2ICEC

Crig bound to c3c
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
307
structure length
296
Chain Sequence
b'TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3 beta chain
molecule tags Immune system
source organism Homo sapiens
publication title Structure of C3b in complex with CRIg gives insights into regulation of complement activation.
pubmed doi rcsb
total genus 51
structure length 296
sequence length 307
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2iceC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2iceC01
2TMPA 3I70A 4D94A 1UAPA 2A74C 2WIIB 2A73B 2QKIC 3MA2B 3V96A 3T4AC 2J0TD 1JB3A 1AYOA 1BV8A 3G6JB 1EDYA 1PXUA 5FO9B 1GXDC 4FXKC 2E2DC 4FXGC 1OO9B 5FOBB 2XWJB 1D2BA 4ILWA 3HS0C 3HRZC 1JC7A 5FO8B 3CKIB 1BQQT 3KLSA 2XWBB 1UEAB 1XWEA 2WINB 3OHXC 5JPMC 5FO7B 1BR9A 2ICEC 2I07B 3CU7A 4LNVA 3FRPB 2B39A 5JPNC 1BUVT 3L3OC 2PN5A
chains in the Genus database with same CATH superfamily
1KNAA 1TITA 2VQ4A 2EVBA 3ICEA 3IMBA 1Q0EA 2WW8A 3D0LA 2ARJQ 3RUGE 2GSIB 1FAIH 4ISVA 4NZJA 4F5CE 1I8LA 5C4ZA 2FEDC 1HNYA 3FW6A 4PMWA 3TBVA 4HWEH 4BQCA 4LLQA 3BP6B 4JFEB 4XNXH 4CMHB 1ZHBA 4X80L 1BBJB 4AIXA 1CFVH 1W9XA 4AKPA 1KELL 4I7AA 3ZZLA 5DD5H 2NW3A 3RNKA 1X65A 5IP7H 2Q2UA 4RZCA 1N9WA 3VXQB 3S1QB 1IBFA 3QDGA 2GVAA 2JB6A 1NUCA 1M7DA 2DQFA 5JPNC 1RURH 3A6CH 4XPBH 3UTSE 3GBLA 2UXCQ 3Q7JA 3P0VL 1VLXA 2VZAA 4MNQA 3M3YB 4RMVA 1NJ9A 4KHTH 4OLXH 5IP9H 1KFGA 4R8NA 2X4UA 4HUUA 4KROB 4XWGH 1ERNA 4PRPE 3WUWG 1N10A 1OXUA 5JUEH 1NFIA 1CXHA 1WAEA 3RWHB 2H41A 35C8H 4K73A 3JTTB 4BBRH 4KTYA 1AI1L 1CI5A 3VG0L 3KBXA 1C08B 1HT6A 5E70A 3NSYA 3MV11 3SYOA 2OMZB 4PJDE 3HOXH 4MNHB 2JXMA 1G6PA 4YC2C 5EV7A 4QIWE 1QUQA 1IC4L 4IBYA 2JA6G 1TO5A 3IJSB 4UP8A 2IQAB 2QPFA 2W0FB 5FUCE 2JIXA 4XOBA 3TP6A 2UXCL 3Q6FB 5LAPA 1OAQL 4BZ2A 3INUH 2EJGC 2CWAA 1DSYA 4KTEH 3O8XB 4JI4Q 4A3LG 1E4KA 3GHBL 2F0KA 2NX5D 2YWZA 2VR7A 2Q87A 3F5WA 2VXQL 4OV5B 4BSWA 5IYDH 3HEIB 2ZF9A 4LIQH 4R4BB 3R7QA 1L6ZA 3PDOA 4KV5E 5KSBB 2Y07H 1U33A 5ISZE 2PW5A 1CDYA 4EZKA 3KFUA 4GLRI 3R8BB 4RGNB 3HMXH 3UYRL 2A73A 3C5JB 2C3HA 3CHSA 4IUQA 1UWXH 4QHKJ 2P49B 3ROOB 3R3OA 2DKUA 2Y0SB 1KXVA 1NICA 2ZX8A 3TZUA 3L2LA 2CBOA 2WPGA 3HC0B 4W9LC 4L1DA 4ETQB 1RTOA 3MYJB 3PWVB 1GKEA 1F2YA 3Q2CA 3L3OA 3NA9H 2ZXRA 1E9OB 3L7FB 4HIXH 2QF7A 2EIBA 3V4UL 1ADWA 2PCFA 4JRXA 2QADB 2ADGA 5B4MD 4OX9L 1TTFA 3GKZA 4U7MA 2J57A 1J8HD 3T51B 3N50A 5HXMA 5FYKH 1FNEB 4N2GA 4YHKL 5DQDL 2YAEA 1IEAA 3Q43A 1E6OH 3GMMB 1WFJA 3KWWA 3RFZA 1ZIAA 1A7OH 5DWPA 1A5FH 1SJHD 3SDYH 2JA7H 4UIMA 4J8RA 5GPRA 2GJ6A 2LR4A 3TNMA 1UUNA 3D4WA 3OKKB 4YHPA 1S72A 4CVZA 3V05A 3UCQA 3BLPX 2VXTL 1J0ZA 4N8FA 3RX7A 3BSZH 3TT1L 5AAPA 3QDME 4F27A 2P5ZX 3QRFM 1V8HA 2EECA 3GTNA 4C3IG 1SMYD 3MRQA 4YXKL 3JAMi 3EYVB 1KGXA 2ED6A 4HH9B 5BN4A 3IMTA 4TPRH 3MODL 4ZZKA 3ESVF 4N8X1 2YD7A 4A68A 5CN3A 1T5EA 2IH1B 1RURL 2K6ZA 4XPBL 5CO1A 4JFOB 3P3YA 3BZEB 3QEGH 4LVOC 3DRQA 4X8CA 3EH5B 2OJEA 4X5PA 3IE4A 4NDMA 3BVNB 1RSFA 3P4NA 4FKKA 1B0IA 1CE6B 1ULVA 4G8GB 4OBRA 2AABH 3ZYIA 2V5MA 3BEVA 2WZ5A 1DOMA 1U8QB 4JO3H 1XF4B 4FXKA 2EH8L 1A21A 2K5DA 3QZBA 4JFQB 1ECYA 4OCWH 2NXYD 3O3AA 1JZJA 2FIKA 4NPKA 4DGYL 1ZSDB 1ZY9A 3KLHD 4IHOB 3FN0H 2KBNA 4OJCA 1V7NH 4WFFE 1XX8A 5D7LA 2JLPA 3QYCA 2JQAA 5KOMC 5JPMB 2X53A 3X3FH 3O4LE 1BOGA 1JFQH 1OM9A 1JJ2A 4PLKD 3LZPA 4U1NA 3ECQA 4UOW1 1HH9A 3E3QC 4A3IG 1PIGA 1QP1A 1K3BC 4XMWA 2GTWA 2LU4A 2NTFA 3GSNH 1SYDA 3B3IB 3D9AH 2VR3A 3CIAA 4EI5D 2DIAA 1LTRD 4HPHA 3VU2A 4BH8B 1SY6L 4RZKA 3ARZA 3G6JB 3O45A 4Y5XA 5TF1L 5CSGA 2CM6A 4XR8C 1KL9A 3UBXA 3JC66 1VGEH 5IGEA 2ZCKH 3AVEA 3E1ZA 4KI5C 5GGRA 3TJEL 2B29A 1NCWL 4WHDA 3V5DA 4D3CL 2Q10A 1SGKA 2XSKA 1E3FA 4JHVA 4XTRC 2DQTL 4QAMB 2CO6A 2DBJA 3MCLH 4HHGA 3WSQH 2B39A 3BT2L 3VI4A 7PAZA 3GJFB 3EJJX 4A3JG 3BUIA 1RY7B 3NH7L 4RAVB 1GC1H 1FFQA 4FC3E 1DVYA 3MI6A 2Q3ZA 5GQBA 5JR1H 2M2LA 3ELAT 3QHFH 4YSCA 2XN0A 2YWYA 1WZKA 2BVPB 2KL6A 5DFTA 3C5ZB 3MA7B 3SE3A 1J5OL 5D7IA 1PS3A 3CX5K 2CLRA 1DQQB 1M42A 3QRGH 1AHKA 3BUBA 5F6IC 1F6FB 2NY2D 3RB5A 2RJMA 3ZE1E 1RIVL 2OW7A 3MODH 3FB6A 4BINA 4HZLB 2EDNA 3HAEG 1PLBA 3GMNA 1SYSB 1FYTA 1UEMA 1QEWA 3DWTA 2L1BA 4JFYA 1Q90A 1CUKA 1J86A 1WCBA 1BOSA 2AK4D 3QRLA 3QUKA 4UM9D 1XCTB 1OP3K 1UM4L 3HI6H 2VQEQ 1Z5LB 1S5ED 5JTWA 4XI5C 5TDOB 4DF7A 2V3EA 4ODUB 1M3JA 1NDTA 2EEFA 1VQFA 3RKPA 1AGEB 5C3XA 2CO4A 1N34Q 2CHWA 4NQEE 3MJ7B 1PTOC 1FGUA 3QO1A 4KK6C 2ATKA 3MRFB 5ICZA 2J0TD 4I87A 1O5PA 5DJ2A 3S96B 3AFPA 1GW0A 2RVLA 5NUCA 4MSWB 4FQLH 3CQZB 4LF8L 3DLLA 3GTTA 3VFVB 4K8RD 2FJUB 1T80A 1J1XH 3HOZG 3SY0A 3VH8A 3SD5A 3HOYG 1P0SE 4S1QL 1VSCA 3HNTL 3TS8A 4UB0H 1S9YB 2HX9A 4TLUA 2FIRT 4EXPX 4GG6A 2DQUL 2XWRA 5I73B 4RGOS 3DTDA 2W80C 2WY3B 4UTAH 4DIXA 3VFMA 3ML8A 5ISZD 1H9DA 3TESA 3HOYB 5KYWB 3ULSB 2AI0L 2QKIB 4JB9H 3OQ3B 3UG5A 3RA7L 1E4WL 2C5DC 4DOHE 1GHKA 2VLRB 4MNOA 1BJ8A 3S14H 2N3JA 2W81C 1TS5A 1MJJA 4G6FB 4U6VH 1YPZE 4L3CB 3S9DB 2EE2A 5DDHA 1N5YL 4F15C 2MMXA 5AW8B 3WJMB 4MBOA 4JHZA 3BVDB 1YMME 4OLVL 4WNQA 3S6CA 4F58H 2JA8B 3A4EA 1OW0A 1F45A 1PEZA 2NY2C 2R83A 2X6UA 1A1NA 3LTVA 3EGXA 1XXDC 4J8QA 3KEHA 5DD6B 3TXAA 3KBFA 4G5ZL 1ADQA 2GJPA 4M6OL 5ETUA 2Q3AA 4UTBH 3CAMA 3HUJE 3VRIB 5IVXA 1BEYL 4RGOH 2G5BB 1FLRL 1P5VB 5JIMA 2LSSA 4IM8A 3F6JA 3SR1A 3VA6A 2E7BA 3AS2A 1Q81C 4ZYKA 2KA7A 4H25A 3UYRH 1FZJA 3U1PA 3ZMNA 4EO5A 4FA7B 4LQFL 5SWZA 2CO7B 4ES8A 3Q22A 1GAFL 4TNWF 1PSKL 1ES0B 1BIHA 3PUZA 4YXLL 2CSPA 4DKTA 3SYCA 2KCCA 2VXSL 5DJYB 1WVLA 1MH5A 1UXMA 2DQCH 3BXNB 4AY0A 4OX9Q 1F9RA 2YTVA 1A6UL 3FOMA 5F7WC 4HMCA 1KBKA 3KPSA 4U1JA 4TSSA 3DA0A 5IB1A 4NEHB 1E50A 3GMRB 3TEWA 2QDWA 2AXJA 3R0MA 4MAZA 2IWFA 3NIDF 4U1HB 1DJYA 4NQVB 4Q9RL 1T21A 3ARGC 2PQAB 2XPGB 3QDAA 4QXGH 1F1GA 1CE1L 1FFPA 1YA5A 4JFVA 4WW2F 3RGVA 4DP1X 4H7VA 4W9CC 3ZTNH 5IREA 1SXSA 1UCBL 4LESA 4WGWB 5E56A 1KJ3L 3VXOB 3MKKA 3KD4A 4ZOAA 1STGA 1G1CA 4XX1E 2H8PA 5C0BE 3Q0AA 4QCLA 5I1IL 4YUEL 4C4UA 1IC5H 4PJCA 3RUGA 4J7RA 5HYSG 1UWYA 4W9IC 1AZRA 5F7HA 2IADA 5I6OA 4J3UA 5C6WH 3TBWB 1HE8A 3D69A 1UB6A 1NCIA 2WNGA 4BEIA 5JIPA 4KJQC 2R93G 1H0DB 2QFRA 5HHOB 5JOFA 1E42A 4CKVX 2I27N 1NC4A 4LF9L 1TIUA 2UWEB 3U6XA 5FO8B 4NZUL 5IROC 1Y1WH 1MAKA 5DF0A 2H2SC 3ARBD 1F2QA 3BD3A 4R26H 3AXIA 4OZFH 3NQTA 1OGTB 3PQIA 3CW2C 4NN7C 4ZPVB 4RQQA 3DMMA 4K15A 4D0DB 3O6KH 4NZTL 2WO2B 5AVRB 5JHDE 3IJYB 4KH2A 3GSOB 3DMUA 2D3VA 2RBLA 1BXXA 2VT0A 2EJMA 2ZSWA 4K7PL 3HOVB 1B6DA 3GSXA 4A6YH 2YKLL 1NPJA 1WZMA 3CC4A 3RTQB 1NMCC 3MCLL 4LUZA 4ZO7A 4ZD3H 4IRJA 3CFKA 4X98B 2UZYB 1CK0L 1UFUA 4UQ9A 4N0UB 4PW9A 2QQLL 5IVNA 2WLLA 4HUWB 1YZZA 3PUYA 3NP3A 3M9BA 3KPSD 1H3PL 2MKLC 4A4IA 2N49A 1FYCA 1FL5A 4L29A 1LE9B 4ZW6A 4QDGA 1SFHA 1BQRA 2EDFA 3I6GA 5JW4M 5FLXL 3F7VB 2IBGA 3VXPA 2YUZA 2KCTA 3QDGE 4B96A 3VJ6A 4XE0A 1JK8B 5D5MA 5IW1A 1JGUH 4YDVB 2P5WB 4O02H 5GJSH 1FJ1B 3HE6D 4GMTL 4Y5YB 5H8DA 5FDWB 1TVBB 1AE2A 4EBQH 3FSVA 1KJ2B 2W38A 5IMKB 5EDXA 3CX2A 1CXKA 3V7MA 3T6ZA 3SKNA 1OTTC 3QOLA 2CUIA 1NFDF 5CEZE 2ARJA 4BZYA 2FUQA 2NZ1A 3L4UA 5ES4B 3CZFA 3NOIA 2D7TH 3WTVA 2FECL 4JDTL 1CLZH 5DM63 1HXMA 2VDOH 2Z6KC 1I5FA 1KJ3H 1BF4A 4ZKBB 3ES6A 3VA7A 1OARL 3O6FD 4R97B 2DQDL 5BJTB 3PIP3 4Z0XB 4UAIA 3CCEA 2JIXD 4QXUL 4LF7Q 1P7QD 4ZX5A 3UP1A 4E36A 2G9KA 4IU3B 2HVJA 3OAZK 3NWTA 2WNXA 3ILQC 4J23A 4PVLA 4L3EA 2ZUQB 3STBD 3RUGF 5B8CA 2CMRH 3TTYA 2GT9B 4IMLB 3RVVD 3ARFD 4JPWL 2HSIA 4ZAKD 2LABA 4PGEB 3UYPA 5DEHA 1BQLL 4EQ3A 1U8LB 2WBWB 4H8PA 4DTGH 3G5YA 5CEXB 4J39A 5JXED 1A1OB 3MU3A 1QNZL 5E8OA 2NVTH 4J3XA 4DQOL 2JA5B 4ZW7A 5L4FA 1QX1A 2Y2WA 3UYOD 5IB2B 2BIHA 3JQOB 1IFRA 1WBXB 2FRGP 3QP3A 4GKOA 4IRJC 4U1SB 3SDCC 2NW2B 5C5LA 4NXKA 1E4XI 4NP5A 3P9WB 4NBYB 3WNNA 2ALAA 4QHUA 5I6KA 3CHOA 3FHQA 4Z7NE 3ULUF 4DAYB 2ITCA 2B2YC 2VDRB 3KMDA 1C16B 3TIDB 3T77A 4R8WH 4WFFD 1U3HA 3D3VB 2F3VA 5K9OA 2M8XA 9PCYA 2FX8L 3NACL 4JPSA 2PLTA 2UXDL 5I23A 1ZS8A 5ITBH 5E03A 3MUZ1 1NCCH 3SPGA 3BWUF 4PBWD 4IFDG 1ET7A 4H1LA 4OFYD 2QZ5A 1S3RA 4IKNA 4PJAE 2ZZUT 2UY7A 1J1PH 4FFYA 4Y19D 3VXMD 5EF2A 3QAZC 4NJAH 4V0BA 1PZJD 3O6FC 3HFZB 5FHAL 1PPIA 2CA3A 3LRKA 1RZFL 2N0KA 2V37A 1HWHB 4TLSA 4CC4A 5E4IA 4HWBL 1N9PA 4NQUA 5KEZA 2Y0SE 5LBVA 1FH5L 4A7GF 4OELB 5ELEA 4RH6A 2D0HA 3ARDA 3JAMc 3QZPA 1NBYA 2ZUYA 3ZE1F 2HPOA 4UDTB 3B7UX 2WB7A 1LTXA 3WNLA 4ZAKC 4FYRA 4NOBA 1CE1H 2B1AL 3CZEA 1MNNA 1CGUA 2GUOA 4DO4A 4ZT1A 4ABWA 2BCKA 2OTWB 1I1FB 2UX7A 2Z8VC 1VQEA 1MJ7H 2YARA 3BS1A 3MJ8A 5IGXH 4C56D 4X6CE 5CJOL 4Y0GA 3UI2A 1ZOXA 2FNWA 3T6VA 3FFDB 5C0RH 4GW4B 3BAEL 3VSVA 4YEEA 5I5IA 5F7KC 3BZFA 2AK1L 3C60C 4MQSB 4YHNB 2F0PA 5F7DB 1MQKL 5AW7B 3TOPA 4YHZL 5HVHC 5JHDA 2DTML 2DN7A 3MBED 4XOAA 1KUMA 4JAMB 2EXWD 1K5NA 2NR6C 1SUJA 4YSOA 5IMLB 3PF2A 4X6DA 3P3RA 5KSAB 2WLJA 1GGTA 4ZFZA 3QXAA 4ZAKB 4YSQA 2K33A 2I5HA 3ND9A 1BZ7A 4CU6A 2YFNA 4W9EC 3VXNA 4PV9A 3NE5B 4JHAL 4HYTB 4MFHA 4PJDB 2IFFH 2RBMA 1CDIA 2CCVA 5D2LA 3VDAA 1NAMB 2L7EA 1LK3L 3CE1A 4XHQA 5I1CL 1P7BA 5EU6B 1U5KA 1ZDSA 4R8WL 1P8LA 1TY2A 3FT3A 4XC3L 4XPHH 3VD3A 3WXWL 2IGFL 3OZ9L 4QHLA 5D5ME 1EFQA 4FXGB 4DGIL 1CICC 1JWUA 1ZLWK 3E38A 7FABH 1OAZL 3AG3B 1S3KH 3B83A 3AC0A 3PO3H 2J55A 3R1GH 4JZJB 3SOBL 1EUUA 1FNSL 2VW7A 2YPVA 3ARPA 5JHMA 3WTWA 4X4ME 1H6UA 3NJJA 1LO2H 5CR8A 4I1NB 5IGFA 4LMQD 1J9TA 3BMVA 3I84A 2OYKA 5BZDB 3U25A 3ARWA 2HMIC 4UMGA 1WFMA 1E43A 5AKRA 2EEBA 2FSEB 4WI4A 4IBTA 4ERSL 4ODTH 2B08A 4N90E 5C0GA 3H3VC 5E4EC 2Q2HA 2D5DA 4JRYE 4NAQA 3CUPA 4JFPB 1K2DA 2VSKB 5A6MA 5L2KD 1D5MC 4E41A 4RAUA 4DXFA 2IJ0C 3QUYB 4MJ6B 4LGSB 4OVVA 3BC9A 3FT1A 3B2UC 1DSWA 3BPOC 3FSAA 2QFPA 3V4VL 4FG0A 3L8QA 3WO3B 5C71A 4BXSV 4GAGH 3UTSA 1G9NH 2G75B 1X5XA 3X3MA 1MI2A 5I16A 4KZDH 2JJWA 2J8UE 1R5WB 5E8EA 2ZIDA 1ENCA 1TYRA 4C2MB 4R5XA 1OCCB 3CPLB 2F9BT 4P2RE 1DTUA 4IOAA 5CD5C 2KOLA 2NY5H 1VDZA 3LZQA 4AYFA 3EYFA 4WI0A 1K8AC 4Z95H 4DAGL 4KITB 4YE4H 5JIDA 2F0LA 3VQLA 1G0YR 4CL7A 1R4PB 4DV3L 3RJOA 1EIYB 4A3LH 1ZKAA 2TAAA 3CCJA 4DKFH 5L2KB 4LP8A 2IHFA 5F9WB 2LQRA 5KS9E 4JZOB 2XWCA 5FF6A 4JQIH 4HS3A 2G30A 3FU7B 1R3LA 4MXVF 1DZBA 2P5EE 3D1MC 4OCMC 1WF5A 4Z7VB 5I8OL 3BIBX 2DJUA 4QT5A 5JOPE 2D4FA 1SMOA 5AVVB 3H2QA 2ZXDA 2WSDA 3O3BB 4GPVA 2NUPB 2VH5L 3VD7A 2DAVA 1ZEQX 4IRSC 3B7SA 5H1SE 1MHEA 4GRLD 3PGCB 4HBCH 4PJEB 3OKLA 1J0JA 2HFTA 4G7YL 3RWEA 3WKNA 2RKSA 2VN5A 4JM2B 3S1NH 2I25N 3G7TA 1HZHL 2IWKA 3BT2H 1PFBA 1EJFA 1Z0MA 4TKOB 3QHZH 3VD9A 3A24A 3KW8A 4OJEH 3LCYA 2VXTH 3NIFB 3P9LA 1OLZA 2W59A 4L1LA 4IBLT 1DUZB 5D7IF 1IZ6A 1BM3L 1HSBA 3VGGA 1PRTC 3MNMA 4DUYQ 1DJRD 1B4LA 3T4AA 1D5XA 2ZSVB 4KKTA 1Q1EA 1BMGA 3QZNA 4GFTB 4MA8L 1MAMH 3VDCA 3PRZA 1ZXQA 3ZPDA 1J8KA 4G42B 1KV7A 1OP9A 4A75A 2R15A 3KPMB 5G4NA 3F3HA 3GRBA 2XRAL 5H37G 4I3GA 4AQEA 3L3DA 4P46D 2YEZA 1D5ZB 1XFPA 3AT9A 3ARED 2F3WA 4BFBD 5HPMB 3H6MA 2ED8A 2YAFA 1B44D 1X7QB 2CIKA 2DQTH 4HF5H 4OU3A 5DS8B 1H15A 1A8VA 1OGPA 3UCRA 4YHIB 5D2NB 2RSOA 3AQDA 1LO3H 3F05A 4UZUA 5EOCJ 4AXWB 5E4WC 4QWWC 4PR5A 3HBQA 4QRRA 2HDLA 5JNYA 2XTIA 4XQQA 3MDJA 4NCC1 2QV4A 1LEIA 2QHRH 1YG9A 1VCAA 2XT1B 1O6TA 2C7UA 2PPBC 2H3NA 2B1AH 2XDHA 1NLBL 1VFUA 4PLJD 1AC0A 4ZXBB 4HC1H 1U8KA 1SN2A 2X4NB 1AOZA 5IWLA 4JFHD 4XNAA 1F4HA 3IN2A 1RU9H 4HUXA 5DCCA 5DJDB 5HJ3A 5C0AD 1RKNA 3PXJA 3GHEL 4NO0D 4YY3Q 1G291 2WXOA 4N0RA 5AW9B 3HGBA 1UYWL 2LY7A 2HVKB 4UY8C 3DBSA 2X1PA 5CR1A 5IT9E 3KBEA 3N3EA 3S3SA 1R4XA 2W8CA 1T89C 1BZ8A 3IMUA 1DQLL 3IETB 2ICWI 4JN1H 3X3GH 4N0YL 1EQRA 2H1EA 5EOTA 2VM4A 5JJZA 4BBSG 4J1UB 1JZ2A 3FB8B 4N2FA 3MNDA 1ET5A 1RJLB 5FV2A 5IFAH 1RZQA 1GGUA 3WCYA 3RN5A 5D55A 4MA3B 1USQA 4UIKH 1L7TL 4WFEE 1OSPL 1DJHA 1T5XA 4X7SH 4WI9A 2A6DB 1QVCA 5HGDB 5GAGC 3U30C 1DOLA 4DGZA 4B9YA 2Y6SD 5IF0A 1OO2A 4NPJA 4QY8B 3WEXA 1SMYC 3E3QE 2WVTA 3APNA 4GMTH 4UAHA 1SR3A 1MRFL 4Q14A 4V1DE 4PRIA 5DVOA 5GS1C 3VFSA 1OE2A 4HKJA 4OFKA 4PU2A 1KLGB 2FO4B 2OAAA 2A9MH 3X3NA 2CIIA 2R1YB 5EKKA 4W68A 4WKXA 5F72S 3K74B 2YRLA 2ALWA 2G2NA 1GPOH 1XNRL 3C8KB 4RG1A 4Y2OB 2EYPA 3FU3A 1D2OA 2O93L 2O2LD 1EA9C 2HT4C 1SJXA 1L0PA 3OAUH 5AVQB 2AK4B 2CDEA 4JV5L 3VFOB 3DVGB 4AYBG 2OTLA 4XP1H 3T71A 3OMCA 4AUUA 6FABL 4GRWF 4OKVB 2O4XA 1M71B 1KN4L 4M8UA 5KYYB 2J25A 3QJSB 3ATAA 3RX8A 3Q2VA 4WKZB 2BP3A 2ID0A 3SEBA 3AT8A 1SHWA 2HQEA 3F58H 4YGVA 3B2VH 4AMWA 4J3OF 4L3EE 4LFCL 4OCYL 1X9UA 4HJEA 5DMKB 4DR5L 3TIDA 3ULVH 5TK4A 1J1XL 1PXUA 1MFBH 3ARGA 2X3CA 4WTQA 2CLVA 4YK4B 1UZ8B 2L7QA 5IHLB 1I75A 1I7ZB 1CD1B 1GHFL 3T04D 4LDCA 3WN6A 4AH2A 2Z35B 3K5NA 2YUVA 4J3VA 4UYQA 3AWGA 4D8PB 4PJCF 4PJ6A 3RZCA 3US9A 3GUFA 4H44C 1PD0A 1PZ5B 2ZKHL 3DSNA 4U6HB 2J2ZA 1MFNA 3ALXA 1PBYA 4JV5Q 1UOLA 3O9WA 4ZMAT 7CGTA 4ZFOA 1KTLB 2PQEA 2DLFL 1UOVA 3ARBB 3A4DA 32C2A 4HP5A 4ORZC 2DQMA 3DYPA 1D9KC 3TFKC 3BH8B 2CWRA 3A8KE 2G2RB 2FWLB 3DXAD 3WO4C 4XCEA 3V7AE 3WY4A 1MKFA 5I6YA 5IROA 5CGMA 3KPOA 4LARH 2X40A 4IBQA 1KZQA 5M7QA 4OLUL 1HNXQ 1OT2A 3FNKA 1BQQT 3H42H 3QC6X 1SYFA 4FRWA 3X14A 5H2BB 5IEKA 4MKTA 3LY6A 3WFEH 5E4EB 1AHWA 3ECWA 2VLLB 2HT2C 4JI6L 1NZRA 3CU7A 3P4LA 4XCYB 5C07E 4E9TA 3F62A 1JZ3A 4WEBH 3VVVA 1Z0NA 1I3RA 1W8OA 3TPKA 5J11C 1LABA 2YN5A 2IHEA 3CD6A 5GS1A 3ECVA 3FQ2A 3HP3A 4ZDHB 1VQIA 5MP6L 4W4NA 4CMMB 3D4ZA 2ZAHA 2P44B 1AO7A 4FQ1L 2YSTA 1PLAA 3BKYH 1X4XA 2WLIA 1R19A 4OD3H 4YQXH 4P5SA 3THML 3TRZA 4ACPA 4OIIH 1KGCD 3IAPA 5HD8C 5F7EL 5C5MA 1PEWA 1GOFA 1P5UA 2LOEA 3DARA 4NUGL 2VRQA 1ID2A 2HH0H 3EBGA 1KEML 1TVHB 1I7RA 2CJUH 3LXBA 3IAGC 3IF1B 3ZKND 1WBYA 4D7PA 1CF8L 1UVQA 5K36G 1WFUA 5TE7L 5IESL 3ULVL 1BZEA 5C09A 4HX1B 3ARTA 1F9QA 1RZKL 2DD8L 3P7JA 4NRXA 4FTVE 4WJG3 2MO1A 4C1NK 4P23C 3VFRB 4CUCA 4XPFH 5C6AA 1PV4A 2J56A 3A67H 1KLUB 1EJOL 2VQUA 3L2NA 3RZCC 3SQBB 1FRGH 4OQ1A 4DVBA 1WH0A 5F1NB 1NOAA 3MRLA 4BK8A 4JFFA 4ODXA 4J27A 3RZOB 2DDQH 4L9LB 3IKKA 3IKCB 3QJQB 4KJPC 4CJ0B 3GMPB 2YTXA 4PJGA 3UPRB 2XGTA 2G0LA 2APTA 2VDRL 4AG4L 5C3EB 1G9NC 2VRKA 3MOQA 1EV2E 3P2TA 3KBPA 1UM5H 5HI3C 1PG7X 4KVNL 3TWCH 5I1CH 1X9RA 4UB0L 2O6CA 1U8IB 1X4ZA 3D06A 2X4SB 1IAMA 3OLIA 4ZMYA 4WJ5A 3MHBA 3GSUB 4NQDE 2DIBA 4LOUD 4Q2ZB 1OXSC 3NABL 1BBDL 1W0WB 5IQOA 2Z9HA 5SWQB 4DP7X 3AJ7A 1F13A 4X3UA 3ZDYB 1HNZL 4EDWL 7PCYA 2DTMH 2RHQB 1XYIA 2Z93A 5EU3A 3CC5A 2DNCA 4KRPC 3UC2A 1U6AH 5BV7H 1ACYL 5K9KA 1I8IA 5CJQH 1B88A 4PREA 3DOHA 1K8IA 4UQ3A 1WFTA 1LT3D 3TURA 3MRMA 3G3LA 2K01A 1X9LA 3IFLL 1DVSA 4N24A 4XTCS 4WUKL 5GGVL 3LIUA 3MRPA 3DK0A 1MHPH 4BE5A 2AITA 5C0CE 5TGBB 3HRZA 5JXAL 2H0EA 2I5MX 1E6JL 4MX7B 4XMXA 4C4KT 1EEQA 2NZ9C 2YXWA 3ZMEA 2WAQG 1CZWA 4G5ZH 1DYQA 2V2WA 3L3KB 4JFXB 1E65A 4HBQA 3CHQA 1HHHB 4Y7MA 4I0PC 1SE2A 5IYBG 1O75A 1SYCA 4HJ1A 1G7JB 2V4DA 5DRZA 5K5YA 4XNQB 4IK6A 4OIKA 4QB4A 4I77L 3RIAF 4DP5X 4L8CB 1EH9A 4BD4A 5F89A 3RWDB 1TJIH 4PRDB 5HHXL 1JRHH 2BH2A 1EGJH 4ZXBC 5KVGH 1I50H 5AFWA 1PKQA 4Y4HC 5E51A 2B59B 2BW4A 2C9AA 4XNXL 5E8PB 2Z7ZA 3VYSA 1DVXA 1GKOA 3MNVB 4HS8L 4KOBA 3V2AR 3J81i 5K39A 2MKWA 3KPLA 1NBVL 4TVUA 1BQHB 1A62A 4AM0A 1WT5C 4DP6X 1VDGA 5M5WH 4LKCB 4PJIE 1SJMA 2XA8L 1NR4A 5E94A 4NWUL 5GS2H 1TTUA 1DO5A 1OAUH 5D1XD 4AQ1C 2F0EA 4JKKA 3OC5A 1JGEB 3M1CA 3NAAL 1A2YB 3L3HB 2B20A 3NFNA 4FLQA 4H40A 4WFHE 3UTTE 3WLBA 4OT1L 5L8JB 1P4LA 1VFAB 1XX9C 3MCKA 3VD5A 1N26A 4BRJA 4AIEA 5A7EA 2BDNH 5D9SA 4CJ1B 3QIUD 3R8QA 4I18B 4MWFB 4JPIB 1AYOA 4TOYH 3PNWB 4M1CD 1K0RA 4XNYH 2WK2A 2CNYA 1IC5L 3MV7D 1PRTB 3HAEA 2Y0SG 1ACYH 1BX2B 1J9QA 3FUIA 3QZLA 5EFIA 3IU3A 3RTQC 2Q76A 1X4YA 5D7EA 5EO0B 3S17H 3SPCA 1A6VL 2YZ1A 1WYDA 3H9ZA 3MJ9H 3IJ8A 4PJIF 3WEBA 4NKOA 2W9DH 3IXAA 3KL5A 1Q8KA 2WLKA 2Y4SA 4F2ME 2Q8BH 3SDDC 1FNGA 5DURB 2X6MA 5BRZE 3OXRB 4NIKB 1KBWA 4A3EG 2CR0A 2V5SA 4L5QA 1K85A 3KG5A 3STLB 4A3DB 2HVBA 5J3HC 1MJUL 4OCSH 1A8ZA 5ITFB 4NO2B 2XWTA 2K78A 2ZCZA 3HN3A 1Q0XL 4R83A 1L9SA 1HZAA 4G43B 4W4OC 1NCBL 4WSKA 2XHNA 1UEAB 3VI4E 1BBXC 5LGKA 3S97C 4KKBD 5I76A 3SYAA 4FTVB 3SKMA 1OQXA 1WTPA 1H3UA 1TJHL 1XGTA 4LPXA 4IOFC 5FDYA 1CDCA 4FD0A 1FCGA 2C1OA 2DQIH 2CGYA 3OPZH 4D0CA 1YN7A 4IJ3B 3X1NA 1XF3A 3MROB 1QHQA 4Y4KC 1AGDA 1FFOA 4CN1A 3R18A 4EN3A 5D1QA 2AQ3A 2P5WE 3OSVA 4PJ8A 5LXGH 1NCHA 5EU5B 1IT9H 2P45B 5INDA 3T3MB 3H0GH 1AGCA 2W95A 2LLNA 3D52A 4DEUA 1I8LC 2Y2TA 3HCVB 1A7NL 1PNCA 4AX3A 1GTFA 1R3KB 3T8MA 4PJ5A 1B0GB 1R4QB 1XPRA 4G82A 1WUNT 3I50H 5FYJL 3FFCA 5CR3A 4MMZB 3RUZA 1U93A 1T04B 1ZLUK 3E5SA 2UZXA 5DGRA 4QHNA 4L3AA 3QS2A 2FL5B 3EUUA 5B1KA 1JDCA 5JXEC 1H9JA 4GG6F 3UBXG 1KJVA 3G6DL 2X6GA 3WBDA 3UMNA 4AK2A 4ZQKB 2KEDA 1L9QA 3FKUS 1I9EA 1ZHLB 1TT2A 2IOMA 1KTCA 3IDXH 1W16A 2GJJA 4LB8A 1ESRA 2I7SA 2VQ1A 1V10A 2WYHA 3FP9A 5C9JB 3B9KA 2PTTB 5FGRA 2GC7C 3Q8CA 3RU8H 1N8ZB 3AAZA 1I3QH 1C5CH 1EQTA 5ISRA 4IRSA 4MQ7A 4KHPQ 2R4RH 1JNNH 3IMSA 1V7NL 5ID1A 5ADPH 4YPGB 2JP1A 1JV2A 2PPEA 2Z92A 3N44B 3BQUA 1KC5H 4HIIB 4QAWA 1IBKL 1A15A 5I5MA 1SYEA 3D4CA 3NA4A 4LO9A 3L6FA 1XJVA 1QG7A 1T5WA 3FB5A 3U4AA 3K6SA 2BNRA 3RWIB 1LV9A 1G94A 3R93A 2V7HA 1F11A 4XXEA 3LQAC 1PU0A 2J71A 4IEFB 3BQUD 4OQTA 5E95B 1NDGA 1P16A 3NZ8A 2A77H 3CH1A 4OCYH 1GUTA 1JAEA 2XWDA 2A9NH 2PXYB 3T1HL 1N36L 3KPRA 3O2DH 5IHZB 5CLTA 2OS7A 3MHZA 2BHZA 3ZTJH 3L16A 2IALB 5GIRA 1PH2A 3HMXL 1TTRA 5FLXE 2AJYL 2X0UA 2I24N 3FCTB 2Y2YA 1FQ9C 2BSED 2X4TA 4IK7A 3QWOA 4KKRA 5ELBA 3SE4C 1CFSB 3BDYL 4M1GL 2N1KA 2HHHQ 4LLVB 1PMRA 4LIQL 2PCPB 5E0FA 1T0MB 5KVEL 5TDNA 9CGTA 5HJBA 2A68D 3D18A 4AKOA 5E00A 4QTHB 2F54E 3V55A 4A55A 1S9KC 4UZGA 2EXTA 3N1MC 2J43A 4A63A 3BWAA 2Y3NA 1HEZB 4HJSA 1TQCB 4FZEH 1CM9A 3D08A 1P6AB 4X6EA 5DZOA 3RFRA 1RZIB 3QO0B 4E41E 1DE4A 4LLAA 3ZQWA 5DHVH 4UT9L 5LGHH 1BJ1J 2CBMA 4GXVH 3QQ9D 3VFPA 5CBAA 2R0ZH 3K2KA 1PH6A 4JBMA 1U58A 2X28A 4PG2C 3HOGA 1K9TA 3RE0A 2PXYD 3QZWA 1OGAE 4M6NL 1PX4A 5E4AA 1DVUA 1BD2B 4D0BA 4JC0A 3LKRB 2JKTM 2EXZA 2HJLA 2R93H 1HYRC 1BP3B 1SN0A 1ZT1A 3HJEA 5ACMA 3S4SA 2EVJA 1S9VA 3IE9A 4X7CC 3EOAB 5E8NA 4UYPA 4LK4A 5LMUQ 5AFAA 1Q8MA 2AJZB 2P5WD 4O51A 3N1GC 3Q2NA 4DK3C 4OO1H 1YUHB 5AOMA 3UEQA 1KCLA 2YJQA 3IFTA 2H4EA 1VPOH 4OZFG 5D7IE 1R3IH 2KERA 2RGSA 4M8RA 3L4XA 5F96H 4F33B 3PL6A 1UWEL 1EXUA 3HG0A 3BQUC 4X6CF 5KN5B 1CK1A 5FO9A 4OB5H 4KKUA 2UXFA 1BVLB 4PJXA 1YNTB 1B9NA 3IFOA 3S36L 5J0BA 3Q8AA 3ZOAA 3BVGA 1KCVL 2HFFB 1PYWA 4LCWD 5J5EA 1ET6A 2EY1A 4FF9A 1OAJA 1JVOA 1UACH 3OGCB 3CFIC 1MNUH 4A2EA 5H35A 3OR6B 1WHPA 4LVNB 4BDVA 1U21A 3VYNA 3QJXA 1JZFA 3E0EA 1T22B 1JHTA 3H56A 4MAUL 3EYUH 1LHZA 1FAIL 4MAYC 5DTFB 3BH9A 5D2NC 4XBGB 3SBWC 1IQDA 1GOHA 2NYZA 2BINA 5DO8A 3S16H 3W2DH 1JYVA 4J4PA 3L7ZC 1IBGH 2W88A 3ATDA 3BAJA 3EJPA 2BC4B 1LTBD 5I1AB 1QO3B 3P75A 2H0PA 1SEBD 4PY7A 4RFOH 5T1DH 2ZAGA 1VQBA 3CFCL 3AXLB 3FONA 3NP4A 2FYYB 2RFXA 3BOVA 1EEYB 2EDMA 4AYSA 1S7VB 4OCRH 4JG0L 2MQ0A 4F2MA 1VJSA 2MCPH 3S2DH 3SKUD 3TO2B 3VE0B 2ZX7A 2R2EB 4KVNH 2AAVA 3ZO0A 3CF5A 2ES2A 3ME0A 4ID6A 1CF1A 2ENYA 4XVSL 1SFDA 2GJZA 1GGYA 3TH3T 2BVOA 4C4BA 1VMPA 3BAIA 3BP4B 3NELA 3W2DA 3FFCD 4H88H 1HAWA 3VXMA 2NQCA 2X0VA 4BQBA 3QIAA 5IBLC 2MH4A 3ZO9A 5DK2A 1CBVL 1CGWA 3RZOH 4I3RH 2ZJQA 2Y07L 2A4EA 1GZPA 3QPQD 3F7YB 3IL8A 3DTXB 2ZUWA 3W0WD 4O42A 5FPIA 2DGYA 3QFJB 3M4OB 2WB1E 3LKNB 1N7MH 1PQZB 3G04B 2A8VA 2G2PA 1HOCB 2LU5A 5ELCA 4H1LG 3DX6A 4P4KB 2R2HA 1OSZA 4LFHD 3EO9H 2VZUA 4MQXC 2FB4L 1DQML 3DBXA 3TYFB 1OAQH 3PUVA 5KS9B 3FUEA 3I4MG 2CHZA 4Y19B 3D9AL 2WP3T 2YPKB 2F0FA 4X66Q 2YU9H 1K6QH 2WWKO 3CMOL 3FU9A 1MZYA 3PWPB 3B43A 3J7AF 1J88A 5T8IA 3ZHLA 5EWIL 4F7EB 1CQKA 2AVGA 2VLKE 3N2JA 4PRBA 5CJBA 4GNKB 1I82A 1ROWA 5EHFA 4OZIA 5JW4N 2MFNA 1IARB 2L4NA 1FI8C 2WSPA 2PMZE 1FNWA 5C0EA 5DJZB 1IM3A 3I55A 2BNUA 5IVOA 4LSSL 1YY8A 4MJ5A 5DHDA 1A25A 3UP6A 4YHLL 4HCEA 3KPQA 4ALAC 2YGNA 3QJOA 1VFBB 2WUCL 4PWFA 5SX4I 1T20B 3EGDA 3OZLA 2VISB 1PZID 3K59A 1JMXA 2AWOA 1KNOB 3D09A 3J80i 1KULA 1SEQH 3EYSH 3FQ4A 1LEGB 1HZLA 4OZ4A 3AMUA 1SLXA 5I73C 1I3UA 4L1SA 4LAAA 1U9RA 4IIQA 4MMZC 1DCZA 3D39E 1Z2KA 2N78A 1IJ9A 2VLJD 3QIWC 4RX4A 4QQBX 1DANT 4YBQC 3RB7A 3W56A 2QELA 3UTQB 2P28B 1JERA 3CZUB 5I2IB 1GS7A 3MLZL 3ZQ9A 3F7KA 1MI5D 1LWJA 1OCZB 5E08H 4YDKH 1UE7A 1MF2L 3PHQB 1VQCA 3B9EA 2OXPA 3NJGA 4XO4A 1QFUH 2XUWA 3QPQC 4GKZA 4MGXA 5D4HA 3C6SB 2AQ1B 2D03L 3R4RA 1G4MA 3TPUB 2BP8B 3L7EA 4D7BA 5CCJA 1SUHA 4DZBB 4KZCA 1JZDC 4LWCA 3HZXA 1YC7A 2FAUA 2IBZY 4U3SB 1LO3L 1ZA3A 3I56A 2DQDH 3CDZA 5KBMA 4M8QB 5GSRB 2WBKA 4K55A 5HGBA 1MCCA 4GIPD 1MRCL 2BP5M 3M46A 3K4AA 3O2WH 2R0KH 4Z7WA 5C3TA 3TBYA 2BSTB 3EO9L 1JZGA 5JIIA 5F6IB 2LTQB 1EY9A 3KYMA 5AW0B 4OI7A 2ESVE 4B3EA 4MMXA 3UZQA 5HYQB 2W0LA 2BSEA 4XB8A 4K5OA 5GZOA 4JO4H 1YAIA 3K2IA 2FT7A 3MGOA 4PRPA 3WIHL 3NFPB 1CBVH 5DO2C 4FLSA 3RPKA 3FTSA 5GADC 1OZTG 3QRBA 3WMQA 4GSXA 2AV1A 4K3DH 1XQ4A 2ZPKH 2VR6A 3CLFL 1I85C 2X09A 2MNAA 2JELL 4P4RB 4R7DA 4PWJA 1Z9LA 2X4OB 1NAML 3ABLB 3QPXH 5K9QI 2XBZA 2AANA 1QSEE 2X2HA 4NQXB 5DRXB 1XMQL 5B3JF 1RHHA 1MOEA 3QXDA 1DLFH 1IGTB 1A1MB 4AJWA 4F58L 4PUBL 3DX9A 3FCBA 4P59H 4AK1A 2EH7L 4K5VA 1Q72H 2F74A 3IGFA 3CN2A 3VA5A 3SK6A 1UCBH 4OCXH 2AV7A 4FYSA 3WDJA 1QYGH 1IM9B 3AQZA 1MWAL 1IBYA 5AB0A 1AQDB 4HGMA 3OX8B 4G7YH 1AZBA 1LK2B 1TVXA 1I1AD 2D4DA 5JEAG 2N8NA 4RNRB 5KYLA 2XETA 3ZE2E 1WAAF 4WDIB 1KIQB 2WHVA 3A3YB 4U1LB 3IDGA 4NUQA 4F1ZA 4PPTA 4WVRA 3B9VA 3NZUA 2PW7A 2OQJA 5C86A 4U49A 1R3IL 2ICWB 3ZRSA 1SQMA 2A4CA 5EC2B 3ZRCC 4L4VB 1MCEA 1V05A 3GMOA 4O58H 1L4IA 4G7VH 5JDSA 3CDGB 4G8FA 4ZFOL 4ELMF 4OKDA 3ZDWA 3CG8A 4LLDA 4PJ8D 3CFBA 2X88A 2PO4A 4ME3A 4K8IA 4A3FB 5I26A 1KWKA 1FORH 1RZ8B 2VDKB 5IMMB 2TRHA 5F3FA 1M4KA 1S5IL 2VZOA 4LFBL 4RBPK 3QQNA 5MENA 4A3CH 1BIIB 5D4JA 1QVGA 2O6PA 1I8MA 3FFCE 2H32H 5TH2A 3UAJD 5CU9A 5BRQA 2X87A 4V11A 1BBWA 1G1OA 4NO5A 4H2CA 1ZYRC 4HCFA 2WBJB 5C0XG 3UO1L 5I8CB 4Z5RB 5EBWA 3FTYA 3MC0A 1E7UA 5HHMB 3WS3B 2F0SA 3ET9F 4HUVB 2UU9Q 1EZLA 3B7TA 1NLBH 2IX0A 4P3WA 2F1MA 4G2AA 1K8DA 2VC2B 3RG1C 1S9XA 4NM8L 1ORSB 1NC2D 4GN5A 2MOGA 5F7YC 4HALA 3V9EA 2QPEB 2B0SL 4LBAA 5FYLL 2VIRA 3BZCA 1V3LA 25C8L 1MPAH 2AJVL 2R23A 5GGSY 5CEYA 3STZA 3HUJA 2YA1A 4ICXA 5JW5B 3ULUC 4XH2B 4LFBQ 3KAAA 4U0RC 1DZ1A 4UTAL 4U6YB 5D70H 1M1KC 1MVUA 1XCWA 3FKIG 2GEEA 5GRZA 3MLVL 4X7EC 1ZGLA 4O02A 2HHHL 1UXWA 6TAAA 5I17B 5J1AB 1KABA 1RIUH 3UJIH 1MHHA 3MNZA 2ZPKL 1KNEA 3BSGA 4HMDA 4X8JB 3SJVD 4NZRH 3P77B 1U3ZA 5EUOE 1FHNA 4GW5A 1QWNA 2W65A 2BOCA 4HIHA 1U3HD 1CLZL 2OMTB 4P5MB 3SHSA 3FQ1A 4OTXL 5LBSA 3V0IA 1SE8A 2PNRC 3O3EA 4Y4FB 4BXVA 1UGKA 3GIVA 4NYLA 1A7RL 4PGCA 4OD3L 3NG5A 3C5ZD 4HZ1A 5TDPA 3C6EA 2JJUA 2OMWB 2R56H 3LIZL 3EYOB 4KUCD 4Q52A 5KBLA 5L0QB 3QUZC 4WHTA 3ZE2F 3KJ6H 5L9DH 4FFTA 5DHVB 1T2JA 5LNEA 3U0TA 4X7DC 2AERT 4OCSL 4ZPTA 3RWCB 2AJ3B 4Q9RH 1DN0B 2BS9A 1SXAA 2G0KA 2XTJC 4DNTB 3IRBA 3ZHKA 4Z3HA 5B1JC 2AQ2B 1JYXA 3GSWA 3D30A 5DZAA 3ZR6A 4Q6YA 1TWCH 3X11A 4X5WB 3FQXA 2VDLH 4RFEB 2QR0B 1ED3A 3TBCA 4A2DA 5IFHH 2NYKA 5ESVA 5L7XL 4N3TA 4N0UE 4XCNA 1P7HL 2NWGA 2X4QB 3MKGA 5AZEL 3WEAA 1ZEAL 5ABDE 4PB9H 4DVRH 2IY5B 3T4YB 1OLLA 3H91A 2CLZA 1Q9OB 4RMRA 4UQBA 4NM8H 4CDGC 2JSOA 1JCKA 2OFQA 3FQTA 4AUJA 4YLBA 1BPVA 3EHBB 4Z95L 4RIRB 5CGYD 5FKAB 5T1KA 4MS8D 1R3HB 1HK6A 1WTVA 3E7JA 1T9HA 3HMWL 1I3GL 4PJIA 2CPUA 3DETD 4IPCA 3CVHB 1FUNA 4AJVA 5JW4Q 2OYPA 4GXVL 1CCZA 2F1EA 4QR7A 3BUYA 5IOPA 4MTMA 4YPJA 4FNQA 4K7PH 4XMUA 2A9BA 2MPVA 3LKPA 4POUB 5ILTH 5F0JB 3LXCA 2B63H 5DRWA 5FK9B 4PGDA 2UUBL 4LF4L 1PVHA 3HNSL 3DKHA 4F37K 5KNBA 3U0PA 1XR8B 3MV8E 4IUUA 3NCWA 1U4MA 3PAUA 3DI3B 1TKWB 4ILDA 1HHGA 4XMPL 3BP6A 4JFEA 3I75B 1JJGA 1IC0A 4QRTA 4CC1A 5I5JA 4Z9KB 3DV6A 3IMVA 4XZUA 2NW3B 4Y1AA 5HDLA 1MCOL 1BF5A 3IJEA 3QDGB 1P84K 2QVIA 2YQBA 3S1RB 1FO0H 1YPZF 2WQUA 1VQLA 4FQXD 4NKIL 5K59F 2X1OA 3O2DL 5HVHB 1UZGA 3M7FB 5IB5B 3GJEB 1OGAD 1NJ9B 3J8F7 3H55A 4S10A 5A2LH 1PF3A 4JBWA 1QTYT 2N1TE 3QR1A 4N2IA 3EZ8A 1JWMB 1JPSH 3HOWG 5CFAA 4FABH 2UUDH 2VZ1A 2X4UB 3BZDA 2XVKA 3MV01 4HUUB 4JUTA 4BGLA 4JE4B 4A2GA 3UJJH 4PTUA 5CP3H 2DJSA 5IBTH 4RA0C 1DJZA 4HSQA 4P4KC 2CU9A 4A04A 4HLJA 1IKNC 2XVSA 3QH3A 5KBDA 3IYLW 4A3IB 1KIXA 1MY5A 1S78D 4NAJA 3TT1H 4X6DE 2F2HA 4B97A 2O5IC 1UE1A 3MRJA 3R4DA 1T1YA 1JG9A 1T0NB 1TT6A 4DK6A 1XF1A 5ELIA 1OE1A 5G5DB 2NVQB 4UQDA 3RY4A 2WGNB 2IQAA 3CFJB 4NM4H 4XMLL 1JYNA 2PPCA 4MVBD 3BIAX 3QJVB 3Q6FA 4IQZA 4XWGL 4ZMLA 4JHWL 1KCUL 3I72A 2C3VB 2K6AA 4JDVA 3ZDXE 3X1BA 3S35H 5I1DA 3VQ2C 2EKSB 1RHPA 4RMWA 3JWOC 3LN4A 2OXGB 2XY2A 5IK3B 5IB3A 3SDDD 3F5WB 1TUPA 4R84A 2WLMA 4RCNA 3QCTL 4J3WA 5AWNH 2YKKA 2NNAA 3DIFB 5C0BB 1CA5A 3ZKMC 1LO4L 2KQNA 2WVSA 3TP5A 4K6DA 1N8RC 4Z7IA 3BVZA 3DUUB 4MA7L 2KHJA 2EDRA 2A73B 3C5JA 5KGUA 3ROOA 1D3CA 4KVPA 4QPEA 3DJRA 4JRYD 5AEAA 4J15A 1EGJA 2FZ3B 3BYYA 4ONHB 4FA8A 4ERSH 3BE1H 5KVFL 4ETQA 3DO3A 4OZHA 3NTHA 4WNJA 3MYJA 5ALCL 1OP3H 5M3MH 2RQXA 1R5IB 4F88A 1ACXA 2CXKA 4A3DH 2DH2A 3CFEA 3L3OB 4TLTA 4KX7A 2PCFB 1THCA 3ZN6A 2RIKA 4HFWB 1SNCA 1C7YA 2WVVB 3WKMH 1QRNA 2DBLL 1T7YA 4CDHA 1XZ0A 2R27A 4BH7A 3BYTB 5I2XA 4HIMA 1TU2B 1A6XA 4JJHA 4DNIA 4XAKE 1S3KL 1DCEA 2B3RA 5E08L 3C2PA 1JHKL 1TNMA 4Z3FA 3GHPA 1M1XB 4FHJA 4A3EH 3K7UA 2HIXA 2QADD 2WXKA 5DUBB 3OKKA 1Q46A 3S17B 1FVIA 4KZ0A 4YWLA 4CVZB 3QCVL 2K4AA 2NUTB 4X4ZA 2R9HD 1U4EA 1E9QB 3PPEA 4DU9A 5IODA 4ELKA 1KLFB 1BM3H 1B9KA 2BOLA 3GD1C 4I85A 1U4LA 4OFPA 5IM7B 2PF6A 4DPAX 4KXDA 2B2VA 5AZ2H 1KJ2L 3RVTC 1CDHA 1J0IA 5ICYB 4HPYL 4IRZL 2OMYA 4GQZA 2DV6A 1FFRA 2EILB 4EAEA 5HPOA 5LMNQ 3J81E 2EEAA 3ZT5A 1BJ1H 1U8JA 5C6TH 1Z7TA 5JAVA 3P4NB 1ASPA 2H26A 1XHHA 4AQZA 3QOJA 3K1DA 3BEVB 3SKOB 1JJCB 1PDQA 1XF4A 5KSVB 4FXKB 3PSIA 1PZ3A 4JI8Q 2OL3H 1IE5A 4JFQA 2P7TA 4N2OA 3OG4B 1I1AA 1IEBA 2J8UB 1ZSDA 2VXUH 4P2OD 3HKZB 4B3RQ 5DJ8A 5I6MA 1NM4A 4TSBH 5HSFA 2R56L 3UE0A 4PH8A 3EH3B 2KCNA 2H32A 3NPSC 4FQXB 4IGBC 4DF9A 3LN5A 4EKJA 1BOGB 4N25A 3HOYH 5JYLA 1DLFL 4KXAA 4U1NB 4A67A 2KLSA 1N70A 3LXUX 4KKCC 5C7XH 5GRVL 2VSDA 3U7AA 2WKLA 1CJYA 1MCJA 3B3IA 1OSYA 4X6CA 3ETBJ 5L88H 4AT6B 1LT6D 4WLCA 4KHXH 4RDQF 5HYIA 2W0KA 4DUVA 1YYLL 4JLRB 5DQJB 3BVVA 3PIQB 4FI6A 3BPCB 1L9OA 2QADC 4K0OA 1KENH 4OF7A 5MERA 5B38G 1WWWX 5J1ZA 3QNXA 4GJTB 1G87A 1JIBA 1KTDB 4AGPA 3GTGH 1ADQH 3V5DB 2I5LX 1CU4H 3TA4D 4OLVH 3ZYZA 1XGRA 4AZ8B 1T6BX 1OGAA 2CO6B 2C4FU 4XO9A 5BUGA 2Q7NA 1SMXA 1YVCA 3GSVB 4B0MM 5LAXB 1N5YH 3VI4B 3X13B 3T1WA 1CFVL 5BV7B 3OSKA 4M5TA 4DJMA 4LHUB 4KY1H 3MLWH 5KBKA 5GISH 4JCMA 4Y1AD 3IDJA 5EUKB 4MMYA 1WTQA 3UE1A 5M3FG 1GGIH 1STBA 1JXJA 4X5LA 4X6BB 1DQQA 1XGPA 2IOOA 4N22A 4ONFL 3MUGA 4U4BA 4B9ZA 4PJ7F 2OSWA 2OBGA 4RFNC 1WE5A 4RGTA 3VW3H 4TVPH 1SYSA 4K3JL 5C07A 1QEWB 4PBXA 2ATWA 1Y1WB 2E6PA 1XCTA 5AG9A 4KLKA 3SO3C 1VQJA 4A38A 1SVBA 3EXLA 2AWNA 2ATAA 1UXSB 2HRGA 5GS2D 5TDOA 1FVEB 1BA9A 3CSBA 3BUTA 4QNPE 1DBKL 1MSPA 3UTPD 4BWGB 5FLMG 1AGEA 3ARFA 1S5HA 1M7IA 2XQBH 4RCAA 1YZ6A 4Y16D 1GVPA 5E8DH 1WJ3A 4AVHA 1ANUA 3QO1B 3W38A 2PYED 4X83A 2F58L 2DWDB 1E8WA 5HI5C 4PRHE 2K7QA 4TKWA 3H3PL 1LYQA 2WM0A 3DIDA 4NNYA 2VLJA 1P7QA 3ATEA 2HB0A 4Z7VE 3FF7A 4KK5D 4CA4A 3LWUA 3VFVA 4E5XA 4AQYL 2XBDA 3SY0B 1E40A 4K5XA 2FJGA 3QEHA 1ZXKA 4OLXL 1OV8A 2BFVL 2HRLA 4M8VA 1NTDA 3MYZA 2YK1H 2LFEA 4HLEA 1QKZH 1MJEA 4JFDD 5FC9A 4KTGA 4N8UA 4Q7DA 2ZKHH 3ERSX 2X69A 3ULSA 3QQ3B 2G3MA 4QYOB 5DSCB 2EYRA 1PD6A 5BQ7B 5HYSA 1MW0A 1Y1VH 3HW7A 2SEBD 4WI7A 2WBXA 2F4IA 1JPFA 5DUPH 3V5HA 3GQBA 4XO5A 3WJMA 5MHSE 4OFDA 3DXAB 3F12B 2IANE 1MUJA 2XIBA 4I0CC 1DJGA 1FC2D 4M4RA 2LS01 4NZFA 3S36H 3P20A 4E9VA 4H8QA 1A1NB 3EGXB 4PW4A 5DD6A 4YO0A 4G9FA 1UWEH 1RLWA 1PFMA 2GK0B 3NUCA 1PZAA 1Q9WB 3TX4A 1DR9A 3JVGC 2GAZA 3GTPB 2PW2A 3JV0A 5EZIL 5DQDH 3VRIA 1T1WB 4FF1A 1PG7W 2EEXA 3HN5A 1QR4A 1T66D 1U4FA 2JMRA 1P5VA 4KK9C 1JHKH 4TL5A 2EVFA 1DBBL 4JKWA 4TM9A 1X5HA 5BPPA 2YBRB 2DQGH 2A1AA 1HH6A 3C6LB 5FHBL 1A4CA 1SXZA 3N85L 4Y7NH 4H25B 5DA4A 4ZNEA 1FZJB 3P11H 4WHYG 5D6DA 1U91B 3RDJA 1HEJC 1OW0C 3U36A 4OGYL 4YQXL 3LNEA 4YAQA 2EIDA 2GSMB 3H85A 4EQ5A 1R9TB 3DXAE 3I9IA 5EZJB 3U6XS 3KPNA 4KY2A 5ERWA 2DEXX 2FEJA 3BO8A 5DJYA 1MH5B 4HS8H 5IBLD 1I4FB 1PTOB 3BXNA 1TZIA 2Z31B 3DURA 4XXDB 4QRSB 1STAA 3WKML 2Y06H 3D48R 1NIEA 5C3IA 1D2BA 2Z6BA 2OYMA 3GMRA 2D62A 3ZE2B 1B2WL 4L2YA 4GP4B 4YBLB 1T4KA 1S46A 1OANA 2QQNL 1T21B 2XPGA 2OMXA 3RR5A 3RGVB 1TJXA 2BZ7A 2BXZA 2HFEB 2CXGA 4HHAB 5I8EA 4W1TA 3VXSA 1SDYA 1UWGL 3FZUC 1RPKA 1HZKA 4LSVH 2WCSA 4GXUM 3OKMA 1MI5E 3W1GA 3L13A 3ATFA 2Q2LA 4NN6B 3WY1A 3ALWA 1F4XL 3CTTA 2VC2L 2I32A 4KMLB 5BRPA 3RUGB 2QSCH 3RQ3A 1TWGB 5GAHC 3KH4A 2IADB 1VMCA 1NGXB 2CR3A 1W72L 3D39D 3I6KA 3WE6B 3D69B 1UA7A 4OLWH 2BRRH 4PWHA 2JCCB 2VWEE 3BGMB 2HLEB 1NC4B 3ISRA 4DV0L 2VQFQ 2BVUA 3NSDA 2UWEA 2Y24A 1HTPA 3G08B 3MJ9L 5FO8A 1VCBC 1MCIA 5IYCH 5LNGA 1KPUB 3CCHB 3FRPB 4OWWB 3T08A 2XWJA 3CXHK 3S9WA 3QUZA 5IJCC 4RQQB 4D0DA 4FNLL 2EYHA 3M7OA 2WANA 4MNGA 2BSSA 2ESVA 4LSSH 2QKSA 3NIGB 3IJYA 3GSOA 5CINH 3WNJA 1G6ZA 1ADQL 1RIHL 4OW6A 2ZSWB 2JJSA 4DV5L 4KGJA 3IJ9A 5FHBH 5A35A 3HZMB 1HTLD 2F0NA 1S5DD 3BZ5A 4DCQB 4BZ2H 4X98A 2ZOLA 3A6OA 2W92A 1D5RA 4YSDA 2IAMB 1L9RA 5C2BH 5EPMB 1IGFH 5ADOH 1T2QL 4ZUVB 3U83A 3ZGIA 3CLWA 4AEHH 4E9QA 2QVTA 4U2ZA 1FL5B 1X5KA 4I4WB 4L29B 3PWLA 3VNYA 2VKWA 1HXYA 2CAKA 2PPDA 2ZXAA 4HK0B 3RI5F 3EJZC 3TWCL 5E99L 3I6GB 2BA1A 1KGWA 3VXPB 4MB4A 1BOYA 1RUAL 5DR5H 1YMMD 2N7BA 5D5MB 5F1OB 4K2LA 1QLRB 4OLYH 5I71B 3DI2B 4RKBA 4ZG1A 4FQCL 5D2LE 4GI9A 3MRNB 1B53A 1TVBA 3X2QB 4V2CB 3IB4A 3VYOA 4FJYA 1AQHA 2ZX9A 4KKLC 5KYUB 1W8NA 4DN3L 1D7DA 4F80A 4PJ5D 1IAOA 2WNWA 3NTCL 2Z6KA 4PJHF 2Q86A 2NN6I 1KC8C 5D7HA 3CZFB 1AXTL 5AW4B 2FO8A 2Z9TA 4PVMA 4BM7A 2R1WA 3GMQA 4EI6A 5I1HH 1Q12A 3KWVA 4Q6IA 4DKEH 3S8GB 2F54A 4Y89A 5DMIL 1WEJH 2RACA 3PIO3 1I1YB 1Z9NA 1QI3A 3ES6B 1O7VA 2Q8AH 5FW6A 4POZD 4FQLL 3ILPB 4FTDA 5AVWB 3T8VA 2EDWA 4Z0XA 3U2SA 3WXVL 4ACTA 1V1OA 3CFUA 2Y5EA 3T2QA 4TUJA 4MJ4A 3WAKA 2MQHA 3LRHA 4GRWH 1STNA 1XDTT 3O9WD 4WW2C 1VQ8A 1H8SA 2MCMA 2PMZB 4NNPH 4F15B 2FE0A 2KS0A 3MLUH 4L3EB 4GFXA 3DDGA 4V33A 3QZMA 2VLKA 3BAEH 1WD8A 3MJ9A 2GT9A 4IMLA 1H5BA 1NGYA 4UTCA 4PGEA 2VYRE 3I74A 4ICWA 1OIOA 3AG1B 5F1IB 4LOVA 1HX0A 3CZNA 3G5YB 4NS0A 4QOKD 2F53A 3FQRB 1SBBB 5E5MA 5E8OB 4CN4A 1A4JA 2BRQA 3TYGH 1TWHH 1YBYA 2J6EL 1QTSA 4AE1A 2OCEA 4Z7AA 2ZUXA 3EJZD 3GMLB 4U1SA 4Z7VF 1N59B 5HDOA 5CCKH 1PH8A 5A6LA 4GKSB 5GZNC 1LT4D 4U33A 3UTZB 1JD9A 4TSAH 5JO5A 1J6QA 4S11A 4M3KB 4MJJA 1KJMA 3R06B 5AENA 1VEOA 4OTXH 3GZOA 3OTOL 2JA7B 2X0WA 4QHUB 5D6DC 2BHYA 4FNRA 4M1DH 1C16A 3QUMB 2BIIA 1LD9A 3R1GL 5J11B 4GT7A 1BYOA 4K2UL 1ITBB 4P2AA 4DGIH 2DOCA 3L9AX 5CLXA 1U8NA 5DVPA 1A5FL 1QQDB 2DI9A 1XTCD 4KTDL 3Q8BA 4KROC 3K5MA 3N04A 2CKBH 4PS8A 4X8XA 2UY7B 4NUJB 4DGWC 4C58B 4J28A 5IQLA 4P2OA 5F9OH 4YHML 4S0TD 1D6VH 5BVPL 1FD7D 4WW1A 4L4TD 5BOZG 3UGUA 2CPCA 5F7EH 5F3BB 3RX5A 4KJNA 3SY6A 4FQIH 5IMLA 4MB1A 1ZHKA 4DP9X 4DH2A 1QZ1A 1CFBA 2OR9H 1YY9C 5CUSL 1A3LL 2DIJA 3LKOA 4FF4A 1ESOA 1SAPA 3UIZA 2D2OA 4NB3A 4NHUB 3BAXA 3BGAA 2NNRA 4UUJB 4OCLC 4DN4M 4MHHG 5E7FA 4I9WE 4LU5H 2IDCA 3QPKA 4G8EA 5F7DA 2CE6A 4DAGH 4GMSH 1UD5A 3J80E 1TQTA 3FUMA 1UZ6E 4X6DB 3LPPA 2CJSA 2NY5L 2P26A 4WGVB 2GBVA 2F15A 3QXAB 5IT9c 2KKQA 4F24A 2A6JB 1J10A 1A6ZB 1BZ7B 2XKNA 1QLFA 1A6VH 3MXVL 3APDA 4JPKL 3PL6D 4PJEF 4P2QE 3VXNB 4BY1H 3X12B 4P3CL 1SEBA 4HJ0C 5GGQH 1N32Q 3PO2B 4M43H 2NXZB 2NYZD 1WZ1L 2B2YA 5EU6A 3V4PA 3MV9E 3ZIMA 2RA1A 2H3KA 3AMLA 4ODVL 3M3YH 4WENB 2J5WA 1M6UA 3RMHA 3EG9A 3UAJA 4QRAA 1JWUB 1HJCA 3AB9A 2YUWA 4BSVB 4FE9A 3QUMH 5DA0B 1P9MA 5KBNC 4MDJA 3N9GH 3AREA 3NCJL 2BHUA 3DRTA 4APQB 4YR6B 4NBXB 5LXVA 1IZJA 1SPDA 1Q0XH 2OCFD 4Z78B 2RH0A 2XXMB 3CZKA 3DTUB 4Z7UF 3UBHA 4CKQA 2GTQA 1DO6A 4X6AH 4ZMTA 2YAQA 4A3DG 3GF8A 4JRXD 5E23A 2NN6G 3V6FB 1W72B 5FYJE 4L3ED 2R0WH 4EEEA 1RUAH 3PJNA 5DR5L 3WJLA 1Z3GL 1BJMA 4L0PB 4F91B 1VS0A 2IPKA 4I0PB 3NWSA 1DBJL 1Z66A 3OQRA 2P5EB 4E41B 4KMUC 4G6MH 3N43B 3ZUNC 4APQC 4HCIA 5M5YB 1XGQA 1IGMH 3TASA 1C48A 3BHBB 4UNVA 3O11A 2OEOA 4HWUA 1CDBA 4BZ2L 1G7HA 1E30A 5IFHL 4GRWB 4BXXH 1QFWI 2FGZA 2HJKA 4LVHC 3WV0A 1WZLA 5K93A 3JBG7 3M17B 5D2NE 1RJYA 3F7QA 4IU2B 3EVQA 1UH2A 5ILTL 1I8KB 3QUXC 5IQNA 1VEPA 4KXZH 3FQUA 2QSVA 1CG9A 1HNGA 4B0MB 1NH6A 4IJ3C 4AYFB 3ESUF 1PH9A 1FGVH 2XZCL 3B6SA 3OXSA 4PRNB 4H0IA 4LNVA 4QRPA 4R96B 2OT2A 1FSKB 1N0LB 5E6UB 3TN0D 3X1GA 2VMCA 4KBPA 3G6AB 1QFWH 1L7TH 1TS4A 3MA2B 1IKFL 3MLUL 4EOWH 2D3NA 1UNSA 1AVAA 4BQ8A 1TVDA 2LU3A 4JZOA 3SGKC 3CVIL 2HAZA 3QORC 3SBPA 1F8TL 2QDLA 4HS3B 5LN8A 4XHJC 1JF5A 1PZBA 3MO1A 3OVUB 1H6FA 2I9TB 1HHJB 4JO3L 1EWHA 4BY7G 1UJ3C 4JDTH 3BZKA 2OL3L 3O3BA 4TRPL 3FU6A 1Q3LA 2C9SA 2NUPA 2HFGL 1I1RA 3LXAA 1LTLA 2XTLA 1WTLA 4GMSL 1JNNL 4JGUA 1WAPA 3MREB 4M9PA 5C0AE 2VXVH 2VDMH 4OSUL 2EIJB 4HU8A 4I48A 3PWPD 1FG2B 3A7LA 3TSSA 1QZHA 5DD5L 4HMIA 4FNFA 3LRSA 4RRPG 5C8JB 1PCSA 3S98A 4HJJH 4OIJA 1MCOH 5EF3A 3RY5A 2KUTA 5DWUL 4IS6A 4HJ7A 4PLKC 1I7TA 3MZGB 4PG9A 3CPFA 4L1BA 4X5XA 4A3MH 4A7UA 4L63B 5DK3A 4PJ7A 2NSXA 1S78C 1UH3A 3PHOB 5EBDA 3PFQA 4DHLA 3H9HB 2W60A 4ZS6C 4JFSA 2DL2A 3L3JA 1JB7A 4JY4B 3JV4A 1WFNA 4X64Q 2AJXL 3L3DB 4X62Q 3G5ZA 4W6WB 4AYID 2VB2X 3DWAA 1HI6B 2D0GA 4HDIB 2COVD 3V0VA 2IX3A 1X7QA 4WCYH 1U95A 4P2RB 4B7LA 4PW3A 2R0LL 1G1YA 3R19A 5B8CC 1NCUA 4E0RB 4XT1C 4FS0A 2SDFA 3U9OA 3TS0A 1FAKT 5GRVK 3KDMB 1JHLH 2VB3X 1N64H 2XN9C 2XQ0A 5C4XH 4F7PB 4MHHI 1LDPH 4PR5B 3LYRA 1T83A 4QEGA 4ZX4A 3F58L 3T0DA 1R9FA 1IGJA 3FN0L 4HIPA 3LEXA 1E0BA 5MEOB 4H26B 1JOKA 1EY0A 1IGML 3CZLA 4WI5A 1FZKA 2Z1KA 2JKJA 2R0KL 2MNJB 5D1ZB 3T3ME 1SNDA 2G60H 5F1KC 1EYGA 4FADA 1HQRB 3CDFA 1JZEA 5T5FA 4NZ8A 5DJCA 1W6WA 5HDQL 3B4NA 3L3OC 2N55A 2VXQH 5F7FA 1BG9A 2EYTA 3D2UA 3SGKA 4Z3EA 1IEHA 2HWZL 2XICA 5AWNL 2XKUA 3HZYA 5I0WA 2HVKA 4PJFA 2IG2L 4AYMC 3LNGA 4NO0A 3IETA 4LAQL 5DLLA 1ICWA 3BIKB 4KVCL 1AC6A 2DWEB 3HG1E 1D7CA 4J1UA 2FYVA 5GAEC 3CCVA 4NMZA 2OL3B 2P5ED 2IC2A 5GSVA 2JWYA 3HS0B 1KT2B 4RWHA 4JRLA 1QFPA 1CKNB 2YPLE 1MDTA 4MA3A 5IB4A 1JTPA 4CW1B 3LMJH 2J4WL 2BSRA 3IFLH 4HJUA 1YEIL 3T0EB 4A6YB 5FECA 5I75C 1FZOB 1ZGLM 1N4XH 3NENA 4LF8Q 1A9BA 1HR0Q 4OIIL 1VQHA 3OTOQ 3I6LD 1J87A 4KMTL 5AKVA 3ONAB 3BPOB 2XI9A 2Z0BA 5F0MB 3BDBA 4GSDL 1I4PA 4CKBA 3MBEC 4XNUL 3I91A 3GTJB 4B3ML 1NGPH 2RDHA 3PO2G 3QDJB 1ZJAA 3ECBA 3NIGF 5EORH 5FYKL 3D0AA 5F0LB 3US1A 3VFSB 4OCNC 4KZEL 2YD5A 3QR8A 1BD2D 2EQSA 4BK5A 4PY8I 4K3GA 3C08H 3APFA 4Y2OA 2UUCL 2JB5H 1DM0B 1RJZB 4X9FA 1CI3M 4GQPH 2KLTA 1AG6A 1BLNA 2CDGA 2EDTA 2UVFA 4KRPB 4OUOA 3ZKXC 5IUSA 1JNHB 3HI5L 3VXRA 4WV1B 2CDEB 1HHKB 4R7XA 4WWKB 3A74A 2DLGA 3UZEC 1NLDL 3S3CB 1Y1VB 3UACA 5B38A 2ODHA 4G9FD 4UDUC 4R2GD 5B3NA 2AMCB 5C4JB 2R7DA 2P8PA 1HNWQ 1NGZB 3OG6B 4WKZA 3UTTB 3L5JA 1F58L 2YD1A 4BUQA 4NNXB 3FMGH 4FFZL 5I1EL 3Q5TA 1NSNH 1GPOL 4F20A 5DJ6A 1RVFL 2CW0D 1VRSA 2YS4A 4GSUA 3PWJB 5C0XH 5I6PA 2BFGA 2CLVB 4OZIE 3KXFA 1H9MA 4BWWA 2B1HH 3N85H 1M56B 3L1FA 4KKCD 3JV5A 5C4JH 1CD1A 2J44A 3VSUA 3EXJA 5I15H 4PRAA 5I4DA 1PH3A 1N6VA 5D1ZD 3F7RA 4YN3A 5I6NA 2G5RA 3DSNB 3U0WH 3BUQA 2J2ZB 4UM9A 1SXTA 3DPDA 3QORA 4LEOB 1OAXH 1AMYA 3HR5A 5HJDA 3A54A 5BXFA 4ZFOB 2HZHA 4HJ9A 2VDNH 3I85A 4IIZA 4BKLA 3AMKA 2BY0A 1NWOA 2QEXA 1PJWA 3DX2A 4QRQB 1SJEB 3OB0H 4UIKL 4NX0A 4AMKH 4QMGA 1CGXA 2CQOA 1KCKA 3SDCA 2UWEF 3HVDA 2QSQA 4LLUB 3S35L 2QVKA 3MR9A 1SLWA 5SV3A 2D3JA 4HJGA 4MJIE 5E2JA 4ZUSB 5I9QC 4M6ML 4JRFA 1NGQH 3ABMB 5GGTA 1NSNS 2Q9OA 4BRVA 2Y72A 2P46B 1AHWB 4GOPA 4FFVC 3GTLH 1E5UI 1HINL 2CUAA 1LNUA 2XLLA 4YUEH 4AZUA 2F0TA 3VR4A 1U6AL 4URKA 4M5YH 1WTRA 1IMHC 1A6AA 2VUKA 1HHIA 5B7EA 1B8AA 4IGBA 5G55A 43C9A 5GS1B 5L2JA 4G11A 2YAMA 3GKWL 4CMMA 1ODUA 2D3LA 3JWDC 1W6JA 4TSCL 3P30L 4F2EA 1MHCB 4DFIA 1AO7B 2M00A 2APBA 2WV6D 1GH7A 1IAKB 2WLIB 4A2MA 1K4CA 3QNZA 1Q7YC 2Y5TB 4W93A 5JORA 1EXHA 1LM0A 1AGFA 3VXRD 2WTRA 5CCHE 2Z8WC 2UXDQ 1P5UB 2C9QA 4DV0Q 3QJTB 4QHKI 5IP9G 4NPSA 2AGJH 5FCUL 4OONA 3VI4F 2QDBA 1E7ZA 4S1RH 3WKQA 5KSAD 1TVHA 5DLQE 1I7RB 5I19L 3JWNG 3IF1A 4TULL 3QJZA 1UD6A 1VZGA 3ULPA 2VUYA 3CN3A 3PJSB 3IDNB 3ASOB 5E1AA 3TBSA 3I02B 4L8SC 4BA8A 5C09B 4IKLA 4H88L 1BWWA 4J3SA 4IZ8A 1MCRA 3L17A 1P1ZA 3MVSA 3A56A 3W1BA 1RD9D 5I1HL 3KL3A 1EIHA 3LOWA 1INEH 3D4GA 3VGAC 1KLUA 3IFPA 2P52A 3S7GA 1YQVH 2VDNL 5BRZD 1UTDA 4Y2DD 5DXWA 3COOA 2LFGA 1I94L 4ODXB 5CD3B 3D12B 2MEJB 5F9JB 4YFLF 4L9LA 3O4OC 5M94B 4ZSOB 4A3KH 1NL0L 4LNRB 4O02L 1C5BH 3E6HB 3O2WL 4XMZA 5DQ9B 4PJGB 3FHAA 2X3BA 4DR7Q 4OQTH 3J80c 4NQDB 5GRYA 1HCYA 4OD1H 3EFOA 1K8MA 1SOXA 1E4XH 1FDLL 2ZUQC 2W9EH 1FNAA 1N6QH 1ET8A 4WRDA 4QF1A 4HD9A 2EIMB 4MYWB 1C8CA 2DJGC 1X5JA 3SE9L 2A6ED 1OTTD 3MMEB 1E2ZA 4Q2ZA 1X5ZA 5JA9A 3WTSA 4G1EA 1HIMH 3H9YA 1PHJA 1M7XA 4TSBL 2DYPB 5ESQB 4Z7QB 3CHRA 2YR3A 4AIZA 1LTSD 5B39A 3PV6A 2W07A 4PB9L 3IGAB 3VM5A 4ADIA 1YDPB 5SX5H 4ZMNA 4NSKA 2CFMA 1AIFB 3CC5B 3GJFH 4OD2B 2VDLB 2LT9A 5EBLB 1K8IB 4PWEA 4UQ3B 4N1HB 1EBAA 4DK1A 2AXFB 2L7UA 3MACL 5D1QE 2I0QA 4WJKB 1A7PL 1RJTA 1VADA 5F70A 1KDCA 4IO9A 5F88B 1PLGH 3OPZL 2FWSA 2IFFL 5CSZA 3MRPB 4U3HA 4C3HH 1AKJA 2K5QA 1XSKA 3GTQB 3TL5A 3ASWA 5TGBA 3ZTJG 1RULH 1J5IA 3Q05A 3D8GA 5J8OA 1L0WA 1MN4A 3UPAA 1T0PB 5EORL 5IWAL 1BR9A 1HHHA 1ETA1 1CFQB 1HC1A 1HWGB 2SOBA 4E6IA 2HJFB 3X3GL 5I1KH 3F8UB 5EJWA 5M5WB 3AUWB 1SDFA 3T0XA 2L55A 4JI8L 1PZUB 4L8CA 2A74B 3ZR5A 3GV6A 2PKDA 2Q7AA 1KGIA 3LEYH 4K6LA 4J3TA 2BVTA 2FATH 3HB3B 4GI8A 2MRYA 4XNMB 1UA3A 5IHUL 5G3LF 2OMVB 4YDIH 5E8PA 2NN6H 1AJ7L 3MNVA 1F4XH 1EAPA 1ZVYA 3MRGB 1CKMA 5K69A 3K7AB 2VJ0A 3MOAH 2GTZB 5K39B 1ETB1 1E4JA 3KPLB 2EICA 1BQHA 4UT7L 4AM0B 1MW2A 1D9KB 1AAJA 1U92B 1ZE3H 4PV8A 3VW3L 1DBJH 4F7MA 2ZXOA 5DUML 2V7NA 3HE7D 4P8QA 2F7PA 1J5EQ 4I2XE 2PYEB 4DPRA 3MTXA 4PB0L 1SJVA 4QGTA 2W9EL 4X7TA 3M6DA 4B08A 3VA2C 1P4LB 3MCKB 3PQYD 1DFXA 4UBDD 4I13B 4IOCA 3DWPA 4XN1A 5EDSA 5BS0A 5T3XH 3CFQA 3JYCA 4OF3A 4CJ1A 2WJ5A 4F93B 4I18A 4IUVA 4MWFA 4JPIA 3ABZA 3L1GA 2FQGA 3KPRD 3E8VA 4M7JH 1QUNA 2CR6A 4X0NA 1JXGA 3KM1A 1BVNP 2O5YH 1RLBA 4MD4A 2WB1B 2M83A 4D9RD 1BX2A 1YMHB 4PMFA 5EFIB 3B8SA 3IU3B 5DD0L 4CNIB 5I8KH 3HZVA 1NINA 4R3SB 4HGWA 2HRPH 1BXUA 3Q8FA 5EO0A 3WNKA 4B3SL 2JN4A 2X2IA 2NY1D 3D6GA 3H7BA 4IKKA 3WIHA 3T2OA 2YAOA 3LQAH 3W9DB 3TEUA 4DA2A 1DFBL 3OMGA 4IDLA 3IXAB 4GO6B 4WNSA 4WWID 1BQKA 4U1IA 2QPSA 4Z7NF 3ULUE 5C1MB 4OJDH 4YC2B 3S5LA 1OXTA 4AH6A 1ZV5A 2B1HL 2AI0H 3HC4L 4PP2B 4WV1C 4XCCH 4P9HL 1UEYA 3OHMB 4MRCA 1LP9F 2ZG3A 4Y9EA 5C70A 3UH8A 3P1HA 3DX8B 1VQ9A 2EDBA 2XV2A 3EGSB 3TIEA 1BFVH 1MCQA 3NCYP 3FTGA 3SYQA 2ASBA 5ITFA 3ZDZB 3U82B 4AIMA 1AZVA 4MCNA 4J3OC 4Z7UA 3D50A 3VWKA 4K23H 4AW4A 3BMWA 1NKRA 4MA7H 4KKLD 1JXFA 2VLRE 3ZBMA 2PNHA 3DGGA 5I76B 1WTGT 3GXDA 5D1XA 3SKMB 1P4IH 2PYFB 5C7ZA 1JCVA 4NI6A 2XRSD 3K5SA 5L7XH 1RPUA 3L1OH 3A55A 1TNNA 2J6EA 1RL2A 5BVJB 5CIPB 3LPOA 1A0QL 3GRGA 5DMGC 4PCKA 5C0CA 1CHQD 3NZSA 1LE5B 4DETA 1M05A 1F3JB 1QSFB 4JDZA 5M5XH 3LKQA 5SWSD 5DHYB 4PZ6A 5D1QB 3KYOB 4HKBB 3P4OA 2XN1A 5D7LD 1QYGL 3L4TA 4KNUA 5INDB 1AGCB 3GINA 1HNZQ 4WWOA 5E2WH 5L9DL 3HC3L 5CS7A 4OR1A 2E9BA 2NSMA 4OZFA 4AYBA 2IMMA 3ARVA 1PLCA 5KVMC 4K71C 1TETL 1B0GA 2D7TL 1SLJA 2CKBA 5EO1B 3VD0A 2FJ2A 4UM8B 1TWAB 4BIKA 3RGHA 4APXB 4PQXA 2RALA 3HE7B 3MLTB 2OWOA 3WD5L 4IJLA 3DMMD 4KMQA 4HU2A 1D1KA 2D9UA 2ZCLH 1XAKA 1XXFC 2FL5A 4TTDD 1CL7H 5TTRA 3EOBB 1NBQA 5JW3H 1WA0X 4P2YA 1B3IA 2DICA 5FGBC 1X55A 2RHSB 1BAWA 4IUNA 2PI2A 4Z7WE 1FNFA 4Y2DA 4Z76A 4XCFL 3GD7A 1VCIA 5CZKA 2OSXA 1ZHLA 4N0CC 3KCWA 3MUJA 5GZND 2FBOJ 2IDFA 3B37A 4KTEL 4E9YA 1G0XA 4V190 4WU7A 5TF1H 5KEEA 4LGRB 4FQQB 2D9CA 3S1QH 3L3GA 3FH5A 4P5TD 3VFUB 2PTTA 1K72A 3HFMH 4U2YA 5F9AC 1N8ZA 3AAZB 4XN7A 4NGHL 3WEOA 3WL9B 4MQ7B 1J8HE 4RAHA 5IV2A 5I0VA 3QDMB 1SFOH 4H02A 1J8RA 2HLAA 3QR0A 2VXVL 4YPGA 2AZUA 3KF8A 1JV2B 5EN2A 2IH3B 2NY4C 5C4HA 5CP3A 4N5ED 3BAYA 3D87B 5CORA 3CFMA 5I82A 3OHXA 8CGTA 1J5CA 4GUQA 2WJ7A 2ERJB 3F1ZA 4PS4L 4Q58C 1P4IL 1T5WB 3CQFA 3EHBC 2AEQH 1VQGA 3ROLA 2OTUA 43CAA 3ULVE 3CCRA 4BYHA 3HC4H 4KHXL 5LXGL 1GS8A 1QVFA 2V7HB 4EXKA 3H4HA 5E4OA 2JF1A 4U1KB 1P6WA 4M56A 3EO0B 3O3DB 4G80A 2F8IA 4NM4L 2YYZA 3NZ8B 3CH1B 4IQHA 4EVOA 2GJ6D 3TZVC 4UTBA 1A6TB 4Q74A 4L2LA 2Y69B 2C9VA 4NWTL 5HHMD 2NX5E 1TS3A 3CU1A 1EU4A 2FT8A 2EOTA 2IALA 4OGZA 1Y6NR 3GRWL 3N42B 4TNVK 3LNIA 4LLQB 2XXFA 2H2PD 4QYAA 1ZHBB 1OOWA 1BBJA 1QACA 4HOXA 1CFSA 4MA1C 2OMUB 3FBKA 2A83B 3KUPA 3MXGA 1IBLL 2OXHB 1GL4B 1TDQA 4RH4A 1KB3A 5E9NA 3LZNA 3MLRL 1IAIH 4MD0B 5FUOL 4RZCB 3FUKA 1SYVA 2C26A 4K8RC 5E00B 4G7RB 3VXQA 3SCMA 4QTHA 3HE6A 1M7DB 2XA8H 3AQYA 2E7LA 2WYZA 3U46A 4MNQB 4KDWA 1GGBL 3NEXA 2UYLA 1HEZA 4HW6A 1CGTA 1S7WA 2FJHB 4WUUD 4XCFH 2NYYC 3RIAK 3BE1L 3OAYH 3TVMB 3RZDB 5DI8A 1A7OL 4FCHA 4N0FB 1OTSC 3GDEA 1NFIB 3QW9A 3UDGA 5KVGL 3CVIH 2VMDA 2AHOB 1BKBA 3TDQA 1XSIA 4IFDI 3QZWB 4ZS7H 4ZTOH 4XNYL 4MNHA 5CKAA 2NPLX 1RZJL 3GI8H 3UTSD 1ZT1B 3SDYL 3D6CA 3REWB 2QLYA 2CO2A 3U4BL 1QBAA 3LZFL 1S2EA 2BVYA 4O51B 4MB3A 5IW3A 1MIEH 2JIXB 2HKFH 3ILDA 1RTNA 4Y9GA 1ZHNA 1IL8A 4NBZB 1WYJA 3PL6B 2I85A 1E8ZA 3H0TB 4Y4HA 1EFXB 1AXIB 2X05A 1ZK5A 3E6ZX 1BVLA 1ZE3C 4LSTL 1YNTA 1O0VA 3IFOB 4PJXB 3U30B 3MXNB 2FHFA 3O8XA 1PYWB 1KHIA 1JF6A 2KUMA 3BVMA 3FCGA 4PLJC 3V6OC 4FKHA 1T83C 2Y9RT 4DEPC 4BSWB 1JPGA 3FKIH 4R4BA 1CR9H 3AUVA 4P48A 2WP3O 1WIOA 4BDVB 1A9VA 4OCWL 4H8WL 4JM0A 1FGNH 4ODHH 1T22A 3FTUA 1NCBH 3R8BA 2VDNB 2E5EA 1ILQA 1YNND 3C09C 4C1NI 2Z4HA 2AJYH 1DUYB 5EF1A 5DTFA 3BH4A 5JEAJ 3BH9B 5FYLD 2Y0SA 3GKWH 2FMMA 5JQIB 1X3DA 4HOZA 5E6IA 2BIMA 3MLPA 3NCFB 4WUUE 2D03H 1JPTH 3PWVA 3BU2A 5AQ0A 4BE6A 1OSPH 3RL1B 3QULB 3BAKA 1SVZA 4A3JB 2JJTA 4JRXB 5CEZL 3EFDL 2ZOKA 5DSCA 2IAMC 4JFFD 4KGLA 1DVFA 1G7PB 4PEEA 3J81c