2ICEC

Crig bound to c3c
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
307
structure length
296
Chain Sequence
TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Complement C3 beta chain
publication title Structure of C3b in complex with CRIg gives insights into regulation of complement activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 296
sequence length 307
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2iceC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2iceC01
3CU7A 2J0TD 3CKIB 4ILWA 1BUVT 1GXDC 2B39A 1EDYA 1UAPA 3FRPB 1BQQT 2QKIC 2A74C 1XWEA 1JB3A 3L3OC 1BR9A 1AYOA 5FO9B 5JPMC 4FXGC 2WINB 4LNVA 5JPNC 2TMPA 1UEAB 3KLSA 3OHXC 1JC7A 2A73B 5FOBB 3HRZC 1OO9B 2ICEC 3I70A 3G6JB 2I07B 2XWBB 2WIIB 1D2BA 4FXKC 4D94A 2XWJB 2E2DC 5FO8B 2PN5A 3V96A 3HS0C 3MA2B 1BV8A 1PXUA 3T4AC 5FO7B
chains in the Genus database with same CATH superfamily
4Q9QL 5CP7B 1EOTA 2VSMB 2N56A 1EIGA 3G6AA 2FL5A 2XWEA 4IRJB 3QDGE 4MGXA 3NIDE 4ZYSA 1AQDB 4K3DL 3FT3A 5L9DH 5B7MA 3G04B 3HOXG 4XX1G 5A6LA 4JFZL 4HS6A 4WK4B 4AEIL 2CHXA 2VDPB 1GAFH 3F64A 2WXJA 1HCVA 1XGPA 3MODL 4JO1L 3WNMA 1ZV5A 1KN2L 4ZMTA 5C6PB 1SBBB 1DANT 1SYSA 1T83A 1AIFB 1E5BA 1O0VA 4CRPA 1HNWQ 1JBJA 1X5FA 2SEBB 1YMHA 3GSOA 1B53A 5HYSB 2Z4TA 3NBNA 1LEIA 1L6XA 2WQUA 2E2DC 4QI3A 1YY8B 4JPBW 1WISA 1ENCA 5KYUA 1GOGA 5E2TL 5DLLA 5DSCA 4XAWL 1G87A 4JLRB 4MQXC 3SQBB 1KBGH 1T2JA 1LE9B 2EYJA 3QQDB 2DDQH 2MEJB 1A6ZA 4A75A 3WUWG 3KGUA 3GBNH 2O5YL 1YNLL 5EAYA 2K45A 1S9YA 2GW5A 1MHCB 1J05B 3TZVC 4P2OB 3Q43A 2GJ6D 1NMFA 2P5WD 2JLLA 2F58L 3C60C 1EQTA 3CBKB 2YZ1A 3BP7A 4PS3A 4I8DA 5I75B 3X14A 1D5XA 2I60L 4NZRL 1ITBB 2ZKHH 3BW9A 1IGMH 5ADOH 2AK1L 1WAPA 3TO2A 2VJ0A 3AC0A 3T3MB 2EXYD 1BQKA 4PG9A 1H0DA 2FO4B 1PZ5A 1HFGA 3ERSX 3RBGA 4HAKA 4ZAKA 4X64L 5KJ4A 5INDA 3KCPB 3F3HA 5ACZB 1N6QH 3GSNL 3KPNB 2V9UA 4XPGL 3LRHA 3NAAH 3MBED 2OTUA 3CHBD 2JA7G 2JKWA 4I2XA 3MRPA 2PMZA 5IB5B 2DQGH 2ZXRA 4U1IB 4C83B 1XDTT 2YK1L 1I8MA 5HGBA 4MXQC 3PAYA 1P5VA 2EIJB 4M43H 2FHTA 2XOTA 3SDAC 3TZVB 2J7ZA 4P46C 3DYMA 3C60B 4IIZA 3EJRA 5E00B 3S34H 1JP5A 3QJRB 2XXGA 4JI8L 1UEYA 1JOIA 5IJVA 4J15A 2C9UA 3T6XA 5HVHC 5C6TL 5CM1A 4B08A 2PYEA 1HZHH 2DQIL 3UPRA 2AVFA 3B9VA 2X2JA 2CKBL 5IHZA 4QRRE 1DJWA 1U8LB 1BHGA 4K7PH 3Q8DA 1FFRA 1QFWH 2A4EA 4QXWA 5DJ0A 5DGRA 5JHBA 5L2KB 1VKXA 2QGQA 2H3NA 3EYQD 5KVMC 1OAKL 4EKJA 3EVQA 4K14A 1OO9B 2IBBA 4X6DA 1FNWA 2DTML 1BIIA 1DN0A 1I82A 3IDNB 1CKOA 1MPAH 3GZOA 4OO1H 5JDSA 3SDAB 3ARSA 4PJAA 1DJHA 4XPTH 1TJHH 1FP5A 2Y2TA 2AEQL 3M1BA 4PRHA 4CJ1B 3MXVH 1DL7H 3F01A 1C1EL 2IQAA 1I7ZB 5IV2B 5A6IA 5JYMA 4NKMA 5HVHB 2KHSA 1L7IL 4XCCL 2H5UA 4DP9X 3U9OA 4ICWA 2VDLB 5E6SB 5DMYA 4P9ML 3CHOA 4K3EH 4NJAH 3OAUH 3EXJA 4GP5B 4I3RL 4YXHH 1PIFA 1A3LH 5IVOA 3QFJA 1RZKC 1Z32X 5F7WC 4X6CA 1R5IA 1M1XA 5AOZA 4A3DG 1BPLB 2E8ZA 3E6ZX 1UWEL 4OI8A 4IMKA 2P24B 1U8QA 4ENED 4B3SQ 4KJPD 1I1AD 3BSZL 2Z34A 1TFPA 2MO1A 1QHQA 3S3PA 1HPCA 3NWSA 4MN3A 3JXAA 3VI4F 4ZPVA 5GRJH 3GSWA 3N1GC 4U33A 2AC0A 1W72B 1PH5A 5GADC 1E9QA 1TKWA 1AXSA 1K8GA 2BDNL 5KNBA 1OE2A 2K4WA 4RMBA 3EOAA 5HYIA 1IBKL 1FN4A 4NP9A 1KFAL 1YAIA 4MTKA 4JC0A 4FI6A 4HH9B 4LL4A 1X3PA 2QV4A 3M4YA 2H2PC 4WKZA 4XCFH 4DF7A 1IVLA 3FU3A 5FM4A 1YHPA 1U95A 3K5SA 4JV5L 4C4KT 1NFIA 3OGOE 4OF6A 5EV7A 4C1NI 4KJQD 5D7IB 3W0WE 4AL8L 4FGMA 3BZ4A 5FHAL 3ZLQC 4OIBA 1ZSDA 3GLEA 3QXAA 2JIXB 3MRBB 1MLCA 3D4ZA 1JFHA 2JI1A 2LXJA 1MY7A 2Z1PA 5EFIB 4G8GE 1LO4L 5KSAC 1E6OH 5L2JB 4W9CC 3M4PA 3NE5B 2Z31A 3HC4L 4WDIA 1F90L 2PZWA 3U1PA 2V5YA 3GRWA 2D5DA 3QR2A 4MNQA 2EIZB 4X7SL 2ZX6A 4FZ8H 4ORGB 5EZLB 1B90A 1OAZL 1JZ6A 1E4XH 2D0GA 1DJIA 3KM2A 3PIO3 2B1OA 5HGAA 4YHHL 4G4KA 3WU1A 2GK0B 4RWYH 2XWBA 4EN3D 2VDMB 3GXTA 1BD2E 2W8CA 3NACL 4R7LA 2NBFA 5FDYA 1JPSH 2X70A 3U0PB 3K2UH 5EDXA 4MHHI 4PY7B 3ARTA 3QULA 1ZLWK 4AGQA 3FKUS 4LRNH 2VXSL 4YHKH 5AKRA 4GG6B 3GTOH 4OTXH 5KSAB 4QD2E 1G6ZA 3CQZB 2CNYA 4GEJA 1UEAB 5D1XB 1LQBC 1B9MA 2EIFA 1NTDA 1SQMA 3K80A 1HFNA 2XKNB 3SDDA 5ISZD 2VDOL 3BXNA 1A1NA 3AXHA 1A4JA 3HN5A 1YEGL 4JFTA 1TZIB 1YCSA 4JE0A 1BPVA 3G5VB 4XVSH 2YRPA 1ZVHA 5J39A 1DJGA 3Q22A 1I8KB 4JEGB 1HHGB 2TAAA 2R69H 3MRIB 4B3ML 1BNZA 5J3HC 2AJSH 3T1WA 1RU9H 1JPST 3OJVC 1PH9A 1GHKA 3Q8CA 2NY5L 3H91A 5FYLE 1ZLDA 2VIRA 2OMVB 3RX9A 2LR4A 5ABDE 4AEFA 1RKNA 3KOJA 2AMUA 4XP5H 2AK4E 2F8VA 4ONHB 3VA5A 1JZEA 4ULLA 4Y7NH 4PRIE 4L3EE 5TE7H 1FH5H 2NR6A 3T1YL 1A21A 3GLAA 4KMQA 3C2PA 3OKDA 3BJLA 1V3JA 4AK1A 5FO7A 5F7FA 3QEQB 1BCPC 2BW4A 3LWUA 1EZSA 3UABA 1HXYB 3KL5A 3I9AA 4JQXC 2WTRA 2IPUG 1C5CH 2X4UB 2XTJE 1HHIA 3SGDI 1R24B 4PQXA 3EYQC 2N55A 4X6AH 3RN2A 4N0UE 3L4CA 1F4XL 2ZUUA 1J5OH 2VQUA 4NBXB 5DURD 3UAJA 4H88L 1YEIL 1AW7A 4OZIA 4LBEB 3AS1A 3FSAA 4QJ4B 4CADB 1NUFA 1TQSA 4D7BA 1WA0X 4KLKA 3SKUD 5IW6B 1CDCA 5F9OH 4GUPB 4ODSH 4Y1AA 4EIUA 3DUZA 3GYRA 4MD0B 5I6YA 4X7DC 2BIHA 1OGAE 4FP8H 5DT1L 2VZAA 4AQYL 1JK9A 1MJ8H 4Y4HD 4BSWB 2QMKA 3UTQA 1T2QH 3Q6GL 1BCPB 4GSDL 5CEZL 5K69A 1J88A 5JQIB 5TDPB 2K8MA 4TOYL 1VQDA 3VFNB 3RDTB 1F8TH 4J5VA 2FX8L 4GN4B 4ANVA 1Z9SB 1CTNA 1DQDH 3HG1A 4XNUH 3RL2B 3WO4C 5K9JL 2G75B 4Y5YA 2PUQT 3QJZA 5BQDA 4A3KG 1I1AC 4J7RA 3FCUB 1HN1A 1RZ7H 2BFVL 3HOWH 1N0XL 4U6TA 5K36H 2OSLA 1GSKA 1K9MC 1QWHA 3O4LD 1D9KC 4NUQA 3DX3A 5FIEA 5C7XH 4BHUA 5IMLA 4JFPA 3QEGL 1GJWA 3CLFH 2WNGA 1VQCA 2BNQD 2I24N 5F2DA 3BFQG 4HJTA 3ZE1B 4FF9A 1KJ2B 2C1PB 4KHTH 4AZ8B 2GC7C 2E9WA 4K5XA 1SMDA 3HKZE 3IFDA 4OZFB 1XCTA 2WMPB 4LIQL 5KBKA 3TF4A 4KJQC 4S0TD 4G43B 1WDAA 4U1KB 1YQ2A 4OGXL 5CLXA 5EIVA 3KPLA 3EJTA 3VYOA 4JB9H 1UVQA 1ESOA 5DJ6A 2CO7B 1OAYH 1AHWA 3DUUA 4NX0A 5AWNH 5AAMC 4NQCE 2LFGA 3ARXA 3WNIA 4YHZL 3FYEB 3AQDA 1D9KB 3MHZA 4RFOH 5DZ9A 2VO8A 4KO9A 4CN1A 5B1KA 5J11C 3KMDA 3BYTB 5IY5B 1I3GL 5IT2L 3VWJA 1JUFB 1KRSA 3NSXA 3LEXA 1SEBD 2NVTH 2V5TA 4FQXD 3PWPD 1F2XK 3PGFL 2EE0A 4LZKA 1OVZA 1CXEA 1MSHA 1E4KA 2XPZA 1EERB 1HIML 3EO9L 2Q2LA 4YGVB 3D9AH 4OGYL 4IK7A 2CO4A 5D7SH 5KZCD 4OZHA 1O7DC 4FFTA 4B9XA 3VQ1C 3JAME 2G5UA 4L1DA 1U8IA 2JXMA 2R0WL 3PUXA 3U7WL 2GBAA 1IL1A 1STYA 1CLZH 2JKLA 2LGNA 3QDGD 4M7KL 4QT5A 3TA3D 4XMTA 2J5LC 3P0VH 1JHKL 1HA6A 2BP8B 4KI0A 2NZHA 4KKRA 4OV5A 1ZS8A 1FL3A 5KVDH 1U0LA 1I4GA 1LLRD 4KHPL 5INCB 1ONLA 4LFCQ 4IIQC 1STAA 3GTPH 3G5XA 4LP4A 4YAQB 1CL7H 3O2DA 5CSBA 3L2MA 3GDEA 2JSFA 5EWIL 2XC8A 1G9MC 1VF7A 4PJ8A 3R7QA 1ZGLB 4A3JH 3D30A 2EYSB 3AABA 2QVMA 2VZTA 1IV8A 1N7ML 4J3SA 1FGVH 3NRPA 2BX5A 2VR8A 3KGTA 2C3HA 3A3YB 4LLUB 3VH8A 4CN4A 4DXFA 1JPTL 1S5DD 2E2HB 3GXDA 2HKAA 4HSCX 5I17A 1DQKA 4H1LA 2MTPA 1QO3A 4FQJL 2FINB 3DX6A 5A7EA 2R9HC 1KFGA 3H9HB 2FECL 2QV2A 5H4ZA 3MC0A 5FFLA 2I27N 2QQNL 2D0OA 4IIQB 5FYKU 3L7FB 1UKSA 3NIGE 1QI4A 4Z3JA 4H8UA 4O02A 4F2MA 1OCWL 2YD5A 4X4MA 5K9QG 5IT9E 4PWIA 1H8NA 2J71A 2WAHA 5DK2A 5KSVA 1Q38A 1V55B 3F1ZA 4IBUA 1PZDA 1V5JA 3DURA 4Z8FL 1R5VA 1GPOH 1EZVY 5F8RC 3V0IA 4J4PA 3NQTA 1A65A 4QHUB 1RJLA 3Q6SA 2A77H 5FCUH 5K93A 2E75C 2N7BA 1S2EA 2ADGA 2TSBA 3QZNA 1BBJA 4U6HA 4GI9A 3AU7A 3GMMA 4A3GG 4TRPL 4BRVA 4WJWA 1S7SA 5E8PA 5C3EG 5D5ME 4DPRA 5I0XA 1QASA 1HZBA 4MXWH 3P4MB 5JMRA 3ILEA 1NCCL 4DP5X 3FHEA 5BXFB 4PJBB 1UXSB 2H4OA 1UWYA 1ZT1A 1YDPB 1W2KT 4YCUA 2W9DH 5JORB 2MSPA 4KKBD 2FIKA 1AGDB 1IL8A 5KGUA 3A8IE 1MW0A 4LLWA 4OI7A 3S2CA 2IWEA 1AD9B 3DVNB 4KTDH 5KG9B 3V10A 5JJZA 4U6XA 3BT2H 1Q81C 1D5ZB 5IY0A 5D6DA 5IREA 4B7IA 1FSKC 4HS8H 4PZ7A 1A7NH 3ILDA 3KPSE 4NOFA 1JXJA 4PJIA 5I66A 5IWAQ 4ZBJA 4J3BA 1BVKA 4IOSA 5G2NA 3GNMH 1LK2B 5C0RL 3MWYW 4Z0BH 3WLWD 2Q8TA 1PMRA 2YMXH 1L9NA 2H3XC 2ZCHL 4P74A 3X1GA 3S88H 4NW2A 2J5WA 4BY7H 5ICXA 5DR5L 5BV7H 5DJCB 3EO0A 2AQ3B 3GRWL 1MRCH 4UT7L 3SQOH 4G1MB 3MKGA 2IAAC 2WQVA 2ZKWA 3QQ9C 5E3FA 4Z7OF 4PSPA 2KBGA 3CW2C 2AXJA 3VRJA 1M56B 1PH6A 4FXLA 3HOZH 1TQTA 1WBZA 1Y1UA 1GUTA 1YECH 4PGBA 4TUOA 2EC8A 1FNAA 3SHLA 1YA5A 2HVBA 4LCUA 1Z1WA 4MAUL 4UV7H 4FI7A 4XP9L 1RMFL 1UGKA 2CGRL 5BPPA 1VJSA 3LS4L 3GPEA 2JEAI 2J7LA 1FSKB 4F2FA 4L4VE 4JM0A 2JCCA 3C09B 4NXNQ 2GABA 1T9HA 4ZTPL 2ZPKH 5T5NF 4OZGE 2Y7LA 6FABH 1JYVA 4LL1A 3GMPB 3U9PL 2DIJA 4BZ1A 3PS6A 3UZEC 4HUVB 1VEMA 4CVWA 4FQQB 2XXFA 3KR3H 2VW4A 3LPOA 3T6WA 1T89C 3OMIB 3NJJA 1JDDA 3UO1L 1SNCA 1NCAH 1IEBB 4FQXC 3V7AE 4BQ6A 2ICIA 3AWFA 3LPWA 4OBRA 3H9SD 1ACXA 1CMOA 2CRMA 3GUTA 4Q2ZB 5CD3A 4X62L 4XT1C 3VQMA 3ZZQA 4KXCA 1E2VA 2XETA 4JK0D 4YWGL 1X4ZA 4BFIB 4K3JL 4GRWB 1V1PB 4LCWD 3O45A 1MCCA 5MP6H 4NQQA 4WO4D 4Z3FA 3ZDXF 4LSDA 3MAWA 1N0LB 1UWFA 5H1SE 3BWUF 5C9JA 3AB9A 1WI5A 5IYCH 4BY1H 3ARFD 3O8XB 3PGCB 4FQHA 2R2HA 4EEEA 2KDYA 3UDGA 1B44D 1A7BA 1K5NA 5AG8A 4CILA 4EQNA 1CT8B 2Y06L 3BKCL 2CFMA 4G8GD 1KNOA 3WS6C 2EIKB 4LF7L 2W07B 5DUPL 4L05A 4B9FA 3CZEA 2KT6A 1KLUA 1KTJA 1FIGH 2GJRA 3MA7B 4JBKA 5ADPL 3GSVA 5HHME 3T2NL 3DMUA 1T5WB 4XT1B 3EGXA 3UYPB 3VFTA 4ELMF 3I6KA 1J1OH 5D8JH 5J22A 1B3QA 1LO2H 3VXOA 2VB3X 3BVGA 1FO0B 1R3KA 1WITA 4XBEL 4RHRA 3VXMB 1ZT7A 2CIKB 1II3A 1JPGA 2H0JA 4FTVB 4ZO8A 4Z7NE 3S1QB 4TNVF 1IXRA 2YPKA 3AM8A 2ROYA 3ZQWA 4PRAB 1K2DA 1Y18A 3QUZA 4G71B 3I84A 3D3VD 3NIDB 1A4KA 4AW7A 1SJED 1FUNA 5F7HA 2DY8A 1ACYH 1HHKA 5CXPA 5HHPB 4OT1L 3U6XA 2NXZB 4Q9BA 5EUOA 4DTGH 4CGYB 5FWRA 5CR1A 3BU2A 2IMNA 1PYBA 3IFPA 4LGRB 5C0BE 2HKHH 1UKQA 4JPQA 3ECQA 2GFBB 3BPOB 4OKDA 2EDEA 2M9VA 5EPLA 3IXAB 1XGUA 3GTVA 5EZIL 4MA1C 3TEZA 3ULLA 5E8EA 5EORL 1JNJA 2OP4L 3RPIB 5JW3H 1PKQE 2F6AA 5MEQA 1IBGH 5KVEL 2Q10A 2W60B 4R3SB 4D0DA 2CWRA 3SD5A 2CHNA 2R1WB 2WV3A 4L4TA 4RMQA 2ZYHA 3IAPA 3GS7A 3VRIA 1FVCA 1KABA 3QXUA 3R1GL 2J12B 4Z7UF 1JOKA 2DICA 3MOBL 4XN1A 1BBWA 1Q82C 3KS0J 3A55A 3QK0A 3TNMB 5FYLD 3WNPA 5BZDA 3GMQA 4GMTL 1NSNS 3VGAC 2HX7A 4AV5A 4WFHD 3F5WA 3U4KA 3PU7A 3MLUL 5L9DL 4MTNA 1XZWA 2YMTA 2ZX9A 3C8KA 1MFBL 2YIHA 1ZE3C 3DVGB 1NKGA 4LCIL 1FZKA 1JTPA 2NY7H 1CSPA 4KKBC 3HNTL 3ILPA 4FULA 2XY2A 4YO0B 5C71A 1HTPA 2EY1A 1T1YA 4C58B 1UOLA 2NMSA 4AH2A 1MJEA 2DEWX 3OKLB 5JOBA 5IESL 2BE5D 1MIML 5DMKA 3SE8L 2XTJD 1XGTB 2WLKA 3SK8A 43CAB 2C3GA 5LJYH 2XU9A 1VFAB 5ILTL 6TAAA 3K46A 4BGLA 4WW2F 1TFHA 1KT2A 2XSCA 1FV1B 5CNHA 5BQ7A 2E59A 3VFVA 3NTKA 2EO7A 3WGVB 1EJ8A 4Z3HA 1NINA 1N18A 1HI6A 3HRZC 1Y1WH 3S8FB 4A2FA 1VQMA 4MJIE 3EYFA 4JBSA 5HYQA 3ILQD 4EQ5A 5E2UL 5TGBA 2DS4A 1OGAD 4WTZA 3CK0L 4CHTB 3ROLA 3B34A 4LF8Q 2CR6A 3J80c 4PJ7F 4GBXA 3LZQA 4PCTA 1QATA 5D72H 2AJVL 4LF6L 4QRRB 5I16B 1UURA 1XCQB 1IZJA 2ODIA 1MH5B 3S6CA 4FFWC 3D2UD 5D4HA 1BF4A 2UZPA 4PRPA 5EPKA 1FH2A 1FC1A 2VL5B 1M7IA 8CGTA 2WAQA 4D8PA 3QIWA 2YD8A 1BQRA 2BS9A 5CYUA 3ZVVA 1U8NA 5JA8B 4TNVK 5EIQA 3KE0A 3O2DL 4U4BA 4J8QA 4LEOB 1GTNA 4AENA 5ELBA 3FQXB 2W0LA 2WLJA 2YSSB 2W9EL 4Y2OB 2WUBL 4PJHB 1E50A 3NPPA 1X32A 1GC1H 2JI3A 1M71B 2HXAA 2ZJSL 2ZUSA 5DVMA 1UT9A 4N0YH 2DM3A 4RBPK 1OHQA 1S5HA 3ZTCC 5DYOB 1BOYA 3O2VH 5JW4Q 3MTXA 2KHJA 1I1FA 3HPJA 2OK0L 4UV4H 1E67A 4JQIH 4UQAA 5B21A 4NQCD 3AT9A 1OW0A 3RI5F 4WJ4A 3SDYL 4YFLF 5E56A 3HS9A 1XX8A 4KX7A 2WBJB 1U8JA 4NCDA 2XN2A 2UUDK 3CSPA 1HVXA 2F0QA 5M3FG 2IADB 1ET5A 3LRMA 4OM0L 3UTSB 3KYKL 3N1QC 1FVIA 5FYJL 2EYRB 3AZUA 4B96A 2B63B 2H2SD 5IP7H 4A3CG 4UTBA 3QPXL 3W0WB 1QR4A 4HJAA 1LT4D 2HUHA 2YUXA 4KBPA 3EJZC 3QWOB 1WJJA 3FEWX 1A3VA 1JWUB 4JJ5A 1OXYA 1MCBA 4YCVA 2QLYA 2I9LB 1KCSH 5J6SA 2IHEA 2MO0A 1GGTA 2WBWB 3FUEA 3NJKA 4FS0A 5B3JE 5BUPA 1G9HA 3S2DB 1IL2A 1P4BL 3T1FA 2Q2IA 3G5YA 4MHEA 5I2IA 3EHBB 3CN3A 2V2XA 1VIWA 4HS3A 3QYCA 1HQRD 1U6AL 4N85A 4OGAC 3VFUB 5CU5A 1ZJAA 2BCMA 4ONGH 4YR6B 5SV3A 4E9RA 3IDJA 2C4XA 3TO4A 1P7HL 1YBYA 2APTA 4BWGB 2F53A 1ETJA 2X3CA 3L81A 3QJSB 1BD2B 2WLLA 3CXDH 3M07A 4JY4B 3RWIA 2BXYA 4KFMA 1AQKH 3ROOB 4OCSL 2H8PB 3W3AA 2FB4L 4IKLA 4F5CE 2A2QT 4P23A 1SM3L 2F54D 4NB7A 5KYNA 3QNXA 2JKIS 1S7VB 1I9JL 4ZUJA 3ATAA 3BCDA 3BP4A 2VQFQ 4HIXH 4D3CH 5IBLD 3NZHL 4JO4H 1IFRA 3IU4H 4M61A 3S96B 4N28A 3STBA 3EXLA 3U6RA 2ZTDA 2CRYA 4FABL 1PVHA 4TSBL 4WORA 2NSQA 2B4CH 4DGIH 3GUFA 4Y9CA 3LZRA 1K83B 4PJFF 2EIBA 4JPVH 2BE5C 1JAEA 2Q1EA 1A6XA 2EYLA 2XTJC 1I8IB 1MJ7H 4LWCA 2FECI 2WVVB 3HLKA 5GS2D 5GISL 3RD4A 3GTJB 3PO2B 3QUKA 3T0AA 3TBVB 4UQ3B 3FO2A 2Y0SG 4IUTA 2Y7QA 2HT2D 4HCRA 1SYVB 2XNAC 4KUZH 5DC4B 3WJMB 4YSOA 4Q9QH 1VZGA 1WH0A 3Q0AA 3FRPB 4LSVL 2LTQC 4BZ1L 4EOWL 1DVFC 4UYQA 4AQZA 4PREA 1STEA 4UP7A 1SNMA 2FGWL 1BOGA 1WVLA 4UUJA 4XN2A 4DW2L 4KN7C 3X13A 2OTLA 2AK4B 4PRIB 5AW0B 1S4ZA 4PG2C 4A7VA 4JFZH 2FH8A 3ARGA 3QJTB 3ILQC 4L3EB 4PJEA 3M4QA 2ID5A 1HXKA 3G5ZA 3QZWB 3VYPA 3MODH 3A22A 4JO1H 1S9XA 3UJTL 3N0AA 4M1CC 3PHSA 3FO9B 5E0QA 2F0VA 4YHLL 1K4CB 3D34A 3MOAL 4WUKH 1Q9KB 2VDLH 3H3PL 1EPFA 3H3BC 2YAHA 4LNRA 4S1SH 3IWUA 3HS0A 4LU5H 2V4LA 1PG7X 3BUIA 3EZJB 5JR1L 3PGZA 3MNWA 4U0RC 5I8CB 4N0UB 2CK0H 5DD3L 4JYAL 1GCFA 4AVKA 1AG6A 1P1VA 1RQ5A 3NN8B 3AVEA 5BZXA 3GBEA 4ZKCB 1MSGA 5J0BA 2IBGA 2E4TA 1I7UB 2LTQB 2WUCH 4AC2A 1DVFB 3IF1B 1VACB 4MDIA 2LFEA 3HOYB 4G70B 4LNVA 2L55A 3KD4A 1FBIL 3F2BA 1YNLH 2KZBA 4IMLB 5GGSY 5HDLA 2A9BA 2OPCA 3EBIA 3LEYH 3M8OL 4E42B 4YFEA 4YDJA 5F9DC 2F58H 5F1NB 5C0XG 3V0WH 4BH8A 2Y9RT 2GUOB 2D3VA 5J12B 2I60H 1NGQH 2GVYA 3HE6A 5HD8D 2DM7A 2ZUXA 4AXWB 3STLB 4DGWC 2K5WA 1QCBD 3LS5H 7CGTA 1KTKE 2GTWB 2G30A 1JGVH 2Q6WA 1ZHBA 4E9XA 3VX0A 2CGZA 1OGSA 3VYTA 1TU2A 2WINA 3I9GL 4L4VD 1RK0A 1J9OA 2DZEA 3NJMA 4HCGA 4PUBL 1DR9A 1F4HA 4W9FC 3NDYE 4YPGB 1QW9A 2OCEA 1CICA 2HX8A 3FUJA 4ZXBD 2L12A 4GN5A 4BFFA 1Z3GH 2BY3A 1BZ9A 5JQ6L 5CV8A 2GY7B 1IKLA 5E5MB 1ZVYA 3EYOA 4DGUA 3B6SA 4JFEA 1G1YA 4Q74A 3HKZB 2VXVL 4FAAB 5C6TH 1V3LA 5JW4N 3A7AB 1E3ZA 4ODXB 4QY8A 4NQUA 5I1DB 3NHHA 1XR8B 1MCPL 2EEDA 4E0RA 3MJGX 3PL6D 1VCAA 1HOCA 3U2SA 5DD6B 4Y5XC 3BAEH 3DJTA 3MVSA 5IZ7A 4LF5Q 2NYZD 5KN5B 1XXDC 1WC7B 1GZQA 3D0LA 4XVTH 1BYNA 4NUJB 4YNYB 3O3AA 4N8VB 2Z7WA 1NBYA 4A3IB 5HPMA 3O9WA 5DYFA 4F2EA 4MKMA 2DTMH 3KUPA 3VGHA 3IAQA 5HGTA 3OKOA 4JFOA 3FP9A 3S14H 3UAEA 1MUJB 4LSTH 5GS1A 3B7SA 1BF8A 1FNSH 3CUPB 3HE7B 3SPVB 1ADQA 4ODWA 1GGUA 4DKFL 4MFHA 4LKCB 2CK2A 2Q20A 2RFXA 3B4NA 5BMFL 4PGJA 5CAYB 4XMWA 1GUGA 1NMAH 4XCCH 3FBQA 1RULL 1I9EA 3QRGL 4U0QB 1OAXH 3ECUA 4P9MH 4AM0B 2GTZA 4JRYA 1I53A 5ACLA 4KV5F 2ZXOA 4WHYG 3RIAF 2GIYA 4Y5XB 1N36L 4JY5H 1C12A 2XIDA 5J7CC 1NGYB 4J23A 4NI3A 4FCAA 2Z0UA 3ULPA 3PHQB 4UM9B 1UZ6F 2XWJA 3MV9D 1GYCA 2IQ9L 1T1XA 4YHOL 5IBLC 1K8AC 4ZX5A 1LYQA 1MDTA 1PZBA 3S1RH 2NZOA 3CFKB 4KJNA 1MHHB 1RIVL 2R3ZA 3HZMB 3HUJF 3N5AA 4I9WD 4WUUE 3RVVC 4KWUA 1ORSB 1K8IA 1QILA 3TP7A 4JBWA 2JELH 3BD3A 3QI9D 4DR4L 3QNYA 4EI0A 5I8EA 1CFSB 4HKZB 1JMXA 1MIUA 1DQLH 2BHYA 5E95B 3RHWF 1F3JA 2JF1A 3DC0A 3VD9A 1T1WA 4XXCC 3VG0H 1E8XA 5BRZA 2F08A 4BGDA 1YYMH 4ZCKA 3KPMA 2A9NH 2HT2C 3C2AL 4JJOA 2CLRA 4B9KC 3S16H 1WZMA 5IVZB 5AQ0A 1GRWA 1R3IL 2DRUA 5KS9A 3FCTB 2C35B 1TETL 4XB3A 1XH3B 3LQZA 5KUMA 5DJ8A 1YMME 5AW8B 3WN6A 4LUOA 1X5IA 4RQQA 3PDGA 1Y8OB 2J72A 3NIGB 4OCWL 4X5XB 4H20H 2XI9A 2ZOKA 1F90H 1TCMA 2OMUA 5DJYA 3QORC 8FABB 3FF8A 1X3EA 2HT4D 3FUMA 4P8QA 5C0JA 3ULUL 4G57A 3TFBA 3OC8A 4X6FA 3IPEA 4XCYA 4BHUI 3T0XA 3IE4A 4ECNA 5F3BA 3RKDD 3GTKB 3LNIA 3V2AR 3WJJA 4GRLA 1P5UA 5GQBA 3PUWA 1LO0L 3ARUA 1EIFA 3ZR6A 2F0CA 4KNSA 3L1FA 4KX8A 1OTCA 2A3TA 5DMIH 1Q0EA 4HPYH 1KXTA 2VXSH 1B3IA 1BR9A 5T1GA 4JFXB 1QNZH 4PJ5E 1NJ9A 1GKOA 5D5MB 3QB3A 5DHVB 3OAYH 1T03L 3BZ5A 4PTUA 5GIRA 5LB1A 1BGXH 3DJSA 4KROB 3BEVB 2VS1A 1I8LC 1SEQL 5D7LB 1UGNA 2GK2A 1CYGA 4YXLH 5L7XH 3QORB 5AVYB 3S0PA 5HD8C 1A1OB 5EEVA 4JKMA 4HGWA 3QAZC 5C4JH 3QNZA 1LD9A 1KJ2H 3NZUA 1OSZB 3MLTA 1RZGB 4ODBD 4UTBL 4Q4IA 4H4NA 4LKXB 1OWWA 4K8RH 1HJPA 4DUXA 3TT1L 3DSNB 4OZFH 3WHXB 1XSIA 4CC0A 2RSNA 1ZTXH 3KPSB 5CEZE 1XTLA 2F8OA 5GS0L 3ULSB 2KQ3A 3GSUB 5TFSL 5JO5A 3GWJA 1IAIH 2NY5H 1CDIA 2C1OA 5E8OA 1XXGA 1QUNB 3S15B 3ZE0F 2GG1A 3RY4A 4A68A 5HDBE 4YDLB 1P7QA 5G4MA 5HGHA 5IVXF 1ROWA 4L5RC 3WMQA 5DA0B 3FSZA 4IHBA 2IPKD 2B9AA 1GH7A 4H26A 3S5LB 2AITA 2R7ZB 2R93B 1J48A 1H6UA 1KF9B 3FDTA 2NT1A 4MLSA 4NS0A 5I19L 4TQEL 1WT5C 2QEJC 3ER0A 4P5KA 2B2VC 2IG2H 5DQJB 1OD7A 4XWOC 2DEXX 1OM9A 1SY6A 1FDLH 3OX8B 4JFQB 4LIQE 3P3UA 3TF7C 3HC3L 5GRWA 4JHZA 1YEJL 5HGQA 3FN0H 2VABB 1H9VA 2JTYA 4TUJA 1U4MA 1NBZA 4FG0A 3JWOL 3VQ2C 4H88H 3RHWK 1AE6H 2PW2B 3CFIC 3VJ6B 5EF2A 5DCCA 4UT6H 3KH4A 3OKEA 1WTQA 4P07A 4DR6Q 4U2ZA 1TVDA 3V96A 1G9NL 5B38A 3J80i 1CDJA 2KQMA 3FNKA 3K8MA 3KLWA 3PUYA 1YYCA 1F00I 2VDNB 1YQVL 3K6IA 4OD2A 2JKTM 3MNDA 4PB0H 2VB2X 2FEDD 1IEAB 3ME0A 1ZK5A 3Q6GH 3KEHA 2DWTA 3LOWA 3AT8A 3FU9A 3QXDA 2YPLA 1QQDA 4HMDA 4M3HA 3CMOH 2DM2A 3ZXAC 1VEPA 4ZZKA 2PTVA 3OD3A 5F88B 4HCRL 2MCPH 2A6KA 5I6XC 3UJJL 3VU2A 1CDUA 1KBPA 4LESA 4IQHA 3U58A 1MG3C 1XF4A 1L9QA 3W82A 2PMZE 3CZKA 4JZJA 1QSEB 3BDBA 2X4TA 4CSSA 5FO8A 1LTLA 5ICZB 5HHMB 1IC7L 2HT1A 3QI9C 4M7ZB 1BMZA 4U3SB 3EQLC 3LRLA 1YN6B 3QEGH 5ID1B 3RWJA 2KQNA 4QHLA 5EBMB 1LO3L 3HGBA 1M6UA 3A54A 2H32A 2ATPA 2VDQB 5I15H 3OTOL 1FGNH 2D7MA 3TYGL 2NN6H 5TJWK 4EBQH 1DVTA 4Z7NB 1XQ4A 3FB8B 4L18A 4YPJA 4DAPA 1T5XD 3WFEL 1LUZA 2FK9A 1E4JA 2Q2HA 3A4EA 1QZGA 5I6XB 3P1HA 1WZ1L 5HVGB 2Y2WA 1WD9A 3DIFB 4XO8A 1H6TA 4NO0A 2DLTA 4X6DE 2GBVA 1MCQA 1KRTA 5I73B 4H40A 4AGOA 5C0BB 4DR2Q 1MQKH 4X8GA 4PJAE 4PJDF 2DI9A 1E9OB 1F56A 1KAAA 4A76A 3L3KA 5IT2H 4ZUSB 3MRFA 4PRHE 1KIRB 5IP4A 4BS9A 5ITBH 2HT4C 3QUXA 4Z1PA 1OHZA 4HXAL 1OXTA 1PKQB 1S5IL 5C0XJ 3S2AA 3TEUA 4QOKD 2F0OA 3LNGA 2JQMA 3EO9H 3RKDC 3NA9L 4BQ9A 3V6OA 3MLPA 4UU9A 5JVH3 2WXGA 4U1NB 4O1NA 1QI5A 1FFPA 1RV6X 4IU3A 2IX1A 5I8KL 4OCXH 2DQEL 1KLGA 4X6CE 2X9ZA 3PWNA 4HXBH 1XYIA 5A16A 5GS3A 3JAMi 4ZW5A 1QA9B 3DM1A 2HJKA 5FB8B 2VISA 3BYYA 4M7KH 4DFAA 1X5JA 3COOA 4WI2A 5D2LF 1DZ1A 1UXWB 4M1UB 1AO7D 1CIDA 1W15A 1YZZA 3BP5B 4W9GC 4X5WA 5GQOA 2HJLA 1U30A 3QO0A 4V2CB 2CUHA 1CIUA 4Y8DC 5KVFE 3OF6A 1CR9L 1DLHA 5FM5O 3MUJA 4JRFA 5A40E 1NLDL 4DV3Q 1ET9A 3D87B 3NK3A 1FE8L 3GTQH 1U4RA 4A3IG 1PTOH 3P3SA 5SWQB 4PLJD 1WTRA 2ZUWA 1ID5I 1HU8A 2MNWA 3C6LD 4YDKL 5E1IA 1R5WB 4A3BH 5HI5D 5DMJB 4RMTA 1QACA 1N7MH 3DXJC 2CM6A 3C5SB 3ETBF 4G72B 1RPQA 2YAMA 5CINL 1XF2A 3WLBA 4ATTA 5C0CB 4XHQA 3KGRA 3TJEL 1XGYL 1IHZA 2B2UC 2VT0A 3L3OB 2CBMA 3P9MB 1ADQL 3QDMA 4MJIB 4KTEH 2AHOB 2PCPA 3CFJA 2O6PA 3U7YL 2VL6A 4WJG3 2CUMA 1G8ZD 3G6JA 5LXGL 1MI5E 4MNQE 3SGKC 4N2EA 3WIAA 2K05A 1GO3E 5IMOB 4UAHA 2I26N 1PG7H 5KNCA 1QRND 3KLLA 3GBMH 1I75A 3FFCD 4P5TC 1L1OC 3TTSA 3T3PE 3T2PA 1AOHA 2YA0A 2WBXA 4V1DD 1DJYA 1FCCA 2XV3A 3FZUC 3VI4A 3IRPX 2A7BA 1RSFA 3ZMRA 2A9DA 3P9LA 2IGFH 2ZIDA 2OMXB 4KXZH 4UNIA 2OLDA 1NDGA 2B1HL 4LLMA 3U4EB 2NTFA 2VQEL 1PD0A 4N9GB 1X55A 4NSKA 3GI9L 4PJXB 1VQAA 4ZSOA 2VDRL 3UP6A 3ATEA 4B9WA 4HIQA 1I9IL 2FO8A 5C44H 4PZ8A 2VW6A 2OJZL 4KX9A 5IQ9A 3S1NB 2B4CC 2HFEA 4G9FA 1B2YA 1F41A 1QBLL 3NFPB 4XN7A 2MRYA 4W93A 1C5DA 1RLWA 4P5TB 2P42B 1JJ2A 1IGJB 4B3TL 4TNEA 1FHNA 4ADIA 4YDNA 4S1RL 2HLFD 4NCC2 4BY7G 1CUOA 4GMSH 1Z6HA 1USZA 2MCAA 2NOYA 3QEUA 1JNHA 3D33A 3SYOA 2B59A 4R8WL 3CX5K 5A2JH 2CHWA 1IKMA 1A7RL 2F1BA 2HJFB 3RY5A 1U8OA 2C5DC 3CLEH 1B0RA 3L3GA 2HWZL 4HSVA 3NELA 1G1CA 3NSJA 3CCMA 3PWJB 3SJVA 3HBQA 3DBXA 4JM2C 4D94A 4B7LA 1G4MA 1SOKA 3A21A 3B3IA 3QHZL 4R26L 4I18C 1EFXB 4N5EC 4OCRL 4PRBB 1AE3A 2JQOA 4NZTL 1F9RA 4Q6IC 2OW7A 5HHVH 3TN0C 4GP4B 2D9CA 1UADC 4JVUA 1OOAA 4UINL 2YGOA 1HSBB 1HH6A 4F3FB 5B4MD 1ZPLA 1MJJB 3MRQB 4MAYD 5LGKA 4KVNH 3QIBD 3I7FA 1YNTB 2N78A 4XPAH 2AXFB 4Z7AA 5I1EL 1IE5A 2AV1B 1IGFH 3MYZA 3TLRA 4NXML 4KKUA 2E27H 4GQPH 3OR6B 2XRAH 4G9DB 1OGTA 1RJZA 1HNXL 4YHIB 1JZ8A 5K1JA 1KGIA 5DK0A 4BK8A 4ZFGH 3EDFA 4ORZC 5BCAA 2GSIA 1ZGLP 4JM2B 4GKOA 1VEOA 1KD1C 1TLMA 4WFEE 2IAMC 3QDJA 2DUDA 1OANA 2P8LB 1FFOB 1QSZA 4Y1AE 5TH2A 4ZTOH 1GJIA 3UO1H 3CPLA 5M5XB 4FDWA 4B50A 4BY1G 5IYCG 4FHBD 2D03H 3P30L 3TN0B 3IFNH 4HSAC 2NY0D 2CWPA 4ZYKB 5I6OA 4Y4KA 2HDMA 4DEUA 2A6IB 3EG9A 1CO1A 2HLEB 4K8RD 1BO0A 3TPUB 4LVNC 4NLAA 1VPOH 4CC4C 1KCUL 4MWFA 2UY7B 4OWWB 4AQ1A 5KVEE 4QRQA 3VR5A 5D70L 1U36A 1I3RA 2VR9A 3CTTA 5IM7B 5G4OA 3PHAA 2PKDA 3VFWB 3HG1E 1T6BX 1YN7B 2R7ZG 2R93G 1IM9D 3D51A 2J1YA 4BFGA 2BH8A 2JVUA 1Z7JA 3H8NA 4XN9A 3O2WL 5JDSB 4AYEC 2Y06H 4JFFD 1N67A 3O6MH 4E36A 5C0ND 4JOIC 2Z8SA 5DUPH 4B9CA 2IAMB 2DJUA 2VUMG 4XGZB 5E1HB 4ZPTA 5CKGA 5ICYB 4HWUA 2Y3AA 3MCKB 5AB2A 1YVCA 1ZXKA 4JN2A 1ETZB 1HH9B 2Z35B 1JXKA 4BXXG 3C6LC 4PLJC 1GZHC 3Q2WA 3BDXA 4Q56A 3VXSB 4CU8A 4N26A 1SY6L 1TTUA 1Y1DA 1IBZA 4LVNB 5HI5C 3ZKND 5CBEB 3RWHA 5ALCH 1RZJL 4JFVA 2LHAA 4O00A 3N85L 5H2BA 2XBZA 3S97C 3V7AG 1HEJC 5CC4A 4O58L 3GSNB 4P2RD 4UNUA 4UQEA 2ATAA 1DO6A 4BA2I 5EZJB 5D7JA 3K72A 3FU8A 3VR6A 2EKSB 3Q01A 2R23A 4A93H 2P8PA 3DTUB 4KHZA 2CBQA 1SOSA 4OT1H 5BVJA 3U36B 4LQ1A 4F93B 1SYBA 1HNFA 5DD1L 1NANH 1RIHL 3L3JA 5CILL 2JA5H 5EC1B 2K04A 4X8JB 3I4NB 5IYBG 4LFAQ 3CFDB 4LSRH 4P59L 2JNZA 4GYBA 2CKBB 1DZBA 1D7DA 2R1YB 2CDFB 1PZJD 3HLAB 4NNYB 3KWVA 5CEZD 4JHBA 2X5PA 4OZHE 4QRTA 3T8XB 5K59E 4CSPA 5HHQB 3TH2T 3N42B 1RUKL 1J6QA 2VSCA 5DHYA 3MOBH 4MHHG 4IEFB 4R5VA 3I02B 5BOPA 1A14L 1XMOL 3F58L 4YDMA 9CGTA 2JQZA 2RJMA 1NLBH 1SJHA 1VCBC 1N32L 2AI0L 1E8YA 2GJZA 3G5WA 5IKCB 4I13B 3WJLC 4DR7L 4WWOA 4TSAH 3C75A 1XB6A 3V0FA 5ESAB 1RJTA 2ITDA 3PAZA 4HH8A 4LCIH 2Y25A 2NY3D 1PVOA 2YQGA 3RZOB 1ICFB 3MNZB 3FO1A 2Z93A 3MV7A 5F96L 4Z78A 3UIYA 1Y1WG 1V9PA 3OZLA 3O11A 5KSBF 3GDCA 4AL8C 3TL5A 1NGWB 3BEWB 5ILTH 4XRCB 4R4OA 2FCBA 2EEFA 1SJXA 1DSFL 3V0JA 1HDMA 2KVMA 1ZLSH 4IQZA 3CD6A 3G08B 3GHBH 2X4NB 1MREH 4HUWB 5DRWB 4YX2L 1EV2E 2I9TB 3WS3A 4A6YB 4BQ8A 3BO8A 4Q14A 2KMWA 1PD1A 3VFPA 3ZT6A 5EEXA 3JWDH 1H6FA 1J0YA 1TYEB 2NDGA 4X4YA 4RZCB 2OZ4H 3VR3A 4HIEA 5BOZG 4X4ME 1GUNA 3WIHA 2ZQKA 4Y4FB 5JIMA 2AJVH 3OIPA 3QIBC 4Z3IA 2QFPA 4YSCA 2B1AH 2EE2A 4N8X1 2ZM6L 4JI2Q 3NJGA 4Y16B 4K3GA 4QXVA 1BZ7A 3OKNB 1TUPA 4ELKA 3TVMA 5I1AA 1TS2A 2O4XA 3KXFA 3M17A 4AYID 2FLBT 5CGYC 3RGBA 4JO3H 4FMKA 1YHQA 2R0ZL 2H0PA 3VD2A 1XNRQ 4QWWD 3TV3H 3ZE2F 1A7OL 4PGCA 2VY3A 4Y88A 1Q94A 4S1QL 1DHKA 1V3MA 2OQJA 2IXQA 3OSKA 2A19A 2NNRA 4R7DB 5D96C 3LIUA 1KJ3L 1C8QA 4BA8A 3KYMA 3F6LA 3O2DH 3LN5B 5KYXA 3OC5A 2MFNA 1F4WL 1Z9PA 1TEGA 2R4RH 4LEXH 3QXTA 4Z0XB 2W9EH 2NY4D 1QNUA 3FMCA 1G7MB 4OI9A 2HB0A 2ZCKH 1I9RL 2PYED 1PTOD 2A74A 2YD0A 1OM3H 5HHXL 4ODHL 4WTXA 2UVFA 4CVZA 3GHEL 2VSDA 4CMHC 2AZAA 4N0FB 1A15A 3U7AA 2X88A 3F8TA 1L9PA 3GTJH 4EZMA 1TWHB 3PO2H 1HEZB 1M7DB 4ZNCD 1KXQA 3HFZB 1AGFB 4PJIE 1O9VA 2NY5C 1AC0A 3ZKMD 2OMZA 3SDCA 2XVSA 3BHBA 5C0NC 2IDFA 3SDYH 3P1VA 3QQXA 2RACA 1BQHA 5H94B 5J6GA 1QMUA 2EOTA 1F42A 3VFGH 3MQIA 3ASNB 3I6LD 2IALB 2D31B 1HZAA 3EGDA 3LN9A 4HBQA 4PRHD 3VFSB 1XB8A 3MXUA 1RK1B 1DBAL 3F12B 1JVOA 5EA0L 5C07A 1D8LA 4A66A 4NKIH 4O02H 4OFIA 5FYJH 4L9LB 5DGQA 3CCVA 1CG9A 1N64L 3ZKNC 4EQ3A 2EVFA 5AVTB 2X6GA 2PW1B 4A3EB 4PD4J 4M3JA 5FW6A 1X5ZA 1JOQA 4WCYL 5HGDA 1VADA 3QFJD 4HK3J 4XPBH 3KDFA 2K6WA 4BFKA 3E6HA 4JMXA 5C0DA 2HTKC 1HL4A 4MQTB 4ZQKA 1KPRB 2V9TA 2F0NA 2JYOA 3NENA 2JCCE 1PXUA 1SYGA 4KXAA 1YMMB 3NJIA 3IETA 1RTNA 4ZMQA 4EUPH 4NYLA 1KDBA 5JEAH 4N2NA 5IR1A 1X44A 4LVEA 1Z6JT 2MPAL 2R1XA 1MCJA 1YNKL 4FJYA 2BRRL 1FFTB 3RPBA 2DMHA 3QFDB 1CD1B 2AGJH 4PWFA 1RVFH 3DOSB 4N2IA 3ELAT 2Z6KA 3D0FA 2KUTA 1IE4A 3MVVA 4JI3L 4PYHA 2DMCA 1UACL 2B8OT 1ML0A 2XV6B 1CI3M 1A5FL 4XB7A 4WF7A 4F7CA 4DP1X 7PCYA 1MHPL 3DJRA 1KXVA 2VLKA 4W4OC 3I4MB 1AP2B 2YARA 2FB4H 4CKBA 5A35A 2XWXA 4FFYA 2QZ5A 5EU6A 5LL6S 5EPMA 4LAQH 2RHQB 1G7JB 1XVSA 4MMYB 3INUL 2YZ8A 3KL0A 1IGTB 4PJ5B 4U1LB 2Y4SA 3SKMB 1MAJA 1O78A 3MXWL 4KD4A 2AQ1B 1UG9A 5E99H 4X3KA 5CS7A 3NZHH 5DEFA 2ESVD 3TOPA 4KZDL 1LT6D 5CEYA 1DQTA 4WNQA 5EUKB 1T83C 3S24A 3DV4A 4MNQD 2NY3C 4FF4A 1BYPA 1EHNA 1GIGL 2XYBA 4EXPX 3QIUA 1ODUA 2HA1A 3AG2B 1JNNL 1R3LB 4X7CC 3AROA 4TPRL 4BSVB 2Z92A 3K5OA 2NX5A 5DD5L 4G5ZL 4KKCC 4WIQA 1BYOA 3T77B 1NIFA 4UOW1 4L0ZA 2ZOUA 3TCXA 2FT7A 5DTFA 4LB8A 1SQ2N 4DCQA 3FT3B 4HK0B 2CHZA 4X5QA 5A2KH 4HDIB 4C47A 1J9QA 1VAHA 1NEZB 1WWCA 3QH3B 4QKXB 5HDBB 4F8OA 4PP1D 4HS6B 4WK2B 3RNKA 5AB9A 1UB6A 2EKJA 4HCFA 4KV6A 3IJYA 4TSCH 2E2JB 2N8NA 1I7RA 1U4EA 2LV4A 3KLKA 5I71B 1A4BA 3UTTD 3S3BB 2PNRC 1D5XC 2WLZA 4HQQL 1OAQH 1WEJL 1BAWA 1GMIA 3QUMB 4P2YA 3AACA 4YH6A 4W9HC 3SGIA 1BVOA 5IB1A 3GSOB 2BMKA 4GW5A 3VI3A 1ITCA 2KUMA 3Q9PA 1LTXA 2Y1VA 2PW7A 1I4PA 4EN2A 4LCCB 2Y24A 3H3PH 4JREC 5CJOL 3IMWA 2PO6A 2WPGA 1DQMH 4ZAKC 2D4FA 3SE3A 5JR1H 1Y8PB 1BDOA 3VGFA 4I77H 4L4TE 4MA3B 3OPZH 1A6ZB 5GPRA 4KO5A 4CDCC 4QWWC 4QNPE 5IROA 5D7KE 5ELOA 4QO1A 5DMGD 1WAAF 1Z2KA 4ELMA 1JGLL 1F4YL 1LP9E 4PW9A 3VXRA 4JHVA 1U2CA 2PXYB 2CO6A 2RDGA 3FVQA 1BM3L 1S78D 2B15A 4WSGA 1N3NA 4MSWA 4RGOS 1FPTH 2C9RA 2VRKA 2WB1A 2NY4C 3JTSB 4DVRH 4ZMWA 4HC1A 5C0IB 3MYJA 4DWHA 2G60L 1VS0A 1N68A 2X2HA 4HOWA 4MZRA 4ZAKB 3C6SA 4I0PD 5GGQH 5INDB 3S35X 2D3NA 1UENA 3NUCA 1P2CB 2SODB 3FC8A 4QTHB 4JBMA 3MBXH 3DSFL 2OTUB 3HMWL 4YBHA 5MHSE 1JRHL 1CBVL 1KENH 2L11A 4BINA 3UAJD 5KVGE 5I5IA 1AI1L 3BIKA 4L8SA 3SBRA 1XV8A 2W0PA 4FEMA 2WVTA 1T5KA 4WFED 4X4XB 5T3XH 5I8OH 5L88L 4FHJA 5IJVB 3RJOA 4AT6A 4O4YH 4NGHH 3RAJL 4AMKH 3T6QC 2HFFA 3DV6A 4Z7UA 1H8SA 1MF2L 2UZXA 3DRQB 2ATKB 3TA4D 3KLSX 5IHLB 1BVSA 1TQVA 3VXPA 3HOVH 5I1KH 4G80B 3NG5A 3PQYB 4R8NA 4JCWA 2DQJH 2P26A 5DJ0B 4G7VL 1VKXB 3GXFA 2LSSA 3QGVA 3I4OA 2H3NB 3L9YA 3VTTA 2GUYA 5LCVA 3HG1D 4IMKC 3ND9A 3V52H 1LACA 1SDYA 1DN0B 1H9DA 4P9HL 2YJQA 1CDBA 3BT0A 4F9LA 1LTTD 5CMAA 3I2ZA 4WNJA 3GFUA 2WAQE 2F0EA 5DHVH 1PBYA 3M1BB 1ZHKB 3JVFC 3OMCA 2FYYB 1NL0L 4DKFH 5TF1H 3MBEA 4NKMB 2WCGA 4JR9H 3SBQA 3V4VB 3VD4A 4MJ5A 5F71A 5E8DH 3REVA 1G7HA 3AY2A 3GB7B 1RULH 4NO5B 1WCBA 5CCKL 3ULUE 1OD9A 4ZD3H 3MLRL 5B39A 2BSTB 4AK2A 1WTWA 4LPTA 2G4GA 3UTOA 4GKSA 1SHWA 1U8MB 4ZMYA 4DUZL 3P11L 4YIQB 3VYUA 3MA9L 1A2TA 1EEYA 1MW1A 3DROB 3TMEA 1IFHL 3L5HA 4RAVB 4YHOH 5DJXB 3KWXA 3QO1A 4LCYA 4PJ7A 3S15H 3HZKB 3KM1A 1TO4A 4I1NB 1SVZA 1L6PA 4YFDB 5DRZA 3RZCA 2Z31C 4DK3A 4GFTB 3HAEB 3MROB 3VB8A 3VWJD 2E9GA 3GP7A 1LVEA 1NAMA 1PLBA 3TZUA 3FTGA 5DVKA 1YIJA 3GMRB 4HFWB 4UDTA 1AD0A 3WIHL 4IFDJ 1UWGL 2A0LC 1RZFH 1BSIA 3UBXA 3NCWA 1MFEL 4OB5L 1QFUL 4QHNA 5D55A 4Z95L 3W3BA 1HNWL 4CKQA 3HI1A 4YHMH 3MLXL 5EO0A 4GAAA 1Q72L 5IP9G 4N8FA 2K70A 2HVJA 3NJNA 3LQMA 1ZEAL 4UP8A 1WCMG 1CKNA 4PP1C 2IOIA 5DM73 1NCIA 4JNXA 1R3IH 3P73A 3PV6A 3TC9A 3VXUD 4AYBG 1NH6A 3GSQB 2Z31B 1HAUA 1DEEA 1TCRB 4WDIB 5ALBH 3PGDA 1PH4A 4QRAA 1MI5B 4G6KL 2F8XC 3SDDC 4CDDC 4NUMA 5SX4I 1RIUH 4LLVB 4OAWA 3K6DA 3BKYL 2UYLB 1WYJA 4N68A 1X7QA 4PJ8D 4A7TA 1TJMA 3NGBC 4DO5A 1PH8A 3D25B 3O6FB 2WXHA 3CDCA 1SE3A 2X70B 1HEHC 4DP6X 4YSQA 1WK0A 3IFLH 4QF4A 3QULB 2YR3A 2FJSA 1HYSD 4ATWA 2EY6A 3MCLH 4X5LA 1D5BA 3BN9D 4PP2B 3R8BA 5M3MH 4HKJB 2EICA 1D7CA 3KDMB 1S78C 4J2XA 4A3EG 2UUAQ 3IMVA 4RISL 4L8DA 3RPKA 1JXFA 2NR6C 4JJHA 5DS8A 3JTTA 1A1NB 4U1SA 5EMYA 5GGVL 3SDDB 1L0YB 4BV1A 2HCZX 3NCJL 1UE5A 2WW8A 5FYJD 1G7IA 2KEDA 5F9JA 1ZV9A 1NFKA 4ME5A 5HGGS 3IVKA 1Q9WB 2D0FA 1IQWL 3TT1H 4XNZB 4HD9A 1JE4A 2CJSA 1RZIB 2BJMH 1EUJA 4KDVA 1NGXA 2HRPH 2XCMC 1VB9A 4NZFA 4A67A 4J4PD 4IBWA 2IANB 3KVPA 5HPOA 5AZEH 1BAGA 1TJIL 4F7MB 1GVPA 1BVZA 4HUUB 1J8KA 2NUTB 2K6YA 4EN3A 3Q0HA 2WQAA 4QF1A 4A7QA 4ODTH 3P2DA 1XHHA 4ZMXA 3N1PC 4NPJA 3TEHB 3G6DL 5T8IA 2R92H 4DV4L 2G9HA 1EMTH 3FQRA 4DNIA 4UIKL 4YXKH 5HHNA 3GEFA 5I1HH 3GRBA 3I2CH 4AGLA 4Z3EA 5HXMA 3R2IA 1VMPA 4GOPA 4JDTL 4N0CC 1SFOB 5C09B 3WFHB 2XZQL 3KNBA 3MX0B 4F1ZA 5FGCE 3DO7B 3J8F7 1HHIB 1S7RA 1DFXA 1I1YA 4FLHA 3BVNB 4FFYL 5M5YB 2DBLH 4XWGL 3SKJL 1X6OA 1NA8A 4Y5YC 2BHFA 4ZI8A 4HF5L 3NK4A 1SDFA 5E03A 4HJUA 4GIPD 3FL7A 2K03A 3E6FA 4KUCD 4PJFA 4ZX3A 2F4IA 2K7QA 2BWQA 4W70A 1RJYA 2ITCB 1LO5B 3FB6A 3WSQL 2ES2A 4Y1AB 5J06A 3KPRA 1BEYH 4B3SL 1U3HD 1G9NH 3FQWB 1QPPA 4HUXA 4U4IA 1O5PA 1ENFA 2F19H 3LZFL 3Q8BA 3MTSA 3Q8EA 3S37X 1CFQA 1MCOL 3CDZA 3SPIA 3M7OA 4CSTA 3HOUH 3KYOA 3NA4A 4DR1Q 3TP6A 1CM9A 2YTVA 1BBDL 3UC0L 1FAKT 3WDNA 1FG2B 1LDSA 2DWYA 4BFJA 3L7ZC 1NBVL 3J7AV 4GEIA 4H02A 1O7SA 2WWKO 4CDFC 2VLJA 4JI7L 3D39D 4JUSA 4Y5YB 1HUMA 4BH7B 1MXGA 2EE6A 2FE0A 2GSMB 4R4IA 1DBMH 1RZ8B 2YN5A 4OLVH 5E2WH 3WTTA 1AHWC 4KKTA 2QR0A 1WTXA 4XTRD 3ZSTA 3MLSL 1L3WA 2XWZA 4C3HB 2W9LA 3TBIB 1QABA 2H26A 4KK5D 5E7FA 3KPPA 4LLAA 5ENWB 1LEKA 1W91A 3VWJC 4LUZA 1KCRL 4OEMB 2B9BA 4P2QA 5SWZD 3ECVA 1HA5A 4IKIA 1N5YL 3O3DA 3MUHL 4JFEE 3ZPDA 4EE2A 5C6AA 1X5GA 5LNDA 1EEZA 2CH4A 1E4KC 1JGUH 1LO3H 2FX9H 3AXLA 3NH7L 5EN2B 1ES0B 1MFMA 4XMLL 1MFCL 3E0JA 4M48H 5HP5A 1DJXA 2MNAA 1U93B 1EDHA 2RA4A 2VLLA 4FX5A 5AUMB 1XF1A 4G59C 2MPVA 3MFYA 2EYPA 4NDXA 1OSPH 4LOVA 3KPLB 4Y4HA 4Q52A 2OXGB 3SCMB 2G2NA 5DJ6B 1WZLA 3FH5A 4MZIA 3ZGIA 3F65A 1I85C 4FE9A 5IFAH 2DQHL 3CCQA 2DQUH 1IBYA 4IRSA 4BEIA 1AQ8A 4NO3B 2YBGA 2DJGC 1KLUD 3QJQB 3LEXB 1HHHA 3MRRA 4X8CA 3CBRA 1F86A 3GMOA 1FJ1A 1O6VA 2VKXA 5A2AA 4HXAH 3O4LA 1S5IH 1T0MA 4PJ8C 5IBUB 2AABL 4YEFA 3BE1L 2X4SA 1AHMA 2I07B 4XPFL 5EOCL 3ARBB 4RCNA 4JRYE 2B2YA 4YWLA 3D4CA 5FUCE 2CQVA 2HDLA 2UZYB 3LRSB 4FYQA 2K4KA 5ECJE 1HYSC 1X54A 1IL1B 1ZKOA 3WWVA 4QT5B 3RN5A 1EHKB 2UV3A 2IX0A 4LP8A 2YQBA 5F1IA 4G6AD 3G4SA 1T21B 4E9LA 4Q9RH 2X41A 1AANA 4MASA 4BQBA 3LNDA 5K1VA 3G5XB 4HWBA 3GKZA 5T3XD 1LTGD 1I8UA 2HRLA 3RX7A 5IOKA 1JYXA 1KGCD 3UG5A 1W6WA 2CCLA 1MCIA 1NLDH 4O0AA 1UZ8B 1X9LA 2YO3A 4HJ1A 3V9CA 3OAYK 5FK9C 1FE8H 4IALA 4N3TA 3ULAB 4MX7A 1HKLH 2BA1A 3QW9A 2IDCA 1H6EA 4KHXH 4YDKH 3TEWA 1SXCA 1TPXC 4NFCA 4G6MH 2CLVA 5LCVL 4J4PC 4L4TD 4AKQA 1VQ9A 3EDKA 4WLCA 5M7QA 4NN7B 1K4DA 5GGRA 1UM5L 4MS8D 3FRUB 5ERWA 5D7KD 2PTUA 1AYOA 1VQBA 5C0AE 1AKJB 1XO8A 2ICWB 4JDZA 2R4SH 3FUDA 4KJYA 3ZR5A 5KS9E 1XGYH 1XD0A 2HKFH 3STZB 4BFRA 3MC0B 1PJWA 2D7NA 3CPUA 3CXHJ 1JZIA 4JI5L 1P0SE 1ZA3B 4K71C 2D7TL 5AW5B 2AKRA 4ZK8A 4JFSA 3QVAA 1UFGA 1WFTA 4S2SB 4WI9A 1WD0A 3RWCB 1WYDA 3C9NB 1C8CA 2R29H 5M5XH 1JN6B 3OR7B 1PZSA 2XX1A 4P5MA 4NAQA 3TA3A 5HURA 4XMPL 5H37H 5FK9B 2GCYB 5FF6B 1RCYA 2NVQB 1F58H 3IN2A 3M86A 2EDMA 1TQBC 1NEUA 4L29A 3KW8A 3VXTB 5D6DC 1FVDA 3HUJA 3E0EA 5C44G 1XTMA 2ZZUT 1KB5H 1A0QH 3PO3B 1N19A 3VMPA 1GGIH 3SPHA 4OLXL 4MMXA 2L9HA 4WEMB 2ADGB 4L6TB 1XF5A 4BUQA 1ET6A 5ES4B 3MV8A 3GMMB 2Q76B 2CCVA 5JA9A 2ENJA 4LLYA 3MLYL 1S7SB 1N2RB 3GI9H 5E8PB 3WHE0 3GSRA 5JHMA 4K71B 4YDZA 3RNQB 2IC2A 1SVCP 2BSSB 2KA7A 2YRBA 2KLRA 2FR4B 1EVUA 4HW6A 1NAML 2EUWA 1Q1PA 4TQPA 3I4LA 5AW4B 3OKMB 4BKLA 5IEHA 3JYBA 1FR3A 1PTOF 2FIKB 5DVOA 1EY5A 4C56A 1OTUC 5K39A 4GBXD 4RGOL 3EYSL 3S35H 4XPHH 4EAEA 5FECA 5LKNA 3JT2A 2VITB 4YZFE 5A2CA 1I50H 4M8QB 4UMSA 3LQAH 4AG4H 1UCTA 5G3LD 2H6UA 5JIHA 5K9OA 3CDFA 2NVYB 3EFDH 3NCFB 4J6IA 5CHNA 3IDGA 5I66B 1JVKA 5F7EL 1EQQA 1EO8H 4XTRC 3IAYA 2YD7A 4L8JA 2NRDA 2CG9X 4QGYA 2LY7A 4W68A 5E8NA 4PRPD 1QWYA 3L5XH 3VCLA 5AAWC 1K6QL 4KK5C 4F91B 3FFDA 1RHPA 2QADD 4L5QA 4XNXL 5HHOA 3QIWD 4XVJL 2ZXAA 3LB6D 2HFTA 3K3QA 1LDPL 3I75B 5D1ZC 5LG6A 2ZWZA 4HWNA 3FS9A 3A0JA 2NY6B 5I1JL 4NZTH 2VZVA 2WYZA 3UTPE 3NP3A 5T3ZE 1FRGL 1BQLL 2BOCA 3GTMB 3MRKA 4P48A 3E7JA 4UINH 1PLCA 1VGKA 2NNCA 2RVLA 3I4NH 3ULUD 2K5DA 2DNCA 4TL5A 4AEHL 1EY9A 5L4JA 1SMOA 1YNNC 1LTBD 4MRCA 4M93C 2B29A 2H6OA 4LO9A 2V5MA 3CN0A 1GA2A 4LLDB 3GIVB 2JCCB 5I1GH 1N59B 4HJJL 1NMCB 4MJ6B 1SDAB 4R4ND 3BZEA 1N12A 4GZYC 1KCBA 4QXGL 4CBZA 1YEDA 5C2BL 3M7FB 5D1ZB 3A7LA 3TT3L 4YLCA 2J6EH 1DUYB 1OAUH 3ZDZB 2Z3FA 2WKCA 3FT2B 5FA3A 4YMPA 1EQWA 2Z4IA 2XXMB 1A0IA 3GBLA 1L9MA 4KRPC 4RSYA 1E1TA 1B2WL 2GIXA 5JHLH 2XA8H 5BNXD 1UH4A 4G7SB 1KG0B 1Y6NR 1ZXQA 3JC66 1N9PA 4XMKL 1OB1A 3K6SA 2HG5A 3CV5A 4LSQH 2PQAA 2YPLE 3QUYA 3AM8C 4YHNB 4AM0Q 3C5ZA 3QUZC 4ODUA 4XCEB 5IVXA 5C9JB 5JOFB 3P40A 2A4ZA 3NFNB 1RL1A 2IWGA 4FC3E 5GS0D 4FKEA 4O42A 4W6WB 3CF5A 1E43A 1H9SB 1ZHNA 2B20A 4JANA 4K5WA 1KNOB 4NKLA 4U1JB 5DFWH 5IB4A 3U4BL 2BCKA 2NUPB 4L2LA 3SDXF 1X3GA 1T7VA 3MGOA 5T1LB 1KCKA 1IC0A 1Y07A 3GGWB 4X8XA 4YSRA 3W2DL 5C97A 1UH2A 1P9MA 1EQRA 2F74B 3FT4A 1MFAH 3KLRA 2JKNA 3HI5H 2C3WA 3FUHA 3I50L 3TO4D 3CCHA 4IHOA 4HZAA 4KRPB 5FOBB 4P99A 1CI5A 2F53D 4XBMA 4BDVA 3VXOB 1R3KB 4FQLH 1KB9J 2OX5A 3MRHB 1QNKA 2B8FA 3UACA 2K8QA 2C26A 3SXHA 1JPGB 1SVBA 1MAML 3QUZB 1QSFE 3VFRA 4L8CA 3H9SA 1A4KB 1F45A 5HYEA 1LLAA 4UY8C 2AEPH 1YEKL 2B2WA 2JA5G 5AZ2H 1BBXC 1WV7T 4ESKA 4LCWA 5IIEA 4YL4A 3BGMA 1HJCA 3TPKA 5BJTA 4N86A 2R69A 2IFFL 3FQNA 3STBD 4WO4A 4HJGB 3CSGA 2RQ8A 3DHJA 1EZLA 2VZUA 4E9TA 5ID0A 3ARFA 4NWUL 3KBGA 2HUEA 4NWTH 4AVHA 4I9XA 2WACA 1TEFA 3MKKA 4MA8L 5DD1H 2C9PA 2R2EA 1GM5A 3F7VB 1XTDA 4L8BA 4GS3A 5GGUB 4C3HG 2IOOA 1PX4A 2OMYB 4P4RA 2ZUTA 4CU7A 4HJEA 5I18L 2LFNA 3LV3B 4ZS6D 3TYFA 1MNUH 3V6OE 2V3DA 1FVCB 4ILWA 1NC4A 4UDUA 2FBJL 4YGAB 5FEBA 5IHUL 2EH7H 1EDYA 1I3QB 2YMOA 2AS5M 1VRSA 2RF4A 4FQ2L 2AUKA 5GJTL 3LH8A 2MNUA 4G6JH 5BZDB 4TVPL 1LP9B 4K0OA 2UU9Q 5JHDD 1NMBH 1PH1A 3H0GH 3BZKA 4L1TA 4LCVA 1K5WA 1FFNA 3GMLB 2Q8RE 5C5LA 3F5WB 3S17H 2AI0H 3QJUB 3QJXA 1J8HE 5KSUB 5IWAL 2FSEA 3ARGD 1JYNA 3D8MA 1PZ3A 4XN5A 3I56A 1FZKB 1SJEA 1VQ4A 4FXKC 1F3DJ 3V5KB 3T4YB 1YY9C 4L9DA 4LF9Q 1FLTX 1SLUA 4F7PB 4GBXC 4AH2B 2H32H 1YVLA 5DMKB 1R9TB 3V5DA 3U2JA 4UPAA 1BUVT 4KZCA 4KY5A 1E8ZA 3KAAA 1KLFA 3EFFB 4HZ1A 1JXDA 4PJDA 4XNYH 5BZWA 5JUEL 1M05A 2NNAA 4KZEL 4K23L 3H3VC 3QARA 1ORQA 1QZNA 4NHUB 3SE6A 1E5UI 4OZIF 3VFVB 2P5EB 3B56A 1DSFH 1WHOA 1FIEA 3WFZA 5IBUG 4GAGL 3RU8L 2OV0A 1ZXTA 1YEEH 3ZYOA 2CMRL 3PUCA 4DAVA 3IKCA 3QDME 3EYFB 4J1UB 4PTTB 5HYQB 1CGSL 4NXNL 1T04A 5TGBB 2AWOA 3T65A 3QQ3A 4AOFA 5BV7B 1EWCA 4FXKB 3ROLB 4GKJQ 3R2TA 1P4LA 2CZNA 2LQRA 4LLQA 2FT8A 2N0MA 4PJHF 2A68C 3HE6D 2HFGH 2OS7A 4HIHB 4KTGA 5E6ZA 1A62A 3ULUC 4QRPA 5K9KA 1NCTA 3MN8A 1QJOA 1EIBA 4GRMB 4S1DC 3P69A 4R5TA 5D2LA 1EA9C 1GJUA 4BSJA 4J12A 3H4FA 3VFMA 4RGMA 2DGYA 3SPGA 3I4MH 1GUWA 5B8CA 2V17L 1JQYD 3GJFB 2WYIA 2HQEA 3CBJB 3K7UA 3LH2L 3K1KC 3OOCA 5DJZB 5IEKB 3IKJA 2WAQB 1T7ZA 1OW0C 2R0ZH 3MO1A 5HDQH 1ZT4B 3B37A 1ZLWH 1ICTA 1A7OH 1CXFA 2JB5L 2QSVA 1JERA 1H9JA 1U8NB 2FJGB 2YAQA 4S1QH 3G9VA 3VWKA 3WDIA 4ZSOE 4AGPA 3S8GB 4WY7H 4CW1A 3UFIA 4W9LC 4OKVB 1KBGL 2XX0A 3S37H 1KJ3H 2DDQL 1U92A 1KIXA 2NZIA 2X42A 4N2MA 4H25B 4RH6A 4JGNA 4LHUB 3GBNL 2WXOA 2XRQD 3VH8G 2R6GA 3X11A 4HAGA 2A8VA 3S1MB 1PF3A 4OIIH 4H1LG 2YBRA 2VN7A 2ZP0T 1Z5YD 2LAAA 3PCOB 3HNSH 3MRNA 2IBZY 3LIZH 4APQB 5M94B 1F5WA 1L4IA 2WD0A 2L5TA 1KBVA 1R75A 1PRTC 4ODHH 3QIAA 3WY3A 5AKVA 3W5NA 4LRIA 5GS0C 3QPKA 1IGML 2YGVA 1U8HA 3Q2VA 1W0VB 2D9QB 1FNEA 2AXGB 3S9DB 1T20B 1F97A 3O9WD 3RZDH 4ZUIA 1E7VA 1U8JB 3MRCA 4IDJH 2FTAA 1PFBA 1JJGA 4J3OF 1N6QL 1S9VA 2E2JH 4HUNB 5CZVL 3W9DB 3TO4C 4L5TA 3L4ZA 2EDDA 3NEMA 3QUMH 2DQGL 2OCCB 3FB7B 2QLVB 3APDA 1YJ9A 4Y1TA 4LAJH 4M43L 1WP6A 2R56H 1KYUA 4HPOL 2SOBA 1C0AA 2F3IA 3MR9A 3OHXB 4BQCA 3TJHD 3S34L 1E5CA 2N7SA 2DL9A 4ZZFA 3B9KD 4JJ5B 4P23C 5DJDA 1IAMA 4FTDA 2ADYA 5KUKA 4JX0A 5FDWA 4FYRA 4PZ6A 5LO7A 1HZHL 4PN6A 3G5YB 2W38A 1KIUA 3JWOC 1GYAA 2K7PA 4HAFA 1F6FB 4MCZA 4HS3B 4RX4A 3CFEB 2F0FA 1CFVL 3FKIH 4ZODA 2V8LA 1MCLA 4K7PL 1QFWL 5KNDA 3IDJB 4HD5A 4AUJA 1D6EA 1G9NC 1NOFA 4DGZA 2VH5L 4NQXA 4TNFA 1U41A 1SFDA 1MWAH 4V2BA 4XAKE 5GGTH 2O30A 3U9UA 1CFNA 3K6FA 2OTPA 5B7FA 1MPAL 4FJZA 2K4AA 5LGHH 3II2A 4GXVH 4G1EB 4BA1I 4JZOA 4WHTA 4XPTL 4KOBA 3UPAA 2XFXB 3NSWA 1A9BB 2HPOA 4CA4A 1I7TB 2AJUL 5JDJA 5JW5A 4JL2A 1IBLL 1GW6A 1AXTH 1DL7L 3MXVL 4P23B 1MHPH 3CFNA 3FW6A 5BRZD 3RTQA 4DN4H 3I3CA 4ZX6A 5IHWA 5CIPH 3DX9A 3QNXB 4K07A 1GKHA 1UOKA 2Z65C 1JZDC 4K3EL 1W0WA 4XNQA 1NPJA 3FT0A 3OAUL 1SOQA 4NJAL 5F3HA 4YXHL 1PW3A 4TTDC 4AX3A 3ARGC 4MLIA 4KQ4H 1UCBL 2DLEA 4AV0A 1KJVB 4QJ3B 3QZMA 3ALXA 1Z9LA 1AY1H 2BHUA 3G48A 1LHZA 5DEGB 5HJ3B 3L9RB 3PJSB 3UZVA 4DEPB 4QTFA 2ARJA 4FLQA 3SGJA 4JDVA 2KS0A 1HQRA 1CHPD 1B6DA 3HS0C 5GRJL 4XH2B 1EWIA 5I6NA 3CU7A 4O9HH 4OX9Q 3CC7A 1FI8C 4LF8L 1BLNB 4L1HA 4AE0A 4U1GB 5DD5H 4G5ZH 4WTWA 1NUCA 4G8IB 5DJ2B 4O51A 2V37A 4UUJB 2FX7L 4MXVF 4XCFL 3X13B 4DGVL 1HHVA 1I4FB 3CD4A 1JF5A 3MRDB 2J8UF 2HN7A 5F21B 4RFBA 5HI3D 3VUAA 3G5ZB 4A3MG 2L7JA 1JYWA 1S9XB 1BWWA 3O3BA 3L9AX 3WE6B 3OAWA 4Y7MA 3MFFA 1PD6A 3LKQB 4F9PA 2WQRA 2G5RA 3V4VH 5LBSA 2AQNA 4HEDA 4GQQA 2JSOA 1LK3H 4LNRB 4UNVA 1E6OL 3HS0B 5CV5A 2CLZA 4ZUWA 4F24A 3MNWB 1KXHA 3C1FA 3W5MA 3EJIA 3EF7A 3CAFA 3K4DA 2H6PA 4GW4B 4JN1H 4FZ8L 2YS4A 4DNTB 2G3ZA 3LXAA 4HP5A 4PW4A 1E4XL 4GXUM 1HX0A 3VXQB 4CAGA 4KUCF 3KF8A 4FF3A 1JL8A 3LNFA 3MSPA 2OYLA 4Q0FA 5E08H 1YJDL 3KDPB 3IPBA 3UBXI 3HKSA 4RWYL 3V0HA 1CICC 5AD0B 1G2SA 3IDMA 4E41E 1JGLH 1S8DA 4DN3H 2FUTA 3N9GH 4XQQA 3BPLC 4NO2B 1JPSL 4YDJB 1P7QD 2ZTCA 4JFDB 3PPSA 5EIIB 1MN4A 3K2UL 1BM3H 3HAEH 1BJMA 4C3IG 1KGJA 4JO5A 2YRLA 2ZXQA 4YHKL 1U3NA 3OXRB 2V7NA 2ZD0A 1KIQB 2L0DA 2BVUA 4OTXL 3ULVH 2VQTA 1CK0H 1PFNA 4F1SA 3MV7E 5JLZB 2L4NA 1PFCA 3HCVB 2YA2A 4F7EA 4ONFH 1Z9MA 3ZIYA 4NUGL 1KDIA 3B6YA 5I9QC 3UXFA 1BJ1J 4XVSL 1JE5A 1YC7A 1CICB 4ZFFA 4YFLI 5GS1C 3HOVG 2R69L 1UEBA 2E76C 4JKWA 4B53A 4HWEH 4NBZB 3SKOB 1NEPA 3F7KA 3UAAA 3VDBA 2AJSL 5G5DB 1RU9L 1HL5A 3EYOB 2G5BA 3T4AA 4JFEB 2HTLD 3EOBB 4DP2X 2FQFA 5BRQA 3L3IB 1U3YA 1KPUB 4XNDA 4H44C 4QY8B 5ITFB 4DFHA 4WRLA 1WZAA 3TJHC 4X99A 2FZ3B 4E0RB 4XP5L 2CDGA 5GSVB 2AJZA 4MMZA 5FUCC 2A83A 1HNZQ 1FH5L 1NM9A 2QQKH 2XSKA 5TE7L 4GUQA 3D0LB 5MERA 1G7QA 5I9QB 1H9KA 1LGVA 2X4RA 2EVIA 4XN8A 2VDKB 3O3AB 1BQ5A 1ZAGA 5HPMB 1YSOA 2BOBA 5HBBA 3RMHA 5I9PA 2P47B 5CJQH 5DRNB 3OKOB 1RH8A 2NTSP 1MRFH 4P9HH 2F1MA 3KJPA 1C5CL 2HVKB 1QLEL 1SXSA 2K1MA 3OV6A 4ODWB 5IYDG 4WU5B 4HR7B 1JJUA 5ELIA 5C4XB 2P45B 3HC0B 1J5OL 4ZS7H 3BVWA 2VQFL 5KSBA 4IS6A 5IGFA 4LOUD 4ZXBA 1E4WH 4G42A 1I3VA 2WN2A 5E6ID 2GTZB 4JRYB 2F0TA 3Q44A 4MNHA 2XN0A 4UZUA 3UTZB 3WEAA 1BAFH 2O6DA 2B3RA 4P3CH 4X9YA 1GKEA 3B2DC 4AV4A 2IX3A 5MEPB 1P4IH 2P9RA 4X0KA 4FP8L 4JRXB 5EBDA 1MJ8L 4WTZG 2EDFA 1KXQE 2FMMA 1T1XB 1T2QL 1KEMH 3P11H 3MNVB 3FQUA 4NO0D 5EUOF 1YUHB 2NY2D 2QPSA 2H9GB 2VDRB 1J87A 1F8TL 4FFZH 4PRNA 2NLJB 3NIGF 1AVAA 1DQDL 4ZO6A 5IW1B 5C8JA 3F2DA 3HN8A 4NQDA 5PCYA 1K72A 1NBWA 1ZDSA 2X09A 2DBJA 2H1XA 3DIDA 3FQ1A 2X4PA 3QUXD 5C07E 1RZ7L 1GUSA 4L3AA 4GQRA 3HB3C 5C7XL 2WAQG 2R2CA 3WIHH 2VQ1B 1UWGH 4OZ4A 4NNXB 1IU1A 4OF8A 4F37F 1MFEH 4EVOA 2PWGA 1K85A 2EDYA 3WJJC 1QFUH 4GRLC 1P5UC 3K0YA 3FT1A 3K2MC 5EU4A 1XNQQ 5M5YH 3AFPA 1S7UB 4JDEA 4PLKD 3SYPA 4KHTL 3UGXA 5I2XA 4X64Q 3MLXH 4WFGD 3PABA 1ND0B 3DMMA 5C0AB 5LMUQ 5AB1A 2P1YA 3ECBA 1ZVSA 4G7QB 1JK8A 4QGUA 4EIGB 5KS9B 2FH6A 5CWSB 1U8KB 4N2FA 2DLHA 5K5YA 5HI3C 3HHSA 3PPEA 5IJCC 3I6GA 3F2CA 1Z0NA 3R7RA 3IMSA 1JORA 1NGZB 4RGNA 2A73A 2E7CA 4WI5A 4F58L 4QL5A 5B1BB 3OF6D 3ES6A 2MNJB 4M4RA 2OM5A 5TDNB 1N8ZA 3MV9A 4JB9L 2R8SH 1OAYL 5AWNL 2V2WA 1GOZA 15C8H 3IBOA 5J9PA 4WJ3M 3HB3B 4JI8Q 1OXUA 1NUDA 1LABA 2QGDA 1AKPA 2XN9D 4RFOL 4A3FB 1I6HH 3BKYH 3BVUA 4D9RD 3EOYG 5CU9A 2ICES 5F3BB 1TR7A 2YFOA 5FR3A 2WSKA 1AH9A 4RH4A 4GRLB 2ICWJ 4F20A 4WFFE 2VLKE 3D0VA 4RRPA 5EU6E 3CDGA 3DXAB 5EU5B 1KXTB 3NPSB 3QG6A 2JA6H 4Z7OE 1QLFB 5TE6L 3D9AL 5D7SL 3FB5B 4PTUB 5IB2A 1Z3RA 1A3QA 1D6VH 3OMAB 2YU9H 4LVOC 4YHYB 3K7AH 3OWFA 3FU5A 4EI6A 3I3DA 1CLZL 1CGUA 3P0VL 1XR9A 3HR5A 2CSPA 2QEXA 3VFOA 5MEOB 2X6UA 4Y8AA 2BOSA 3X3MA 4PVBA 4ABQA 3QBTB 1D2PA 2G0KA 3UERA 5KVDL 4RLDA 2PETA 5G3LF 2EXZA 1IQWH 3S36X 4DESA 4EI5C 1PLAA 1KZYA 2IH3B 1CL7L 5F1SA 4J8RB 1RZJC 5I26A 4DO6A 2OZNA 4RFEA 4N2LA 2NX5E 2FQDA 5JO5B 4U6YB 2R92G 4Y9FA 2QPFA 1OXVA 1RHFA 2KKQA 5E8OB 2Y23A 1JCKA 1EEFD 4PGZA 3SOBH 1HL9A 3HZYA 3MMEA 4NC2B 5HGHB 2XY1A 3AMLA 1UASA 3HZVB 4H26B 4QLRA 1AZBA 5KBDA 5GSRA 1J5IA 3CC5A 4IM8A 3U9SA 4KKNA 1DDHB 4JPIA 2FUQA 1Z5LB 5CV9A 2OI9C 2VAJA 1NMGA 5CP7A 4G9FD 1GHJA 3ZDXE 1AGEB 4EQPA 4IRJA 4B3RQ 4UBDC 4HIKA 4ZO9A 5JXED 3PP4H 4CSZA 5LHDA 2XG5B 3G04A 1F9QA 4FFVC 1S4IA 4F33B 1IBKQ 4ABVA 3PE9A 4POZD 2E7BA 1GS7A 4QXTA 4EI5B 2JEBI 4ISVB 4MD5B 4AIZA 4Y19D 4FFYH 3FAXA 3UADA 1KV3A 3NDZE 1SBBA 4NHCH 1NBZB 5AENA 1AIFA 2KJXA 2G2PA 3HMXH 5HJBA 1LTRD 5JOEA 4FNSA 4HF5H 2RMNA 4JZJC 1EAQA 3HOUG 2SEBA 3QJFB 5F6IB 5HYSA 4KKAD 5IFJB 4ELME 2GJJA 3HJ0A 1YY8A 3SJVD 5EU7C 1GPOL 3VXRE 4K5PA 1HCYA 3RTLA 3ZT5A 2OMNA 3DX1A 5MI0B 1KELL 1QFPA 4JLRA 3US1A 3SQBA 2E8YA 4NUPA 1KDJA 2A77L 1CTMA 4K0KQ 3CGTA 4LQFH 3QQDA 5FCUL 5DUMH 2RCFA 1WBXB 4PJ9D 4FG2A 1V7MH 5EO1B 2LS01 1XAKA 1MNNA 4MTMA 1F1DA 1MHCA 2YPLB 3QXDB 4JHAH 4NQEB 1J05A 1MWOA 4P2OA 4MXWL 2ZYRA 2IPKA 1C16B 1K8MA 1S3RA 3W38A 5AVXB 4OGZA 1QPXA 4PMFA 3A8JE 4LHJB 4ZOAA 3SE9H 2ICEA 2W9DL 1IB5A 5BS0D 5GHWH 3BH9B 1E4HA 4H8PA 2NXYB 2BVEA 2GY5A 4TLUA 4UF7C 2WQXA 3AU0A 4KTDL 2VCOA 4P2AA 5FO8B 3QUGA 4AIXA 4O2FB 1B4RA 2VLRB 5T1KB 2WZ0A 1UE6A 25C8H 4HS8L 4M5SA 1A7NL 2HT3D 3QDJD 4TXVB 1OY3B 3GK8H 3KCPA 2ADJB 3KPNA 3PXLA 5ACZA 3QJHB 4HV8B 1WZKA 3GNML 1ZVNA 5D93B 4Z0BL 5LBSL 1S7TB 3RGVC 2YMXL 4QXUH 2ATPB 3VSTA 4Z7UE 1N5YH 1IBMQ 5IB5A 4HEPA 4U1IA 4UQIM 1WAAA 3NH7H 3VB9A 4C83A 2E7LA 2GJ6E 4XE5B 3V6OC 5NUCA 2XRSD 2P5WE 3CSTA 1QFWI 1QSFB 4XE0A 1MRCL 4DH2A 1ZS2A 1WS8A 3L2NA 3OPOA 5I30H 4NIYE 3ZMEA 1EY0A 3PO3H 1YECL 4OO1I 4OD1H 5E6YA 4AGNA 4UV7L 2K28A 1S7XB 2ADFH 3L3KB 2F0UA 1U8LA 3CQPA 3SYQA 2N3SA 5L2KA 5I23A 3CSFA 2J4XA 3IYLW 5DC2A 3PF2A 1G84A 3RGVB 1J5EQ 2QJDA 2ORBL 4HC1H 2OL3B 3T1YQ 1EAPB 3IDNA 3ULVD 5A7BA 3KR3L 4UU9B 5J1SC 4A2EA 3H7BB 1RKRA 3HFMH 1SDDB 4MDJB 1FFPB 2LLNA 1K3BC 2P7TB 1UOWA 4GKKQ 2GHZA 2RTTA 4YSSA 1KLGB 1SGKA 4KD3A 5A16B 4CJ1A 5IV2A 1CQFA 4JI0Q 2QDLA 1KBBA 3ENEA 3N44F 4D0BB 4EXKA 2VISB 5D7JD 3HOXB 4UB0H 2J1ZA 4DXGA 4U31A 4WV1C 1J8HB 1T5XA 5JPMC 3QO0B 4PJ7E 5MEND 2A1WL 3MRMB 3OG4B 1UUNA 2YJLA 5MP6L 4PGEA 3BH4A 2JK8A 2H1LM 5AW6B 1I4XA 3M6DA 1DVXA