XPGH 3NQTA 3SQBB 5C3EH 1LP9F 4DR2L 4FQCH 3CFJB 4R4OA 2K45A 3SDDA 5HYQA 2YJQA 5C44B 4HMEA 4MDIB 4A3GH 1CE1H 1YEKL 2V3DA 3S3DB 1UM4L 2J6EH 2NTSA 2NVTB 5D4IA 2XZQH 4A55A 4ZFFA 5I24A 1R0AH 1OAYL 2CO7B 2VUOA 3PDOA 3CP0A 3PP4L 2Z34A 4LPXA 4EVOA 3S17B 2N8NA 4MMYB 1WFNA 2ENSA 4MWFB 2V9RA 1MW0A 1DQQA 1UXWB 4U6TA 5JAVA 1YMHA 1EZLA 3AGVA 4EIGB 3L1OH 1S5DD 1NCBH 4IIQA 1TIID 1GC1L 2N4IA 2K04A 1JPST 3EFFB 3URYA 1AO7B 5DO2D 3BPLB 5H37A 3PIP3 3L5WB 1SYGA 2MTAA 5F72S 4IZ8A 1U9KA 4O42A 3KNBA 2OKMA 1FV1B 2LMCB 2BA0A 2Z6BA 1P2CB 2AJXL 2IV9A 2AXHA 2JJTA 2VDNL 3ATBA 3DIFB 4FMVA 4ODVH 1HZLA 1QVOA 2QGCA 4FULA 3ARFD 1QPPA 5CEZE 2H1PL 4YLCA 3INUH 1WD9A 4PJIE 3OPZH 2K33A 2YGPA 3CFBA 5JPNB 3J07A 5DD1L 2XN9B 2Y1VA 5C0XJ 3QJYA 4CGYB 1OW0A 1VQDA 2F0LA 1GAFH 3EAKA 5FM5O 1MFUA 1NC4A 2B4CL 1DO5A 5IGFA 4OJDH 4X4KA 3OC8A 4EEEA 1IAII 3K7AB 3S15H 3O2VH 5J9PB 5C7XH 3QZPA 3K8AA 2F74A 5C86A 5J1AB 5BVJA 2K3TA 3IDIA 4G8FB 1A3RL 3RWFB 1QHOA 3BDOA 3PFUA 3WS3A 4P2RE 4AGNA 4Q6IB 3BAIA 4IYKA 4ZMNA 3KFUA 1GUTA 4LBAA 1DANU 1LTSD 3FU3A 4CKBA 3KWVA 5E99L 4FADA 1Z5YD 5F7MC 3TVMA 2GUYA 1MXGA 5FA3B 3OHXC 1M2VB 1BFTA 1SHMA 1V10A 4PCYA 1A3UA 1XAKA 3JV6B 4M5ZH 3US1A 3K0XA 5C2BH 3A5ZB 1J5CA 4CL7A 4BXXG 2ODIA 5KVDH 4Q9QH 4A3FB 3SEPA 5MP6L 3A8KE 3BE1L 1AHWB 4KX7A 1JWSA 5KBNC 3KCWA 4E41B 4NGHL 3EJRA 5I8EB 5ANME 1FBIH 1XGRB 1UD2A 1ZKAA 4N2FA 4FNPA 2XPGB 3KK7A 2DWSA 5JQIB 1GUOA 2EAEA 4KQ4H 4MQXD 3RDTD 3C5ZC 2CQOA 4XVTH 1KC8C 2MJWA 3ARGD 4NQDE 1JV2B 3VQLA 2JCCA 4NSKA 2HD3A 1NUCA 2OMBA 5A2QL 3ARPA 4JFFE 4NNPL 1GGUA 4K3DL 4XHJD 4JJHA 4RRPG 2OR7A 5JOBA 3EJZD 4GP4B 2DH3A 2O61A 1D5XA 3AREA 3CTTA 4FRWA 1X5IA 2R2HB 4RMBA 3GIZL 1XGQB 3MRJB 4OZGE 5E8NA 1O78A 3J81c 1PH6A 3OG6B 3VI3B 4F93B 4N1EA 1P4BH 1A7OH 5CV9A 3KPMB 2VDPB 1PS3A 4TVPD 5I8OL 5J11C 5AB0A 5K9OB 3N44F 5D5MB 2ADYA 4XVUC 2SOBA 1DN0A 2NUPA 3VYSA 3SK8A 1ZGLP 1AQ8A 3GTQH 4AM0A 2HRPL 2FYVA 4O9HH 2XOTA 1B4RA 2VC2H 2CUHA 2DOCA 3O3BA 4K7FA 5JUEL 4RBPH 1NGZB 2VN6A 4CJ0A 1RURL 5F3BA 3ATEA 3C6SA 5J7CC 4PJBF 1STGA 4K3HA 1N6UA 3PQYE 3QG6B 1KPVA 4O1NA 3TH2T 4FABL 1U8KA 4YGVA 4DF7A 3IVKB 4WHDA 3QOJA 2Y5EA 1NGWB 4EUPG 4X6CB 4NQVA 4FXKC 2ZAGA 3N1MC 4HQQH 5AKVA 1T5XB 3BWUF 3MACH 3BN9D 1NOLA 3D2UB 4NPJA 4KHVA 1RIVH 1VFAB 5H4YA 2GC7C 1ORSB 3DJZA 5F0MB 5EZPA 4QRUB 2YEZB 3AABA 1DQDL 3K4ZA 1YNTF 5J6GB 4PWIA 3NFPB 4UV7L 4U6XB 5LMNQ 3EGXA 4A3CH 3CZJA 3KVQA 4HEDA 1G0XA 4XPHL 4YE4L 5F1IB 3GSOB 1X3PA 2BCOA 3FQRB 2DQFA 1S5CD 3ULVD 1DQLL 4ATTA 2AV7A 3DX8A 3AG1B 2YARA 4Z95L 2ZSWB 2OTPA 3BZFB 1LWJA 3FQXA 4IN3A 1MREH 4A2MA 1XTLA 2IDUA 1OP4A 1C4QA 1EAJA 2QKSA 4P2OC 1IAOB 3I6SA 3VCLA 3QIUD 1MKHA 2E9JA 5MEQA 3ZZQA 4PRPA 4WO4C 4KRPB 3ZSSA 4NZJA 4BY1B 4O2EA 4U1MA 1DD2A 4PCKA 4C8XA 1PVOA 1AGEA 3O6FA 2DQEH 3RUGE 4YHNB 2WLMA 4XX1E 2OMVA 4AC4A 1GGIL 3BC9A 4X9GA 5DJAA 2W9EL 4KJWC 2B2TC 1FZMB 3AC0A 4R4CA 3OZ9L 1AS6A 5ISZA 4FLSA 4AH2B 2WLNA 4EZJA 4U6HA 3FQTA 1E5CA 1IAIL 2EE0A 2R1YB 2BNRB 3T4AB 5DZOA 1RCYA 4ZMWA 3OWEB 2UXBQ 4QJFA 1HXMA 5JHDA 4PGCA 5JVH3 3FZUC 4L4VD 4B9YA 5DR5H 4D0CB 1M1XA 1PZBA 1L0XA 2HKHH 4H20H 4GUCA 5LMUL 1NMGA 1T3FB 3RGVD 5EIQA 4PB0H 4P46D 5HI3D 5AFWA 1FAIH 4HWEL 1BQSA 4OJYA 2W0FB 4BH8B 2IADB 3LH2H 1GC1C 3MQIA 5C0AB 1DYQA 2Q8AL 3PQIA 1TWGB 2XN2A 4AL8H 2MCPH 3QQ9D 3GUFA 2OXGB 2UY7A 1J0JA 3NJJA 2X05A 3ZQXA 1UWEL 2FDBP 4N0UB 1TXYA 3B1UA 1VGKA 3DX2A 1Q4NX 4M8AA 1HOCA 1MCSA 2C34A 4L3ED 4ONGL 4LGRB 3AS2A 5LMNL 1HCYA 2GIYA 3B8SA 3KF8B 1TZIA 4N4YB 2GQHA 1CDHA 1KZQA 4X64L 1EJ6A 4J5VA 4DAMA 2V7HB 3LXAA 1FNSH 4OGXL 3CSYB 5GGRY 3RR5A 1OXSC 1FIGL 1KL9A 4GXUM 3BZKA 4PQXA 4KK5D 1FJ1A 2B4CC 3KEHA 4RH4A 3MR9B 5FHAL 2BP3A 4N2HA 4B3RL 3LJ3A 2HDLA 3L8QA 1KJ2H 4KJYB 2X6AA 4JY5H 1LEIB 3MNVB 5LCVA 3TREA 3WAKA 3GM8A 3BIKB 1CE6B 3SDXB 1Q90A 3UYRH 3KGTA 1KBKA 3P9LB 3EGSA 3TF7C 1PLCA 1ND0B 3QXDA 4XOBA 1D5ZB 5E08H 1OAKH 4NZUL 5H2BB 4PGBB 1JZFA 4LPVA 2WUCH 4QOKD 2PP8A 4K0OA 3TPKA 1J5HA 3DSFL 5C8JB 1N59B 5BN3A 5C9KA 5DWUH 4BQBA 1R3IL 3ESVF 1A3LL 4FTVA 2HH0L 3CC5B 1GGTA 3KYMA 4WTQA 2XKNA 3TASA 3TJEH 4AT6A 2WAQA 3PPSA 1Y7VA 2UXBL 1PL3A 4FG6D 2XWJA 4WIQA 1P53A 1N0LB 3W1BA 5KBMA 2QVTA 2Y36H 3TCLA 1EOVA 3WELA 1I7TB 1F9RA 2IF7A 1ERNA 2HWZL 3GTLB 4XXWC 1JERA 4YBQD 3QDHA 3MRDB 5SX4H 4QRPB 1GMIA 4UI2A 5E8EA 3KEDA 4HIOA 1ECZA 4DV1Q 2FBJL 3MLTB 1YPZA 3CDZA 2JKXA 3P2DA 4JHUA 1HHJB 4EZLA 4HJ0C 2QPSA 1DVUA 3BPLC 3LEXB 5JOEA 3NPZB 3VTTA 5AL8A 2CM5A 1M1SA 5C4XH 1E43A 4GI8A 1Z7TA 4FP5D 1VESA 3D8GA 1H9RA 4MCZA 2CDEA 4P57B 3RPIB 4LO9A 4YSPA 5I0ZA 4ZCKA 4R97C 1RJYB 4PJFE 3LRGA 4K8JA 4X8XA 2F3VA 5JNYA 4YC2B 5JPNC 1B3QA 2R4RL 1EJ8A 4MXQC 2XN9C 3MFGB 4LLUB 4FX5A 1JR0D 1JNLH 2JELL 1F42A 2P8PB 2VZSA 4Y4FD 3UJJL 3V0WL 1XZWA 1H5BC 1JZ4A 2X4UB 4FF1A 4HJ9A 5ICZA 4F3FB 5IBUG 5IK3B 1VCBC 2EXSA 4G8AC 3HKZE 1EFXB 1Y8OB 1IUZA 1F4WL 1LP9E 3GTPB 1WBZB 3SGKA 2ZTBA 2H0EA 3CK0H 3KPPA 3VG0L 2EYMA 1KBGL 3MBWA 2JKRM 4LVNC 4NRYB 4Q6IC 5I28A 1EGJL 3FSZA 5EKKA 1L0PA 4XXDB 1J10A 5HGBB 3MLSL 3R1GH 4DGZA 5D7HA 2ADJA 1E3FA 4H8QA 1EAPA 4OIJA 2NNFA 2DH2A 4JO3L 4WDIA 4NKIH 1BX2B 1I7UB 4WFED 2HLFD 1G6RH 3E1ZA 4I85A 4TUJA 2KZBA 4C56A 4Z78A 4KJPD 4YAQA 1VFBA 2VDKL 5IB2B 4W9CC 2FX9L 4P5SA 1QZNA 3IMSA 4LF6L 3FB6B 4IU2A 1PKOA 3W0WA 2ZCHL 4JQVC 4PU2A 1J8HD 4JBWA 3KPSE 3AFPA 2HQEA 1S7TA 3BAEH 3HZMA 4NN5B 4WU7A 4X4ZA 3TV3L 1FGNH 1JVKA 1UCTA 1EZSA 3TA4D 4KKRA 2DYPD 2FWLB 2M83A 1F4XH 3BDCA 1OF2B 3AMLA 3NN8B 1QNZL 3NJKA 3ZMNA 3CPWA 4G6AC 4S2SA 3UZQA 3QXTA 2NNRA 5DZAA 4G6JH 1J05A 3HNSL 5DJCA 4UINL 4DV1L 1SXBA 1HA5A 1AXTL 3VI4B 4ANVA 5LNDA 4KTAA 1EX0A 1U3HA 3B56A 4PP2B 5I1KH 1U95A 2FO8A 3IRZA 3P11H 4DAGL 3O6LH 2HT3C 3EUUA 2ILLA 3MRQB 3BGFC 2J44A 3M88A 4F24A 4O02L 3IF1A 4WK2B 5GGVY 4PIBA 4UPAA 4P59H 8FABA 3POCA 4E6IA 3BEWA 5IHWA 1UM6H 3PIPA 2A4CA 4KROB 4OCMC 3UTSB 4Q0XH 4GLVB 5KS9F 1P7KB 2EVHA 3ESNA 1YHBA 1SOXA 2F0HA 2P5EA 4ZAKC 4A66A 1XBRA 4CGUB 4N5ED 1JFHA 3OKNA 4XPFL 15C8L 3QEQB 3VE0A 4N2BA 1ZRUA 5TPWH 1OGAE 2QTEA 4BCXA 4KDTC 3B2UC 3DX7B 1YUHA 3LKPB 5ICXB 2P5WD 4K6DA 1CD1B 4NNXA 2NZ1D 4IO9A 1X5JA 4WSJA 1C08B 4N2NA 4J1MA 3R8BA 1F6AB 4JY4B 1T2JA 2WIIB 1QA9A 3RA7H 4KY1L 4F57H 1NFDA 5HYFA 4TYUA 4R8WH 4PJ8D 5G4MA 4JANB 4OU3A 3BVMA 3V9EA 3W2DL 3MJ9H 4F8TA 2NTFB 4J1UA 4PRAA 2UWEF 4G6MH 4OLWL 1AR2A 1Z66A 1J9OA 4GT0A 2GI0A 3BSZL 3A8JE 3TTSA 2JH2A 3RX5A 1U42A 4OJFH 1ZT4A 1B4OA 1M6UA 2WB7A 3PGCB 5C0JB 1TPXC 3RVWD 1OAUH 3VYTA 3K6IA 3H7BB 3BH8B 2V2XB 2GSGB 1PFMA 1HN1A 3U1SL 5DD6B 1DANT 1J9RA 4N6RB 3ULPA 1EYGA 5EBMB 3VM7A 2N88A 3ILPB 3KL3A 5EB9A 2QFRA 4K5OA 2F54E 5EF2A 2BCKA 1G291 2EXYD 2XN1A 4KTEL 2ZCKH 3EG9B 2LU3A 3PL6C 1GZHC 1LEKA 3N2JA 4ZUIA 5L2KB 4AJVA 2FINB 3BJUA 4LLAA 5GGRB 4EDXB 1CDGA 2WV6D 4GPVA 3SVMA 2YBRB 4B97A 2R1XB 1D6EB 3HEIB 4K2UH 1UACL 4M4RB 4Y16A 5AOKA 1ITBB 3U2JA 5E70A 3O81A 3IFTA 4L2LA 4LL9A 4MDJA 5ACLA 4HUCA 3PUYA 1FNEB 3KG5A 1N33Q 1MJ7L 4G3YL 2UZYA 4QRSA 5C0GA 2VLKB 1IBDA 3N9GH 1IKFH 1MAML 4HR7B 3WHE1 1L1OB 4PJBE 3GSNH 5FV2A 4DW2L 3T4AC 2WD0A 1YEHH 4B7LA 1TCRB 4FNUA 1S72A 4LF3B 3KLKA 3BKCL 1DBML 4N8VG 4OCLC 4PTTA 1B0GB 3AG4B 2Y23A 2A77L 1USQA 1YN6A 2Y7QB 4GSXA 3EDDA 4LLQB 25C8L 2PQAB 1NCOA 3Q8FA 4UQ3B 4HCEA 5BRZD 3TS0A 3BMWA 1J0IA 3SCMA 1JPSH 1RUPL 4HYTB 3HG1D 1A9VA 3JSSA 1NDMA 2Z0UA 4UUJB 3U4BL 5D72H 4ZMQA 1DUZA 4JKPL 3IEAA 4KH2A 1IZ6A 4QXGH 3HVDA 4UILH 4B27A 1RJLA 2R56H 1QEWB 3LKRB 4K94H 2XNAA 4WUKL 1ZHBA 3WN5B 1EBPA 5T5NF 1RZGB 2BSDA 1M05A 2NY7L 4WFFD 1N4XL 1CXEA 5GROA 5JW4Q 1XXFC 3K81C 2ZKWA 4Y2OA 3RPBA 4OI8A 8PAZA 3CQQA 1IRAY 2NR6C 1PKQA 4YPGA 3S35H 3BAWA 5AZEH 4LMQD 5LJYH 4PV9B 1XF4A 1YJWA 5IYBG 2DWXA 1M71A 1MWAB 4EQOA 1HNYA 2CD0A 4FQ2H 3CXFA 4XB8A 5EWIH 3LEVH 4I5BB 4KN4C 3FQNA 3MCKB 1MELA 4HIKA 1ZVSA 2Y1YA 4A93H 4NDMB 1KFAL 4KJQC 4M6OH 4ZW7A 4XP9H 5AAWA 2P24B 4YXLL 4E2OA 4IRJD 2EYRA 2ZAHA 1OB0A 4KJWD 1J48A 5BQ7B 4F9LA 1MFAH 4QHKI 1KABA 1D5ZC 5C4JB 1KJ3L 2E8GA 2NW3B 4BBSH 4HZLA 5CWSB 5JR1L 2VQUA 4V2CB 2HJKA 2VLRB 3QUZC 3QAZB 2F19L 1MLCB 3A6BH 4WNJA 2ZX7A 3FZUD 3QDGB 4JRXB 4D0DA 4CHTB 1YJ9A 3MLYL 4BA2I 1V27A 2HFEB 4XRCB 2I46A 1WC7B 4U7SA 2XVKA 3KLAA 1BMGA 5C0BB 1Q38A 2G0KA 1HEJC 5EA0L 2OCFD 2QDLA 3OSOA 4F37K 2K05A 3EYUH 5G4OA 4ZMTA 3AY4A 1GZQA 4J3OG 4HPYL 1RXLA 3APNA 4XBGA 3JAME 2JQOA 1SGKA 5DJXA 1E40A 2R2BB 3MTXA 4UM8B 4XNXH 3JUZA 3DVGA 2WJ7A 3GMPA 2FRGP 3DYPA 2A3TA 2IQ9H 2JNZA 4QRBA 4G7VH 2VRAA 2YPLB 4X5LA 1KN4H 3W9EB 2ZXWB 1G9NL 4NYLA 3CCJA 4AY0A 1I9JL 2X2YA 1TQOA 5KEZA 2J6EA 3I3EA 3VFOB 1EUUA 1U8MB 5KW9L 3C1EA 1YIJA 3LNIA 3H15A 3QNYA 4QNPF 3M8OH 4FTDA 1IT9H 1HQRA 1QR4A 1UENA 1GJWA 4J23A 4FF4A 5LQBH 2IOMA 4KKUA 2XQYK 4JM4H 1IL1B 1OHQA 1TFPA 4YC2C 2CFMA 1KDCA 4YE0A 3TNMA 2H2SC 1H9VA 1VCAA 4KMQA 2AQ3A 4XAKE 3DYMA 3O3DB 4NZFA 4J27A 4WI0B 4DIXA 1PTZA 2WKGA 3QG7L 4HJJH 5GXBB 2BOCB 2BC4A 2DI7A 5ETUA 3QORA 3SIKA 5EOTB 3CN0A 1J88A 4JFSA 2FJSA 4TQUS 1JSYA 3MYZA 1RH8A 4FNTA 4BY7G 1G6VK 3CZFB 2YA2A 1FWXA 4G5ZH 4HV8B 1M7DB 1XIWB 5M94B 2KUMA 3ERQA 2QEXA 1PG7H 2AJSH 5KVGH 2H32B 1S7WB 5HI4C 1F4YL 4JHWH 1B9MA 3JQOB 2MFIA 4QB4A 3ETSA 5JXEA 5F0PB 1IL2A 5F6IC 3EH3B 5E6IA 1Y8PB 3O3AB 5ACZA 3M9BA 2RHSB 1YQVH 4NN5C 5DD0L 1BNZA 2KKQA 4QF1B 3KM2A 1H0DB 2N3JA 4OCYH 1BXUA 5CKGA 2Y25A 3WIHL 1SF3A 3H53A 2OTLA 4R5VA 3CPFA 1TLMA 1A1MA 4H88H 4NJ9L 2E7HA 1JDAA 4IRSB 1B70B 2GAZA 3MA7B 4GSRA 3PGFH 5EEWA 1KG0A 3S8FB 3PV6A 4OWTB 4LL4A 4PCTA 4L0PB 2IGFH 3ARBA 2JI3A 3HHMA 4FP8H 2J5WA 2EVFA 4K07A 3VR6A 5FYLH 3HOXB 4HIPA 1AO7D 3CU1A 2JB6A 1UE6A 4JI8Q 2QADB 1BQHB 3MLXL 3HS8A 2C9RA 1BP3B 2JLLA 1WF5A 1ZA3A 2IWFA 2WOYA 3DKHA 4Q58C 4F2MB 2D7TH 3NIFB 2X6BA 3RKDC 1YCSA 1NL0H 4HK0A 1TQBC 2VQ1A 1QG3A 2XY1A 5D7IF 1NBZB 2J8UF 1IGJA 4YSAA 1OO9B 4P07A 1ZGLA 1B53A 1K0SA 1E7UA 4XB3A 5D4HA 5CGMA 1WLHA 2XN9D 4MXQD 1YG9A 1GHFH 3ZE0B 1FJGQ 1HHKA 1AZCA 1M7IA 2MNWA 4ZUTB 1UG9A 2QZQA 2AJYL 3ASWA 3B3IA 4HIJA 4NZ8A 2C4FU 4FQLL 2XWBB 2NUTB 4F37F 2R51A 3H9SB 2BVPB 4EVNB 5I5RA 4JFDB 5A43C 2FUTA 5I1HH 1IGCL 1HI6A 5ALCH 3HLAA 3VFTB 1IEAB 2UX7A 4KKAC 1J9TA 1UYWH 3CVBA 1GJXA 1NIEA 3CUPA 4YHIB 3VB9A 5GZOC 2FEDC 2NY5L 4PWKA 4CMHC 3GBNL 2VGLM 5I1JH 4QXWA 3NEXA 1SF5A 5C6AA 3FRUA 2JTYA 4IPCA 2VN4A 1T4WA 3HR5B 3OD3A 4PRHA 5GS0D 5E5UB 4M7KH 4RGNB 4U1SB 1NAMA 1ZVYA 4P4RB 5I1DB 2OMYA 1HFGA 4JCLA 2X09A 3V6FB 1BF2A 1QNIA 4P2QB 2AJUH 4X6EB 3B7SA 4YWKA 1T66D 4Y4KC 3DGDA 4E41D 1HAUA 4GO6B 4ODWB 3GDEA 5KSBB 5EF3A 5I1IL 2ZYRA 2C7UB 4PBDA 4G6AD 4XTRD 5CUSH 2DBLH 4DN4H 3BHBA 3MRBB 3EIFA 4U1KA 4FLOA 2JE8A 2VJXA 3QFJB 4QRAA 3FHEA 4IPGA 1NCWL 1QSFA 2D4DA 3D51A 5HDBF 4Q52A 2HT3D 5LAXA 2WFWA 4JI8L 1Y1WH 1DVTA 2FMMA 3U6RA 4KBPA 5C0XH 4RFNB 3ZMEA 5BPPA 5IT2L 5D2NA 3SDAB 2O6EA 2HG5A 4XVOA 4DKDC 2YPKA 5KS9E 2DLGA 3LS5H 4NC1C 1FVCA 1LEGA 3CIAA 3ESPA 3D18A 4MRCA 2CSPA 6FABL 1SBSL 1D6EC 3PO3H 5HP5A 2VZ3A 3BVTA 4TTDC 5FLUA 5GRJH 1YO4A 2X1QA 2IBBA 3IMVA 4AQEA 3FO1A 5D1ZI 5ERWA 2GJZB 1XXGA 1FJGL 1R3KB 4KDWA 1P7QB 4S1SL 1OTSD 2E27L 4NUPA 1S7XB 1YEKH 2PW5A 3F2UA 3G08A 1UM4H 5LUMA 1OAYH 2AAVA 3S35X 1N26A 2RD0A 3PP4H 3WD5L 3X13A 3B2UD 1DJGA 4CDDC 4YWGH 2JCWA 3D4DA 2B9AA 2XRSD 2X42A 4DKEH 5KTEH 4H0IA 3X14A 1F97A 5EU6A 1K3IA 3NP8A 1OM9A 3P54A 2A69C 2X4OA 4FI7A 1I1YA 3MAWA 5I1AB 4E9WA 1WFQA 1WITA 4G8EA 2UWEE 1T5XD 1V8HA 4B5ZA 3W82A 1N18A 3M1OA 1B88A 3D2UD 4GFTB 4KZ0A 1ZOXA 1Y1UA 3G48A 1MJCA 1G9NC 2CMRL 3N6RA 3BPOB 4LRNL 5EN3A 1XMQL 4YSSA 5HYSG 4C83B 2F0CA 2BJML 4GBXB 2VDNH 2AJXH 4WW2C 1NOFA 1VLXA 2BY0A 4XNYL 2CA3A 5ESVB 3S5LA 2VZAA 1VF7A 3CZSA 3O8XB 2H1PH 1JXJA 5GQBA 4GRWH 3SE0A 4AVKA 5KVEE 2ZJSL 4IOSA 4ZFGL 2O6PA 3GMOA 2B4CH 3MGTA 4QAWA 5K59F 4LNQA 3CXCA 3INOA 5LGHL 1MY5A 2AANA 5F96H 4G7HC 1NA8A 4KRPD 5I4DA 4N22A 4PWEA 5DYFA 2C9XA 4I0CC 3MNWB 5CD5C 5DHYA 1GYWA 1OQXA 2ZX9A 4JBJA 3ET9F 3JC66 4BFBD 2J3SA 3D30A 2YS4A 3EYOA 3AWEA 5D1ZB 1ACXA 3PWJA 4FGMA 4FLQA 2L1BA 4KFMA 4RMSA 5E99H 5FO7A 3FFDA 4MZRA 3VXUA 3ARDC 1NTGA 3AM8A 4BJLA 4OLEA 3OB0K 1MFDL 5GZND 1H3GA 2BNRD 1S3RA 3SYQA 2IY5B 2Q9OA 3DK2A 4K4KA 4OFDA 2AEQH 3VVWA 4HMJA 3ARRA 3FH5A 4ZXBA 2E7LC 4HIHA 3KVPA 3O45A 3LKNB 1C5DA 3BE1H 4FKEA 5D7KE 4L5RC 1ZHKA 2MH4A 5BCAA 3G5WA 4N0YL 3S17H 2DJMA 3EO9L 4E9QA 2ZONA 3ULSB 4H5SA 2I0QA 4M6ML 2R0WL 2ESVD 3BKML 4F7MA 1QACA 4OZ4B 3H8NA 1XSJA 2ZKMX 4OKVA 5E8PB 5C0AD 4LRIA 5BO1H 4CMMB 1T0MB 4YHHQ 1BD2E 4TRDA 1KXVA 4F7TB 3N06B 2IDFA 1PG7X 4JG1L 1BZ8A 5ID0A 1EHNA 4U3SB 2AVFA 1KB5H 5H37G 3V7MA 1JZ6A 4Z6AT 4IIZA 2K28A 4IMLA 4KKSA 4NNPH 2GVBA 4EOWH 3UYPB 3HZVA 3PMFA 4FXGB 5FOBA 1U8QB 2QQQA 5IW3A 5T3ZE 3EJPA 5D2LF 1H6FA 4LAJH 4OZIB 3UFIA 1FO0B 2JCCF 3S3PA 4Y2DA 1A7QL 3MUJA 1OK8A 3VG9B 4N8CH 2O5ZL 7PAZA 2OJEB 3ZLQC 1ZLEA 1NLBL 3HOYH 3U83A 2NYZA 1AXSB 1PFNA 5M3MG 1S78C 2DMHA 4M93C 4AG4H 1Y0LB 4W9LC 2KCCA 4BSWB 4X6DB 3QJXA 3SXHA 1TTFA 3WS6A 2CK0H 3KDPB 4OF0A 1DQJB 3IDYC 1I1AB 3MTSA 2HRPH 5AAMC 2CWAA 1SYSB 1X5XA 5JUEH 2VRQA 4CADB 5IP7H 3MGOA 4LCCB 1GKEA 1KJVB 1RURH 3VWJB 3H85A 1AE3A 2ALAA 2DAVA 1PFBA 2NY5C 2EE9A 2BW4A 4N2LA 3ARGA 7CGTA 3CVIL 3LQMA 4FABH 2ICEB 3W57A 3LEYL 1WT5A 4QXTB 1TIUA 2DQTL 4I2XA 4F1ZA 2PYFB 4FQPA 1DN2A 4X0NA 2VOTA 2IH3A 2OMNA 3LMJL 2BP0A 3T71A 1PD6A 3GHBH 1FNWA 3GUTB 3L4YA 1ZY9A 2JQZA 1OT4A 4WTZG 3MXNA 1DQDH 1JQYD 1VFUA 3Q2NA 2AXWA 4G82A 3APDA 2EXWC 5LGJB 2KZ1B 4K3EL 2Y7NA 2ERJC 5T3XD 3VXNB 4BSVB 4I4WB 3VTMA 5HYIA 3QEHA 4ZX5A 2CCLA 4IRSC 4YE4H 3CRLC 2AABH 4QRPD 5JA9A 1PCSA 4XT1B 1EY6A 1S7SA 4WWID 3GSVA 3MKKA 2Z1KA 4Z95H 4Z7QB 4YHHL 2PWDA 5EOCL 4QNPE 2XSCA 2BWQA 5G55A 3QPXL 1OLLA 5DZLA 3WFHA 5JYMA 4CU8A 1FVDB 1G6RA 3I9PA 4Y9GA 1A65A 3KWWA 1JZEA 4TQEL 4IBLT 1O5PA 5FYKU 3QYCA 5HJGA 1AGCA 3QULA 5IP4A 2H2SD 5FF6A 1GGIH 2YD9A 5CXPA 4H0GA 3LQZB 5M95B 5H94A 2W9EH 1FIEA 4LB8A 1AYRA 3L2LA 4A3EH 1CGUA 1P4LB 1P16A 1XFPA 1I4QA 1M56B 2NY1B 2M8XA 1ASZA 5LGYA 1EFXD 2BNQE 2IBZY 2JKWA 2P44B 4HUXA 2OSWA 5CLXA 4G9FE 2NSMA 2V8MA 4XMLL 2JTDA 1KGCE 5TFSH 4KHZA 3L08A 3UCRA 5M3FH 4C59B 2K70A 2ZWZA 1N8ZA 2QEJA 3OSVA 5A2LH 5HDRA 4WSKA 5HI4D 4WI3A 5KYXB 3CX2A 3LN5A 2VR3A 5ELOA 1OCRB 2N1KA 2XWZA 3BJLA 4LKXB 2X44D 2NLJA 3OF6D 2IL8A 5C5LA 1RP8A 2IAMC 4RGNC 4MA3A 3VXRE 3K57A 1ZSHA 2F53E 4RFEB 4TKWA 2CVRA 1UWEH 1F90L 3ATAA 1N64H 3BZEB 2XZCL 3W5MA 3P3TA 4GLXA 3L0OA 2Y4SA 4ONGH 5BMFL 2UZXA 4XMVA 1SE8A 4K2LA 1GUGA 1UE5A 2GITA 1U4LA 4L37A 5K93A 1BVNP 4XO5A 1QX1A 1CLOL 5EBGA 3V96A 1I9EA 2WB1G 1T9HA 3B34A 3C09C 4OGXH 5ELNA 4DV2Q 1ZSDA 3V5KB 1FIGH 4HOXA 3B5GA 4GP5B 5D7IE 3GGWB 5EF0A 3I4MH 2J8UE 4PJCB 3PWPB 4KGJA 3BPNB 5FHAH 4H02A 3BI9X 2J56A 2F7RA 3CH1B 4LAQL 4JJ5A 3LIZL 2YSSA 4NUQA 3U2SA 2GTWA 2C9VA 1EWIA 2DV6A 3IE4A 2CBOA 3HHSA 4PJAF 4ESKA 3CLFL 5B7FA 2VE6A 4AUYA 2E4TA 3MJ9A 3BH4A 1JYXA 4GFXA 5FXCH 3FPXA 1YHAA 4A3JH 1L9RA 4KROD 3UTSD 4KKPA 2HLEB 4DV7Q 1MHEA 1KCRH 1SVBA 3CE1A 3FB8A 1UA7A 4NP9A 4NZUH 4JHAL 1REIA 5B38A 1I8MA 3DSFH 1Y14B 3G6JA 1DQTA 1AG6A 1S7QA 3CFDA 1UM5L 3D69A 4JFUA 1J87A 1LT6D 3IFLL 1R3IH 3B8YA 3RFZA 3QEQD 1HHHB 2GHWB 3L5IA 1WISA 2HH0H 3VSUA 4AKPA 4KKAD 2Y0SB 2GA4B 1PQZB 2PPFA 4GIPD 4PN6A 4YSOA 4AQOA 5DS8B 2C3VB 4LK4A 3D09A 4TL5A 2FLBT 4IJ3B 5FO8A 5FYKL 1JHTA 1GYUA 3ARZA 3LKQB 1HHVA 3X12A 1INEL 1SQMA 1A8ZA 3RIAF 1MCDA 3HCVB 4XZUB 2HWZH 3D4YA 3HRZB 5C6WH 5EQ0A 3QUYA 1UGNA 2GJ6E 4KLKA 1CFMA 1T2QL 1Q9KA 3HS9A 4Z7VB 1I3UA 1ZA6A 2FBJH 3BGMB 2NMSA 1RJZB 4HUUA 2H8PA 1SJEA 4XC1L 4RVBA 4F8QA 4HUVB 2L04A 2C4FT 4JGNA 3D52A 4AIEA 1X5AA 4HLZH 3ZK0A 3BYYA 3GSNA 1YPZF 5IROD 2MO0A 4GP8B 2HIXA 3CSPA 5HDBE 2XTJE 3O0RL 4M1CD 3Q6SA 2JYOA 3O8XC 4UZUA 1NEZG 3FU0A 5TE4L 1WV7T 1HYSC 3EF7A 3PUCA 1S46A 2F1AA 1B0IA 2R4RH 4P5TA 1EO7A 4DV2L 1DSYA 2H6PA 2JELH 3RZOB 2XXFA 3UJJH 2ROXA 1VQJA 2YD4A 1B9NA 3OMZA 5CEYB 2GT9B 2KHJA 1WUZA 2A6KA 3D4CA 5FB8A 5L2KD 1NLDL 1OM3H 3VXMA 3T0EA 3OL2A 3ETBJ 5LXGL 1YBYA 1EGJH 4AYBE 1WBXA 2RIKA 3DV4B 4MJ6B 3V4PA 1XMOL 3G9AB 4EQ5A 3P4MA 4DV7L 1Z9NA 5KVFH 4UAHA 5ELEA 1H8NA 4JO3H 4PJGA 2VLKD 5LBVA 3U6XS 5JIQA 5F1NB 3TJPA 1BREA 2AXJA 3RWJA 3N42B 1LO3L 1AC6A 2CDFA 4TSAL 2VDKH 3I70A 3GK8H 2FX9H 2Z35A 3RU8L 5BRQA 1EHKB 3MODH 1KHIA 3UZVB 2ZCHH 43CAA 2WAQG 5IIFA 3TV3H 2NB0A 5I2IB 1E8XA 3RI5K 4TVAB 1XGPB 3EGDB 4FQIH 1GGCL 1JXGA 1PX8A 3WNIA 1BM7A 4JCWA 4YWMA 3GSQB 4YCWA 3S36L 3KBPA 3HC3H 4PJ7B 1D5BB 5ELBA 1NUGA 3GNML 5EOQH 4NOFA 4AZ8B 5CZVL 1HSAB 4PHXA 5IZ7A 1RL1A 1C5CL 3HNSH 1MNUL 1WFUA 4UINH 1UKTA 1AXTH 1PYSB 3DDGA 4PWJA 1KYDA 2OTJA 2Z31B 4FG0A 5D7SL 5BRZE 3U82B 5CN2A 4H4NA 4O02H 1CSQA 1O6VA 2E9BA 5K39A 3SDCB 3ZDXE 1KTRL 4AYFB 2Z65C 5K59E 2K52A 5BOPA 4C1NI 1J8HA 3VG9C 5IMLA 3AU7A 4AYID 3S2HH 3I4NH 2EICA 4LP5A 2D0FA 1Q94A 3S4SB 1TZGL 2NXZB 2Z93B 1E5UI 2ZYSA 3A0OA 4UWQB 1LMKA 4XN8A 2DD8L 3SJVB 1HZHH 4Y9BA 1HIML 4XPFH 5CD5D 1LE9A 5ID1B 2V8LA 3D6CA 4DAPA 4JPBW 3CZLA 3LZNA 1SXTA 5EO1B 4BH7A 1NWPA 2JSFA 3MN8A 1RPUA 1JTTA 4FN0A 4IM8A 4U0RC 1V8QA 4K0KQ 3KH4A 4X9BA 3TA3C 2J1WA 3VWJC 3TPUB 2WLJA 3OKEA 5FDWB 1ZE3C 1YAZA 1KLGB 2VLRD 1E90A 1S6NA 4OF6A 1OE1A 3DLQR 4U1JA 1O7IA 2A68C 7FABH 2LXKA 1XTDA 3RWGB 4TQIA 3MTRA 2NPLX 4KY1H 3RZDB 2CBPA 2WVVA 3QDGD 4H1LB 2PO6B 4JRXD 4P4KC 5E6YA 3F6JA 5EU3A 2PW7A 1WQVT 4N2EA 4OI7A 4PJEB 3W2DH 1FYHB 1ZTXL 5C0BD 1FR3A 3OX8A 2LU4A 4OLWH 5FA4B 3GD1C 4YXHH 5CCKL 1KDJA 4LUOA 1VQAA 4XTCS 1TZHB 5HJ3B 1U8CB 5KYYA 2MQHA 1NFDF 3PV0A 3T4YB 3TNNB 1K8DB 5TGBB 3LRKA 3TZDA 3LN4A 3CHQA 1AHMA 1UB6A 3BAYA 4JHZA 5J6SA 2ADIA 4L8JA 2XWTA 2P8LB 3ASOB 3S2DB 4N2IA 4RGMB 4NNYA 1NDGA 2YPLD 1U8JA 4EXPX 1WH0A 2DDQL 3DECA 3UTPD 1N3NB 2ZOKB 5D2LE 3NJXA 3AUWB 3D06A 4KTEH 4QY8B 3OHXA 3RWEA 2JCCE 4ILDA 4EGVA 1HXKA 5GSRB 1FYTB 3FYEB 4KD4A 4DR5Q 3QQNA 1EJFA 5D6CA 2OQ0A 2E47A 3QJOA 1S7RA 4XODA 3IJYA 2V4DA 4CKQA 4LVOB 1J9QA 5JQ6H 3EXLA 3WY2A 1KACB 1UACH 1OXYA 3HNVL 2YZ1A 4U1IA 3CQZH 1CUOA 3S1NH 1A6AB 4WKZA 5I1LA 5FCSH 3UH8A 1T1WA 3BP7B 3CC1A 4G3YH 1MJ7H 3RI5F 5C0CA 1A9EA 3GLDA 1TQSA 1MAMH 5M5XB 5FLXE 1DL7L 2G2RA 2NY1C 1YNKH 5DLML 3BP4A 4H7VA 4JKWA 3PAVA 5AYTA 5GAGC 1PSKL 1W72L 5DJYA 5EZJB 5H35B 3C5ZA 4DAYB 4A7QA 4D8PB 2GVYA 4PY7B 1YNNC 1XIWD 4KKZA 2A77H 5IHUL 1ORQB 4ELMB 4K0KL 1IKLA 1IL8A 4LSRL 1UZ8A 25C8H 4NFCA 4ABNA 3IFDA 2AZAA 2A9BA 4KHPQ 1NCUA 4Y1AB 1I8IB 5IWLC 4JI5Q 2OTWA 2WLIA 2J6WA 4PG2C 1X9NA 1RUPH 1DJRD 2A73B 4NO5B 4L4TB 1EZ6A 1KXLA 2KECA 2CKBL 2EEDA 3NCEB 1Y1VG 3I02A 4JKPH 3U4BH 3GHPA 1AGBA 2XBDA 3CHRA 3ZGHA 1LV9A 2R61A 2EXWD 3GIVA 4MAYC 4B50A 1A3QA 1CFNB 3F6IA 4WUKH 1GGBL 3E1F1 2NY6B 1O6SB 3J80L 4P9ML 2JB5L 1NNXA 2NY7H 1Z2KA 2JLPA 4IRSD 1TU2A 2YRPA 3EHBB 3TP4A 4NCC1 2GEEA 4OELB 2JA6B 4B6ZA 4DHLA 2EIJB 4IHOA 2VUMH 3FB5B 3VGAC 3VFUB 4JDVB 3HG2A 2UUDH 2AQ1B 2QADD 2I26N 5AW0B 2XG5A 4LAAA 4TF4A 4UYPA 2A4EA 4I3GA 5HHVH 2MKLC 4FXKA 4M62L 4PRPE 3RVUC 4OEMB 2IAAC 5E1IA 4N68A 4DR5L 1KFAH 4EN3D 4YS4A 3RN5A 1BKBA 2IMNA 2G60H 4Y5YA 5I76A 3TL5A 1MBYA 4JMXA 1B4JH 1FA4A 4L05A 2H4EA 4NQCA 4R4NC 1OGTB 1UA3A 3GSWA 2WNKA 1KJ3H 4N28A 5J22A 5T1MA 2NCMA 1JF6A 3NJIA 2DNEA 2VW9A 1IC4H 2QQLL 3DI3B 3MXWL 2BDNH 3H9SD 4R7NA 4WI6A 5ISZE 4QRRA 4A3MB 2YN3A 2EYPA 4JFDD 4N9OB 3W3BA 2OMZA 2DRUA 3CCHA 1V3KA 1I3QB 2QDWA 1V43A 3AAZB 5DRNA 1Y6MR 5GGUA 3MLYH 5E1GA 5JHDE 3CSTA 3P20A 4TLSA 1HTYA 1TJXA 4M3HA 2SDFA 1P5VA 1L0WA 1RZ7L 4RQQA 2PR9A 1DGSA 3DIVA 3PY9A 4M7ZB 4P2OA 4RDBA 5EA0H 3D05A 2ZXRA 3LPWA 4UCFA 1G43A 1F4AA 4WO4A 4YJZL 1DUYB 5I16A 2E86A 4YMPA 2OR9L 4JI5L 2OI9B 2YD3A 3NABL 2F7OA 3IAGC 4RGND 4JG2A 4KK8D 1IEBA 1UT9A 3E0GA 3NE5B 3IBOA 5HI5C 1KLUA 4PJDB 2EY2A 1JD7A 1WZMA 2NSQA 3M07A 3UC2A 2Q3XA 4A3DH 1G9NH 3C2PA 4P2QD 3L7EA 5IGEA 4QO1A 3HS0C 2HVBA 2KLRA 7TAAA 3LKOB 1TLKA 3OLDA 1M1KC 5DEHA 3FTZA 1H9SA 4MGXA 3OAYH 2MMXA 3N1FC 5BV7H 2ED6A 4GUOA 1N5AA 3EJIA 5CV5A 4X65Q 2VDOL 3ZVVA 5IMKB 1BSIA 3MV8A 3QFJD 2FX7L 1P1ZA 4YL9A 2BIHA 4GZYC 4PJAE 5CU5A 1FQ9C 1DOLA 2XVBA 3MRGA 3PUUA 4OD2B 1OSYA 3A5UA 1U8HA 2CALA 3QG7H 2ENQA 2XWEA 2VB5A 3WJMB 2OZNA 3SDAD 1UWVA 4MZ9A 1B0RA 4CC0A 2EABA 2DJUA 3GI9H 3DDFA 3UTQB 4HIMA 2Z6KC 5HGAB 3KYOA 2I5YL 3FT9A 2TRYA 4YHOL 5B3JF 4JM0A 1AD9A 3L4WA 5JZ7C 4QHUA 2X53A 2DLIA 3K5SA 4L5SA 3FH8A 1LM8V 2E2JH 2ZKYA 3L4UA 4FTVE 4RAVA 4ZD3L 4C3IG 4NUJB 3MUZ1 2WZPA 2F08A 3M4QA 3N50A 4GMSL 4X4XA 2FFKB 4G8IA 3MNDA 1R5IB 2PNRC 2MOQA 5DD0H 3CBRA 3EFDL 4O2CA 4QTHA 3WIHH 3WNLA 4NJ9H 3KPOA 1F00I 3AXLA 4XCEB 1VQ5A 5I26A 2KCMA 3KF6B 3VFRB 2DWEB 4MTMA 4JKNA 3CNKA 1HQ4A 1CIDA 1CT8A 1X5FA 3NH7L 4IOAA 4OLXH 4YX2L 3ZOAA 3VXSB 4CNIB 1W6LA 5D1QA 5CC4A 4X4MA 2PPCA 3H3KA 5B8CA 1X5LA 1Y69U 1YPZE 3WY3A 1QCBD 3WYRA 3K80C 6PCYA 3L9YA 4U4BA 1M6OB 5MERB 1ULVA 3L4ZA 3MLXH 1RL2A 3JUYA 5EZOH 1CURA 4GBXD 4L3FA 2BSEA 3BCDA 4MHHI 3WUWA 3W9DB 4A3GG 2EC8A 2LKVA 3G5XA 1ROWA 4AK1A 1N70A 3FTWA 3LCYA 3O8XD 5FM5M 3VA7A 1IBBA 2OMUA 2CO7A 3GPEA 3SDCC 4L63B 4DK0A 4N90E 4XX5A 4B9WA 5INCB 1HYSD 5IMOA 4F33B 3RVXD 1ZDSA 2PMZB 4OIIL 1DVFB 3AYHB 2AJYH 1UWGL 3FJTA 2WC7A 4FQHB 4NLHA 3S7GA 4FQLH 4XXWA 1A1NB 2NXZC 2UZIL 2XJKA 2TSAA 2CR6A 3H0GH 2BFVL 1DQML 3ALXA 3HHRB 3DPBB 1IGCH 3PIOA 3BVNB 3BUIA 3NDYE 4NOBA 2VIRB 1SNMA 3F84A 4EI5B 1MD2D 3L9RA 2VZOA 1KCUL 1KB5A 2JF1A 4WGWB 5D1ZD 2OXHB 3FO2B 4PGDA 3GTTA 3MDJA 2DTMH 3L5WA 5MI0B 2G5DA 2JJQA 4NP5A 2NY5H 3EDKA 3WTSA 1K8IA 3GBNH 3MXPA 1FV1A 4I3RL 4X0KB 2VSDA 3FDWA 5KWYC 5M5WB 4M03A 1LK2A 4C56E 4KV6A 4W9GC 4U1NB 1OF0A 4ICXA 4J3BA 1ETB1 1OSPH 3LX0A 3ZYYX 1T1YA 5ALBH 3RWDA 2JK5B 2PO6C 3W0WE 5JPNA 3K4DA 1IX2A 3QSKB 1MHCB 2YPVL 4X5XB 1F58L 2I07B 5A3ID 2E6QA 5I2XA 4RAUC 1H5BA 3U4EA 2FNWA 2RR3A 5IHZB 2AI0H 6PAZA 3U7YH 4Z77A 5E8OB 2K7QA 3LPOA 4OUUB 4PLJC 1LABA 4OZFG 2FJHB 1LK3L 4M8UA 4Q6IA 2JQAA 4RGMC 3OJMB 4P23B 2Y7SA 2ZXOA 1NCWH 2YEVB 4DV4L 3FFOA 3L3OB 4NB3A 4KO9A 1RTOA 1TWFB 3HE7B 2ZNXA 2A9MH 5IT2H 1OV8A 4YQXL 5AVTB 5AKTA 3MYJB 4L5QA 1XBDA 3GJFH 1MI2A 5FO9B 3JV6A 3RY5A 2AJ3A 1K85A 3COOA 1FNUA 2B14A 4R9HA 2Y22A 2Q8IB 3K74B 4LVOC 5J8OA 4JI7Q 2QQNL 1SBBA 2XY2A 3FPUB 2E5EA 4RMUA 1DZ0A 2F03A 1L9OA 3E9HA 3AFQA 3G5VA 4CU7A 4NKDA 4S1SH 4R8IA 2P5EE 2WYZA 2YAHA 2E27H 1JFQL 2WZ0A 4BCZA 4LEEA 1I1AD 1BBDH 3EYQC 2I85A 4YO0B 3DMMA 4JFPB 4LHUB 3D39B 3O9WC 3P3RA 1FORL 3WD5H 2YD0A 3I84A 3QO0A 4GSUA 5C9JB 5IEKA 5G3LD 2YHGA 3QIWB 4NXSA 4LIQL 4XCYA 2CO1A 2KQMA 1XB8A 1VQOA 4ZO7A 1IYUA 2Y3AA 4WI9A 2BHFA 5J06A 2AITA 4HGKC 2CLZB 1KMGA 4NCDA 1T2XA 2J2ZA 2JFCA 4GW5B 3IJHB 4JFTA 4JY6A 4N1HB 4TNFA 5LBSH 4RMWA 4ABVA 4KZDL 3S37L 4N0FB 1NFDE 5IE8A 1YUKB 3O3EA 2VLJA 3RHWK 2CMRH 1GSKA 1N19A 3I6LE 3P1HA 2VB2X 3VI3A 4WUUB 1Q0YL 1X9LA 1MPAH 2NY3C 4ZAKA 4EX5A 4B9ZA 2NY6C 3S34L 4GG6B 1IGFL 1MIEL 3I2CL 3QC6X 2EH8L 4XIGS 3FPYA 3IDNA 4XNYH 5FLMH 1BOGA 4I0KA 3SPGA 2R92H 4LEXH 4A67A 1UT2A 1JE4A 4CJ2C 1JVLA 4X99B 3VRLF 2ZJSH 4ZFGH 4HMIA 5GHWL 3UO1L 4RCOA 2NX5A 3FT3B 3HZXA 2IT1A 3QZMA 1E5YA 1ZCRA 1KIPB 1TJHH 4K6LA 3MRCA 4MCMA 5F8QC 4AX3A 3NRPA 3IDMB 1VFAA 3G5ZB 3GXIA 1CKOA 1HSBA 3VD1A 1EERB 4JI7L 5DK0B 1FNGB 4U6XA 5CSBA 1JF1A 1L0YA 3MC0A 2C3XA 1KCLA 2NY1D 2OQJB 1E4XL 4D94A 5F1IA 4BWGB 2ZXGA 2WLYA 4ZKCB 5BZZA 2LAAA 3MRHA 4LCIH 5FYKD 5C3IA 4XHQA 1VADA 1YNND 3BZFA 5DVPA 1MCIA 1E24A 3II2A 2IBGA 2B08A 1XX9C 1IGIL 2B8GA 4M7ZC 3EO9H 1GZHA 3PL6A 5DEGB 3ZZ1A 4M6MH 4Z3JA 1U92A 4M1DH 1E28A 5K5PA 1WS7A 3BKMH 3LZLA 4Q6YA 3O13A 3HOVH 2OI9C 4JFQA 3IFOA 4LP8A 3KCPB 3UBXI 1GTFA 4MVBC 2G4EA 2BSTA 3KHOA 2JP1A 5E0QA 1OB1A 1VQMA 1TTGA 3QZNA 5ESAA 3UJIH 3PHSA 1FH5H 3GXMA 5DTFB 2NT1A 1R34A 5CR3A 3HG9A 3FRPB 3PO2H 4OD3L 4ZX6A 2R1YA 2BNRA 3S3BB 4ODXB 2EYTB 3QOLA 4HG4K 4K5XA 3FCGA 2ZP8A 1A7QH 4BFIA 2YK1L 1PKQE 2O5ZH 1OOWA 4WK0B 4YDKL 1QNKA 1OWWA 4Y8AA 1NLBH 3B43A 3B9EA 4F7PA 3PWPD 3S1RB 1RVFL 1ETZB 3Q8DA 5DU7A 2GY5A 4DT2A 1OIOA 1BM3L 3TN2A 1O80A 3H42L 3VR5A 3MBXH 4P2AA 3SOTA 3QZWB 1L3WA 3ZHNA 2B1HL 4NUGL 3VYPA 4M5YL 1XD0A 2AEWA 4R4ND 4Z9KB 3WNPA 2F7IA 4XNUL 5EO0B 1X3QA 3NSFA 3CVIH 3VR4A 1A4JA 4UDUA 1GTNA 3FO9A 3LEYH 2DQTH 4XN4A 2X4RB 1CDJA 5SWSA 3UX9B 4Y19B 4MTNA 3QR2A 3LMJH 1KCVL 3VXOB 3DXJC 2I24N 2NR6A 4W6YB 3T1FA 2VMEA 3V4VB 1C1EH 1O9VA 1GUNA 1MFBH 2WZ5A 3I4LA 4AUUA 4HT1L 2OMXA 4OGYL 2C5CA 1OTUD 3MR9A 1H9KA 2KMWA 5FOJA 5GRVK 1I3VA 2VS1A 1GS8A 3DUZA 3UBXB 1EGJA 5I5JA 4X3KA 3GQBA 1PH2A 2VMDA 3RL1B 2KENA 3RY6A 4BM7A 5F7EL 4TLTA 4LWCA 3RWIB 1KIXA 4TLKA 4DEPB 5FW8A 2V7NB 1AG0A 5H2BA 3NHHA 4D7BA 5CMAA 3OZLA 3QUZA 3NWSA 1U3YA 1QP1A 3QWRA 3IMBA 4PZ6A 4TQEH 3T6ZA 1HK6A 1AQDB 3D4GA 5K36H 3WIIH 1FFNB 2ISDA 3JYCA 3P7JA 3AG2B 3LPGA 1QRNE 4F20A 4YHYC 1B4LA 3NZSA 3BFWA 4H8WH 5IFHL 3VM5A 5AW1B 3FH7A 4TPRH 4TOYL 4KHXL 1DVFC 2VAAB 2NXYB 3V55A 4M43L 3CN1A 3HC0B 2VW4A 5B3JE 3UROR 4BDVA 3WU1A 4XNBA 4MD4B 4FZ8H 2B63B 1TWAH 1OCCB 3WJLC 5DJ2B 3MV9B 3FFCA 1QOHA 3QXAB 3SK6A 5JZ7D 5DK2A 3UZEC 3LEXA 4PRNB 4NQEB 2AJVL 1WCMH 4XP4L 5C09A 3VX1A 4PVBA 3KPLB 1ZE3H 1JPGB 4J3SA 1OAZL 4O02A 4AJWA 3RPIA 1ONLA 2SEBA 1OO2A 4FKKA 1OT1A 4NQXB 3ULUL 5F97E 3DSNB 3VJ6B 3FVQA 4V190 1A3TA 5GRUH 4KKBD 2LFNA 3AMKA 4MNGB 1F90H 2XICA 1UC6A 1STHA 3MUGA 3GMMA 5BMFH 4F3FA 2AW2A 2NSXA 3ZDWA 3V2TA 1EVTC 2X1PA 2K5VA 2GSIB 3L6FA 4O51B 2YLHA 1UFUA 3MRIA 2I9TA 1KRSA 3T0BA 1Z9PA 1CLOH 4XMPL 5E9NA 4X7CC 3WNKA 4KC3B 5AB1A 2EEXA 4NRYA 4X50A 2AQQA 2CLVB 4DO4A 1PW3A 4KZEH 1NMBH 1WGVA 3D87B 3NQKA 3GTMH 2BSRA 3L3OC 4PI2A 5LAPA 1XGZA 1FL6A 2Z31D 1XWVA 4LAQH 3SBWC 2Q6WB 3LIZH 1CD0A 2WP8J 3BWAB 5T1KB 1M53A 3CLFH 2DKMA 3SDCD 3W2DA 1I53A 5KVDE 3HE6B 1XH3B 3L3KA 1BBJB 1YNJD 2VQTA 1JE6A 4HWNA 5KYUB 4ZFZA 1RY7B 2ICCA 4FQJL 4PTUA 3VFPB 3TBTB 1N32Q 3AWFA 4JHAH 1T7ZA 3WKQA 2ZM6L 2NXZD 5KVMC 4XCCL 1UM5H 3BYTA 3F00A 1W0WB 3K6OA 1CGTA 1P6FA 1VZGA 4WFHD 4X5RA 3SJVD 5E4EC 5IB3A 1RUQL 2BY3A 3G6EA 2J55A 3FW6A 4G80A 5MEPA 3WTXA 3G6JF 1OVZA 3T0VA 2VN7A 2EUXA 2P52A 4LOFA 4XNZB 4AE1A 1GYAA 4OIFA 3SO5A 1INEH 1KLGD 2LTQB 5E7FA 1DBJL 3NTCL 3FT0A 3STLA 1HA6A 2F1EA 5DURB 4HLJA 5IQMA 4U4IA 2CHNA 5A2IH 1BF4A 4PRHE 1T2QH 4K3JL 1G7PA 3S1QH 2GUOA 4XC1H 3V6ZA 3RGHA 2QFPA 2PP9A 2OJ1A 1BFVL 4QIRA 2ZJQA 3X3GL 3MLUH 2WXOA 4Z1PA 1OCWL 2MPAL 3ERXA 1U8NA 3CW2C 2QCPX 2W07B 4NQUA 4MS8D 3ZIYA 4EMZA 2OL3L 1F86A 2FWOB 3O0RH 3M1BA 4HF5L 1LYQA 4JI1Q 5TE4H 1GZPA 3NZ8B 1K8OA 1X4YA 3ULAB 5A2JH 3DX7A 5GZOA 1MI5A 1OK0A 1CZGA 1QSFE 2CU9A 3DOSB 3IDJA 3EZJB 1CZWA 1BW8A 5IB5B 3U9UA 3VFSB 3RJOA 4PUBL 5AW3B 3B7YA 5DJ8B 1FYTD 4ADGA 4APXB 1XHHA 5BN4A 5E3FA 1K4CA 5D2NE 2VUYA 2BH8A 2DIJA 3L4XA 3OKOB 3IMRA 4G1EA 4J6HA 1SHXA 3K46A 3B9DA 4GW4B 1DSFL 5FWQA 1J1XL 3RE0A 4HGWB 2BIMA 4JANA 1J8RA 2EE6A 1G51A 2XG4A 1CMOA 2A74A 2Q7YB 3TN0A 2HPTA 3U9WA 1KCSL 4UV4L 4Y4KA 3NSJA 3UAAA 2R4SL 3FUMA 3T5WA 3VDYA 1N32L 1JBJA 2W0KA 2VR4A 2X40A 1YJDH 2LGNA 1LO3H 4TSAH 4XNQA 1BXAA 1LQSR 2VO8A 4C54A 1RKNA 1OE2A 1G7LA 3AJ7A 3MGAA 5DHXB 1AI1L 2WMPB 5DHEA 3RU8H 4YSUA 3QNZB 1E2VA 4AQ1C 1KRTA 3BGAA 3GTGB 3V5DA 4PJGF 5E9DA 4D0BB 2L9HA 1X4XA 2XFXA 1XGUA 3KJ4B 2G75A 1HC1A 3KYNA 5JIMA 1EHLL 2H2PC 3DHMA 3GI8L 1GGCH 3FONA 2E4FA 4U0QB 3PG2A 3I50L 4Y1AD 3TT3L 3PJLA 2ZE0A 5CGBA 2J1YA 4BUQA 2YLKA 3S36H 1TVBA 3BPCB 3BD4A 4L4TD 1QAWA 4PVNA 5EUOA 1N5YL 2YGNA 3GNMH 1AHKA 5DZPA 5CZVH 2DUDA 5J4MA 1D6EA 2KUTA 1C5CH 1G7IB 2HSIA 4Q4EA 2AFNA 1DCZA 2BOBA 3GXUB 2BDNA 1AS8A 4J3UA 2NY6D 4LKCA 3BT2L 1EEZA 4GRMB 3UL4A 3VRLE 3EHBD 1OXUA 1BCPB 1KGYE 3MRNB 4ZFOB 2BVOB 3O2DL 2XV0A 3OKLB 2CH4W 3F7YA 1TCRA 3BKYH 4UM9B 2RQEA 2EY6A 3AADB 1QR1B 2BW5A 4JI1L 1TVHB 2Y7QA 3BAXA 3EKCA 5AOZA 3T2NL 3ZHKA 3CPUA 2EDYA 4CKCA 2FL5A 4ABUA 4RGOL 4AQ8A 1MSGA 1EU3A 2DD8H 4FO2A 4CVWA 5HD8D 1HIMH 5DRZB 4EUPH 2PZTA 4KI5C 3U0PA 1CD8A 1IIIA 3CZKA 4ERSL 1U30A 4HBQA 1X65A 5F7WC 5DQ9B 2VISA 2OPCA 4L2YA 2YN5A 1UJ3C 3DV6A 3LOWA 5ITFB 3VXUE 3DRTB 5I75C 5ACMA 5A16B 4WW2A 5AENA 3NUKA 1XF1A 1YN7A 1PH3A 1SUJA 4X62Q 5FYJH 4AWJC 4E9VA 5HHPB 3ULUC 4LF8Q 2PO4A 5K1NA 4DUZQ 1ZTXH 1DE4B 3RPKA 1MN4A 4OWWB 4U3XA 1QBBA 5CCKH 5DVOA 5EU5B 2DQHL 3UYOD 1ILUA 1NMAL 2VR5A 4PH8A 4I5BA 1Q1JL 5F0JB 3MCKA 1F2YA 4RMQA 4HX1A 2HX8A 2ZP9A 4HIIB 5JPMB 4E0RA 4OF8A 4PJIB 1S5IL 1MCKA 2N01B 4WRLA 1EMTL 2ENJA 2MRYA 3HB3B 4HWBL 5D7EA 3PUXA 3STBC 4BBSG 5EULV 1GHJA 2DDQH 3FUDA 4DEPC 4OV6F 2BMKA 4MQ7A 2NW3A 3RJQB 3ARDA 5AUMB 2VZ1A 1WYDA 1VACB 3NJFA 1KIUB 3QJRB 4F58H 1A2YA 1ACCA 4FFVC 4KGLA 2A9CA 4NN6B 2E7LA 1MH5A 3OGCB 4P2RB 4BXSV 1X54A 2QMKA 2Z8WC 2HFEA 5I0YA 3WIHA 4KRNA 1MZZA 4J3WA 1UXSB 4F8NA 1ZHLA 4LQFH 2Q2LA 5F70A 2IGLA 4WU5B 4MX7B 1FG2B 2NXYC 1CYXA 4CU6A 3BSHA 2VWEE 5MENA 5E94A 3PWLB 2R2BA 3ARTA 5DLMH 1FN4B 4RCNA 1JUFB 3SKMA 2EO9A 4OL7A 1HZAA 1D7FA 3SKOB 1PSKH 1W72H 4LLYA 4QJ3B 2F0NA 2D5DA 2PI2A 4JEGB 5IHUH 4EN2A 1JZJA 1SFOH 2CAKA 4OO1I 1JGLH 4RKLA 2GFBB 4LSRH 4TSCL 1LT5D 1BBXC 1QLEB 2EEAA 5ANMB 1QHQA 1QNUA 3TT1L 1NCJA 1QATA 2IJ0C 1Q12A 2A19A 3CF5A 3BUYA 1OE3A 2YXWA 4I2XE 3D0LB 4OI9A 2CR3A 2HRGA 5HVGB 2X2HA 3VWKB 1EIGA 2CKBH 4X62L 1XZ0A 4LEOA 1WOCA 4LF8L 4HAKA 1Q46A 2GCYB 3G3LA 3MREB 1DOMA 1S9XA 4DUZL 2BIIA 1R3LB 4I48B 4NQDB 1GGBH 1H3VA 1LMIA 3PHOA 3WFCL 3GSRB 4DZ8A 1RZ8B 4P9MH 5F3HA 2EUWA 4G9DA 3KH3A 5ABZA 2WTOA 1UKQA 4JFFB 3UBHA 3CC7A 3HI6H 1BDYA 1FVEA 1UUSA 2KYIA 4Y1TA 5AAMA 4IBVA 3WGUB 1PAMA 1G9EA 3VXSD 1H6TA 2QGEA 4C83A 1NQBA 4YSCA 1DVZA 4F2EA 1SY6L 5E0FA 5CEZL 2G5BB 4FHBD 5CN3A 3S2DH 5FW7A 4OZGB 3O41B 3Q06A 4XI5C 3TBSB 2VQEQ 1TQTA 3QFGA 3VFVB 1PZSA 3ECBB 4M1GH 5GS1B 2CM6A 3R06B 1A6WH 4M62H 1TEFA 5CP3H 5PAZA 3V0VA 1J5IA 1SLJA 5IY5B 3QK0A 1YECH 2OMTA 1MWOA 4L9LA 2FSEA 3E6HB 2XV6B 3PQYB 3VFNA 3Q8EA 4IPHA 1DVFD 3RMHA 3S14B 5IGDA 2QL1A 1CF8L 3KS0J 3Q1SH 2QQLH 3MXWH 3P0VH 2OF1A 4GRLC 4ONHA 3GTJB 1IBGL 5C0FB 4GKJQ 2H5XA 2EDOA 4R3SB 1F3JB 4P04A 4ZDHB 4Y7NH 1YY9C 3VXQA 2D31A 1A15A 2W9DL 3QIBC 4EI5D 4JPKH 5LGKA 2F5BL 1WTQA 1DJHA 3TM6A 4KNTA 4YHML 3NCJH 4ABWA 1BQHA 1I9RL 2XSKA 2F0QA 1T89C 2ZJPA 4KVCL 3T3MF 2LTQC 3GJFA 2Y6SC 3WIFA 3P77A 3E9TA 2ITEA 2OR9H 2AF2A 3SPIA 2KT6A 4B3VA 1YEDB 2PYEA 2YR3A 1BLNA 2VXWA 2O4XA 4TL4A 1SHWA 1CFTA 1RHFA 2BH0A 4O2FB 3STZB 3VGEA 4Y1SA 5ADPH 2K14A 2Y3NA 3GSXA 1O7ZA 1MFMA 1EEYB 1JMZA 1UCBL 4AYEC 2XZZA 1HCFX 2VDOH 3VFTA 3C8KB 3KR3L 3RUGB 1IEAA 3CFQA 2W94A 4MZ2A 4P23D 1M42A 3GD7A 4H26B 5J56B 1V1PB 2ATKB 2HT2C 3HE7D 1KJMA 3EUDA 1SPDA 5L8KB 1KDIA 5I73B 1GS7A 3Q5OA 4UNTA 1SLVA 3KBGA 2BHYA 3SYOA 5LBSA 3EQLC 2VQEL 1KC5L 1TSHA 3K8LA 2IAMA 4GJTB 3B9KB 4L1DA 2GC4C 3QO1B 3RFRA 4JFHE 3NG5A 2W81C 1HDMB 1UVQB 2I5YH 4YHOH 1LDPL 4C3JB 3RNQA 1Z5LA 5IEHB 2ZUQB 3G6JE 3QQ3A 1JK8B 1FZKA 3UEQA 2ZXQA 1MZYA 1R5WA 2GEQA 4JFXB 1BEXA 1ED3B 5D7JA 4ZD3H 4LLVB 4ZW3A 4GKJL 4LHUD 2HLAB 4A3MH 3D39D 4CA4A 1KWGA 3T9WA 1KQSA 4GMSH 4I0PB 3QIWD 4XMWA 1CK1A 1Q9LA 2HFTA 3EYSH 5FPIA 3KJ4C 5JIKA 3EFDH 4KXZI 2HB0A 3RNUA 4GRWF 2OW7A 4IU3B 4OLYL 5HBBA 4JN2B 1KIRA 2DF3A 4PLOB 3WCYA 1HINL 5CD3A 3DK0A 4CRPA 3UG5A 4AVHA 1SXCA 1F9SA 1LO5B 5JW3L 4YX2H 2GY7B 3ZE2F 1IGML 1UZ6F 3EOAA 5ILTH 4XYOA 1ZJAA 3PO3G 5EFIA 3FN3A 1DHKA 5BJTA 1DLFL 1BOSA 3TRZA 3IDGA 4FKHA 3ZYJA 4WUUD 3UCQA 2FJUB 2VXVL 4I7ZC 3WI9A 1CGWA 1P7QA 4FDBA 4NKQB 3UAJA 1NINA 4AIZB 1BR9A 3NELA 5HPMA 4AEHL 4JBMA 1F8TH 1A0IA 3GTOH 4CSTA 1X6OA 5HY9A 2VMCA 2O72A 3L4TA 4X6BB 2DB8A 3M4YA 3DBXA 2FO4A 3ME0A 1UWGH 2F0DA 4DO6A 4OZHA 1PH7A 5EC2A 2HKAA 3WTVA 2UZIH 5ADOL 2WQXA 5TDOB 3S2CA 3UOAB 2BFVH 4OR1A 4BIKA 3ROLA 3IFPA 3R3OA 1FSKB 1YYML 2D9UA 3T0EE 3VXME 2X6VA 3M46A 3T2QA 2ASBA 3EFOA 3SBRA 1K28A 3OKKA 4LLWA 3SYAA 5ESQA 2NNCA 5AOIA 1A66A 4KTYA 3RTQC 3LHPL 3U36B 4V1DA 5FJ8G 3DURA 5EIIG 3C3LA 2CH8A 4PJGE 4HP5A 4ZW6A 3D9AL 3CZNA 3FAXA 2EDFA 4A3BG 3O8XA 4RX4A 3M3YH 3UABA 4MQTB 3PIQB 2IWEA 1JP5A 4A4IA 2VITB 3SE6A 2KQ3A 2BSSB 2X4PA 2YPVH 2R7ZB 1SDFA 1F58H 1MXDA 4RMFA 2VDRH 2Q3ZA 3JV4A 1S5HA 4KTGA 1U93A 4I65A 3APMA 4JFOB 1U8OB 2R1WB 5E23A 5CR1A 3RNKB 3WFDL 2N78A 4AV4A 4UIKL 2ZG3A 2RBMA 1JTOA 5JHMA 3MNWA 4DVBB 5L2JB 1HFNA 3S5YA 1LK3H 4NEHB 3J2PA 2QQKL 2JA5G 3LVTA 2YAQA 4Z5RB 3N43B 5ES4B 1CXHA 4AITA 3BEVA 4YVUA 4NO2B 3FQ2A 1QTSA 4LNRA 2O5XL 1XCQA 4YQXH 5DSCA 3M4OB 2DMGA 1WWBX 1NC2A 4X9HA 3TH4T 1WFMA 5DJZA 1TO5A 3HKZB 2NVYB 1T21B 5EDSA 1D1IA 1GPOL 1LP9B 3F2CA 2DNCA 2AK4A 2GJRA 3ABZA 2QQNH 2CHZA 4HS8L 1AP0A 2DQUH 3KL5A 4ZO9A 4L8CA 3EJCA 2Z91A 3A6CL 5AYUL 1EQQA 4RZCB 5DT1L 1GUSA 3BXNB 1RLBA 4OSUL 5D9SB 3OKDA 1QSEA 1L5GB 1KXTB 3LV3A 3ZIMA 1XR9A 4ELKA 3QRBA 1EEID 2GHZA 1T0MA 4FFYL 4JKLA 4LCUA 4CMMA 3HG0A 1FORH 3KPSB 2H7WA 4IKKA 2F0TA 5F9JB 4ANKA 4Y4HC 1IM3B 3VW3L 4NAJA 4J8QA 1KGIA 4LIQH 1N6VA 4OQ1A 3L5JA 4U1HA 1B3AA 4IHBA 1EZVY 3VFMB 1P7HL 2O6DA 4Z23A 1RU9L 4FEMA 1RDPD 2WINB 3TWCL 1PFCA 2FLRT 3PRZA 4Y19D 1GA2A 1QLFB 4IEFB 4WV1B 3ULUD 4KZDH 2X70B 4OM1L 3S37H 1NBWA 3VWKC 2X89A 5KYLA 1KLFB 2IXQB 2AK1L 1DEEA 1QFUL 1U58A 2A4ZA 2NBFA 3SR1A 1M90C 3E5SA 2CJUH 5IYBH 2B16A 4JB9L 4N8FA 1IGFH 1INQB 1MIEH 3I2CH 4E42B 2EH8H 4DXGA 1JWMA 2LFGA 2QR0A 4HHAB 3BZDB 3PS6A 4QUOA 3ZL4H 4F7EA 2BWIA 1IBKL 4XP5H 2MHAB 1JK9A 3GMRB 7PCYA 3PF5A 3MEFA 3NZUA 3TA3A 1EZVX 3STBD 5CN1A 3VWJA 5HGDB 4H8VA 3K58A 5KVGE 2J4XA 1GVIA 4M7JL 1TOXA 5C0EB 4PRIA 3UO1H 1S9VA 1A9BB 2H3NB 2IANA 4RSVA 3U4KA 4ZUWA 1S8DA 1T5WB 4FFVD 2OYPA 3R2TA 2K6YA 3QUHA 3OLGA 4ODTL 5C0IB 2BLFA 4P4KA 4P48A 1SJHB 5DRXB 5J1SC 1OGAB 2OR8A 4MJ2A 3ZPDA 3DO7A 1R17A 1B6DA 4HK3N 5DRWA 3HOUB 1FE8H 1XGTA 2XI9A 5DFVC 3D4RA 4Q56A 4BSVA 4G42A 4HMCA 2V2TB 3HBPA 5C0CE 3L7FA 4H7BA 4B08A 1E4XH 1EZUA 2N59A 4J3OH 2DQMA 5JHBA 5IKCA 4UQ2A 1FFRA 4MD0A 4QTIH 5FYLE 2EPBA 2VL6A 5D71L 2K9FB 5ITBL 5DFTA 1XCXA 1LO4H 3VU2A 3MV9D 3FUJA 2DN7A 1P5UB 4GEJA 1E9QB 1BVLB 4JHVA 3LIZA 4X7DC 2A0LD 4NQED 2X0UA 3WENA 4HD9A 3D3VA 5FGRA 5IQNA 1ODAA 4Q8BA 4XPBL 4BWUA 1UTDA 2DYSB 1BZ9A 3J80i 2WXMA 4CN6A 4KD3A 4JAMB 3LD8B 2J4WH 2VNCA 3DETD 4FC3E 3HPLA 1Z47A 1JN6B 4OT1H 5DQDH 2FCBA 1KFGA 4D3CL 5DJ6A 4GN3B 2F54B 4A3EG 5DEJA 1FGBD 2DEWX 1NMCB 4NMZA 2FECI 4OD3H 5K69A 2EYOA 5TSSA 4JFZH 3TEYA 5FK9C 1HCZA 2HX7A 2Z4QA 3P69A 4QLRA 5DO8A 1NPUA 3I6KB 2WQVA 1PDKA 1NGXA 4WJ5B 2K5NA 2YK1H 3N44B 4BY7H 4JM2C 3WMQA 4DGIL 3ABLB 2BWDA 4KK6D 3BUDA 1DBKL 2AVGA 1CA6A 2HN7A 1NSNL 4K5WA 1RVFH 4FZEH 1NUDA 4ZS6C 1V54B 3VRIB 4BHUI 4PG2A 5I73C 1KWKA 1VKXA 4ZMVA 5T1KD 4PJBB 1FF5A 1THCA 3HE6D 2XQBL 4LGSB 4MAYA 2ZSVA 2ZYHA 4DV3Q 2BVUA 3E9UA 4GOSA 4XNUH 4KUZL 4NQCE 3BZEA 4JYAQ 4IQZA 5EBCA 2C3HA 4A63A 5J6HA 1N7ML 2M2DA 1MVYA 5DVLA 3GINA 1KGJA 3JTBA 2R69H 4WEBL 4S1DC 1YNTB 1CDYA 4QRRE 1DLHA 1I5FA 5EZIL 1KCVH 2FO1A 3P0YL 1YY9D 5JOPD 2N0KA 1EUTA 3JTTB 2IH8A 3C60B 4X2UA 1STAA 5IVZB 2AAAA 3V5KA 5CIPB 3HMWL 2YD6A 4HT1H 2ZOWA 3QPKA 2HCZX 2WNGA 4KXCA 3RVVD 4F9PC 5J57B 4A76A 4P2CB 1QYGL 1U9RA 5I8KL 4K71B 1STEA 2NZ9C 5DURD 2PCPA 4UT6L 4C47A 2UYLA 2WP3T 4BY1G 4TUKL 4YHZL 3CCSA 5IV2B 1QUQB 2XUWA 4F88A 1STYA 2OFQA 2XT1B 1W0VB 4NKOB 1KTLB 4ZZKA 3N3EA 1T83C 4DAVA 1KGUA 5IGXL 3V2AR 2E2HB 5CEXA 4XB7A 3CFEB 1CZ8H 1MHPL 1CQFA 5I6WA 1C12B 3T51B 1MCOL 3GP7A 5CINL 2X2JA 3MV8E 3RUZA 5LHY1 4NHCH 3ROOA 2HT2D 5IFHH 1S3KH 3V5HB 4TOYH 1VPOL 1EOTA 2XZAH 3NEOA 3T8XB 4TSBL 1PZID 2D03L 4XZUA 4NQQA 2WLZA 4QTFA 2RF4A 3PWUB 4M43H 4RRPA 1EYAA 4IUNA 3D08A 4YHPA 3GBDA 4FOMA 4Z7VA 3IU4L 3L3JA 3MCLL 3O4LA 2VW6A 2EDWA 1PRTC 4B96A 3FKIB 1AFVH 6CGTA 5F7FA 1F1GA 2DWDB 3ISYA 5TDNB 1X56A 3JVGC 3NPPA 4DV3L 3QEGL 4QHNA 1YDPA 3FYIB 2RA4A 3HS0A 4XP4H 4BK4A 2JIXA 3C87A 4H25A 1OAZH 1G94A 4RIRB 1A62A 1MJUL 1EH9A 4QRQA 2EACA 1WVLA 5CBEA 4J39A 4MKTA 3PWVA 4GRWE 1UQSA 5DMGD 2A9DA 3BWZA 3N0PB 3I6GB 3QGVA 2ADGB 3QUKB 1HH9B 1X7QA 1JZ5A 3C6EA 3FU9A 4K5PA 1CTNA 1HVXA 3ZE2E 1UZ6E 5I66B 4EUPA 3QH3B 3RAJL 1R24B 3EYVB 3K7UC 3RTLA 4XMPH 5CU9A 3IWVA 3DUUB 4ZMPA 5KNBA 3HJ0A 1VQLA 2Z6KA 2NZOA 2AJZA 4G4KA 1SDAB 4X4ME 3MFYA 4OBSA 5D1QE 1CQKA 4ZRGA 1A47A 5K1VA 4Q9CA 2XRQD 1IJ9A 5HDQL 2FHBA 2UUDK 1SXSA 4DR1Q 1D9KC 4NM8L 4FL4C 4MTKA 2FECL 4I9WD 1E7ZA 4KKNA 1BCPD 4YDJA 5D96C 1E4JA 1OSEA 1MLBB 1PX3A 3NCXA 5C7ZA 3HI5L 4UM9D 1MCCA 5JHLL 3ONAB 4C3HH 2JJWA 4XXEA 1YEGL 4FQJH 5DJDA 5E00B 3QJFB 2CG9X 1K73C 1D5MA 1X3DA 3ELAT 1G7JB 4ZUSA 1EDYA 3NIGF 4XCCH 2QMJA 2DM7A 4DGWC 2KLTA 1YEJL 4R4FL 3RVTD 1RUQH 2UY6A 1A02N 1T1ZB 1AGFA 1NBVH 3NIDF 4BRVA 1HSAA 3VH8B 1RUKL 4BELD 2CXGA 3IU3B 4Z7AA 2AKRA 4ZUVA 4PV8A 5A2QE 5GIRB 1PD1A 1DBJH 4D9LH 2EDTA 4QHLB 3JWNC 1L0QA 3DVNB 4F15B 5KAQF 2YAEA 4XPTH 4W6XB 2QBWA 4WV1C 4K3JH 3SGJA 3JAML 2G9HA 3D25B 3D34A 3A3YB 4Q2ZB 1QW9A 3ECQA 2B3RA 5AVUB 1BIIA 3OXSB 4H8PA 4NPSA 1M4KA 2V2WA 3X3GH 2VERA 1N6QL 1OCWH 2MPAH 3DUSB 4NENB 3VO0A 2OL3H 2YWZA 3WDJA 2F52A 5EN2B 2MNJB 1W72A 5CEZD 1TITA 1AQHA 2HKFH 2RCFA 1IM9B 4LSDA 4HF5H 4M61B 3HB3D 3QFDB 4U05A 3F2BA 1E27A 1YNXA 4HHWA 1S9YA 2ZUYA 2NQDA 3TPUA 1S7UB 4NJAL 4MIUA 3RL2B 5CJBA 1O75A 1SDDB 4DPAX 3RWHB 2EVIA 2ARJB 1CU4L 4DR1L 2KC0A 1J1OL 1UUPA 2CKBA 3C75A 1ZHNA 2NQCA 4YBLB 3V10A 2DJSA 1O7DE 3VQMA 5AZUA 1I8LC 3WOVA 4ZMLA 1PIFA 5KBKA 3U30B 4P2RD 2PO6A 3RIFK 5F7NC 1DSFH 1J1XH 2ICWI 1BV8A 3O6ML 3T04D 4F1SA 3EOBA 4RAUA 2HUEA 5FA4A 1KCSH 4UV4H 1SOKA 2NY2B 2IH1A 2HVJA 3FCSB 4S1RL 4X6FB 4PW4A 3T4YA 4G71B 3S96A 2D9QB 1K5NB 3CLEL 3REWB 1IAKA 3GJEB 2GJPA 1OQOA 4HU2A 2H26A 4ZQKB 5A2KH 5T8IA 1AI1H 4RGMA 2KLSA 4MJJA 1ZLSL 5J12B 2Z8LA 1NCDL 2DICA 3C6LC 1EHLH 3K6NA 4X7TB 2PUQT 3GI8H 5H37H 3I50H 4JG0H 2EQSA 3VVVA 5KSUB 3L95A 2RVLA 3VWKD 4DVRH 2YFNA 4MNQA 3LD8C 3BQUB 4FYQA 3KJOA 2VLJE 2JA9A 4HS3B 4XNMA 5CO1A 1IE4A 1A6AA 4NQDD 3K6SA 1ZJBA 1ML0A 3BT2H 5EUOF 1EJOL 2NTSP 3KDMB 4JFFD 4LSQL 1ET9A 5IBLC 5KS9B 1V3LA 3OXRB 3O2DH 3O9WA