2ICEC

Crig bound to c3c
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
307
structure length
296
Chain Sequence
TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of C3b in complex with CRIg gives insights into regulation of complement activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Complement C3 beta chain
total genus 51
structure length 296
sequence length 307
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2iceC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2iceC01
3L3OC 5FO7B 3T4AC 2E2DC 1EDYA 1PXUA 3CKIB 5JPNC 2I07B 4FXGC 2A74C 1XWEA 2WIIB 1D2BA 1GXDC 2B39A 3G6JB 1UAPA 4ILWA 3MA2B 3KLSA 5FO9B 3FRPB 1BQQT 3OHXC 2QKIC 1JB3A 2A73B 2ICEC 1OO9B 2J0TD 4FXKC 3V96A 3CU7A 2XWJB 2WINB 5FOBB 1BV8A 2PN5A 5FO8B 1AYOA 3I70A 2TMPA 1UEAB 2XWBB 5JPMC 3HS0C 4LNVA 4D94A 3HRZC 1BR9A 1BUVT 1JC7A
chains in the Genus database with same CATH superfamily
4IKJA 1F2ZA 1EO8H 3KH3A 2E4TA 3UPAA 1H3VA 5LMNW 1Y1UA 1RHHB 4U1HA 4J5VA 3UZVB 1FNAA 2F54D 4HJSA 2NXYC 1U4PA 1WTRA 1XMEB 2E9IA 2BC4B 2J2ZB 1EERB 1NIFA 1NBQA 5KW9H 2B5IC 4ISVA 2K7PA 4GI6A 3Q13A 2P5EB 3PWPE 3QUXB 4EQPA 2Q8BL 2Z35A 1ZLDA 2ZZUT 5CZXD 3AREB 2VXSL 3CZFA 1XMOQ 2V5SA 3EDKA 3L6FB 2JCCF 3HMWL 2JMRA 4PRBB 1QR1A 5M9OA 2YD0A 4YHOL 3IDIA 1GO3E 4MWFB 4X8GA 2CJUH 2L0CA 2FO4A 5HPOA 1WOCA 2FH6A 1JZ6A 3KYOB 1INDL 5BOZG 5AAWC 3VD1A 1MEXH 3GSOA 2WOYA 1W6KA 5F9WB 4L5FH 3WS3B 1SFOH 2XWDA 5I8OL 1CR9L 2RCSL 5DF0A 4N86A 3BSZA 3LZPA 2Z4TA 4NQDE 2QKIC 3JWNE 5FKAC 4HMJA 1TJIL 1V55B 3IU4H 4M5ZL 5DQ9B 1NEPA 1R0AH 5KBKA 2FATH 1TR7A 4PMEA 3NEXA 5GJTL 2N0KA 3P0YH 1YNKH 3T51B 1R5WA 2P24A 4PRHD 1NE3A 4QF4A 4HCEA 3MRGB 4KJWD 4Q6IB 5TE4H 3RG1C 3STZB 4XVJH 1BEYH 1ZLUH 3H9HB 2DMBA 3FQRB 4Z7QF 1ESOA 4QJ3B 2K28A 1EMTH 4UYQA 5IF0A 4UT6L 5MHSE 2DWTA 3KLAB 3ZTEA 4W6YB 5JYLA 3RUGB 4OTXH 5ANMB 5D1QE 3QFDA 4A3GH 2W81C 5I82A 5LBSL 3OX8B 1TZGH 3DHUA 2RH0A 3ARDB 2YLKA 1PNDA 3EN2A 3WBDA 1RQ5A 2Z93A 4DK6A 1XEDA 2LVCA 2V2WB 4GT0A 5I19L 4GKKQ 2RB8A 5FUCE 4DWHA 1RMFL 2UZYA 3WFBL 4QF1A 3PS6A 3S37L 32C2B 1B0IA 3Q2NA 1MEXL 4P73A 5SX4I 7TAAA 1SMDA 4NO0D 3PAUA 1LK2A 1QSEA 2Z4QB 1OGAD 5EF0A 4DNIA 1ZV5A 5DK0A 2O5NA 3F2CA 2K6WA 2ZXOA 2HTKC 3GGWA 1STYA 4KJQD 4FFZH 1N5AB 4JFFD 5DRWB 3SOBH 4NC0B 1QBBA 4GKZB 3SO3B 3MV7B 3KPPA 1I8IB 2EEXA 4PI0A 1UA7A 3BYYA 3EYOA 4IUQA 3L3DB 1QFUH 5E1IA 1N8RC 2BDNL 2VM4A 2XJKA 4PP1C 1BJ1J 4GO6B 4EN3B 4OLVL 4KI0A 4O58L 4XE5B 4G6JH 3LOWA 4N6RA 3FCBA 4KJYA 1OSPL 4X3UA 2FQFA 3DI2B 3HZMA 3IAPA 1GIGH 2OT2A 3EYUL 4NPJA 4F33A 1PZJD 3F7LA 3X3GL 6CGTA 4DN3L 1ZXQA 3DEPA 2B63G 2NUCA 1IGYB 4NQSB 3A24A 4ZI8A 5KYWA 4M5ZH 3WFDL 1VDZA 2QADD 2BH0A 4HWBH 3BAJA 4J2QA 1Q46A 4NOBA 1KIQA 4GUCA 5GJTH 4YHYC 2RQEA 2E9WA 1ZANL 2VKXA 2OMZA 1HSAB 4AUUA 2OKMA 4UV7H 3VR2A 4PV8B 3ARTA 5H37G 2ZNWA 3DBSA 4HK0B 1I4RA 1KNAA 4PTTB 1DONA 3FO2A 1IC5L 1GUWA 3GRWL 1AOZA 1XFPA 1SJEB 3QUHA 4LFHD 4PS7A 4JQIL 4IBVA 2PABA 2MQCA 4GSRA 4MAUL 3WV0A 2K8MA 1YHPA 4YZFF 5JIIA 1Q9LA 2YGPA 3QB3A 2GBVA 2UUAL 3FB8B 4H8UA 2FHBA 5TK2A 2VLRD 5IESL 3K71A 2KEDA 3PPSA 4JO2H 1U8KB 2VMCA 4JI8L 3TIDB 3N40F 1EAQA 4OLYH 4W68A 5EH1A 5IOPB 5M7QA 3CZEA 4P5TB 4X4MA 3M4OB 4LP5A 3NTCL 1EJOH 3S2HB 3S34L 5I8EA 3PWVA 4HIIA 1JNNL 1JGUL 2COQA 2PN5A 4YJZL 4CVZB 4RGMA 1PKQA 2XWZA 1D9KA 1MWAA 2IOIA 1EGJA 4OO1I 2RFXB 2N78A 2XWEA 5BZDB 3NDZE 1CE6A 1CWVA 2A9BA 3MXVL 2JA6H 4IO9A 3DURA 4XN2A 2F0KA 3FU8A 3PSIA 2CJSA 3LKRB 3GMMA 3D7PA 4GNXC 2A6KA 2ZCHL 1DN2A 1WBZB 4L1BA 4OAWB 3SGKA 3KMDA 3NK3A 5AENA 4F7XA 1I3RA 1VZGA 5TQ2L 2OMBA 2FEEI 5EBCA 2ROXA 1YYLH 2P47B 4U1LA 4PRDB 1R5WB 5CLYA 3QCUL 3RVWC 3QIBC 3DHMA 1CI5A 1BCPD 4O58H 4D8OA 3ME0A 3S7GA 2MHVA 4XN9A 2K5WA 1HHGB 4JZNA 4QXWA 4XB8A 1QD0A 4M8QA 2K1MA 5E94B 1HN1A 2AGJL 3DDFA 3ZE2B 5CV6A 4DEUA 1PVOA 4ENZA 3WS3A 1WBYB 4A3JB 1QUNB 1ACXA 3PQYE 2YAMA 2CA3A 2OYPA 2EEFA 4JJ5B 3X2QB 3OLEA 4DP4X 3KLKA 4LVOC 1AZNA 3H2PA 5GS1C 1M9WA 1J9OA 3T77A 2AXFA 3QXAA 2B2UA 4HBQA 2ZWLT 4HT1H 4KGJA 2VLKE 1CXHA 4UQIM 1ED3B 1X3FA 1AGFB 5CCHE 5DSCA 3OMIB 4NKIL 4X7CC 2VDQB 5IVXB 4YSCA 5AUMB 1RK0B 2PR9A 3OKMB 5FDYA 4WUUA 3A3YB 3BQUC 5JO5A 2ENYA 5HHOE 3IU3A 5D7JC 5IYDG 1QYGH 3P11H 1XAUA 2QMJA 1YY8A 4YC2C 1CURA 4BCYA 4PJ9A 1EGJL 1STEA 2X4SB 3HG2A 4LSRL 3H0GB 1PAMA 3OJDB 3HFFA 3QJSB 4HS6B 3SQOH 3V0AC 1EAPA 1G9ML 3D0LA 1QFPA 3WXWH 5I0ZA 4NKOB 3OAWA 1MFAL 1DVFB 4EUPG 1KYUA 4PZ7A 1MCOL 1JV5B 3V52H 3URYA 4H8WH 4BK5C 4BKLA 4TQIA 1SDDB 1CDHA 4DKDC 1F6AA 1S7TB 4X80H 1KCVL 4JX0A 4KTYA 3KLSX 2FX9L 2IVFC 5A16B 4D9QE 3C5ZB 1JB7A 4JN1L 3NFNB 3MLTA 5D70H 5HBBA 4RMBA 1R3IL 4A75A 2TSAA 4LF8Q 3PABB 1P6WA 1QQDA 4LLMB 4KVCH 1U33A 2NR6D 1W9XA 3OSOA 1I3UA 1DYQA 4F7PB 1FIGH 3AG4B 4ECNA 4HIPA 4UV4L 4DAPA 2E5LL 3ZU8A 3P40A 4FXDA 4AQ1A 2ZXPA 2QGCA 2X89D 3F83A 5EU3B 5F1IA 5KSVA 5K9OA 3GHEH 2I85A 5ISZA 2ZXWB 4NO3B 2M26A 2WLHA 2UZYB 3VWKA 1NCVA 2J8UF 4MS8D 3BSZL 4O2EA 1OSZB 3FDTA 4OM0H 2FYYB 3BAEL 3O4LB 4JM2B 5DMYA 3VG0L 4IIQA 4QOKB 2A83B 1E4WH 1VQ7A 4KNTA 3CZKA 4LW1A 3D25B 4JI6Q 4GOSA 3W57A 1YVCA 2IX1A 3UBXI 2H4EA 2XG5B 3VH8G 3RUGA 4DP5X 2W92A 5E94A 1P5VB 3UJIH 3CFDA 1P7QA 1HI6A 1A6ZB 3DETD 4ODHH 2OL3L 4IGBC 3NWTA 3OHXC 3LQZA 3OJMB 4CSTA 5ADPH 3VU2A 4K3GA 3VYOA 1IMHC 4GG6E 4LOFA 3SODB 2CHDA 1O5PA 1CT8A 2ICWB 4F27A 2R7FA 1BM7A 1S7QB 2BIMA 2WB1B 1HNYA 4KKCC 4PJDE 4DAVA 1XF2B 4JQXC 3U46B 4DNTB 4XMVA 1QZGA 3ECWA 4DF9A 6PAZA 4LFAQ 3GIZH 2VDQL 4OAWA 4MJ5A 1AACA 1VQFA 3W1GA 1K8DB 2EH7L 3GMMB 4P59L 4P9ML 3LX0A 5F7DB 1T7ZA 2CHBD 3OGCA 2G30A 3BZCA 4J4PD 4ZUVA 2JJTC 1IM3B 4U4BA 4PMWA 4L37B 1CSPA 4G80A 1JL8A 4IU2B 4DV6L 3S5LB 1PPIA 3BPNC 2OTLA 1CL7I 3CU1A 3IDYB 1XR8B 1OT2A 2WBXA 2IWGA 3FTYA 4NLHA 1SGKA 1B2TA 4DP1X 4YDKH 1FVIA 1CLOH 3LV3B 3O6FA 2VLRA 4PS8A 4CVUA 1EEZA 1EIFA 1D5MA 3CG8A 3D48R 4NN6B 4JN2B 2UYLA 35C8L 4LCCC 3BDOA 4OD1L 4NB7A 3AABA 4UNUA 3VG0H 1DHKA 3ZE1E 3EDJA 2Y4SA 2J44A 2JLPA 3IDYC 3T0XA 5GHWL 1U91A 4FP8L 1A3LH 3EUDA 4FLQA 1FYTE 3U6RA 4LXFA 1T7XA 1XXDC 4MNHA 2DQHH 4AH2B 1FUNA 1KB9J 3JYCA 3WO4C 4G7SB 3V4PB 5D1XD 2J7LA 3DJZA 1Y8PB 4NZTH 2B29A 5A2KH 4J4PC 5I24A 3B3IA 3FCGA 3GS4A 3R1GL 2NY7H 4FQJL 1ICFB 3FPPA 1ZKOA 1N8ZB 2OMZB 1RUKL 3CBJB 1GW6A 4YUEH 1PTOC 4AEHH 4DZ8A 1N0LA 5AKRA 4LBEA 4ZNEE 2OMYA 2PI2E 3QXVA 1YMMD 4OCYL 3L9BA 4HQQL 3T6QC 2YSSB 3HLAB 3WDJA 5JR1L 1HAWA 1TVBB 2EYSB 3RLOA 5C97A 2ZTDA 5GRUH 2YGQA 2KL6A 1T21B 2Z92B 5D1XE 3C6SB 3M8OL 5HYJD 1BZEA 1G7MA 3QO0A 1LO0H 5HDWA 2IHFA 5FHBL 1IAMA 5E9DB 1NDGB 5AW2B 4BKSC 4F5CE 1BA9A 2C4FU 3VNYA 5GS0H 1XWEA 2IH8A 3FULA 5FAAA 1MFEH 1PZKD 3T1YQ 4NZUL 3DSNA 3EYOB 1QOHA 3NSCA 4U3XA 5D4JA 4UQBA 4H8HA 3BWAA 5HP5A 4GKSB 4JFED 1NBVH 3QJHB 3AACA 3QGVA 4UP8A 4HCIA 4EXPX 3ZL4H 1MCNA 2EY1A 3AB0C 3HZVB 4ZMXA 4L3EB 1DLHA 4S2SA 3DHPA 5DC2A 3ZKMC 1IV8A 4BBSG 1U3NA 3MJ7A 3QUZA 3C6LD 1ZVHA 3QEQE 3SDAB 1DVFD 4WI0A 4A2GA 4OI8A 1X5JA 2ZKWA 5H4YA 3TN0B 3ZDXF 5AVWB 1JCVA 1Q9KA 2Q7NA 3ZHDA 3MMEB 2HFGL 4CDGC 3RZCA 1AO7D 4UM8B 1KJMB 3RUGE 3HBZA 5I19H 2R4RH 4PMFA 4BSWB 4JI0L 2O61B 3GBMH 4PW3A 3GKWH 3FOMB 5CILH 2IMNA 1WCMB 1X5ZA 4YHHQ 1PZ2A 2QTEA 4IRZL 3QEHB 3P0VL 4KKRA 2G9HD 2JJSC 5FGSA 2QSTA 3L16A 5ERWB 3MN8A 1BHGA 4KAQL 5ANMA 2IWEA 4P2QA 5I5RA 2E0PA 3D5OF 1QSZA 5L8LB 3DUSB 1OKEA 1CLVA 1PZBA 5ACZB 4KZ0A 1SEBD 5ELEA 1F4HA 1UKQA 2OJEB 2Q7YA 4LOUC 4U1KA 4WCYL 3VXTB 5I1GL 2BOBB 1W6LA 3V05A 2J6EL 4UTCA 1S7UA 1YA5A 4TSBH 4DVBB 1OXVA 3FQ2A 1TZHA 4NQCD 3VYUA 1FZMB 1UJ3A 1GOZA 3SD5A 5IB4B 3NCXA 2HLAB 3QIUB 3E1ZA 4WW2C 4U68A 5GSRB 4N5ED 5C09A 2VQUA 1PTOF 3MRIB 3RNQB 5IP4A 4APQD 2R0LH 3LCYA 1UA6H 3MLSH 2QGBA 4E9LA 4A7SA 4WTWA 4P75A 5JVG3 3P7JA 2HCCA 4J8QA 1CTMA 3DHQA 3I4NH 1ZWIA 3QZWB 4YDJA 1CTOA 3WY4A 1J1OH 1MLCB 2IQAB 1UFUA 3HNVL 1JK8A 1JYVA 2VLRE 1GUTA 1KD1C 4I13B 3LPOA 3FQUB 1ZK9A 1IL1B 1KNOA 1YEJH 1R3KA 4MX7B 1DP0A 3HG3A 2EIZB 4OCWH 1VIWA 4XAWH 3VB8A 1S7WB 2H1PH 4ZUSB 3IDIB 4QB4A 1E4XH 2BNUB 3GYRA 3IJ7A 1I5FA 5A2CA 1VPOL 2IDFA 3IMUA 4WU7A 3VXME 1CUKA 4KMTL 3G7TA 3OAZK 1IBGH 4KI5E 5KVGE 4WW2B 2DDQL 4P46C 1V05A 4MMXC 5FECB 5I1DA 1NCNA 3CHRA 5D3IB 3QFGA 5DJDA 4CBVA 2E4FA 4LSPH 1S5ED 4RESB 4DO4A 1CVSC 2PPCA 3FT3A 3P77A 4LCUB 4OF8A 4XX5A 4NQVA 4IIZA 1MCWW 3D51A 5C3XA 1PNCA 3L2LA 4TPRL 5E5MB 1VACA 3RVXC 2YPKA 2V7HB 1MFMA 3NTCH 1AQKL 1RZKL 1RP9A 3LHAA 1GYCA 4NXMQ 4L8CA 4GQQA 2MPAL 3A74A 5EQ0A 3EYVB 1CU4H 5DMIH 3S3DB 3V6ZB 3LWEA 3QJOA 2CLRB 4PGZA 4XCEA 4HEPG 3TJEH 1X5LA 3N42B 3A8KE 3LKQB 3OKEA 4GP5B 3C08L 3MRBA 3T8XA 1HOCB 4PG3A 4OGYH 5ALCH 2IIJA 3RA7H 2YXMA 1Y14B 1HOEA 3C09B 3L3KA 1JPEA 4Y19E 3TEXA 5IEKB 1N59A 2V2XB 2VZTA 5F71A 4P23B 1MREH 3T8VA 3UDWC 1QX1A 1SN8A 4F58H 2DQJH 1JK9A 4ICXA 2K70A 3UAEA 1IEAA 1VFAB 3BAKA 2XTIA 4LLWA 3OKKB 1X4ZA 3TH4T 2YUVA 2IPKD 1XT5A 3X13A 5KBLA 3QQ9D 4F7KA 3FN3A 4H88L 3FMGH 4JDZB 5K39A 2MO1A 3L9YA 4DA2A 2DLFL 5D7SH 3N41B 4JGUA 4Z3EA 2OTUB 4YHYB 4XWGL 3RWDA 2XV6B 3FN9A 2O5IC 5L2KB 2HMIC 5EZIL 1Z9PA 1I7TA 5HVGB 4A3DB 1HHVA 4ATTA 3GUTB 3NSWA 4PLKD 1GRWA 1IC5H 1DVSA 2ZCLL 1JZJA 3RTQA 3A23A 2FWOA 1GC1H 3KHOA 1QA9B 1XGPB 4ZDHA 2WQXA 2ZUYA 3L08A 5C1MB 1PY9A 4JPSA 2VITA 4LUOA 4MAYC 1CDGA 4XQQA 4OO1H 4G6AC 1T2JA 4P9HH 5JQ6L 2SEBB 3CSBA 2WBWB 2XN2A 4MN3A 3ILPA 5EULV 3P1HA 1CDYA 3LS4L 2VOTA 3BGFB 2L4OA 4I1RA 4XGZA 5C8JA 2MPVA 5J6GB 4HZ1A 5L6YH 3H9SA 5BRZD 5IJKA 3DWTA 4I5BB 1BIIB 1RODA 2AEQH 1LEGB 3S2AA 3QXDA 5DD3L 4WWKD 3WN6A 1LE9A 4F8LA 3IFTA 3TBWA 1PEZA 1QI4A 3MFFB 4RCOA 2F7OA 1HFGA 2EACA 4LPTA 1QTYT 4Y7OC 2Q2LA 3SHLA 3RPKA 2WXJA 3OMAB 3BIKA 1GVPA 4L8DB 1DQDH 3AFPA 4RKBA 2VDKH 4J3VA 4ZPVB 2MHAA 3O2WL 8CGTA 2WVSA 3QCTH 3OMNB 1DCLA 2Y6SC 1BOGA 5ALCL 1G7LA 3EJQA 3NGBC 3DOSA 5EOTA 4Y89A 2Q8AL 1SY6L 4HCGA 3GEFA 4R7NB 4Z7VA 3LKNB 2IBBA 5FO8B 3ZDXB 5L9DH 4P4KB 2XY1A 5JEAJ 1CBVL 4UTBH 1INEL 4MJIB 2GUOA 4MD5B 1BVSA 2F7QA 2DH2A 1MI5B 3BAYA 3OKYA 4APQB 5FEBA 3NGBB 5AW7B 4GY4A 2AFNA 2XWRA 3V5DB 5F6HI 3IJHA 1L0YA 3S5LA 4J3WA 3WU1A 4Q7DA 3TVMB 2MTAA 2DIEA 4P2YA 1SNOA 3RTLA 2NY0B 4PM1A 1MHCA 4NGHH 2IALB 2Y7SA 5KJRL 3NIDE 4G8FB 2O26U 4WHTA 1WZLA 1QWNA 3ISRA 4HPYL 1BF8A 2ED7A 2MCPH 1LLRD 5E4XA 3H42L 4GW4A 2NNRA 4U6TA 3OV6A 3Q2LA 2W0KA 1IKLA 3SBQA 5JHBA 1V9PA 1I4HA 2E5LQ 1C5CH 4U3SA 3N52A 3BGFC 5KG9A 1P4IL 3UPCA 2FWOB 1BFOA 3J81E 2R9HC 4G1EB 3UL4A 3BFQG 5JQHC 3B2PA 1BDOA 1L1OA 4N28A 3TCLA 1BAFL 4E5XA 3UDGA 5L0QB 4PJXE 1MNNA 1P4BH 4WY7L 1NY4A 1UACL 2DMCA 3TBVB 3NJMA 4V2BA 4YL4A 3N43F 5IIEB 3QUXC 4AGMA 1R3HA 4G6AD 4IIQB 1LP9A 3ZT5A 2B5IB 2HPOA 5JIHA 1PQZB 4DV6Q 3ZZSA 1INEH 3VSUA 4BFGA 2WQ8A 5DD3H 1CXFA 3N44B 1YDPA 3JVFC 3HOWH 5HJBA 3DXAD 2Y7OA 3ERSX 1VFAA 2HIVA 1U4RA 4DXFA 5EN2B 3X1NA 1EJ8A 1JC7A 3BUYA 3EH4B 3IF1A 3I6KB 4KV5F 4K55A 5I1EL 5IB2A 1FNVA 1U4EA 1HILB 5LCVA 1IGTA 2BNRA 3VYTA 1XH0A 1E0BA 2XN1A 2VIRB 4LDCA 3FL7A 4MQ7B 5C07D 5I1CH 1LWJA 1N4XH 2FGZA 4X8JB 2NN6I 3TZVC 5J56B 2PCFA 2Q6WB 4P23C 4JCLA 3EIVA 2UXCQ 4OIKA 1ZLWK 3PO3G 2DY7A 5J5EA 4MS8C 3F7PC 2XNAA 2WJ7A 3WNPA 4CJ1B 4NNXA 4K2KA 1QHPA 4ODXB 5CEYA 3TO4C 2WHVA 2WWNA 5DJ2B 4C83B 1WAAE 2CJTA 3KVDD 3DRQA 3BPOB 4RWYL 2B59A 5SX4H 4GXUM 1R34A 1MFCH 2L8AA 1NSNH 5EU5B 5IB1A 3V4VB 3DX3A 3HAEB 2VDMH 4AT6A 5JHDD 5L2KD 4DOHE 1JICA 3DBXA 5C0RL 4OCYH 3HE7A 3KWWB 5EEZA 4WUUB 3MLWL 5IMKA 5CR1A 5I1DB 3CC5A 3QEUB 4L5FL 3ZO9A 4RFOL 1EBAA 4UB0H 4ZW3A 1HHIA 1B4JH 4XNQA 1IL2A 4UIMA 4F7MB 3KPRB 4CC1A 3JTBA 3A6OA 4DPBX 1OCWL 4H40A 3GI9H 3BSHA 2WP8J 1XCXA 2Y7MA 4MMXB 2LLLA 5DRNB 5LAXA 4JVPA 5C08B 2SEBD 1NDMA 5DFWH 4GLRH 5ESAB 5C0XG 1AKPA 4N0YL 1B3QA 3L13A 3V10A 3ULUC 1FYTD 2DNEA 3TBYB 3BGMA 4PY7A 4DR7Q 5CZRA 3LIZH 1G43A 2F53E 5AYUL 4YDLB 3ATAA 3QUMB 3GZKA 3MXWL 1S5FD 4N9GB 4X3SA 3UG3A 4JUTA 3QZWA 3U4AA 3R8BA 1EMTL 4AXWB 5E6IC 4NIYE 1TY2A 5E7NA 2E8YA 3GMRB 2X4UA 5DYOB 2L1BA 1EJFA 1H6EA 2CNZA 3N1PC 3EVQA 2DMHA 3K72B 2HXAA 1ZK5A 1KBWA 3AS1A 4G6KL 4NZRH 3PFUA 2NT0A 3K6NA 5AOIA 4LK1C 2E7BA 3VA2C 3L3HB 2GY5A 2X2IA 5IB4A 1GKHA 4I7ZC 1AQ8A 1A1NB 3EG9A 4DO5A 4JI4Q 4FG6D 3O9WB 5I28A 1GZQB 3ZDXE 3B7SA 4K15A 2OX5B 2XCMC 4MXQC 4KI5F 1Q90A 2K4KA 1CZ8H 3ZYIA 1LT3D 3WFBH 1AP2A 1EAJA 1F9QA 1EZSA 1AFVL 4P4KD 3QDJA 5CMDA 3AXHA 1XB8A 3KXFB 1WCQA 3TO4B 1NGZA 1RD9D 3L4CA 3SDDA 3TA3C 1I82A 2H2SD 2XPGB 2XN0A 3WN5C 2CA4A 5AW3B 1TCRA 4DGUA 1MW1A 2PNRC 5CZKA 3FUMA 5FLUA 4HOWA 2WVVB 4MCZB 2C4FT 2ZJQA 1W0VA 5EZOH 3X1FA 1QCBD 4C55A 2VDPH 4HMCA 5L2JA 4OJFH 4JZJA 2AQRA 1YEGL 3GM0A 4Z7WB 1JGLH 1H3GA 4NKDA 5DD1L 3ZDYB 5IQ9B 2GBTA 1GOGA 1VENA 1JTPA 2IG2H 4ZW6A 4QYAA 1NCHA 4HGWA 3V0JA 4Y5XB 5I0VA 3WKYA 2DYPD 4L0YA 2YU9B 5DHYB 2VE6B 5KSBE 4NWTH 2FJFA 1VQKA 4QTHB 2RSNA 3ITPA 4NC1E 5KS9A 1QB5D 1HZHH 2VB5A 4HH8A 3R0NA 5E1FA 1B9MA 3PQYB 5JZ7D 1A8JH 5JXEA 1HSAA 2BY3A 3ZE2E 3AB0B 2WV6D 3PHOA 4RBPH 4GBXD 1MI2A 3IYLW 3VJ6A 3MNZA 5GIRB 3ZKMD 2HX7A 1E2VA 2CQAA 3TZUA 3CFBB 2DQFA 4L4VD 2VLLB 3KM2A 2MNUA 3TV3L 1BMZA 3AS3A 4J3OH 1NR2A 4XZUA 3LIZA 3IJSA 1GMIA 3QJFA 3OHMB 5DMGC 2XV0A 3CSTA 2I26N 4YGVB 5DURB 4A7QA 4W4OC 4A7VA 5KNBA 2W65B 4FXKC 4Y0GA 1EA9C 1SQMA 2AV7A 2H1LM 4WV1A 3HC0A 2NTFB 4X4XB 2ATKB 2B2XH 5JUEH 2R93H 4I1PA 3MHZA 2GAZA 2D7TH 4FQJH 3AM8C 3T53B 3L3GB 3QORA 5MHSD 3VXMD 5ABAA 5B8CB 3UC0L 1KCRH 2HVJB 4FQPA 4LWCA 4YSOA 2ZOKB 2D3NA 1Z32X 2KQMA 2LGNA 3SJVA 1UWFA 1I7RA 4JFFA 3GSQA 1LT6D 2ICWI 4JOIC 4B5ZA 4ATWA 1ZHLA 5EU6D 1G7QA 1VCIA 2WLKA 5DS1A 4ERSH 3L4UA 2BSSB 4N2FA 1LO0L 5TJWK 4XRCB 2MIZA 3FU5A 1Z1WA 2ZIDA 4WO4A 4YH6A 5DVMA 5CJQL 4JZOA 1UHVA 3FUHA 1Q0XL 3KDFA 4OLUL 4NZUH 3TOPA 4NAJA 4HWUA 4KRLB 2NNXA 1TT2A 3P4MB 4XNZB 1DR9A 4PJIB 4Y2NA 2DQMA 1YJDC 4HHGA 1JZ8A 5C0CD 3BRDA 2QSCL 5FXCH 2MOVA 4NHCL 4NRYB 5IR1A 3I6LE 2BS9A 4DUXA 3U4EA 1YYCA 5GQBA 3LS5H 3SE4C 3LZLA 3RIAK 4WHCA 3ND9A 3CK0L 4O4YL 2HT3C 3GSXB 1MCKA 3EFXD 4IUVA 4NW2A 2N55A 4S0TD 4NNPH 4M1DL 3BEVB 5DUML 1ZAGA 2KC0A 5IZ7A 5L8JB 2XWTB 4O1NA 1G9NC 4NAMA 2JA8B 2EDJA 3CZNA 4LAJH 1GL4B 4ZO7A 1RZJH 4HX1A 5M3FG 3ZE2F 3BAIA 4Z95L 2ZE0A 3FTGA 2GFBB 3DX9B 1DVTA 3Q24A 3TBYA 4DV2Q 1T0NA 3VXPB 4WNQB 1MJUL 3V2TA 4A3EB 1CIUA 1YCSA 4W9ZA 1ZLWH 4KRPD 2WTPA 2A6ED 2O61A 3KR3L 1ZDSA 4C54A 2XZQH 1XGYH 4JO4H 4X6CF 1PLBA 1OXXK 2DTML 2ZPKL 4K5OA 3A5VA 1S5IL 1E4HA 5TD4A 1BQUA 1QNIA 1IGMH 3TFKC 4CUCA 3LVEA 3O8XA 5F1IB 5KSVB 4IK6A 2H26B 4RAVA 2AQ2B 3SOTA 3HC4H 3LH2L 1DBAL 3LD8C 5TF0A 3N50A 3J80L 2E59A 3EYSL 4F37F 5GRWA 3HAEA 2E2IB 1GY1A 4FFZL 1JWSA 3Q0AA 4A3CH 3J81c 4NNYB 1QPKA 2DN7A 1J87A 4LESA 3RN2A 2E7LA 1MH5B 1SMOA 1BZOA 2MTPA 2AXWA 2ZP9A 1UEMA 5K1NA 5I5JA 1XGRB 3WUWA 2Q3AA 5TE6H 2YAQA 3D33A 4AMKH 2BSED 2GK0A 1D6EC 2ES2A 1ZGLB 7FABL 5NUCA 1XGUB 1V3LA 1ES0A 3QHZL 3K8KA 3HS0B 2ZOWA 1DJSA 2A9DA 4WEBL 5EUKA 1EAPB 4G8EA 2D0OA 2BY0A 2UXDQ 1ZXTA 5BZDA 4IALA 1E8ZA 4MCNA 3FCSB 4R2GD 1UCBH 2A99A 4PR5A 3QWOA 1EGJH 2LOEA 5GISH 3HRZC 3F6LA 3WTYA 4PY8I 1TS4A 2QDWA 4LSPL 5ACZA 1QSFB 3IMTA 4N8UA 2YPVA 2LXJA 4PRPA 4Y4HA 3KVPA 3Q8EA 5LJYH 2FX9H 2HWZL 2GB2A 4HV8B 2DQ6A 2X0WA 4EI5C 2ERJB 4RMSA 4Q58C 5JORB 1ED3A 1MSHA 1FSKC 2GEQA 1BJ1H 5KS9B 3V4UH 5D4QA 3M4QA 1I1AC 2H3XC 4FJZA 1PH7A 1X3GA 4OWXB 1LILA 3F2UA 3DYPA 3HVDA 5IE8A 1JPST 4B3RQ 1FV1B 4JI3Q 3J7YW 3VXPA 2YEZA 3NQKA 1F11B 5C9JB 4HEDA 1ACCA 3DX9A 3K1DA 3KJOA 3ESMA 5D1QD 4CJ0A 1J8HA 1EUUA 2HLEB 3KPRE 3THMH 2FJHA 4UY8C 2PQAB 4XCYA 3NIFF 5DT1L 4S1QL 3GMOA 5GS1B 2JQAA 5BXFB 3GB7B 5J8OA 3IFNL 2P5ED 4NT6B 4H0LC 4TM9A 3SBWA 5EN3A 3US1A 1G1OA 1CE1H 2B0SL 2HLFC 1C7YA 3GTJB 2PTVA 2ZWKA 3GSXA 3A22A 4B0MM 1M71A 4Y1SA 3UYPB 3NIGE 2FZ3B 4A1RA 4FG0A 1SVCP 1LO4H 4D0CA 3MXPA 3U4EB 1C12B 2ZCHH 3MJGX 3L2MA 4GXUN 1VQJA 4C3IG 1HZAA 1G7HB 1UT9A 5F7KC 1L6XA 1FL0A 3MA7B 4WWPA 2BP8B 1A6AA 1HHKA 4W93A 1GKEA 1VQNA 3EH2A 2O72A 1BZ7B 1RUAH 4PV9A 3RAJL 5HVHB 3ZKQD 1UZ8B 4TF4A 1MI5A 1A6WL 1ZE3C 5D71H 2EIMB 4NXKA 4N3TA 1AOHA 3FN0H 2KT6A 2FEDC 4HS8H 5LLIC 3E6HB 4P5TA 2NTTA 3TO2A 1KABA 2C7UB 2A6DB 2HSIA 5IQ7L 4PW4A 2VZ1A 1BOGB 4IN3A 1Y6KR 1NBCA 3RWEB 1MJ8L 1I6HB 3TBSA 4ADIA 3FT9A 3X3MA 3M4PA 3BH9B 3QDME 3F2DA 5IQOA 2F54E 4PJCB 1SF3A 4M7JL 3NPSC 2HWZH 3MRQA 4O02B 2K7QA 5TQ0H 1S78D 2IGLA 3BFWA 4HHAB 1KGYE 3BEWB 3MV8A 1TETL 2UVFA 2D7PA 1IC7L 1KEML 4XC1L 1G1YA 2ATAA 2D5DA 1UQSA 5EPLA 3L95B 2ZXAA 2NY4B 4Y4KB 5GS0L 1HXYD 3NJVA 3S1MB 1N34Q 4HPOH 1XCTA 1RKRA 5FFGA 1AKJA 3TBTA 4YEFA 2VR3A 2VLLA 4NN5C 1XIWB 3AVEA 4WGVB 4ELDA 2PTTA 5IT9c 1MJEA 4GAGH 2H1EA 4JI1L 1MAML 3CN0A 3PJSB 2YPLE 4DVRL 4KROB 1CBVH 4K7PY 4LVHC 4YHML 5I2IB 2D03H 2F19H 3OWEB 4XODA 4FNPA 2F0PA 1DQML 4N1CA 5DZ9A 4JI4L 3PQYA 3E8UL 1FFPB 5C0ND 8FABA 2VXUH 4J3XA 1FN4B 2BOLA 1PG7W 4IUNA 1JPTL 3KWVA 2HDMA 4JHAH 4G8GD 3L1EA 3ZX1A 4ZX3A 1TQUA 3T0EC 3HG4A 5D7IA 1VQPA 1CXIA 2I27N 1OK0A 2XVBA 3VWJB 2QVTA 2OK0L 2NZHA 2XTSA 5CINL 3VSVA 1C0AA 3CF5A 3UZQB 4G7HC 3AQDA 4S1SH 2D2CC 1KYFA 3KDMB 3O3BA 3NCYS 1JRHH 4WSGA 5M94B 4KVPA 3VMNA 2R92G 3SGDH 4WWID 4RWHA 3K2UL 1B9NA 2KCTA 2EZ0C 4MMZC 1T5EA 3O13A 1WZAA 3AWGA 3F6JA 1MXGA 3NVQA 4XC1H 2E2HH 4KUZL 3GJFH 4JBSA 3MV8D 4L4VA 4Y4FB 4F8MA 2H45A 4ZKCB 1F1DA 1GCYA 1V3MA 1XF5A 1YNTF 3DX7A 1AYRA 3MV9A 4WFED 4WTZA 4XXCC 5IJBC 2OTJA 5DHVB 3SSGA 3QDJB 2CLRA 2NT1A 4XCEB 4G9DA 4BE6A 5B3JE 1TZ8A 5EBDA 1AP2B 2CUAA 3VGDA 5IB3B 4Q0XL 2H9GB 4HW6A 2FL5B 4WTXA 5JXED 3RGVB 3WHXB 3DVNB 4YHMH 2JI3A 2D03L 1PJ9A 1U6AL 2IV9A 4CMHB 5SWZA 4IBSA 1ASOA 2V3DA 1HL5A 4G9FB 4M1GL 5GZOD 5CGYD 1MNUH 1S78C 1P84J 1OTCA 2G2RB 1QI5A 2HJFA 2AJZA 4BBRB 3ILQD 1PLCA 3K4DA 3NBHB 1ZDQA 1HEZA 4F1SA 1J9RA 3EW3B 3PWNB 4HPOL 2BFVH 1ZTXL 1GH7A 5BVJB 1FYTA 3BVTA 1DTUA 3TYGH 2AV1A 2M00A 1EHLL 4EAEA 3MRFA 1BG1A 1MHCB 5IGBA 3DX6B 4I88A 3VXOA 1CM9A 3OHXB 1PD6A 4GP8B 3RPIB 4A3EH 2HFFB 1BJMA 1A3RH 1L3WA 3W0WA 3SR1A 5AYQA 1KIRA 1PLGL 3RHWF 4FZ8L 4HIEA 5A7EA 3I9AA 4H8QA 1A9BA 4HIEB 2K5VA 2JA6B 2IPUK 4KZEH 1CN4A 3AREA 3CZFB 2KBNA 3CSPA 4Z23A 1OB0A 1DJZA 4CJ2C 3SB3A 5C0AD 5TDPA 5K59E 5KBNC 5DDHB 3INOA 2AAAA 5COYA 1Q9WA 3BS1A 2YTVA 1OVZA 5I1IH 3HB3D 3PP3K 1UWGH 5JHLL 3S1QH 1P4IH 3QC6X 5DK3A 4LASL 4LOUD 3KLRA 3NZSA 2MQGA 4F5CA 5EC2B 4LNQA 3R19A 3ULVF 1MCEA 4GS7C 4JI0Q 4DR5Q 2HJLB 4LDOB 3MUZ1 2BFGA 4OO1G 1AQMA 2ED9A 4EI6B 2Q20A 2VISB 4YDMA 3RWIB 1S9XB 3NFPB 2NVQB 4WLCA 2W9DH 3D2UD 5KSAC 1YMHA 3UEQA 4PGBB 5I66B 3JWDH 3CU7A 4W9GC 1PVHA 1LTBD 3C5ZC 5E8EA 2ISDA 3QNZB 1TZIB 1UT2A 2X6BA 1M1XB 2OQKA 4N2GA 4FFWD 3VGAC 4BXVA 5F72S 3FP9A 4IDJH 4PGJA 2ARJB 1Z6HA 1P1ZB 1DVFC 1WC7A 3TDQA 3L9AX 1AIFB 1U8OB 2R29A 4HU2A 4OZHF 1HJCA 5E2WH 1A9VA 2XFGB 2PP7A 3JV0A 1HL4A 1UJTA 2FEEL 2M83A 4YSUA 1TWCB 3TCXA 1GYUA 1UA3A 1KN4H 3RIKA 4YC2B 1RZGA 4ZO8A 3TN0A 1IZKA 3QWNA 1AO7A 1BF2A 1M6UA 4G5AA 4FMVA 5T1MB 1S7RB 2FT7A 3E5SA 1N6VA 3LKOA 2LTQB 3VXNA 2L3BA 3SXHA 1A6UL 2FUTA 2GT9A 3TIEB 1EHLH 1A4BA 2K05A 4XX1E 4PG2C 3QUZD 4OZGF 3O3EB 3QJHA 4RGNA 1N33Q 1ET6A 1W72L 1XGZA 3OIQA 1A6TB 2ZAHA 2EIKB 4BBSB 1JQYD 3S35L 3TESA 4NENA 1Y1WB 3TNMA 3D4RA 1N18A 3Q0HA 2WXIA 1MAKA 1TKWB 2VUMB 5I5IA 2XTJD 5I2IA 2JI1A 4TLKA 1W8OA 3RB7A 3SGIA 3AGWA 2UU9Q 3HOXB 2FT6A 4GYBA 1Q81C 1KXHA 3HC3L 4HTHA 1DBKL 4BXXG 4FXGB 5I8KH 4WGKA 4LLUB 4PJFA 1JB3A 4MNOA 1A4KA 5L7XL 1L9NA 5J4MA 1KTLA 4DKAC 4X6DA 1YPZB 5MEPA 3J80E 2BHFA 4TOYL 4H4NA 4OIJA 1UE7A 2VO5A 1NCAL 3S48A 1C5DA 4LPVA 4NXNL 3JTTA 3EFFA 4ODVH 3S5YA 3GHPA 3ESUF 1U2YA 2CLVA 2GHZA 3CVHH 2XXCB 4A3FG 3OZLA 5C6WH 4UDUC 2FX7H 1SHMA 4XOCA 3JWNC 4CNIB 4RMUA 1B4LA 1T6BX 1YITA 4MNHB 1U8IA 3VYSA 1VQ4A 1HNZQ 1PX8A 5FYLL 4QKTA 3UGXA 4A6YA 1EOTA 4NMZA 5M5WH 1AHWB 1XPOA 5JTWA 5HYIA 4U1JB 2IDSA 5GISL 4PJBA 4LF3A 1IZJA 5D14A 2E7CA 2RSOA 4YXLL 1RIVL 3MLXH 5GZOC 3IDJB 3FU9A 1HX0A 1E27B 2QPFA 5I6XC 2ZWZA 2R29H 4NQDA 4ABQA 1E9OB 4PV9B 2V3FA 2XWXA 4B53A 3MFFA 1TSHA 4Q89A 4QXUH 4QQBX 1TJGH 3IPEA 3VFOB 3LTVA 4WO4D 5HD8D 1U2HA 1F1AA 3L4VA 3BT2H 1QG3A 3UE0A 2QZQA 5DUBA 5IVZB 3BRGC 2DJMA 1TITA 5BMFL 3G6AA 1U8JA 3SDXB 2VMEA 5BO1H 3QHTC 1SFDA 3RNQA 3AWFA 2X4OA 3RTQD 3S35H 1V1PB 3GV6A 1I3GH 2E46A 3GSVB 3U2JA 1XB6A 2BOCB 3AXIA 4LCWD 4Y5YC 5EG6C 4PJAB 5D1XB 3IAQA 3ZTNL 1NCTA 4F87A 4LLYA 2DLIA 2E9BA 3PJLA 5EU7E 4JKWA 2YA2A 3HE6B 1VQOA 4ZXBB 1ONQB 5AW0B 4J2XA 2Y72A 4RRPA 4UBDC 2QMKA 3G6JE 1HCFX 5I30L 4DK1A 3QS2A 4MMYA 5CP7B 1JE6A 2JA8H 2RGSA 2VDNL 2YEZB 3Q1SL 4C2MB 4DR4L 1FV1A 4L8SA 1TSRA 4LCIH 3J80i 4PRHE 3NEMA 2XIIA 1D6VL 3MLUL 3ECBB 1F86A 4JDZA 4O2EB 5K5PA 4TVAB 3LY6A 4K9EH 2CLZB 1SLXA 2UUDK 2BIIA 4WWKA 5D2LA 3OQRA 3QUGA 1UB6A 1H9VA 3GO1L 5F93C 3ML8A 4JDEB 4OFKA 1HH9B 5D2NA 3HNTH 2Z8WC 1CL7L 3D2UB 3S36X 3H6MA 1XWVA 2C3HA 4DAYB 4XPBH 3KYNB 4EI6A 3S8GB 3MRLA 4GAAA 1UUNA 4H20L 5CSZA 3O0LA 4G1MA 5EC1B 5EKIA 5FB8B 2IJ0C 3GQFA 3OKEB 3QWOB 3T8XB 2HT4D 1EZVX 2VN3A 3GS7A 1FZKA 1DJXA 2D7TL 2B4CH 3OF6A 5D55A 1UM4L 1VMCA 2QVFB 3EOAB 4X7DC 4R90H 5FX3A 3V4UL 3G3LA 4HKBB 3GSNL 2AEOA 2QSQA 2Z0SA 3DUHA 1AD9B 4PLNC 5IM7B 2YN3A 4H8WL 3O3DA 4X6FB 3V6OA 1WCBA 4NQQA 3PGFH 1KCVH 4Q0FA 1G7MB 5C44G 2YPKB 1MH5A 2HKHL 3OJDA 4HS6A 1KEGL 3N85H 1QAWA 4A2FA 5E6UB 4M3JA 2NX5D 2PZWA 2VL5A 4QCIB 4X98B 3EYSH 2WZAA 4R97C 1ULVA 2VB2X 4K8RC 4KUCD 1KCLA 2C1PB 4UILL 5IYBG 4WW1B 5IHUL 1FI8C 3NP3A 5DSCB 3FRUB 4XPTL 5BN4A 5ADOH 1FFNB 1LL1A 3K7UA 1CICA 2EDRA 4JJHA 2FHTA 4YHPA 1KXLA 3Q7JA 2VERA 4OB5L 3NRPA 4XPGL 5L0QC 3T77B 2A1WL 4GRMA 1E4XI 4M6NH 3O4LE 3WG7B 1VQCA 1RL2A 2EE2A 3QIUD 4UYPA 4AH2A 1ROCA 4NZRL 2EICA 3DO3A 4PJ7F 3LS5L 2OTWB 2PO6C 2VXUL 3V6FA 5HDBB 3RVUD 4ANXA 2KERA 1HIMH 1CGVA 3EGSA 1IT9H 4UB0L 4XVUC 1CD9B 5F9OL 3T5WA 2EDEA 5EEUA 5BVJA 2RIKA 1GSMA 3NJXA 4BH8A 4RZCA 2RBMA 2IV8A 1NUDA 1MHEB 1A0IA 1WFUA 3Q8DA 3LPPA 2BNRE 4G83A 4AGQA 2WV3A 4JE0A 3G5XA 2H0FA 1XPRA 1NCWH 2OMWA 2TSBA 3E9TA 5A3ID 5EJWA 4C3JG 4WI5A 3ZQ9A 3F7QA 2C3XA 1E7UA 5LCVL 4FMKA 2XUWA 1RI8A 4TKWA 3H4FA 2DD8H 3LJ3A 4YHIA 5FA4B 5BJTB 4HSCX 1JNJA 3TFBA 2FWLB 2Y9RT 1TWGB 4GUOA 4XR8C 2VDQH 4KXZH 3MV9E 3UE1A 4ALAL 2D4FA 5T1GA 3G6JB 3F8TA 3U46A 2KLTA 3HOXH 4OY9A 4YR6A 1SYBA 4M7LT 4OJFL 3SN6N 2HFEB 2A74A 3C60B 5ADOL 2D8KA 4IPHA 5ICYA 2O4XA 2DS4A 3MOBL 5DZOA 5M3FH 2XX0A 1CQVA 4WO4B 2R1XB 4OIBA 5LHY1 4BH8B 4XRCA 4WFFE 3FPXA 4AMXA 3CFDB 4UHVA 1Q9KB 2CH8A 2XRQD 1X5AA 3PNWA 5CC4A 4DQOL 5FKPB 4M3HA 4UAOB 4ZMYA 2YXWA 4ZCKA 4LDLB 2YD5A 4ONHB 5DJ6B 4HEME 1QLEB 4DEPC 4ZS6D 4KX9A 4ICWA 1KTDB 3LWUA 2FINB 2K50A 1ITCA 1B2WL 5ENWB 5IBUG 4U2ZA 4XMPL 2DM4A 3VFTB 5F2FA 2ADFL 4HK0A 5IGXL 3MCKA 2E75C 1GXEA 1KYOK 1NCWL 4K7FB 4LUZA 2WNXA 3HE6D 4X4XA 4E0RA 1Z7JA 2FRGP 4IRSA 1AMXA 3A67L 3OWEA 4M6NL 3VWJC 1ZYRD 4KNUA 2IG2L 3R06A 5F9JB 4K7PX 3QO0B 2PQEA 2GJ6B 4JK0D 2F5BL 2WLLA 1IT9L 5F9OH 4CAGA 1HQRB 1NL0H 4PS3A 1LV9A 4DGYH 4QHLA 4FFWC 4HC1A 3RZCD 4QRBA 2XQYG 4HWEL 1KT2B 3CDGA 3B8SA 4HLJA 4R5TA 5CEXB 2X6LA 1NUCA 2QQKL 4E0RB 2DWEA 2Y24A 2Z0UA 3T0EE 1RMFH 1NFIA 1FAIL 2B9AA 3I70A 4Z7OE 2NNAA 1CF8L 4R4BA 1N5YH 1ZLUK 4RHRA 1YPZE 4ZFOA 4CHTB 4G1MB 4RRPG 1DSFL 3OJVC 4AYSA 4GN5A 4X5XB 5CSZB 1F77A 4ONHA 5DJ6A 3RIFF 4BRVA 4DV5Q 5IT2H 1CA6A 2XVGA 4M4RA 4Y1AD 1VQEA 3UIYA 1IFGA 3DPBB 4DKTA 2KCNA 1SBSL 3KPOB 2Z6FA 4WWNA 5AW1B 3UCQA 2R1WA 1ZTMA 4YFLI 2O93L 2WSKA 3ARFD 3IKCA 4TLUA 2SNMA 2QQNL 4YO0A 2DV6A 4QPEA 2V33A 5EF1A 5K9QG 4XNXH 2NNCA 4ZTOH 5GADC 1BZ7A 3GBML 2PW1A 3ARDA 3JVGC 4LNRA 4L37A 3LIZL 5T1IA 5AYUH 5D70L 2XKUA 3PQIA 3OMCA 4MD0A 1EY0A 2XA8H 1ZVSB 4E9VA 4HDIB 5LN4A 1JN6A 4EIBA 1OE1A 1Q4NX 2O5JC 2EQDA 4OCSH 3W1BA 4RGOL 2WNGA 4Z8FL 4I3RL 2OCCB 4RVBA 3WSQH 5AKTA 1NJIC 4PRID 5C0GB 2IDQA 1BQHA 5HGDA 2Q8BH 3GHEL 3OR7A 2CKBA 1FA4A 5GRJH 1R19A 2UU9L 5CM1A 1T89C 1ITBB 5DM63 4PJIE 3DXJC 1V7ML 1N12A 4RZCB 4CC4C 3I3BA 3MUGB 1AMYA 2DAVA 1JN6B 4J1MA 1O9VA 4IDLA 1OZTG 3H9SD 4OVVA 5BRZA 2KZ1B 4O4YH 1JGEB 2DTSA 1FH2A 3IXTB 4CVXA 4JM2A 4P04A 1B2YA 1MWAB 3WMPA 4NXNQ 4TOYH 4HCSA 2WXKA 3KJ4C 3QSKB 2EDGA 4P5KA 3ZXAC 1AD0B 2K3HA 2QHLA 1AN8A 4BY7G 2NQ3A 2X89A 3ESPA 4O51B 1BFTA 2EVGA 1JV2B 1D5IH 5I16B 4N9TA 2BSRA 1HHIB 4MDJA 2A19A 1CGTA 2AKWB 1Z0NA 4Z95H 1HNZL 1F45A 1YN7B 1GGCH 2PXYC 2Q87A 5M5XB 5C0AE 3AC0A 4GKLA 5EZPA 1QUPA 2O6PA 4IOSD 3FFOA 5A2QE 3MRPB 2M9VA 4X9FA 4X5XA 3OTTA 1EY6A 3ROLA 2ERJC 3DPDA 2BH2A 1TF4A 2XQBL 4LHUD 2BWIA 2IF7A 1VGKB 5EUKB 5HHQB 1YNXA 3EYQC 1C5DB 1P7QD 4KFMA 3O3DB 4PWJA 3OB0H 1NAML 5F44A 3WIFB 1HINL 1XZ0A 2VZ3A 1C9SA 3GDCA 2JIXA 3OQ3B 1XZ0B 3BZEA 4JFQB 3IWVA 4ZFFB 4GRWB 3IJSB 3STLA 3DJTA 1YYML 2EDOA 1K8IA 3TMEA 1HZBA 3SJVE 5EEXA 1S7VA 4GW1B 2C3WA 1XXFC 5B1JA 2PZTA 2I0QA 1SXCA 3GHBH 5T3XE 2NSMA 4PI2A 3SK4A 4DHLA 3R06B 1MVFA 1PG7L 3MRPA 5CHNA 1LTXA 2YTYA 5F9JA 3QQ9C 1X9UA 2AJVL 2YKKA 1J0YA 3WEAA 2C26A 3RNKA 1K2DB 1YEFH 4HU8A 4O02H 4IBQA 4F2MA 3IMVA 2XVLA 3MRKB 4O51A 3CFKA 2BY1A 2KYIA 3MFGB 4AW4A 2UY7A 2VC2L 3V9CA 3GO5A 2CRZA 2X9WA 4NFDA 3BYTA 1NMCC 1UOWA 3FMGL 4O2DA 4FXLA 1MCPL 4L8SB 3RFZC 2BSDA 4FTVA 1QYGL 3VXRA 3AT8A 3N40P 3OPZH 3KPSB 2BVUA 4JDTH 4PJHE 5IVNA 1XGQB 3LMJL 5BV7B 3EYUH 5L2JB 2F0OA 5T3ZH 3ARZA 2A6HD 4S3SA 1SFHA 1J1XH 3MNMA 4KKPA 4TV3A 1ZEQX 1KIUB 4HWBL 4K3DH 5DEZA 3PIP3 1BX2B 3ARBB 5I75C 4FKHA 2G75B 4HBCH 4NDXA 2ZCLH 2H2PD 2E27L 3HKFA 1E9PA 2J57A 2O5XH 5JOBA 1ND0A 1S7XB 1PTOB 4NC1C 1WIUA 2COVD 4M56A 4L1DA 4N5EC 1U8QB 4OLZL 4DK3C 3S2DB 5AVTB 4QXGL 1NSNS 3HKSA 3NTKA 1UEAB 1X7SA 2WWKO 1VFOA 2A6KB 3BKYH 4MAUH 1A6UH 1UH4A 2RBLA 4PJ8A 2FB4H 1AZRA 1Z9FA 3D4YA 4XAKE 3RWIA 1IYVA 5DRZB 2IALA 3WO4B 2F53D 2B2WC 3KLHC 3B56A 5DK2A 2YFNA 3B7YA 5AB0A 3E9UA 4JREC 3H3PH 3V5DA 2DIBA 3ICEA 3LH8A 3W2DH 1GUNA 2R2HB 4R90L 1E27A 3VR4A 3B2MA 3V9EA 4XWOD 1JZFA 3TM6A 4RFBA 1I7UA 3ZDYE 3L7FA 2HN7A 3QUMH 2WSDA 1TTRA 4QRTB 1BQHG 2PPEA 3MLRH 1DQVA 3TF4A 3WNOA 4OZFH 3O9WD 5GGRB 3HFMH 4R4IA 4FN0A 4K73A 4G8IB 5AAWA 2W80C 3GJFA 4HSPA 1OWRM 5D1QC 2DWYA 4F15B 5JHDE 5CCKH 2IPTH 4A3JG 15C8H 2PPFA 4EVNA 1PXUA 4EOWH 3P9MA 1J86A 2N7BA 2YPVH 1RZIB 2E27H 3QDMD 4H1LB 4HYTB 5CD3A 2CE6A 5AAMC 2HFFA 1H5BC 2GTWB 2VWEE 4L3CB 4ODBD 3SPIA 4OZIA 2H6UA 1AAJA 1JHKL 4JI3L 1T83C 3VG9C 3WTWA 1LT4D 1XF4B 3JXAA 3H9SB 1QRND 2JELH 2WLIA 2WUBH 5KVEH 2XV3A 2HB0A 4JDTL 3AJ7A 4EPSA 1E3FA 1JTOA 1YVLA 4NXSA 1MQKL 1DJWA 2B1HL 3L3IA 2Z3FA 3I50H 2G5RA 2ATWA 3LRGA 1A7RL 5TE6L 3CX5K 1A66A 2Y3NA 4QY8A 1IGCH 2A6IB 4K5WA 4TUKL 1IVLA 2AQ1B 1ZTXE 2Y69B 4NQTA 5C4JB 1IBKL 5T33L 4N5UA 3TNMB 2GUYA 2H9GA 4NENB 1OPGL 1WA1X 4CMMA 3MCKB 4M7LL 1I7TB 2NDFA 3MACL 1HJBC 5EKLA 4GBXB 1JDAA 2XKNA 3TN2A 4X8JA 3SE8L 2WVTA 3PO2G 2XQ0A 4QHKJ 4NO0A 4WNJA 1E5BA 1ENCA 3WWVA 1AZCA 1E6OL 5JHMA 1Y69U 2PW5A 1Q0EA 5DFAA 3R2TA 4LFBL 4M8UA 2F19L 3RU8L 3RZWA 1SJHB 4F2FA 1IGJA 4N24A 2VJ8A 4JZJB 4ZQ3A 4L4TA 2PR4L 4I9WD 2NVTH 4MJJA 4MYPA 4ZMLA 5TDOA 5IGEA 3GD7A 3STBA 3V4VL 1HRJA 5TDOB 1D1IA 2VW4A 3UTZB 2AJSH 4H02A 4ZBJA 2AI0H 3QZBA 5M3MH 1GUOA 1B3JA 3O2DA 4WKZA 3UZQA 1HXMA 2WCPA 4G7OC 4DV3L 4JRYB 3APNA 3TURA 4QY7A 4NS0A 5MENA 2XXFA 4XWOC 4ZRGA 2RHSB 3HKZE 1OIOA 1ZT1A 4ULLA 1MG3C 3SPGA 1NQBA 1FH5H 3A0OA 1VHPA 2J1YA 2EEAA 4D94A 5L4IA 2OX5A 3ZZ1A 2PWGA 4U1MB 3O9WA 5F0JB 3IS0X 1XVSA 2A6IA 3E2HC 1MHPL 3LN4A 2SODB 3IDNA 1PYSB 2NY1C 3GSUB 1PH3A 2BDNH 3D4GA 1AXTH 1O6TA 1WS7A 3K72A 4OR1A 5I23A 4D0DA 3AT0A 2B15A 2HT3D 3PHQB 1CUOA 3S3PA 2P28B 4GSDL 5BUAA 5LWYL 1I1CA 3LGJA 2VN7A 4ZQKA 2X6CA 3FW6A 1GW0A 5J6HB 1LTGD 4A3FH 3U4VA 1E0OB 4J3TA 1FNGB 4Y1AE 4OX9L 1L0YB 3QJQB 5FCUH 4FQHB 1VEPA 2WKOA 5L2KE 2I7OA 3WEMA 4AV4A 4GRLA 2R56H 5HDQH 5KN5A 1VKXA 2YD8A 2J56A 1ZLSL 1PKQE 4BV1A 1V1OA 3NK9A 2FEDD 5D5MA 3RGHA 4PJCA 4YDLC 1IUZA 3RJOA 2ID5A 2CMRL 3KPRA 1FVCA 1FFNA 3TJHC 3VXQA 3MXUA 5E99L 4DV5L 3RLSA 3I72A 1CFSA 2QHRH 3RY6A 2H3NB 3GSNA 2ZXDA 1T1XA 3K0XA 3E6HA 3HE7B 3KJ6L 3KWWA 2MCAA 1U8IB 2VL5B 4JJOA 2V1CC 5JW3H 3VXRD 2A2QT 2X4QA 1U8CB 1TVHA 2Y5EA 2OZ4A 3O6LH 1AGEB 3FT4B 4DR1L 1U4FA 3VGHA 4FJ6A 2WIIA 1IIIA 3BUTA 3QHFL 4M1CD 3V7AG 5F89B 2VSDA 5GGTA 2Z4IA 4KKNA 4AQYL 2OAAA 3HOZB 4QGYA 3DETC 4I5BA 5E2UH 5J6GA 4AE1A 3V8CA 2J4WL 1QSEE 1IEBB 1NAMB 4LVNC 4HJAA 1Z5YD 4QRRE 4PLJD 3DXAE 2X2HA 1IAKB 2EVHA 1EHXA 4I2XA 1WHOA 4KU1A 4BWUA 1ID5I 1JZDC 2D73A 1KLUD 3G5VB 4NO2A 1IBML 4ORGB 5JMOC 2CPCA 4FL4C 4UTBL 1S2EA 2H32B 2NY6D 3AU1B 1EEID 2NB0A 3C1FA 3PIPA 5M5WB 1NLDH 1O5DT 5SWQA 5GS1A 5C0BE 3WY2A 5D2NB 4PGCB 3BXNB 2XGTA 1SRDA 1RHFA 2K4AA 3L4TA 4HCRA 4DAGH 4G11A 2SNSA 4CJ0B 3T3PE 2F54A 5K36H 3VD3A 2CLZA 3KF6B 2QHRL 3ND8A 3C12A 4DGYL 3VA7A 5DD5H 3JWOH 3MKKA 1LXMA 3RI5K 3VXUD 2VDPB 4QMGA 3CZUB 5CJOH 2EYRB 4NEHB 3FB5A 5A40E 5AZEL 3BSGA 1XTDA 3L7EA 3QUKB 3V0DA 1IC0A 2R7EB 3T13A 3ETBF 4DUZQ 4LLAA 2QBWA 1L1OB 4ZUWA 5KUMA 5I0WA 3G08A 1U58A 1WD9A 1XBDA 3ULLA 3MOBH 1CF8H 3K6IA 1PF3A 3OF6D 4N0CD 3U0TA 2QF7A 1I6HH 2C1OB 1T2QH 4DGVH 2CKZB 3I7FA 1G7PB 1OAXH 4M8RA 3VM5A 4MCMA 3SZKC 2F0IA 4FF4A 3HI6H 4EN3C 3AFQA 1YBYA 2BNRD 4AYBA 5FM4A 5D7IF 2LAGB 5AOMA 5E8EB 5CV5A 1IAKA 4DW2H 2QQLL 5T5NG 4ZAKA 1UM6H 5DQJB 1WP6A 2ITCB 5DUBB 4YGAB 1SOKA 1TFPA 1BOYA 2ICEA 1FO0B 5D1ZD 2ZKHL 4EXKA 1N0LB 2NYZD 1LD9B 1MDAA 3OG4B 3CE1A 2DWDA 3ILEA 1EFQA 3QHFH 1ASPA 4G7VH 4Y1TA 3ARGA 2JKJA 5SV3A 4XVTH 1S4ZA 1FP5A 3I02A 3RPBA 4DESA 2RQ8A 1IKNC 5F96H 1FGVL 4FQXD 4RETB 3ULVL 3BH9A 1QNKA 2X6UA 3GXIA 4NWUL 3TVMC 2O4EA 1TYJA 4HIOA 1QRNE 3KJ4B 4M9PA 4DUVA 3ARRA 1DVZA 1WYDA 2OI9B 2C7UA 1I50B 1UGNA 3S9DB 3UAAA 4CRPA 3F12A 3WFCL 3HBQA 4DP7X 2NY1D 5LCVH 1T5KA 3NRFA 2DL2A 5DLLA 5KVMC 3MQIA 4UTAA 2JA9A 2XTLA 3RKPA 5BO1L 3I56A 5DC0A 4MKMA 3G6DL 4OM1L 3IXTA 1OAQH 2B3GA 2H0PA 2P1YA 1SXAA 5M5YH 2Q1EA 3JTTB 4KKLC 3VCLA 4IGBA 1F90H 3ETTA 1ET7A 1CHPD 4TL4A 3KLLA 4B9KC 2OPCA 3GJEA 4ZX4A 1WVLA 3MRJA 1B1ZA 4NI3A 2YRPA 2BNQD 4OM0L 4Z7VF 3P9WB 1OF0A 4KO7A 3UTPD 3ZIMA 4OD2B 3NQTA 1UM6L 2IWHA 1ZPLA 3CMOL 3OR6B 4C3JH 5IHZB 1NC4D 3H0GH 2ALYB 1K3IA 2EO9A 3M88A 2AQTA 4OZFG 2AJZB 4PH8A 3ULSA 2Y5QA 1LK3H 1PDQA 1KULA 4MZ9A 3CK0H 2ZONA 1NGWA 2P7TB 1U8PA 4PRAA 5L4JA 1E9PB 3OAUL 5JVH3 1NC2B 4ZMWA 2ZOOA 1KXTA 2R8SL 4EVOA 3IETB 3QIWD 4OXPA 2HVBA 2G5DA 2C3VA 3GT6A 3BD3A 3QRLA 3VRIA 2B1AL 1CC3A 4IRJD 2ID0A 2LV4A 4K3EH 2SDFA 3CVCA 5I1KL 4PMCA 1F3RB 1L7IL 2NY4D 4FQXA 4PVNA 3SQBA 4GUQA 3VXRB 1ZHBB 2XZZA 3OZ9H 4LCYA 1XF5B 1FO0H 4XPBL 2F52A 2CAKA 3RWJA 4AM0Q 5AVUB 1BMGA 1CO1A 5TDNB 3DEOA 3V0HA 3KDFB 1S7RA 1XIWD 3CVDA 3PIQB 2Z1KA 4QUFA 4CN1A 3U1PA 4HJGB 3FZUC 4L3EE 4KROD 1Q1BA 3M6DA 3IGFA 5KYNA 1PFSA 1E42A 4HV8A 2FK9A 2E76C 4KFZC 3KDMA 3UPRA 1NCDL 3CUPA 4OGZA 3CQZH 2I9TA 2XIDA 3VD4A 4KKBD 3L1OH 1KGCD 4AVJA 2EUXA 4WJWA 3MUUA 4HMDA 2D9CA 3GTPH 4G8GB 5CV7A 2JSFA 2YGVA 3SE6A 4WRDA 5CUSH 1YEDA 4M6MH 1KDCA 1F97A 2XBDA 3O4OC 3MLTB 4OQTH 4OJEH 5IMMA 2OW6A 3V6ZA 4DUWA 1HEJC 2PNHA 4MHEA 1H19A 3W1ZA 1X5FA 5DHVH 2LW3A 5C2BL 5JA9A 1SDDA 4DP8X 3QFJB 3C09C 3SE0A 4ZUUA 5HHME 5CEXA 4CDEC 3NJJA 1MUJB 3VRLF 4U6XA 3WNIA 2YPVL 2O5ZL 2WLNA 5KYXA 1MCWM 2W5PA 2VDOB 1PY4A 5EPKA 4G7ZC 1SYDA 1SLJA 2VUMG 2BE5C 3T4AA 5AOJA 4AZUA 4A93G 3Q43A 4NQVB 4JAMA 3HOXG 3O3AA 3QVAA 3AY4A 4IBTA 3HOZH 1FD7D 5DD6B 4DP0X 2WLIB 3QDJD 3I4NB 4IK7A 1PSKH 4AL8H 3CHPA 1YEEL 4F7TB 5INDB 4H1LA 3VFTA 5GS0D 4GG6A 1ORSB 4OLZH 4G42B 5C3IA 4A04A 5JDSB 1WD0A 3CBRA 4Y5XA 3U9OA 3F65A 4PRHA 1ODAA 2R1YB 2EYOA 4XMKH 3PL6C 5ID0B 3VDYA 4TNWF 3ABLB 2DJSA 3Q2VA 1GVIA 4PJFF 5F2DA 1CHQD 1W3SA 3CLWA 1RJTA 2VLKA 4R96B 5FUOL 4EIGB 4E68A 2J72A 3C60C 3VFWA 3TO2B 1TJHH 2JJSA 4J6HA 2B63H 4KDWA 1SJVA 4LKCB 2VLKD 2XWTA 1QFWL 2YD6A 1Y1VG 2DY8A 4FGMA 3X11B 4F80A 1CQKA 2AEQL 1DM0B 2UZXB 2Q8IB 2EYTB 1J9CT 3B9KD 1WD8A 2R2HA 4WO0A 5DMKA 3OR7B 1ZV2A 1JJUA 4JDVB 2CKNA 2DM3A 1IU1A 2A6HC 1RK1A 3NJFA 4RWYH 1RJLB 1IM3A 3EJJX 4GO8A 1MF2H 2YZ1A 3P3SA 4IOFC 4D8PA 1TWHB 2CK2A 2OSXA 4XXWC 2YIHA 1JP5A 5K9KB 1RZJC 5EPMB 4P2OC 3QCTL 2R93B 5F7HA 1N6QH 3PWLB 4HT1L 3ZL2A 5IV2A 3DX7B 3MJ9A 2J8OA 2WBJB 2E3VA 3L3HA 4OLXH 5FK9C 4ZD3L 1MRCL 4NYLB 1XEUA 4JFPA 4W9IC 4NT6A 2YXFA 12E8L 1B70B 1UD4A 3QB7C 3S1NB 4F7CA 1I8MA 5KRUA 2Z8VC 5IQLA 1ZSDB 3QUYC 2FJHB 1XPUA 1Q3LA 4IW4C 4FHBD 2NR6C 2ODIA 3K81A 1C7TA 4DV3Q 4ANUA 3UX9B 3WTVA 3NZHL 3SDAA 2DKSA 4TMPA 3KPSA 5C4HA 1CMOA 3MZTA 4FFYL 4QUCA 3BZKA 1QACA 3WNLA 5BPPA 4UQ9A 5FGBA 5IWLC 3QJTB 1K0RA 4NM4H 2VN6A 2W91A 3K6OA 2HUEA 3HN3A 3A7AB 2D31B 2APSA 2V0AA 1NC2D 3FO2B 5F21B 5B8CA 3LPGA 3VWKB 2W9LA 4AQ8A 5BW7C 3L3GA 3QORB 1VQ9A 2OR8A 3BZ5A 1TEGA 3E9HA 4M7LH 3SIKA 2VC2B 4NRXA 1JPSL 3RNKB 1OCZB 1GMEA 3FRUA 4IRJB 5AEAA 1YIJA 2LHAA 1AXIB 1OQXA 1SDYA 4H1LH 5E9DA 3QJFB 3JC66 2EJGC 5E03A 1L9QA 3ZBMA 3SPVA 4F7PA 3S88H 4OLYL 3HOVG 4PJEA 5H37H 4PTUB 2HT4C 1QQDB 4DERA 5GHWH 3ELAT 1QFWM 1UEYA 1T7WA 1LP9F 5I0DA 2OMVA 2YMTA 4L5FE 2B59B 4U0QB 3WE1A 1YQVH 4C4UA 4LF4Q 5IMLB 1EQQA 1XCTB 5KSBF 3MRNB 2DKUA 1JNLL 3PF5A 1B50A 2KENA 5C4XB 1A14H 4LPXA 3PHOB 4N0RA 4ODXA 4OX9Q 4ZUUB 1JF5A 5GGVL 4IRJA 2ZUQB 2AMCB 4FCHA 4YPGB 4LMQD 5HGHA 3IWUA 2DTMH 2ZPKH 1RIUL 4EZMA 4JFXA 3D12B 1F9RA 4GFXA 3UDWA 1A4JA 3WFHA 2XTJB 5DJYA 4POGA 1BGXL 2VE6A 3KPNA 3B2UC 1RKNA 4A66A 3H6JA 1MLBA 4YLCA 2FLMA 1P2CA 2Y06L 4RAHA 3U6RB 4BK8A 1N6QL 2OMXA 1QUQA 2B8GA 1KNEA 1T4KA 4NM4L 4RAVB 2OP4H 3IF1B 3QFJD 5FKPA 4J3UA 4H7BA 4GOPA 2V7NA 1OP5H 3VO0A 1JRHL 3TH3T 2EY5A 1T6WA 1QKZH 1YNKL 1OGAA 2CRYA 2HP4A 3OVUB 4QF1B 5CO1A 3WMSA 2FSDA 3LV3A 3O6FB 3EROA 2BZDA 2J1WA 3BH8A 3JV4B 2ITDA 4MCZA 1RUPL 5CMAB 4XXEA 2QVIA 5C0DB 4QI3A 3HE6C 1OGPA 3ZHNA 3CMGA 2BMKB 3I91A 2ZX7A 3ABZA 4HH9A 5IT2L 4P2RD 2EIEA 5EORH 2J8UB 1SNCA 2F0GA 1HXYA 1QNZL 3EAKA 4YS4A 1SMYD 2F3VA 3ZN6A 3LYRA 3VMPA 1H6FA 2VR6A 3G9AB 3P3UA 1EWHA 2B1OA 5BJTA 2G60H 5AALA 4LF8L 4RDBA 1AR1C 5B7EA 3BP5B 3JUYA 4DZBB 3QJVB 3ZHLA 4H2AA 2ICWA 3MRGA 1F6LL 4A3KH 1U8PB 2ZWNA 5C0BB 4LF5L 3H7BA 2QDLA 1V1PA 5I6NA 1BEYL 3F5WA 3HS8A 4XQNA 2ZWSA 3S1RH 1MELA 2FQEA 4G6FD 1DVQA 3D87B 1CG9A 2XA8L 3TT1L 3HLKA 3F7YA 1SUJA 5DQ9A 2ENJA 5F88A 3J81L 2BCKB 3REVA 4OCSL 4AXWA 2AJYL 3JV5A 2OSLB 4LLDA 5ESQA 4DU9A 4OTXL 5T3XH 3UAJC 3WDNA 3MREB 2VKWA 2GTZB 2VLKB 3NTIA 5CXPA 2WLJA 1STGA 4JI7Q 4MD0B 3RLFA 2L12A 5TFSH 4C4BA 4IQHA 2J1KA 4C3HB 2Y25A 5G5DB 4MZRA 2C5DC 1NDMB 4JI6L 1J0ZA 4N2CA 2E6PA 5L6YL 5E4WC 2GQHA 4RGMB 3SEBA 1RUPH 4PW9A 5I8EB 4GT7A 1OLZA 4ZNCD 3BH8B 2QTVA 1RP8A 4YHPB 3DTXB 1WCMH 4G7RB 4PJ8D 1CBJA 2B8FA 3TP8A 3PP3H 3QG6B 4IEFA 1Y0LB 3K71B 1H3PL 4PB0H 3RVVC 2OMXB 4O5LL 3IK2A 1I1AD 3BW9A 4MBOA 4Z9CB 2WM0A 3V79C 1UENA 5BCAA 2K5QA 4A3DH 5EOQH 1MFEL 5IKCB 1MCJA 1KLFA 1KDJA 3BLKA 1URZA 1UURA 2X05A 3EUUA 1MJ7H 3OKOB 3APCA 3FRPB 5CEZL 2X9YA 1II3A 5E5RB 3QA3B 5A16A 5ANME 3S3JA 1XGYL 4N85A 2K75A 3LIUA 4ABUA 2FLBT 1IC1A 4B3ML 5C70A 3WUWB 3EOAA 4BFIA 2F5BH 2GIMA 4GXVH 3I73A 2D0HA 4XPFH 4XOEA 2OMVB 4ZT1A 4F33B 2XQBH 1BOSA 4PJ9B 4PLKC 2AEIT 4ZAKD 5C3EH 4UNTA 1MCLA 3FK3A 4CU8A 5EC1A 5AFAA 4PJCF 2Q3XA 3SDYH 3VWKD 1UM5L 4K8IA 5J22A 1PHJA 1QA9A 1XGPA 1OXTA 1EJOL 2VM3A 3I4MG 2AQ2A 4DAYA 1QBMH 5JJIA 4M7ZB 5DS2A 1T03H 2GBUA 3O8XB 4FNLH 1O7IA 4X6AH 2F8OA 3G08B 2BINA 2ZUTA 1RFDL 2LQRA 4WTQA 4ZYKB 1QW9A 1RZ7L 3W9DA 4PB9L 1KELL 2CKBH 2MKLC 3G6EA 1Q72L 1TWCH 4M43H 1KHIA 2W95A 1R3HB 4JLRA 4GO9A 3WDIA 3UTTD 1QBLL 1FC1A 4ONGL 2GJRA 4IU3B 3H9SE 1YEFL 2FFKB 3PNWB 4F57H 1YYLL 4LLWB 3NZ8B 1BD2B 2WB1E 1CQFA 1ML0A 3AT9A 1W0VB 2BJML 2X2JA 3C8DA 1G94A 3ORJA 3UIZA 4QRSA 4HMIA 1GXDC 1JGUH 1TYEB 4EUPH 1KBVA 1ET8A 2HAZA 2QPDB 1EU4A 2V2WA 3EBHA 4RMQA 1JFQH 5IP9H 4TQPA 4UQAA 4AEFA 3BZDA 3L3KB 3ILQC 2GW5A 3TO4A 4F9PC 2CDGB 1BF5A 1L5GA 1A6XA 1RZFL 3MTSA 4HLZG 5DA0B 1YEJL 5EPMA 3IBEA 3RL2A 4QOKE 4XAWL 2VISA 4M6AA 5IP7H 3IN0A 1U92A 4JREB 3RY4A 4XCFL 5LGJA 4HOZA 4XO3A 1JVOA 2B20A 3P4MA 4FQ2L 1ANUA 2JTDA 4X6CB 1U8HB 4L3FA 5BS0B 1ZY9A 1U8CA 4YLBA 3ZRFC 1ICTA 1A3TA 1EIYB 1X7TA 1FAKT 3MJ6A 4A38A 4LFHG 1Q0XH 1SMYC 1QTPA 5KNCA 4M61B 4X0KA 5ICXB 5FECA 5IOPA 3DOSB 4U7KA 2E2JH 3UTSA 1WBXA 2BM3A 3QIBA 4PLJC 3VRLE 3VSTA 4KHPL 1UM5H 3JV6A 1JBJA 4P2QD 3L3OC 4PCYA 3BVZA 5IODA 5IROC 3MROA 5I1JL 4QHMB 5FFLA 5E2UL 4I18C 1ORSA 3IFPB 1W8NA 5HI3D 1U95B 2C35B 1CE1L 1PDKA 1UD3A 1EQWA 2Y0SG 2B0SH 1YEEH 3A54A 2VMJA 3EFFB 2Z35B 3H1ZA 4FQCL 3MBEC 4M62H 3RFZB 1LO5A 3R3OA 1TO5A 4BY7B 1Q72H 1QR4A 1MLCA 2IQAA 2XZCH 3BP4A 3DMMC 4MA7L 1LLAA 2WXQA 2L9HA 1A7OL 4YGVA 4HIQA 3WFZA 3BDYL 3TEZA 3CXFA 1BFSA 4NQSA 4IZ8A 4EZLA 2HMID 4KPHL 2OWOA 1MZYA 4CN6A 1ZVYA 2JKRM 4NUJB 1RPUA 2MQHA 4GLVB 2G2RA 1OEZW 3I9IA 4FS0A 2LVEA 2JE6I 4TXVB 1JHTA 3GTLH 1MFAH 1O9WA 4C83A 4R8WL 2CDEA 3V0GA 4U6XB 4JY4B 3KBXA 4N2EA 2WP3T 3QYCA 5D7JA 4QXTB 4YK4B 1NINA 3SDDC 3TA3A 3WHXA 5ALBH 5D9SA 1E2ZA 4ILDA 2KLRA 4OVUA 2OYLA 4G9DB 2UZPA 2A77L 5I2YA 2FJFB 3U58A 3L4YA 1Y1WH 1K9MC 3FO1B 5DHYA 2XFXB 5C4JH 4GKNB 3LH2H 3QAQA 4ACPA 3BVGA 2VDNH 3VXMA 4IQZA 1TENA 4J6RL 3SK8A 4H25B 1GS7A 3GRBA 4DP2X 5I1JH 4Z7WA 3GV3A 3KGRA 4UNVA 3SO3C 2XPZA 3LEXA 1OAUH 2X6AA 3VU1A 1TNNA 2MWCA 3BQUD 1AE6H 3HHMA 4PGDB 3CKIB 2I07A 4JFOA 1C5BH 1IEAB 4X7EC 2EC9U 2X1OA 5EIIG 5LL6S 1UASA 1FFOB 2GIXA 4BFBD 3EJYD 1J1PL 3W3AA 3S17B 3PIQA 1IW7D 1G9NH 2AF2A 2ED6A 2PP8A 5EO1B 3PUWA 3ZGHA 3RVXD 3SDDB 1LP9B 3RWCB 3E80A 3G5YB 4ONFH 4PG9A 3QO1A 4KPHH 4Y2OB 3HTLX 2Y6TE 2XKNB 4NQUA 2P43B 3QG1A 1AHMA 3LNHA 2XRAH 1PRTB 1EHAA 1SFOB 3BDCA 4LQFH 1S9XA 3NFPA 4Y19B 2OK0H 2F0LA 1QLEH 1FL3B 3GI9L 4HOXA 1LTRD 4YIJA 4NWTL 4UQEA 3II2A 4IUUA 4PCTA 4U3SB 3SHSA 4NWUH 4BZ1H 2P48B 4L5RC 1SZNA 1EY7A 2RDHA 1PH9A 4WV1C 2F3WA 3GP7A 3J80c 5HJ3A 4A55A 2BDOA 3AM8A 1OY3B 3QORC 1EYDA 3MJ8B 2GJZA 1R9TB 3H3VC 3K4AA 3T2NL 2H3NA 3GSNB 4PWKA 3GJEB 2Z8LA 3PDGA 1HTPA 3V7MA 4PVMA 3TXAA 5JPNB 3IJHB 1EXGA 2QEJA 2X2YA 3SYPA 5IJVA 2E9JA 4LL1A 5IW1A 5FKAB 3IFPA 3FQ1A 5TPWH 4OZIE 4FTVE 5B7MA 3N5AA 4YSTA 4KUZH 3WGVB 1KIRB 1BBWA 1RUML 2GIYA 4GQZA 3CMOH 4MA3A 4KKLD 2O6DA 3U1QA 2GJJA 1WBXB 2Q9OA 4XOAA 4YIQA 5GRUL 5ITFA 5DI8B 5LHDA 4WI3A 2J2ZA 5HDBF 2BA1A 2YU9H 2GSIA 1H9KA 3KK7A 3MO1B 4BY1H 3LNIA 3SO5A 3WCYA 5EKKA 1XX9C 4LCCA 1W0WA 1WRFA 4DN4M 5GS2H 1AGBB 4FTVD 3V8OA 3J7ZC 1C5BL 2HLAA 3NRQA 2MFNA 2P8LB 1FZMA 2K9FB 3TBWB 4XMUA 2F08A 3ZTDC 43CAB 2NXYB 5C71A 2P5WE 1KBBA 2BA0A 3PMFA 3NESA 3DVNA 4IHOB 1X9NA 5DM73 2HDLA 4EQOA 2D7OA 2H2PC 2EVIA 4WJG3 5LG6A 1IBHA 1WIOA 2ZP0T 4N0YH 1BNZA 4X3TA 2KDYA 1IW7C 5ICZA 1BV8A 3CVHA 3I50L 3ZUCA 3CFJA 1D1KA 4PV1C 4NBZB 4LQFL 4N8X1 1O7YA 1K5NA 2WLYA 4GIPD 4Q9RL 1VQ6A 2ESVE 2RALA 4XP9L 1NGXA 3FTZA 4OELB 5DWPA 1UC6A 3WEXB 1JMXA 2C9QA 1SYEA 3CVIL 4U3HA 3U0TB 4QRSB 5DHXB 4EGVA 1F0LA 4P74A 1TWFB 1JPGB 4FLHA 1R9FA 4BFFA 3IRCA 5JHDA 1G91A 1S3OA 5FLXL 3OKNB 4HXAH 4PJGF 5JEAG 3UBXG 1IM9B 3UBHA 3H2QA 1T5XB 4JPVL 4YBLC 2FQDA 5B1BB 1BM3L 2J7ZA 3O8XC 3EJRA 3D0AA 2YTXA 4JO3L 1XNRQ 1KRTA 5CZXC 1NLDL 1SOSA 2F54B 4PJCE 4CU7A 3X12B 4P72A 1ASYA 2VLJB 3UROR 4GAGL 2BS71 4XZ4A 4N20A 3NEOA 4ZFZA 1AP0A 2B4CC 5K9OB 1O9ZA 3GMPA 3UC0H 3TEWA 2GITB 4BUGA 2E7LC 4L5TA 3AU1A 5E2WL 1ZPUA 2R92B 3SYCA 1PL3A 1OXSC 4LF5Q 1QSFA 3MZ5A 1WAEA 2UUDH 4ZS7L 1EVTC 4LCWE 3BD4A 5CJOL 1UATA 1T21A 2H0EA 1O7ZA 4DV1Q 1UH2A 3M1CA 3MRBB 3V6OE 5I15L 1KJVA 1IAII 4M48L 2KQ3A 3SE9H 5DD1H 4O5LH 4ACTA 4BHUI 5DZPA 4DN3H 5B38A 5EDSA 1K5WA 1K8OA 3ARYA 1X6OA 3ATEA 3DJRA 3P30L 2PYFA 4DR5L 4MNQB 2GK0B 2CCLA 2Y7NA 1ZGLA 4DZ8B 4Z78A 1YY9C 4ZMTA 3KLQA 3D30A 4ADGA 1P5UB 2P8PB 1W2BA 3NSXA 3HOWG 1P16A 4PJAF 1XGTB 2V37A 3MI6A 4QO1A 4KOCA 1NUNB 2X4QB 1AR2A 3UBFA 1Y7VA 3CQQA 3PUCA 5A3IC 4LCUA 4K94C 5CR3A 2UWEF 2CD0A 2WXFA 5GGTH 1S9VB 5DJ0A 4ZSOA 3PLYA 3P3RA 1YNTA 3UADA 1MCCA 2PWEA 5A2AA 1I7ZA 1YMME 1J1OL 1ZLVK 2WPGA 2JCCE 4LGRB 3NCJH 3S24A 3J7A5 3V0VB 4A67A 3CFTA 5JLZA 4G43B 3PCOB 2HTLC 3V7AE 2F15A 4E9TA 5CGYC 2AHOB 3CW2C 2Q2IA 4M03A 4PJEF 1BPVA 2BNUA 4BQCA 3BIKB 4OFIA 1XD0A 4ETQB 5LDSA 2VUOA 4G57A 3WKNA 4FQHA 2AQ3B 5I2XA 1F42A 1LEKB 2KMWA 2P8MA 1C7SA 4KV5E 4UOJA 2EE3A 4ME5A 3CCLA 1EFXA 1HCVA 3MA7A 3SDCA 5EWIH 3LRSA 2H4OA 5KS9E 3CH8A 3SGEI 3U79A 4PJBF 2C4XA 1STBA 2WQRA 3Q3GA 1K8DA 1EZ6A 4XGZB 1UH3A 2OSLA 4LLDB 4GQ9L 1OCOB 5E2JA 3PXLA 4HP5A 4LB8A 4P2OD 3WIIH 1U8QA 3S97C 4OZHB 2JJWA 1IX2A 1WUZA 1C08B 1G7IB 1JPFB 1JSYA 4P0DA 2IH1A 5C0BA 1IGML 4F2EA 2FJGA 1JZGA 4YXLH 1CGSL 5KTEH 3H94A 2DWSA 3LHPH 3ATFA 4RGOS 4PN6A 2BY2A 2YUWA 4K23H 1GGBL 4U1MA 1ZGLP 5DR5H 4KHXL 1K8GA 1RERA 4LHQB 1V7NL 3JWDC 2FATL 1TJGL 1QNZH 3O6FC 3S96A 4JHUA 1E8YA 2WZ5A 4RQQA 5AVZB 3EO1B 2NLJA 4H13C 3R4RA 1MFBL 4UQ3A 4XP4L 3NT0A 1JPSH 3BYTB 1U8LA 1J0IA 3D52A 4JANA 3PWVB 4HIIB 3UH8A 4M6ML 1IKMA 1BMWA 5GPRA 4LK4A 2Z8RA 3OKKA 3PY9A 5E2TH 4DR2Q 2E47A 3BDBA 5DJAA 3SE3C 3BJLA 2BIHA 4L4TB 2B9BA 2DQCH 4MCYA 3LRMA 4OCXH 1IAIL 4NJAH 3QUZB 4QHKI 1JHLH 1T7VA 3IDGA 3MCLH 3GI8H 5F1NA 4JHWH 2ZUQC 5K59F 4ILWA 5DO8A 1ZLEA 4LBAA 4JL2A 3KPNB 3FQXB 1IIKA 1I8AA 2NW3B 5D7JD 5AWNL 1KG0B 2DYPB 5AVSB 2VXTH 5C6TH 3KBGA 1K0SA 1M7XA 1X5HA 2NTFA 3CNKA 5GZNA 3GS0A 3ZYYX 2D62A 1C8CA 4S1RL 4XPAL 2WQVA 2ZYSA 4Y2DB 1VGKA 4LRIC 1BXUA 1T5XD 1KBKA 5KVGL 3CHQA 4OIAA 1OB1A 1NGPH 1WT5A 3OAYK 4FRWA 2DQFB 4X5WA 2VSKB 1FNHA 3L3JA 1JXGA 3TBTB 5EUOB 1BJ8A 4X5QA 2GJ6A 1AJ7H 1J8HE 3RTQC 3BZFA 3HJ0A 4BH7A 1MD2D 3WS6A 3GTPB 3T3PB 1MJJA 1M2VB 2I9LB 4PJDF 3EDFA 4IRSB 1ZMYA 1YN7A 2RQXA 2ICES 2VH5L 4OSUH 3GTOH 3UYOD 3VQ1C 3FH7A 2EIDA 1HUNA 3KPPB 2ZJRA 4XVTL 4KMTH 2JTYA 3QO2A 1F41A 3ISWA 4AIZA 5I6MA 1T7YA 4A3KB 1G6PA 5ENWA 3JWNH 2J21A 5FDWB 4OCRL 1HH6A 4PJGB 3BDLA 3OW2A 4A3LH 4KNQA 3RZCC 1AEXA 3KPMA 4JJ5A 1BWMA 3RIFK 3BE1L 1T0NB 4HPYH 2WD0A 4PWEA 4FL4B 1OF2B 3BQVA 5AD0B 4ORZC 1H15B 4U6YB 1DJHA 2VAAA 4X7FC 1IFHL 4XP4H 1CXKA 4KK9C 5ICXA 4DFAA 1RUAL 4L8BA 4GKJQ 4U1NB 2FVNA 2UX7A 4IOFD 3BKML 3HR5B 4Q6KA 3WLWD