2ICEC

Crig bound to c3c
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
307
structure length
296
Chain Sequence
TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3 beta chain
publication title Structure of C3b in complex with CRIg gives insights into regulation of complement activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 51
structure length 296
sequence length 307
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2iceC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2iceC01
2A73B 3FRPB 1BV8A 2WIIB 1PXUA 2WINB 1BR9A 2PN5A 1XWEA 5FO7B 1BQQT 4FXGC 1UAPA 4ILWA 3T4AC 4LNVA 5FO8B 5JPNC 3G6JB 1BUVT 1UEAB 3MA2B 5FOBB 1EDYA 3CKIB 1JB3A 3CU7A 1GXDC 2QKIC 1D2BA 2ICEC 2TMPA 3I70A 3V96A 2A74C 3KLSA 3OHXC 4D94A 1JC7A 2XWJB 3L3OC 2B39A 5FO9B 2XWBB 1OO9B 2I07B 4FXKC 5JPMC 2E2DC 1AYOA 2J0TD 3HRZC 3HS0C
chains in the Genus database with same CATH superfamily
1IL2A 1TNNA 4RESB 5C4JB 3ZW3A 2RD0A 4HHAB 1HHIA 2X9ZA 1NBVH 3JWNC 3K6FA 2AGJL 1P5UB 4EN3B 3H3VI 1DQLL 1FBIL 4IKIA 3WV0A 4A37A 2VC2L 1L6XA 1M2VB 2YN5A 2EJGC 2QQNL 3GIVA 2YQ3A 3R93A 4C2MB 2MP1A 1TS2A 3QIWB 4MMYB 3U1PA 1BJMA 4JRFA 1V1QA 2Y3NA 1C16B 3N6YA 2OP4H 4HIJB 4ZJ9A 5BW7A 2NX5B 2R0LH 4MRBA 1BBDL 3BZDB 4JI0Q 1X5HA 3NFNA 3NYKA 1IBKL 3ZUNC 3TMEA 1U4MA 3DIFB 4M6AA 3BG3A 4YIQA 1CDGA 2XNAC 4DV2Q 3UG3A 2HRPH 4NC1C 3G9VA 1I1YB 1RIPA 2KOLA 5LHY1 3CC5A 1DBMH 4MNGA 2H26B 5C3IA 5CAYB 5I0XA 4JFPA 2V8MA 4LVOC 2GK0A 3DDFA 4APVA 1AZVA 3TBVB 4IUPA 4KI5D 2BJMH 5KYXB 4YLCA 2J8HA 1N0LB 1LGVA 4PNYA 5A40E 2NTFA 3C2AL 4RZCB 4EI6B 2B63B 3I4NH 5IB4B 4TSAH 3GTKH 5JR1L 1ZWIA 4FA8A 3P02A 4M5TA 2CQAA 2ZX7A 2QSCH 1BD2E 5F7DA 3FOLA 4Y16C 4PJEA 1FQ9C 4UUJB 2LU3A 3MRLA 1YEGH 5I30L 2W94A 1Y1VH 4C83B 4B3VA 1BZ8A 1KGCD 4H0IA 4XVJL 4U6YA 2K5HA 5DK0A 1R75A 1CXKA 3RTQA 3VU1A 1XGRB 1PLAA 2V1CC 4PJXE 3MLRH 4XX5A 1CLYL 4KV5F 3MV8A 4X8JB 4YSDA 3D31A 1C1EH 3SJVD 1B53A 4LLMA 3CMAA 2R61A 3O0LA 3CFMA 2ZTEA 4LEOA 2BP3A 5IB1A 1WBZA 1JI2A 2Q76B 3S1RB 5FX3A 5KSAA 2DYPA 3LS5L 4XAWL 4PMFA 3CCSA 3O2VL 4NQCD 3OKMA 4BDVA 3U1SH 4JI4Q 2BFGA 2HJKB 2UYLB 4ZNEE 2BW4A 3F5WA 3FKIG 1F4XH 1UFUA 2LVCA 4FXTA 4IOFC 5J6SA 3WFCH 4TN9A 1TO5A 4DUZQ 2EDNA 3IDXH 4GS7C 2B8FA 2CHDA 3JV5A 1ETB1 4U6HB 3TN0D 5C0RL 4RDBA 4C1NI 5I9PA 1FNSH 4G6JL 1TWAH 1KYOJ 3O4LB 1N6QL 1DUZB 4XNQB 3DEPA 4XH2B 5C0IB 3DMMA 5KEZA 3ZBMA 1HIML 4OZFH 4F88A 4JK0D 1EBAA 1CO1A 3VQ2C 3BO8A 3LZRA 4OIAA 1IYUA 2QPSA 3D39B 4Q58C 5I1IH 1SF3A 3UTZB 4PJDA 3LZNA 5IHHA 5B39B 1A4JA 3U4BL 3IM1A 2DWDB 2NNRA 4YAQA 1TIID 2WOBA 4AZ8B 4O02A 2H45A 5IWLC 1TLKA 4OU3A 1G7PB 3KLSA 3KL5A 5C7ZA 2YMOA 5D2NA 1NOAA 2F0TA 1XL6A 3CRLC 2BFVH 4MAYB 1EPFA 3KLHC 5CJ5A 3GK8H 4X5QA 4ZLTF 1J9TA 4IIQB 5CCGE 3LEVL 5GGQL 3EFFA 1EXHA 1PKOA 3UMTA 4DKAC 1GYVA 2J6EA 3LVTA 4QT5A 2ZXAA 1FAIH 3ATEA 2XRAH 2BNUB 1LJMA 3GF8A 3QORD 1NAKL 1MXDA 1XMOQ 4OCLC 1PX8A 3GSWA 2L7JA 3QPXH 2EY1A 2LGNA 3RP1A 2AQ3B 3CVIL 2XJKA 2WD0A 2RCSL 3RZCD 3FQRB 1CDUA 3A4AA 4P5KA 5FYKU 3I9AA 3T13A 1L9RA 4LVNC 1CT8B 4OTXH 3POCA 5JLZA 4P2QD 3N2JA 3RDTC 1DQKA 1EZ6A 1XB8A 4R5VA 5H35B 1FO0L 1GZHC 2ZP9A 4CADA 1BX2A 3HS0B 1G6RL 5EO9A 2P42B 1NIBA 2F0EA 2B2XL 3T6QC 4EQPA 2VXQA 4J3OH 4RWYH 4UQ3A 1E9OA 3RIAK 4JFED 4BCXA 3EROA 3OWEA 1LK3H 3US0A 2WFWA 2N4IA 3V4VB 2I5LX 2V2WA 4HG4J 4UQAA 1THCA 2I5YH 5F7LB 5F0PB 3WY3A 2OK0L 4HD9A 4X80H 1MFDH 3TZVB 4Y4KA 3T16A 3H7LA 4IDJL 4J3OD 2APXA 1KB5B 1IC1A 1TJIL 3QI9D 1Z6JT 1SJHA 3B9VA 3FZUC 2Z1CA 1YYML 2XBTA 3KS0H 2C9SA 1MWOA 5C09A 4JFVA 4PJ5E 3ZTNL 4RFBA 4JDEA 1JGUH 1KEGH 1ZT7A 1KLUD 1SN5A 2FEDD 4R7XA 4JI8Q 2VDNL 1L9PA 2JMRA 3NIGF 4GMSH 5E2VL 4HU8A 5CD3A 2DF3A 4CMHC 3M4QA 3QIBB 4XP4H 1MSHA 1G8ZD 1RD6A 2BE5C 2MNWA 2ZWNA 3D4WA 3NTHA 2A6IB 3N1PC 1TTGA 1TZOA 1YEEH 4NQSB 4OQTH 3CXCA 3HFFA 5LMNL 2BP8B 4R5XA 2BERA 3L13A 5IWAQ 3S1MH 5JHDA 3IFDA 4TSCH 3ARYA 1ITCA 2P5ZX 3DM1A 3TZUA 1J1OH 1OW0A 5LBSL 2XTSA 4UAOB 4BH8A 2D7TL 2IPKA 3FHQA 2G5BA 4YZFE 4ZO7A 3MLTB 3DLQR 4FNTA 2BS9A 1JNNL 2JQAA 1FV1B 3A6BL 4N26A 1BOGB 1DXMA 3CQQA 3M4OH 3MFFB 1L5GB 1LO5B 1B70B 3TN2A 1L0PA 1HTYA 3NFSL 4RGOH 3KD4A 1J0HA 5HYJD 4PJ9D 2XKNB 3AW5A 1HXYD 3FT1A 1OARH 4HOWA 1X9NA 4PGEB 5I1GL 1NOLA 1IGJA 5IJBC 4WZ9A 4YNYA 3BRFA 4WHDA 1ZTXH 4GQQA 5C0CE 5C92A 4YH6A 1KAWA 2V5MA 3BH9A 3BSGA 2Y5TB 1T5EA 3HOUG 3CUPB 3H54A 4PS4H 4XN5A 3GJFK 4CC1A 1SMOA 1EEYA 4M1GL 1IGTB 4YHHL 4PJ7A 3X11A 2VDLB 4HEPG 3A67L 5I5JA 5HI5C 4F20A 1MVFA 4YXKH 2W0LA 2CHBD 4Z3HA 4JPKH 5CXPA 4IK6A 4MS8C 2CU9A 4XPFH 2EE1A 1DJYA 5BV7B 4GMTL 4OCXH 5KOVC 3IYLW 1QW8A 2OS7A 3EJSA 3ULUF 4PRHE 1M9SA 1GOZA 3F12B 2LW3A 2R0KH 3C60C 1MZYA 5C0NC 5KTEH 3R18A 4HT1L 1NAMA 1NMBH 1XCTB 4CAGA 3CZFA 5KVEH 3I4LA 2YMXH 4OCSL 5C4XB 5CNHA 1T5WB 4OZGB 4I18B 4A2EA 1FCCA 3F2BA 2VR3A 1K3IA 2X6BA 2N56A 3QUZA 1ZVSB 4OLXL 3IAQA 5A2AA 2KCTA 3ZDXF 3CPLA 4FNPA 3CC2A 2E5EA 5KG9B 1YHQA 4M3JA 1CD9B 4P23C 4TVAB 4UQ9A 4G7OC 1NUDA 5AAWC 4P71A 5FYLE 4HR7B 3MJWA 3UTTD 3FKIH 3QQ3B 3L16A 5C0BB 4WV1C 4F2FA 2QVTA 3K72B 2FQDA 3IGUA 5F8QC 3NPSC 3MV9A 4C4KO 5A43C 4YIJA 4Y19A 1RDPD 4GKKL 5DZAA 4EIZC 4F7EB 1DQMH 5T1IA 1QSEE 3DJSA 4PJBB 4XMUA 5HGHA 4DP5X 4FQCH 4R6UA 4M8QA 4LHJB 3KBGA 2GEQA 4WO0A 3OR6B 4HIHB 4KI5E 3RUGA 1JMCA 2JIXD 4LVHB 5IJKC 3IPFA 1K83H 4RIRA 1F1DA 2LV4A 3U4EB 3MKGA 4PRPB 5AWNH 4WKZA 1QNZH 3U50C 1EYGA 3OKNB 2BSCA 5JZ7C 4PJHB 4QNPF 2FK9A 2Y24A 3KK7A 3JTTA 4F5CA 1YNJC 2N7SA 3MI6A 4MNQB 5DJDA 3RUZA 4BZ2A 1QFUH 5IVXE 1QBLH 3ABGA 2ASBA 2LSSA 3BGMA 4PMBA 3QXDA 3EO1A 3VI4F 4KTGA 2XVSA 1KGCE 5AFWA 1NCTA 3GBEA 1A6WH 4ANVA 3U0PA 1N67A 4HVBA 2BVPB 5CIPA 4DR5Q 1CICD 1R3KA 1RLWA 2IANA 4XCFL 1NDTA 4HWUA 2FQFA 1HZLA 1YCSA 3SJVE 4J3VA 2L0CA 2KZBA 5E8PB 1O80A 1PVOA 4PV8B 2XSKA 2VLJA 2VE6B 1YMHA 3AQYA 4CN6A 5K9OB 4JFDB 4XBGB 3BVTA 3N9GH 2E7BA 4M1DH 4POZD 1X5GA 2EIKB 4AQEA 1UD4A 2BIHA 3HB3B 4NQCE 3NEXA 1HC1A 3SDCB 2LAGB 5CJQH 3MZGB 1XXFC 3T2OA 5AG8A 1JDDA 1QRKA 3ML8A 4PLOB 1PG7W 3IMTA 4NM4H 1QWNA 2O30A 3QG7H 2W9EH 4M5ZL 5BMFL 4S0SD 3REVA 3CAFA 4ZFZA 3HMXL 4W93A 3TYGH 4X9GA 2C7UB 1MCOH 1NC2A 3V4LA 1D5MC 4U1JB 3HOVG 1M1KC 3DVIA 3GM8A 1ORQB 4U3HA 4ALAC 4H88H 4U4IA 3PWLA 5E4EC 4ONFH 1M7UA 3PNWA 4KBPA 5JPNB 3W39B 2NR6C 1OSZB 3QQ4A 4U33A 1D2BA 3TFKC 3NA9L 4JI6Q 4BY1B 3D2UB 3IJYA 5A3ID 5I0DA 1UA6L 1U2CA 3OAZK 1K4CA 3T0ED 4FFZL 2VUMB 3GMNA 4MVBD 5KUMA 2XIIA 2VZUA 3I02A 5EOCH 4L37B 5MERB 3GTQH 3B8SA 2J1YA 3VD1A 3CCJA 5I74B 1WE5A 1WI5A 2MTPA 3KM1A 2GUYA 3L54A 5K9QG 2KUTA 2EZ0D 4R26L 3D07A 4OCWH 3PUCA 4FQIL 4X50A 2ZX9A 3ULUC 1F6LL 3IU3B 4ONHB 1XDTT 3CN3A 3ULJA 2VKWA 2JXMB 4OZHB 4BFKA 1UWEL 4Y4HA 1W15A 3CDCA 4OGYH 2GKIA 1NR2A 1HJPA 4X66Q 4HLJA 2CWAA 3ETBJ 3L3DA 4DV0Q 1U93A 4E9SA 3TESA 2E5LQ 1SGKA 4WLCA 1BSIA 3TPUB 1M05B 4NZRL 1ACXA 1S9XA 5JXED 1CZ8H 1QSFA 2NNCA 2WAQB 3M17A 4PIRF 2Y0SG 3NMEA 4X4YA 1BCPF 4PZ6A 4FFTA 4IRJB 4LP4A 2Z91B 5AVRB 4X7TA 4M6OL 1HSAB 2EO7A 9PCYA 4OIJA 1A9VA 2IADA 3DRQB 5EPMA 1ID5I 4Y88A 1A02N 3RWFA 3TCTA 2YD7A 4YBQD 5F70A 4IUUA 5C4ZA 2OMBA 4DO4A 1ZVHA 4QLWA 1F8TL 2ADIA 4P2QE 4MJHA 2Z64C 2MPVA 3GXFA 5D7JB 1WYDA 5FOBB 1E8ZA 3VFPA 2YRPA 1KCVL 1MCSA 2KLTA 4QJ4B 5D2LA 3JAMi 3FQWA 1RPQA 4F7PB 1OQXA 5DQJB 2D9QB 4F7MA 4EQNA 1WCMB 3HOUH 4EQ3A 4JFEE 4DAPA 2L7QA 4WDIB 5D8JH 1OV8A 3L3GA 4JFOB 1NCBL 2NN6I 2BOCB 1Y0LA 5JW3L 3A8JE 5BN5A 3Q44A 2EKSB 1U30A 5FM5M 4GAJL 4XYOA 2EH7H 4IBZA 2YS4A 1Q1BA 1BVLA 2DKMA 3MOAL 4X8XA 1PH7A 2DY8A 3Q2CA 4HFWB 1RXLA 5D1XB 1D5BA 2BZDA 1SDAB 3D4YA 1LTTD 1ZA3B 5IHLB 3VI3E 4IMKA 2BWDA 2ZIDA 3EBEA 5C0GA 1BVKB 2Y2TA 4M8UA 4XGZA 4HZLA 1Q12A 4XE0A 1WA2X 4XZUB 1AC0A 1EAQA 1I1AA 1MJUL 2EVBA 4EI0A 2HDLA 1X5JA 2EEAA 2PP8A 3MHBA 1UXMA 2ENQA 1M2OA 3SE9H 2EYRB 4XNYH 5JA8B 1CYXA 5DGRA 1E9QB 2NQ3A 3JWDC 5D7IF 1ZHKA 1CTMA 3BVXA 3HMWL 5BR8L 2Y1ZA 1FNUA 3HAEB 1GZPA 1I9RH 2GBUA 3ZTDC 3GSQB 1Z3GH 1SQMA 5JW4M 3JWNG 2DMHA 5J6GA 2YRZA 1A7OH 2H3NA 3VG9C 4FA7B 1PYSB 3H0TA 3EFOB 4XCNB 1ZLSH 3HVNA 5DQDH 2J1KA 5F7NC 4M48L 3M46A 5I1AB 2F8XC 4WW2F 1QZGA 4Y5VB 1IGIH 1TZIA 1SYEA 5CGMA 5FV1L 3UAAA 3ARSA 2YAEA 1F90L 3CMGA 4YDZA 4BE5A 2DTMH 3MFGB 1XV8A 4QIWE 2K1BA 5ELCA 4PJIF 5DHXB 5FM5O 2BS71 2JSFA 3T3PB 4OCRL 4LCYB 3LB6D 4LLDA 1FFPB 3ALXA 3BXNB 4JRWA 1DVFA 5TDNB 3T51B 5I76B 4F7CA 1HK6A 1TVBB 3OTOL 1JHTB 3OKDB 5JW4N 2NVTB 1BQSA 1JGDA 1ZTXE 4HJJL 2N8NA 3F1ZA 1P9MA 3BZ4A 4AUYA 3OQ3B 3EJYC 4K5NA 1ZSDA 2BVEA 2ZXBA 3FU9A 1WGOA 1Q0YL 1WA1X 1A7NL 5I75C 3BSZH 1TFHA 3DV4A 4BZ1H 2VW6A 2R93G 3D48R 1NGWA 3PQYA 4HS3B 3BESR 3GMPA 3JWOL 1INDL 1TSHA 1P4BL 3NA4A 5I5MA 2GHZA 2NY7L 5TE4H 3KNBA 5L2JA 4LCVA 1OAXH 2XJLA 4NHCH 1FO0B 2W9LA 5DJYB 1TZHA 3ARFD 1G6RB 3IGLA 4DAGL 2NYZD 5D1QD 4TLTA 1KXQE 2X69A 1KT2A 1CDYA 1D5IH 1KSRA 1N3NA 1VCAA 1B9KA 1YPZA 2CPCA 4G71B 2RHSB 1GGIL 4PJAB 3NACL 5DI8B 2YMTA 5BRZB 1OXSC 1EIBA 1S9WA 1C4QA 3OGCA 5F7YC 3UG4A 2WCPA 3FO9B 2FWOA 1XT5A 4XNAA 5LXGL 4XHJC 4K5WA 4M7LT 4Z7VE 2Z4HA 3ZTCC 1EO8L 1NDGA 2Y6SC 4DN3L 4H8HA 2BCKB 1R3JB 5KVFH 3MLUL 2EIDA 3WTYA 3HUJA 3C5ZA 4C1NK 3HOVH 2J7ZA 2K6ZA 3IE9A 3OLIA 4S3SA 4FXGB 4PY8J 2R1YB 1JHLH 1I31A 4PJCF 3LPGA 2ZXRA 1YY8B 3DHUA 1A64A 4L4TD 5DO2C 1XF5B 2VDNB 3F84A 5E5RB 4NQEA 4DETA 2UUCQ 1U41A 3DUUA 3DX7A 2IAMA 3N42F 2Q7AA 5HDBE 5T1MB 3RIAF 2CH8A 3IFOB 5MEPB 4Z8FL 4WNSA 2E74C 1UYWL 4P59L 4TTDD 1MHPH 4FHJA 4RSVA 4P2OA 2Q20A 1W6KA 2CKBH 2WQAA 2Q8IB 3SOBL 1I4FB 1X7TA 4FFYL 4P5MB 4XQJA 2Q3ZA 3NCYP 4GEJA 1AR1D 3ECBA 4H8WH 4X5XA 5GSRA 4DN4L 4OJAA 4Z95L 1SYBA 4RQQB 4GLRH 1ZKAA 5LMUQ 1BBJA 2DLFH 4Q6IA 3CXHJ 1FNGA 3SCMC 3CPWA 2EYTB 1J9RA 2FJUB 3SODB 3RX5A 2P5WD 4U1HB 3V7MA 3MO1B 1XF3A 1HH9B 2X70B 2A6DA 3KR3L 3U4AA 4FTVE 3ULVH 4ODSL 1XSIA 3U2JA 4MB3A 5HHXH 1S9YA 1UXWA 3SSGA 1IBGL 1RZKC 1KELH 2FWLB 2QQKL 1B0WA 2CBTA 2XX1A 4JN2A 4DKFH 5EJWA 5I1EH 2V5RA 4AH2A 3HE6A 2XQYG 3HOWB 4C2MH 2CO6B 3UAJA 1K8GA 3WXWH 3TXAA 3KYMA 2WO3B 5IEHA 2R6GA 2P52A 1H9SA 4B53A 3ULVD 1YEHL 2WGNB 5T1LD 5T5FL 1DZ0A 3V10A 5FGRA 2JCCE 4G8GA 2ZAIA 1U6AH 4MDIB 3NIFE 3UTOA 3SPGA 2HT3D 2JA5G 3VXTA 2EXWC 4GBXB 1I6HB 3X14B 2B5IC 5ALBL 3HE7B 4OZIB 4S2SA 4ZW6A 1BXXA 5JDSA 5M3FB 4WW2C 3S4SG 4IBYA 4PJGF 2E9IA 4JZOA 2YD3A 2ICEB 1J5OL 2MRYA 1ZLVH 2Y06L 2DQTH 1GXEA 3BQUB 2IWFA 3HPJA 4DNLA 2AJSL 4C56E 3S1QB 2FQEA 4R96A 4CUCA 2DM7A 3B9AA 3OSVA 2JK5A 1UJ3B 2DQUL 2HN7B 2UWEB 4H20H 5EF1A 5CC4A 2HFGH 3CFEB 5AOMA 3CW2C 3T0EE 4LF7Q 3G6AB 4Y0GA 4X98A 2NY6D 5TPWL 1DLHB 1EJ6A 3SBQA 2JE8A 4A3IB 5D7LB 3WFDH 4X0KA 5D5MA 4ZPVB 5CKAA 3KXFB 1TWHB 2IFFL 3TO2A 4AMKL 5D71L 1G5GA 5TTRA 5DA4A 5LAXA 3WU1A 2F3VA 1NSNS 4ILDA 4R7DA 1MFEH 5ERWB 2WXGA 1NIAA 3FQXA 1E3ZA 4NO0A 1B3JA 1CGTA 2AK1H 5F3FA 1R1CA 5KBNC 4Z7WB 4DKEH 2FL5B 5E4WC 1CKMA 2F0HA 3QGVA 3RGBA 1SYGA 3TIEA 1NY4A 3PO3B 4PJ8D 5LGHH 4PCKA 4L05A 7CGTA 3CLFL 1OGAB 4I3SH 3RGVD 4K8RC 3WJJA 1AFVL 5CBEA 1V7NL 3L1FA 4GKOA 5H94A 5F0JB 1B0GA 5EU6B 5SWZE 5J5EA 4WY7L 4MWFA 2FEEL 3QUYD 1QAWA 3JWNH 3VH8A 4CDCC 4HHWA 4ZS6C 2H5XA 3UABA 4QGUA 3GTLH 3CHSA 3E1F1 3FRUB 3ZPDA 2J4WL 2P47B 1JYXA 2IL8A 1VQKA 1N6UA 1TCRB 1ZEAH 2E6QA 1A1OB 3KYKH 4P8QA 1AGCB 1JVKA 3DJRA 1G7IB 1MDTA 2YK1H 3B9KA 3BFQG 1H5BC 4Y2DC 5E5LA 4NO3B 3IJSB 3S9WA 1KJMB 5J6HA 1BM3L 2XN1A 3QUKA 1N0XH 2VAAB 3AWEA 4IHBA 2KZ1B 2CDGB 3Q8CA 1LE9A 1YUHB 4KUZH 1E8XA 3PIOA 4OF5A 5CP3A 1J05A 1FFOB 2K78A 1RJYA 5GHWL 4HFUL 4QRFA 2RALA 3NBHB 3L4TA 4PRDB 5EO0A 4N2CA 3CFNA 5LCVL 1LV9A 3L3JA 1UUNA 5BOPA 1IGFL 3VD4A 2Z35B 3L1EA 2R93H 2NY5C 3F7VA 3F2DA 3U9PL 2P8LA 3VCLB 4WJWA 5IB3B 3MRGA 1CF8H 4N6RA 3T8XB 1A3LH 4LDLB 4BSJA 3DA0A 2V7HB 1BGXH 2XFXB 3QNYB 2B2VA 2AJ3B 1I85A 1XZWA 1QQDB 1XCQB 1EFXB 1NJ9A 1P7QA 4XC3H 1HAUA 2PTVA 1SM3L 4PEEA 5J57B 1SJEA 3VWJA 4R97B 2WTRB 5HHPA 4TSBH 2EVIA 3Q8BA 4QRPD 3EG9B 2YIHA 4WSKA 3N1FC 1YC8A 1U2YA 3PHOA 3PREA 3FFCB 2FMCA 5GAGC 4XWOD 2W1NA 1NCOA 1VQNA 1YJDC 2QSQA 2NY1C 4J8RA 2Q2EB 3QZWB 3MRNB 1AQ8A 2LE9A 4ZMAT 1QWYA 2Q7YA 2AV1B 1KN4H 1EFQA 5JIKA 2Z93B 3WIHL 3SGEI 4ME3A 4WRLA 3TNMA 3WMPA 1FIGH 5ID0A 4MCZB 5IYDG 5M5XB 3EYOA 3Q48A 4FQ2H 4TUOA 2X4NB 1JERA 2F08A 2F4IA 5C8JB 3CVDA 4KTDL 5DUJA 1XIWA 4NCC1 3UBXB 1DN0A 4CJ0B 4GAFB 4M7KH 1XBRA 3KH3A 2CKNA 3ZHDA 3B3BA 1IE4A 3QUXA 4FL4C 1HQRB 4K5LA 3FTWA 4JZNB 4I0KA 5IBUG 4KNTA 4QRSB 2WSKA 1BFTA 4A7SA 4LE8A 2DICA 4KDWA 1A9EA 1C08B 1IC4L 2CLRA 4G43A 4IMLA 2GG1A 2ZOKB 1T0OA 1U3NA 2A6KB 1HQ4A 1V3KA 1JWUD 2J73A 1EQVA 1OGTB 3HZXA 2IV9A 5DUPL 2E2IH 3VFSA 3OPOA 3PS6A 3RGHA 1IEAA 1XWVA 1BZ7B 2HZHA 4F3FB 2J72A 1WT5A 3MSPA 1ILQA 2KERA 4L0ZA 4D8PB 4IOFD 3SKOA 3PWUB 1LK2B 3ATFA 4DGVH 3W3AA 5L9DH 4FLSA 3GDEA 2VMDA 4LGSB 1PF3A 3U6RA 5IGXL 3U0WH 4WI4A 2FAUA 2GJ6D 1WP6A 3L9BA 2F54B 2IH3A 2VLRD 2EUVA 3A24A 5MHSD 1EK3A 4J8QA 3GMMA 3RPKA 1UXLA 3PGCA 3RZDB 2BIIA 2FD6L 2VH5H 4HUXB 1TKWB 2HLFC 3EW3B 4QWWC 5D1QE 5TE7H 2Q87A 5HYJB 5L0QB 4M61A 3PHQB 4H5SB 2JA8B 4IOIA 4N8VA 1RUQH 4I65A 3FN0L 3QJHA 4XMKL 1MJCA 3ZN6A 4JJ5B 4J3SA 5BXFA 2O5ZL 1CIDA 3NEEA 3WGVB 1BBXC 2NY2B 5JEAJ 1WJ3A 5T3ZL 1U95B 4XP5L 3BWSA 4GUOA 3DX0A 1W72A 4LKXB 4Q9BA 1BG9A 1DBBL 1P0SE 5HI4C 2JA5H 2J1WA 2EY6A 4DV6L 4NRZB 2DQDH 2RR3A 4MAUL 4HH9A 4LAQH 4L3FA 1QLEH 5C7XH 5C3EG 2PUQT 1AHMA 5IMOB 5LL6S 1HNXQ 1JWSA 3ARDB 2W07A 3C6LD 1HDMA 2VDMB 4N1HB 1UT1A 1L9QA 2BOLA 3BKJL 3L5WB 4PRHA 4ELMB 3HKZB 5ACZA 5IFHH 5LG6A 4Y2LA 2EYHA 5C3WA 1LO3L 1XGYH 4GNKB 5KVFE 3WO4C 3CCEA 1JHKL 3L6FB 1UE6A 3LPWA 3C9NB 4A68A 2SNMA 2BCOA 3R3OA 3L5HA 1S7SB 3ZZLA 5J89A 4OX9Q 5E1FA 3OJDB 4Y8DC 4CRPA 5EEWA 2ZJSL 4P4KC 2KECA 1Q7YC 3NESA 4NXML 3AWFA 1YDPB 4R7VA 4WI9A 4MTKA 1LP9E 5EOCJ 1QEWB 1D8LA 3VXUB 3I7FA 3UTTB 3W2DL 2W80C 1G7MB 2J25A 2P5WE 3EJTA 2JJTA 2FCBA 4NFBA 4LLAA 4C3JB 2PO6B 3MRJA 3V9EA 3ERSX 2OZ4A 3MVVA 1I9JH 2G4EA 3OAYK 3QHFH 5E00A 3I72A 5ABZA 4DR6L 1RK0A 2HT4C 5E6RB 3QQNA 1ENCA 3BQVA 3ZQWA 2YXWA 2JQOA 1AOZA 3EO0B 3BVVA 3KJPA 1TENA 1WA0X 3D7PA 1QSEA 2W91A 3NTCL 4K23H 5EB9A 3RDJA 3O6FC 3H9YA 3V7AE 5IBLC 1BA9A 1IU1A 3ULVE 3CZKA 3V55A 1I3UA 1RZ8B 1GC1L 4HCSA 3PL6D 4K73A 3CSFA 2EDGA 2RCNA 2JA6B 1ZE3H 4PY7B 4AEEA 4Y1SA 3FZUD 1G1OA 3KLAB 2Y0SE 2F4VQ 1WZ1L 3AY2A 2QEXA 3D85A 3MBXH 4JDTL 3OX8B 4RGOS 3GV3A 3LKQB 3RNKB 2B4CH 5BQ7B 4J3BA 1KB9J 1K73C 2NX5E 1O6SB 3DSFL 4XP6L 3WIFB 4E0RA 2BIMA 2BSRA 2MOVA 2YQGA 3J8F7 1QD0A 4W9HC 3U9UA 3B5HA 5C08B 5IVXA 4OV5A 3NAAH 2XU9A 3JT2A 4AL8C 4O9HH 5IHWA 2NY0B 3QG6B 2Q86A 2N01B 4GQ9L 4XXDA 1XCWA 1R0AL 4Q6KA 4Q9QL 3SY0A 1PIGA 2MHVA 2FLRT 4A3BB 5F6IC 4JM4H 1AZPA 3SDDC 1QI3A 2X4OA 4MNHB 4JBKA 1G94A 1H6UA 4NZUL 1AXTH 4OLUH 4OVVA 4QRBA 3KPRB 2LTQB 4DVBA 4YPGA 4RAUC 1AO7D 2APBA 1MY7A 1KXLA 4XCYB 5T5NF 3ZDYB 3MQIA 4P07A 1SY6H 1PG7L 3VXRD 4YUEL 5A16B 3NENA 2A2QT 4XDXA 4A3GB 1EEID 1AIZA 1VACA 1MJ8L 4FYSA 3UFIA 5DMYA 5GS1B 5E8NA 3MA7B 4XYQA 4Z77B 4KK8C 3R7QA 3B2UD 3WTSA 4ELDA 4GRMB 1R9TH 2P46B 3OHXC 1WAPA 2F1BA 3ZTEA 1DVUA 1TG8A 3QO1A 5CU9A 4E9RA 5CU5A 4KY7A 3DX6A 4KJYB 2G0KA 3TPKA 1D1KA 1D5ZA 3L4YA 3OHMB 5EPKA 3QG1A 2ZJQA 1U4RA 4PB9L 4NSKB 3Q2NA 2VUYA 5GJSH 3AGWA 1F58H 2BVQB 2D3VA 2KCMA 5KBKA 1G84A 5IYDH 4M8AA 4DUYL 3NWSA 2AEIT 2QKIA 4ZD3L 3RNQA 3WUWA 2A9DA 1DQIA 5FA4A 2X3BA 2R2HB 4KKCD 5DZVA 4GG6E 5MEQB 5DZ9A 1UZ6E 3VSQA 3M6DA 1I7ZB 3MA2B 1OXYA 3JWNE 1E4WH 5FKAB 4A39A 1JB3A 1G9ML 3H9SB 5LWYL 2N0KA 5B1KA 2WBJA 3FT3B 3J07A 3RY5A 5H2BA 4HIOA 1TXYA 2AGJH 5HDLA 3D4ZA 5PAZA 1XVSA 2I69A 4V1DB 3VFWA 2F18A 2VC2H 4HS8H 4N20A 5EU7C 5C07D 2QQNH 4JHAH 3TIDA 2ZG2A 4HKBA 2OCEA 2ED6A 1PX4A 5J56B 3KCWA 1S4IA 1MKFA 3W1GA 4QRQA 4ZKCB 3ECWA 4LARL 5ECJE 3TWYA 5I8CA 4QHNA 1KJ2L 4OCYL 1O7SA 5EPLA 1IBML 5DVLA 4BIKA 1DDTA 1NCHA 4DV3L 2MHAA 5EV7A 5KNBA 5BUPA 1H9VA 3IFLL 3Q5YA 4N2EA 5AZEH 5I1LB 4PCTA 3JYBA 3LRSA 1DYQA 4DPGA 1CA5A 3WUZA 3TO2B 2FATH 4QRPE 5CHNB 1ZVYA 4KXDA 5CP7B 1YUKB 3A0OA 1MNUH 3H3VC 4JFSA 5ICXB 4KFMA 1SYVB 5SV3A 1PZBA 3ZVVA 2HFFB 3EYVA 4JFHE 4GY4A 5CGYD 2BLFA 3GSNB 1TR5A 3VQ1C 3F65A 3KWTA 1H3UA 3S15B 1YNJD 4X8CA 3QIUB 2E75C 4YE4L 1AS6A 1O7DC 1U8IB 1W9XA 4N3TA 3KLLA 3MRQB 2FJFB 4YSRA 2IWGA 1J87A 5C3EH 1I8KA 4JI5L 2QQLL 5T33H 2K01A 5KYUA 4HHGA 4NOBA 4P72A 3T6VA 5DHVH 4ZAIA 4A3JB 4F87A 3CQZB 1HZHL 2YXFA 4HV8B 2ADGA 1KULA 5JOFB 1XR9A 4P3CH 2A73B 3D09A 1M4KA 4KXBA 4PV9B 4IBLT 1MF2L 2RF4A 2Q3XA 3IDYB 4Y5YC 4GSQA 4L8BB 3GSRA 4D3CL 25C8H 3FQ2A 3LD8C 4QRRD 1AGDA 1OK8A 4EVNA 1Q9LB 4IRZL 1MGSA 3T1HL 1UM6L 4XCEA 3L4XA 3SPVB 3SPIA 3NSJA 3L9YA 1KTLA 3LRGA 4X7SH 4KKTA 3NDYE 3SGDH 3BN3B 5TF1H 3PAZA 3LS5H 5L4FA 4S1QL 3T3ME 4M6NL 4JREC 3SBWC 2GJ6E 1F4WH 2VLRE 1JJGA 2UY6B 3ENEA 3VA6A 3ZHNA 4IGBC 4W4OC 3N3EA 3PV0A 2UUBQ 4Y1AB 3HBQA 1PH1A 2E4FA 4G6JH 4A7GA 1U3JA 5AVZB 2FT6A 3E9IA 1ANUA 4PW9A 1N6QH 2CHXA 4K94L 1YIJA 4NGHH 4FC3E 2DEYX 5BJTB 3NFPA 4JDZB 3TFKD 2AUKA 2YPVA 4XNZC 2CDFB 1AGFB 1ODAA 2WXKA 4MQXD 3VGEA 4AC4A 3RA7L 4KOBA 2Z9HA 4CU8A 4U1KA 4DKDC 4YBLC 4D0DA 1DGSA 2N55A 3SGKC 3WXVL 2EYLA 1T7YA 5LLIC 2EUXA 4XXEA 3J81L 2CZNA 1AD0B 2XGTA 3QR2A 1F13A 4FNLH 4GKNB 3ULUD 1NCVA 5BVJA 1QR1A 4HQQH 3FRPB 1U3HB 5HD8C 2OXGA 2ADJB 4MAZA 3UZEC 4UBDC 3MLVH 5HURA 1UAPA 3LEVH 2F03A 1Z9SA 2X6VA 4ZUVA 2QELA 3TVMB 4B9YA 3WCYA 3BP6B 3IJ7A 3DO4A 5TGBA 3OKKB 3OQRA 1GUTA 1Q94B 1SAPA 4QGYA 5J3HC 1KBKA 3L08A 5JMRA 3Q24A 2GVYA 1LTAD 4DNRB 2YSSA 3FFDB 1PZ3A 3KWVA 2CR3A 3CVIH 2P45B 4RSYA 3UERA 1MJEA 5HGAA 4A6YH 4AQAA 3ROOB 1T89A 2AQPA 1MWAH 1BOSA 1TQUA 3GIZH 4AYEC 4JFFD 1JPSL 5JNYA 4WCYH 2R7EA 3W57A 4X62L 1TETL 2K28A 5AOZA 2CSPA 4UOW1 3VAEA 1KIUB 1KZQA 2QMKA 2K33A 2AANA 1DQDL 4E41B 1QPXA 2A1WH 2WYHA 4H02A 1NLDL 1N2RA 4FG6C 4QLRA 3E9HA 1A0QH 2EKJA 3KF6B 3QHZL 3H56A 5KIXA 4L4TB 4M9PA 2EDDA 5LGYA 2NB0A 2KHJA 1AW7A 3DUZA 5KSBF 1HEZB 1SXSA 1TPXB 4PR5B 1G4RA 1CURA 3EDKA 4KH2A 5EH1A 4AC2A 2ED8A 4B3RL 1LVEA 1X3FA 3ZDZB 2OK0H 1IB5A 4KZEL 2F19H 1KCKA 3BPOB 1IQDA 4YX2H 2O61A 1B4TA 2AK4B 2Z31C 5L4JA 1TJIH 5B1BB 1DJGA 1EIYB 1X5IA 2G5UA 1PFMA 1TS3A 3D69B 4KROD 1N34Q 3NCBB 5J22A 3BDBA 4JRYD 1XGPB 1NEPA 3QT2A 5F3HA 3K5NA 4RFNC 5EWIH 5CYUA 2VMFA 1K2DB 3CE1A 4L8DA 2YWYA 2GC7C 5EUKB 2XN9A 3QDJD 3RI5F 3O9WD 4EVOA 2RQXA 4CDDC 4FTVA 3GXPA 2P8PB 4PJBE 2O6PA 4JY5L 4PGDB 4KPHH 5E9DB 5E1QA 4F91B 5HHOB 3K0YA 1ZAGA 1TZGL 3MJ9L 4MJ6A 4RX4A 4ZOEA 5LBSH 4LNRB 1KLFB 1KGJA 3W0WD 2D7TH 4DP9X 3Q1SH 2Z92B 1G4MA 3WSQL 3MRIA 3V4PB 1E2WA 4ODTL 5L2KD 2K7PA 4X6DF 5TK4A 3N50A 1AO7E 2J2ZB 4B9IA 3OR7B 2XETA 4UOZA 3KOJA 1SBSL 3P4MA 2GITA 3VXRE 2XXFA 4ZYKA 3BZEB 2Q2TA 1AKJD 3UTQA 4UT9A 3WEXB 1JZ4A 3M1BA 2AI0L 4QOKA 1OT2A 1JZGA 3AT9A 4XODA 2LFEA 1T0MB 3VGDA 1KIRA 1MUJA 1GTFA 2VR4A 2ATPB 1FNFA 3KJ6L 3HR5A 1PL3A 2XV3A 4UMGA 3ZE0B 3N1QC 2ZOTA 4X4KA 4MZ9A 4M1GH 3S97C 4O58L 1RUKL 3VG0H 4C56A 4APQD 4KO9A 5E2UL 3EJYD 2OT2A 3A67H 3U30C 3GLEA 3FL7A 4G83A 1VQJA 2YPLA 3MGAA 3BIAX 1CBJA 1L1OC 3AG3B 4XTRD 4HIDA 1MI5B 1JPGA 2NDGA 3CZNA 4MYWB 4OD2A 4JO1H 2CO1A 4L48A 4NNXB 1N64H 4ODHH 3WLBA 4B3TL 4M62L 2AJYL 2E9JA 1R9FA 5EKKA 4MMZC 2WK2A 3IS1X 2A4CA 3K2UH 5GGSB 3ABLB 3B3IB 4U2ZA 2GA4B 1MZZA 2YKKA 5DZPA 5C07E 3VUAA 5H4ZA 4DOHB 1BCPD 2TSSA 2L55A 4JGMA 1LT4D 4X6AH 4HUUB 3B5TA 1LEIB 5JHLA 2YZ8A 2FIKA 4NYLA 1R5IA 2V0AA 4XHJD 5F3BA 3AU7A 1QFWM 4LCCB 4FDBA 1E5ZA 5SX4I 3I4MG 2I5HA 2EDBA 1VFBA 4KMQA 5SWZA 1UUSA 3QO0A 4EN2A 1V54B 2FUQA 4GO6B 3DK2A 4PH8A 5ESAA 2CMRH 2Y22A 3TP8A 1JV2B 3IXTB 5EA0H 5KANI 2X53A 1E28B 4IOCA 3D87B 4YSSA 2DQIH 3ZYZA 3GSUA 4PGJA 3QRGH 4H1LG 5KYNA 3VXOA 3TS8A 1IKLA 2WZ6A 3ELQA 4PLJD 5D6CA 3OPZL 3PJSA 4PGCB 2B2TA 2WIMA 3TWCL 3MRHB 3LXUX 5D96C 1J8KA 3WHE1 1P2CA 2RAMA 2CM5A 1I4GA 3ZQXA 3MLSL 3WFBH 5B38A 3OKYA 4G57A 2K9UA 1I3VA 5DD5L 2A68C 1AJ7L 5HHQA 3L9RA 1MHHB 5HGQA 1TWGH 1KGXA 2P5EA 3W9EA 3F58H 3FO1A 3K7AB 3I6GA 3UPRB 3GXUB 4A3EB 2YGPA 1KPRA 4YSEA 4ZAKC 3S8FB 3E6HB 3BAWA 3D0LB 3U2SB 2XNAB 1IE5A 4JPWH 2UXCQ 4FYRA 2EXDA 2ZPKL 3QB7C 5HVFB 2BC4B 2OLDA 1L3WA 1BDYA 1GOFA 4AVKA 1HZKA 5HP5A 2DQEL 4QRRE 4LVOB 1Q46A 3Q3GA 2YUWA 2OMXB 5COYA 1GGYA 3STLB 1CDHA 4XQNA 4MSWA 5EEZA 2CPUA 4LF9L 4F8LA 2F6AA 3WJLA 4GUPB 1YNTB 3HS9A 1NMAL 3KPLA 3WNOA 3NN8A 1M7IB 3F83A 2MGSA 4ENZA 3U6XA 1N6VA 3MJ7B 5DS1A 3WMSA 2EXWD 1YNLL 3OSOA 3SVMA 3IDUA 4PP2A 4R90L 5KSBB 1RUMH 3JV4B 3R7RA 3QJYA 2R4SL 4KTYA 4OJYA 2P80D 4IKKA 4Y16B 4DP4X 2B3GA 1Y8NB 1I82A 4JN1L 3BFWA 5IW3A 4Z7OF 2X4QB 2XWDA 3HHSB 1V7ML 3MRDA 1HE7A 1YECL 3C2SA 3WFEL 3DO7B 5CBAB 1ZXTA 1K6QL 1EY7A 2EIBA 1GKOA 3LXCA 3INUL 2GSIB 4FFZH 2R0WL 1OB1B 1MVYA 1LT5D 3GJEA 4LFHG 4TNVF 3OBAA 1AGBA 3CH8A 4XXCC 4AYFB 2AXWA 3DVNB 2NRDA 3E8UH 3ILQD 3L3OA 5F7EH 4K8RH 4DK6A 5KAQG 5EEXA 4HN7A 3H4HA 4WW1B 5EQ0A 2HFEB 2GTZA 3TJPA 3CD6A 3D18A 2Q6WB 4FQIH 3SEPA 5K39B 2A74C 3MCKB 1IZJA 2XWRA 4GS7B 2A99A 2DWXA 1J5IA 4Y4FC 3OJVC 7FABL 1PTOB 3WIIH 1QRNB 1E4XL 1XMEB 3BLBA 4FP8H 4X6BB 1KBGL 4K8RD 4GOSA 2X2HA 3CTTA 5DT1L 1NGXB 2NPLX 2MMXA 2OKMA 3QUMA 4L8CA 3ETTA 1NPJA 1DONA 4KY2A 1ZLDA 2YAHA 5E99L 4NWTH 2F58H 2FR4B 3VFVB 1AQKH 4M6OH 1AHWC 3KF8A 3SE8L 3U46A 5CLYA 1A4AA 2TRHA 4KJWD 3C12A 1WTLA 1N32L 1P69B 5E6IA 5D72L 1TWFB 3QC5X 1BLNB 2E2JB 1BQHG 3CH1B 3WE1A 3KGSA 1KTCA 3FOMB 1BOYA 4Y2DD 5IHUL 2CWPA 4BXXH 1GGBH 2OA9A 3PWNA 3TH2T 2NY4C 5ILTH 3KEDA 3DUSA 1T4KB 2DMCA 1VFOA 2NNAB 2HCCA 3FMGH 4PJEF 5F9OH 3NRPA 4Z7NF 4WF7A 2VW4A 3HC4H 5GISL 4MLSA 4TRPL 2VDRH 4JZJC 3N1MC 2WWNA 4U1IB 3JV6B 1HE8A 2YPKB 5FFOA 5JW3H 3GMLB 3ND8A 3STBA 4QNPE 4W70A 5MI0C 1JK8A 4NXMQ 2FO4B 1SDDB 1GXDC 1VQEA 3HZYB 3UYOD 3X13A 2KDYA 2X9WA 3U7YL 4QXTB 3RVTD 3MRRB 1P84K 1SDYA 1IKNA 4MB5A 5TF0A 3PIQB 1JG9A 5TFSL 3VWKC 4AM0A 3DBXA 1OCZB 1UFGA 4UNVA 1NZRA 3IXAB 3CZJA 4LVNB 3APFA 4IQHA 3HOZG 4JRYE 4NW2A 4JRXB 2IWEA 1RHPA 1XX8A 2YHGA 4BFRA 3RDTB 4OCMC 2AXFA 3NK4A 3MUGA 4EI5D 4UP7A 1JGVL 1M7DA 1G7QA 3NCCB 1M6UA 4X0NA 3QDJE 1WIOA 4ECNA 3CFQA 1E42A 4LSPL 2N59A 4ZUTB 3RYMA 1T9HA 2NY1D 3MLYH 2FJGA 2D4DA 1DJRD 3FUEA 4LP8A 2Z1KA 1VQ5A 1CLOH 3KH4A 4HS6B 3J7ZC 3W0WE 4NB7A 4PW4A 3QPKA 4RWSC 4GFXA 3I4MH 2WXFA 3WYRA 5L2KE 1A7QH 4HHAA 1GM5A 1FZKB 2UZXB 4R1JA 4KKAC 2E2DC 2D0GA 4PJDF 1ML0D 3GI8L 3JVGA 3BP4B 2R92G 1FORL 1FNWA 1QBAA 2OJEB 1R46A 1M2VA 3QUHA 2HAZA 5LAPA 4HWEL 2ESVB 5LQBH 2QADC 1RODA 1IBHA 2WUBH 4LCWD 4X6CB 4DP1X 4O42A 3QIWA 3CCLA 2RA4A 4MMYA 2WQ8A 5I71B 4H1LH 3RMHA 1NCDH 3ULSB 3HCVB 3P3RA 1SNOA 5L6YH 1C16A 4HIJA 1MLCB 4KHTL 4CMHB 5IODA 1EZSA 2IDUA 2NX5A 3BZDA 3N40P 4ELKB 1J0IA 4Q4IA 2MFIA 4A38A 2CJUH 2GEEA 4KKLD 5EEUA 3DIFA 1N26A 3AZUA 2DJSA 5EIIB 5DEFB 1M3IA 4BFGA 1EO7A 1WAAE 1X5ZA 4PJ6A 3H2QA 4LHUB 1V1OA 2ZNWA 4TMPA 3VDAA 2R59A 3RG1C 1I1YA 2WN2A 1OTCA 5FM8A 3TH3T 1CXIA 3MPCA 2J12B 1DVTA 1OSPH 4HUMB 3TBVA 5JA9A 1VQAA 5BW7C 3IDJB 1XHHA 4J7RA 5KYXA 4HSPA 2FH8A 4QWWD 1FVEB 4S1RH 1N0LA 4Z0BL 3SHLA 1MCJA 3F6LA 4HUCA 1JL8A 1OANA 5GZNA 1RZKL 2X1OA 1ONQB 4EI6A 3HN8A 3U7WL 4HG4K 3M3YB 1Q9WB 2AJXH 4JPVL 4Z7UE 3TTSA 2R1WB 4XT1C 1KMGA 2JJSC 4AT6B 3M4PA 4Z7AA 2R9HD 1BPLB 4OD3H 3NACH 2QFPA 4OD1L 5DHMC 3D4RA 4R4BB 3I9GL 3PWPD 3CDYA 3EJZD 2CDEB 1OHZA 2F8IA 4UUJA 5B1CA 3K7UA 1T83A 5IB2B 3MXWL 4C83A 1XR8B 1VZGA 3LIZL 4B3EA 2NUCA 3MRKB 4KJPC 4YR6A 1OF2B 3DMUA 4P9MH 1XGRA 2HD3A 4JFZH 4KU1A 3P3UA 1HWHB 1Z7TA 2BMKB 3PPEA 3WS6C 4X8JA 2D0FA 1EUTA 1I8LA 2YWZA 5DYFA 5JOPD 3KXFE 4B9KC 1SNQA 1B0IA 1MLBB 3APMA 3C60B 3WNJA 4GOPC 2KDGA 3HOGA 4PB0L 3L5XL 3LQAC 3BN9C 5TQ2L 2Q76A 4XMPL 2J88L 2UVEA 5IIFA 3FB5B 2VO5A 1FJGQ 1H6EA 3II3A 1AOHA 2UYLA 3QPQC 3G5YB 1WGVA 4P59H 1VCBC 4KQ4L 2D3LA 5T1DL 4JI7Q 3RTQC 4OV6F 4IDLA 4B9FA 3TZDA 1W16A 4GUQA 2YAFA 5SWSD 1HNYA 1DR9A 1VLXA 3KDPB 4P23B 4U6HA 4N0CD 4ZMVA 2B1AL 4FFYH 2BVOB 5CWSA 2A9NH 2Y6TE 1XZ0B 2YKLL 2D9CA 2FH6A 4XH2A 3S16B 4FF9A 1RI8A 4IS6B 4YSPA 1V27A 4QHUB 1TXKA 4R0LA 4WV1B 4NWUL 5KSAC 1C48A 1HRJA 4KITB 1WFOA 1FZJA 3RD4A 2AQTA 5FO9B 2KMWA 2P24A 3ZKXC 1CA6A 4DH2A 4QF1B 4P5TC 4LFHD 3UTZA 4GI8A 1HKLH 4K3DL 1KYFA 4NI3A 5B39A 2GVBA 2DD8L 2F53D 2HFTA 1IBGH 3ME0B 5DQ9B 1SE8A 4ZI8A 3H1ZA 2DWDA 3AFLA 3QWQB 3LH2L 4AZ8A 2CH4W 3J80L 3L7ZC 1HZCA 1G7PA 4B7LA 1PMYA 1AE3A 1DJWA 2KBGA 4MAYA 2PTTB 2K1MA 1VQGA 1HHGB 4KVPA 1A21A 1EZUA 2NUPA 4IIQA 1T2QL 2F1AA 4AL8H 2ZWKA 3BYTB 4FZEH 1RHFA 5IT9L 3ZE2E 2OMNA 4O2CB 5ALBH 2DTSA 4HULB 5HYQA 3PP3H 2VQFL 2BNUA 1B4OA 3Q06A 1NE3A 4ORGB 1Z47A 2X4PB 4JI1Q 4PJIE 3RU8H 4WI8A 3BT0A 1YN7B 1YY9D 5IF0B 2ZAGA 3FQRA 4JKPL 5D65A 4OT1H 1S5BD 1HXKA 4AKQA 5TQ0H 2J3SA 1D7DA 4PBVC 1I4RA 1WLHA 2QR0B 1CT8A 1Y8OB 5AYTA 1MW1A 2EXYD 1K28A 2ZE0A 2VN5A 4UIMB 2YAQA 2OR7A 4BS9A 1PCSA 5E2TL 3SDDD 5IMLB 5TPWH 4LLVB 5H35A 1ORSB 4NUPA 4HWZB 5DS8B 3FFCE 1S5IL 2YJLA 2NY5L 3CF5A 3VXMB 1XB3A 4KK6C 4DK1A 2UUDK 2OBGA 3CX2A 1RL1A 4A93G 3DPDA 3HOZH 3ARBD 5IB5B 3RWEB 3EH3B 2AFNA 2WINB 1NFKA 4H26B 3L3IB 4UQEA 4OFYD 4L8JA 1CUOA 1BQLH 3D0FA 4RGND 4LASH 1SEBB 2WMPB 4ZSOB 3SPHA 1RZJC 2ZX6A 3TZVA 3LKSB 1XCXA 3CLFH 5E4EB 4OF0A 1ZANL 1KB5A 4KN7C 1YJDL 4F8NA 1HYSC 2C9XA 1VZIA 1XFPA 3MODL 2JYOA 2AHIA 1DLFL 4NXKA 1Z9PA 5LGJB 4TVSa 4AQ8C 1O9ZA 4FQXC 4P57B 3URYA 2BY1A 1XTMA 3S5LG 4K6DA 5TSSA 1RULL 1SLJA 2R92H 2QLVB 1AMYA 3Q13A 3QIBA 2BSSB 5KJ7E 2A6IA 4Z9KB 2J1XA 4C57C 4HXAH 2PCPB 4Y5XB 3IGKA 5KN5A 1QLRB 4Y4KC 2V9TA 4NQSA 2BP8A 4X4XB 3WEAA 1M4VA 2Y25A 1LDPL 3AB0C 4JQXA 1E5YA 5CUSH 1UNSA 4YWGL 3WL9A 4RAVB 2TMPA 4XPGL 2CR0A 3MLTA 4KLKA 1IAMA 4HWBL 4P74A 1ADQA 4GRWH 1FV1A 1Q81C 4FXKC 1BOGA 3GO1L 2R69H 3MFFA 1LO5A 3QCTH 2ADFH 4X99B 2R8SL 5DR5L 3ZDXB 5GHWH 4HFUH 4F58L 2XKNA 3LN5B 3GHBH 2H41A 4PGEA 5J13B 3KPNA 1CSPA 2VR7A 5FKPB 4ZOCA 1IGFH 5CGBA 1OW0C 3BOVA 5I8KL 1VQLA 2Y5TA 1TNMA 3CUPA 4ODWB 3D08A 3MXNB 3B6YA 2R1XB 4LF5L 4JBSA 4UDTA 1IGTA 4HF5L 1SVCP 2WWKO 1XNQL 1T20B 3AJ7A 4JV5Q 2XQBL 4TVPL 4U4BA 3UTSD 3BUTA 4WK0B 5AKSA 2FO8A 1MRDL 3T1FB 3RZOH 2QA4A 1SFDA 2JELH 3QJZA 1D6EB 4PS8A 3VA7A 2OXPA 4LWCA 3BDYH 3BKYH 4JANB 1J1XL 3E3QE 2R56H 2C9VA 2ZX5A 1R6VA 3F12A 2O1AA 1BR9A 1OTTC 4GP4B 1XCTA 5DC9B 3C2PA 4XB7A 4L5QA 1BFOB 3LNIA 4BFOA 1T5WA 4PJGE 4KRLB 1Z9FA 3NUKA 4I18A 2RSOA 3QXAB 4OZGA 4X9FA 1VZHA 1WCQA 4POGA 2C9UA 1ZVSA 1Q1JL 5BS0D 3PDDA 1FLRL 1KABA 4IYKA 5KG9A 3VI4B 3OZ9L 4HTHA 3JTBA 4JQIH 5E8DL 2X89D 1DQJB 4NKMB 5J1AB 3VGAC 4PRIB 4L6TB 4ZW8A 2DQGL 2HP4A 3QQ3A 4GFTB 4QEGA 4TQPA 3S2CA 5EPJA 2FX7H 2VXTL 2XVKA 3K72A 1H3VA 3KYOB 5TJWK 3AUWB 1RVFH 5FAAA 1MFAL 3NJIA 3DKHA 4F7EA 3H15A 2ZUYA 4PJBA 3T0DA 4NQUA 4OF8A 4CVXB 1U58B 4J3XA 3V0EA 3VG9B 3IMBA 4A75A 2IV8A 1KCRL 1PX3A 3GBML 2JF1A 3OR6A 4IGBD 4PP1C 2JJQA 3AREB 4NXSA 2IXQB 1P8LA 3U4EA 1FR3A 4O0AA 1I50H 3EF7A 4K15A 5ALCL 1MD2D 4KKUA 2FHFA 2VQUA 2C5CA 3OKNA 1Q38A 4MJID 4E6IA 1RZIB 3IBOA 4GRLC 4CSSA 3IRCA 5LGKA 2A5UA 4PJHA 4ANWA 4MA7H 3E9TA 2Y07L 3H7BB 2ZWZA 5D2LF 3CQPA 4P49A 5D1ZA 4ZMZA 3H4FA 2ROYA 3BAEL 4FQJL 1C5CH 2Y7LA 4IHOB 4QCIA 4PWFA 5C08E 2Y5QA 2VABB 6FABL 5AKTA 4XP5H 4XVUC 2BVPA 2P28B 1HXMB 4GIOA 5B7FA 2K45A 2EO9A 3M7NA 3MBED 5I26A 4MAUH 5IR1B 5I75B 5GGRB 1B4LA 1KG0B 2I60H 4K9EC 5E8PA 5JOPE 4JVZA 4PV8A 2VE6A 1X5MA 1BJ1H 5DD6B 5FHBL 5K9OA 1X3PA 4JKKA 4XBGA 5IQ7L 3DC0A 1C5BL 1RIVL 2Y3AA 4IFDG 3H0GG 1QBML 4UT7H 1I7UB 1PG7X 3KPRE 2HYMA 4UM9D 4KMTL 5E51A 1EY5A 3ESNA 1JRHH 2JQZA 1FI8C 1HCVA 4JG2A 1LO3H 5DMGC 5BO1H 5DJXB 4GLAC 3TSSA 1UT9A 2IBGA 5DMKB 4YCWA 1VQ9A 5SWSE 3MROB 3FTVA 2C7UA 1AG0A 2VZVA 3I9PA 1H8SA 1KWKA 2BP0B 3GD1C 4U1JA 4X9YA 2XWZA 3QISA 1ORQA 1ZDSA 5BZWB 1N8OE 1CD1B 4A3FG 1PSKL 3DGDA 2MTAA 4A93H 1LTLA 3OB8A 4R7LA 3WNKA 4ZMTA 3W39A 1OSZA 4OM1L 5LG1A 3RIFK 2XN0A 4N25A 3K5OA 2W60B 2BH8A 4D9LL 4EUPG 1W6JA 4AQOA 4W9CC 2EYSB 3L2LA 4FG6D 2F53E 4MJ5B 2G2NA 1DVSA 3ML9A 2NVQH 2W9DH 5F71A 4EEEA 1IO4C 5MERA 4L37A 2GFBB 1S3KL 3V5HB 5IM7B 3HOXG 5CSGA 4V190 3BRDA 3KVQA 1CDJA 3IU3A 4ONHA 4PPTA 1STEA 3LRLA 1O5PA 4TF4A 1T6WA 4L23A 2Z31D 5C6WH 2XTLA 3KYHC 2VWEE 2XV6B 4MMXB 1QVGA 2WLJA 3OMNB 3RNUA 1TJHL 3F6JA 2H47C 5CO1A 1BVSA 2ZCHL 2WAQA 4B41A 3SCMB 1JPEA 2VMCA 4IRJA 2PW7A 4NB3A 2Z91A 2FE0A 3JYCA 1HSAA 3TT3L 3I70A 1MSPA 2WC7A 3ECQA 1ILPA 4QCLA 3DPBB 3FTGB 4MD0B 1OAKL 4J3WA 5ISZB 2N1TE 3V0VB 5GZOA 5KYWB 1URIA 3P4OB 2V4LA 5D7IB 4BUGA 3WY2A 4EOWL 3TA3C 1E3PA 1C0AA 3PGFL 4N0RA 5D7JA 1JOIA 1YPZF 4IUQA 1OO2A 1NC4A 4ZTPL 3VYRA 2CCLA 1SHMA 1EWHA 1QASA 5F97E 3GKWL 4BCYA 5I6YA 4F7PA 4NZUH 3FC8A 3S5ZA 1HNZQ 2IG2L 2YGNA 4P73A 4L0PB 2W0PA 4W81A 2B5IB 2VNCA 3BWZA 1T03H 2BOCA 4E42B 1EXUB 2EKSA 4CDFC 1DM0B 1PG7H 4WUUB 2X0UA 2ITCB 4RGNE 4CC4A 5J8OA 5M5WH 4KV6A 3OKOB 2UZPA 5I18L 1FDLH 4LEBA 2EACA 3HUJF 3P0GB 4HFWA 5D1XA 3REWB 2EOTA 2L4NA 2JKSA 2D7PA 5DXWA 4F7TA 1ZA3A 4YQXL 2BCMA 3NG5A 4A7QA 2EDOA 1BVKA 2J8UB 3Q05A 4FO2A 1UKQA 4BM7A 2ZCKH 2ALYB 4K14A 2B1HL 4K7PL 2CHNA 2DLGA 3H3PL 3QULB 3CXHK 4FJZA 1MELA 5I15L 5K9QI 4AGNA 4R4NC 1JF1A 5IREA 3D0AA 1IAIM 3FU3A 4GLRI 1QG7A 1YEIL 2EYRA 1E9QA 1DN2A 4E9YA 5DSCB 1QACA 3QRBA 3ULPA 3HAEA 2QVIA 4NP5A 3IK2A 5LWYH 1T5KA 4I48B 1G9MH 5E6YA 5JTWA 3BUDA 1QFPA 4Y2OB 3SZKC 5DJ8A 1RKRA 5I82A 4I7ZC 1HPCA 1WTXA 4XCNA 2OL3H 1B6UA 2FGZA 5I1AA 1PLCA 5F9WC 5EZIL 4Y5VA 3QYNA 5E70A 3FFOA 2AQSA 3RHWK 1Q4NX 2IMMA 2WXMA 4G7VL 4XN2A 1E50A 1X9UA 3MFGA 3MBWB 3BMWA 4GRWE 3OG6B 4LGPB 1KJ2H 5D9SB 4OCYH 4K2KA 3EAKA 4K71C 2ICWJ 1XPRA 4LCYA 4WWOA 1EZVX 1YJNA 4Z3GA 1FFPA 2VDKL 4WO4C 3PRZA 3IFLH 1VQ6A 5TDNA 5I76A 1A6UH 1LHZA 1TVBA 3OKDA 1JHTA 2PW2B 4PTUB 2VS1A 3UTSE 1BMGA 4PJCB 3NJGA 2DQMA 3P11L 4MHHG 4B9XA 1CGYA 4X8GA 5AKVA 1OP3H 5IQMA 2OULB 3N42B 3A8IE 2CM6A 3ROLB 1S7QB 4UT6L 4HS3A 4RMBA 3GTMH 4P48A 4MJJA 2JB5H 5DM63 2EC8A 1UD5A 2XXCB 2NT0A 2O6EA 5K9KB 5K59F 3WKML 1JCKB 1DVFC 4JBWA 2GPZA 4I3RH 5CILL 1Y69U 1FO0A 5DJYA 1LL1A 1PZKD 1G6RA 4A3DG 5C0EB 3MXVL 4WTWA 4KD4A 1P9MC 3LMJL 2W0FB 1E67A 2QQLH 4G6FD 4J4PD 5D5MF 4R8WL 1O5DT 2H32H 4ZAKD 4LFCL 2KEDA 1TTUA 4PJAA 5INDB 4IFDH 3H0GH 2IF7A 2WV3A 5BRZA 2IDFA 2P49B 4UQCA 1UE1A 5FO7B 2KENA 1FHGA 1JNLH 3CHPA 3FO9A 4HLZG 5E8EB 1UE5A 3UEZA 1HL8A 1KCSL 1ZKOA 1BZEA 3PG2A 4J6RH 1UA7A 3CZEA 2AAAA 1A3RL 1W0YT 2C1OB 2BCKA 1R3JA 2NY1B 2KQNA 2Q8BH 4OLVL 4RGMB 2H9GB 1VQDA 4FXGA 1L7IH 1N4XL 1JBJA 2CHZA 5E94B 1JI1A 4IOSA 2VLLB 1YEJH 1XF5A 3LQZB 5AZUA 1M42A 1SNMA 5T1MA 3S34H 3IFOA 3NCFB 3ZDZE 4EUPH 5MEPA 3R2IA 3H3BC 4YDIL 3CFIC 4MA8L 5IOCA 3KLWA 4MJIE 4JI3L 3E2HC 4FQ1L 4LF3B 4R2GC 3VTAA 3UJTH 5KBPA 1E40A 4KFZC 1I4FA 4M93B 4OF7A 4HEME 5LBSA 4P5MA 2UXDQ 2K9FB 1H3PL 5I66A 1GUNA 4WJ3M 3HOXH 1RV6X 1TT6A 1UD8A 4RQQA 3PMFA 2F0CA 4JM2C 4WFED 3NRFA 4ANKA 3N0AA 4GAAA 3GJFB 1BVOA 5CEZL 2EYTA 1HWWA 1VGKB 4ONOA 5AOLA 2EJ1A 2X70A 3H42L 4ODVL 1P1ZB 1B8AA 2KQMA 4JQVC 1MG2C 2R27A 3IGAB 3QXUA 3VD3A 4P2OC 1G7JB 1KFAL 4KKSA 1KNOB 2MH4A 4F8PA 4KHXL 1YHBA 3JSSA 4ENED 1WAAA 4L5RC 1EIHA 1TZ8A 2CO6A 1DVXA 3FB7B 4Y4FD 3AQXA 2HKFL 1PYBA 3AC0A 3SDAD 1KTDA 1YHPA 4JPSA 4N9TA 4OONA 2NXYD 3KBEA 3VFGL 3NUCA 2CALA 2V17L 3LEYH 4MDIA 4NDXA 3GTOB 1QFHA 2VITB 3HG1D 1JIBA 4GBXA 3HC3H 3X14A 2A6HC 1XPUA 3HE7A 1ACZA 4PRBB 3HG9A 3OAYH 3RKPA 5I0WA 1FZMB 1EU4A 1IYVA 4YFLF 2VN3A 3HE6C 4F27A 1I1FB 2K5WA 4AK2A 2ICEA 2WBXA 3IAPA 4LEXL 2WZPD 4K9JA 3DK0A 3K5MA 1RMFH 3PWPB 1IV8A 3BQUA 2E2HH 1KGWA 5C5MA 3VRJB 1IXRA 4KJNA 3BDLA 1UJ3A 2HH0L 2HN7A 3M88A 3S3PA 4B9PA 2WLHA 3CFEA 5BVPL 2IW3A 1IM9D 1T0NB 4NKLA 4LFBQ 2WIIA 4ZXBD 1RU9L 3G6AA 3V6FB 5HDWA 1EXGA 3K4ZA 4G4KA 2F0FA 4LNQA 2R0ZL 3FCSB 1DLHA 1Z0MA 5D7LA 1LEGB 1MI5E 1NLDH 5IW1B 2VM9A 3T6XA 1D9KC 2ZUWA 4G11A 4QHLB 1QNKA 2OMTB 3KXFA 3NJHA 4ZPVA 3V79C 2E7LA 2C3GA 3QHZH 2COVD 1KC5L 5DEHA 4BFFA 3CQFA 3WO4B 2RBLA 1WC7B 2AJVL 4RNRB 5ERWA 4J3UA 2PI2A 4DQOL 5C0FA 4Z7WA 2FL5A 1DSFH 3GC3A 4YHLL 3V05A 4YMPA 1OXTA 5IESL 1JPST 1UC6A 4WGWB 4P4KB 2WHVA 3G6DH 4GAYB 3VWKD 2XZCL 1ZHLB 3GGWB 5KVDH 1RZFL 4DFIA 1OGAA 4JDVB 4GXVH 3BIBX 4DSYA 2Z8LA 3PDGA 3ZZ1A 4GNXC 4Y8AA 5GS0C 4Z76B 2DY2A 1ET9A 3OZKA 4QTFA 1NGQL 5EU6A 5FM4A 3A23A 4QAMB 3V0WL 7TAAA 4XO9A 4YZFF 1I3QB 2X10A 1JPTL 5FPIA 1BDOA 4OGAC 4U49A 4HOXA 2N3JA 5IYCG 5ETUB 2VJ8A 3HZKB 3CFUA 3FRUA 4MXWL 1F9RA 4L9LC 2N78A 1HTPA 1NEZB 1TCRA 4JO2L 5LO7A 3ABKB 3GP7A 3O6FB 4ABNA 1A1OA 3HFML 4OFIA 1AGCA 1CXHA 1PFOA 1G7IA 3T4YB 4AYBB 1KCUL 5KSUB 5IUSA 4KKAD 4J2XA 1WZKA 1UEBA 4QIRA 1KJMA 3I90A 3EYQC 3IN2A 2FUTA 4AEFA 4HAKA 2VAAA 4N1EA 2L11A 2CIIB 3MJ8B 4LUVA 4A3LG 4OJCA 3V5DB 1FH2A 1YG9A 1SBSH 1K0RA 1DBAL 1Q72L 2CDGA 2QADD 3FO0L 4IRSD 3CSYB 4PW3A 1YUHA 5HJGA 3WIAA 3NQKA 3FVQA 5KJRL 1A1MA 1FFOA 5AW5B 5CSZB 3NBHA 1EJOL 4W9KC 4N28A 3K5RA 3GSOB 4HMEA 1P5VB 4PRDA 3W5NA 3ZE1E 3B9KC 1U0QA 3GXIA 1J8RA 2BIPA 4MQTB 3TYFB 1G9NC 5IB3A 3VCLA 3L5IA 5ESVB 4E5XG 5CN3A 4FF4A 2E47A 2X87A 1GIGH 2CK0L 3K3QA 2W88A 1TJXA 1TTBA 2A77L 2FLBT 2V7HA 2XFXA 2AJ3A 2JTDA 3QNYA 4QJ3B 3V6OE 1I3RB 3HMXA 4B7IA 1QQDA 1XCQA 1EFXA 4A3DH 2QPEB 2GSGA 3C3LA 3IT8D 2WTRA 1K5NB 4L4VB 2ZM6L 1FJ1A 3EG9A 3MACL 3FFCA 2JFCA 3GPEA 1F6AB 2CJ3A 3OOCA 4JOIA 4QXWA 3QZWA 1SZNA 3UO1L 2P5PA 2D2CC 1P6FA 1Q0EA 2H1PL 4HLZH 2DDQH 4BBRB 2AV1A 2DI9A 4FFZA 3HKFA 1TUPA 2Z93A 1GZQA 2QT6A 4IBUA 1JD9A 3GMQB 1WIPA 3NP4A 3OHXB 2PCYA 3NJNA 4MCZA 3VWJC 1SOSA 1W0WA 2X4NA 1C9SA 5C8JA 1W8NA 3FCGA 1H9RA 3LHPH 2ZXOA 1FLTX 3UBXA 4GP8B 3MNMA 4GXFA 1TSRA 1HQRA 4JYAQ 2M83A 2QTEA 4JZNA 5HPOA 3LZOA 3IJEB 1AANA 3T4AC 4QRSA 5I1KH 5AYUH 3RIFF 4CN4A 1M57B 4CGUB 1C08A 1M71B 2CCVA 1JDAA 3A3YB 2Z8VC 3HI5H 2ZOKA 1ESRA 4FQQB 1FNEB 2OTUA 3BN9D 4OF3A 4AQYQ 1BP3B 1OGTA 1SVZA 4KRPD 1N33L 4L0YA 1XXGA 4NJAH 1BZ7A 4F3FA 1IM3B 1XIWC 4FF1A 5FFGA 4LMQD 1CLZL 2ZF8A 4D8PA 2ODIA 3QRFM 2NVXB 1FN4A 1JZJA 3PWUA 1LK2A 4HK0B 5IVXF 3DV6B 3RTQD 4MKTA 4YWLA 3X1GA 4OKDA 1TJGH 3DWTA 3MV8D 2F54A 3OXSB 4N8CL 5DRXB 3V0GA 4OJDH 3KDFB 3U36A 5D1ZI 1CU4L 5GRVK 4UYPA 3MLSH 3BAYA 3V0IA 4BGLA 4HUXA 4NUGL 1TKWA 1WUNT 2ZTDA 5DD5H 1IZKA 1SYFA 3PHQA 4LF5Q 4LPUA 2PCXA 2DYPD 4NN5C 5DD1H 4ZTEA 4I0PB 1QZ1A 5KSAD 4LIQL 1XH1A 2B59A 3PAYA 4UANA 5DYOB 3OLGA 1X5AA 3PUXA 4DR2L 2ZAHA 5BQDA 4JJ5A 5CJBA 2OR9L 4HMIA 3R0MA 1OE2A 4ZO9A 2FDBP 4V2BA 3ASOB 1BJ1J 4DF7A 4GT7A 4H4NA 2V4DA 4HUKB 1TR7A 5DUMH 3QH3B 4LKXA 3JVFC 1Q0XH 4UINH 5B7MA 3L3KB 4NRZA 1E4HA 1OM3H 2BW5A 1DSYA 2WYIA 1CWVA 2H8PB 3DMMD 5AZ2L 2LABA 1EX0A 2A19A 1BVZA 2PQEA 2A9BA 2LVEA 3SDYL 5IMOA 1C5DB 1OAJA 3ARDA 1NMAH 3HNVL 3WJMB 1YQVL 1QHQA 3L5WA 4XXWC 4ELMA 2XTJD 5IJVB 3HKZA 2I0QA 2J6EH 1EA9C 1EFID 5EO1A 3S2HB 4AH6A 3L6FA 4F37K 1H9DA 2AC0A 5EUOB 3ULLA 4PI0A 3W9DB 1S7SA 3U4VA 2OM5A 4J23A 4BBSB 3OJDA 4BWWA 1GYWA 3NTKA 4DN4M 3BGFC 2VQTA 1NTDA 2DLEA 4EGVA 1MG3C 5AENA 4JRXE 3RWDB 4B27A 4WFEE 1YECH 2HKAA 3ITPA 2F5AL 3NP8A 2K4KA 5IYBG 1QEWA 3VXUA 3WOVA 1CQYA 1R17A 1G7MA 3S6CA 1JZ2A 3LD8B 1YZZA 2PO6A 5CEXB 3TONA 5EN3A 4RH6A 2YJQA 1EJ8A 1T1ZB 3FB6B 1EMTL 2DYSB 4KK6D 3TDQA 3HRPA 4BWGB 3AM8A 4HIPA 1HFUA 4H1LA 4OIKA 1WWAX 1WQVT 3HI6L 2CUIA 4FE9A 2VXQH 3EO0A 3S35H 4AGOA 1SR3A 2VZ3A 2JA7G 2KHAA 2VDKB 4BA8A 5CZRA 2HHHQ 4OH2A 5IYCH 5G2NA 3C8DA 4PY7A 5D6DC 2IHFA 1KBGH 1HYSD 2ESVE 4YSAA 3WGUB 1E5UI 2BNQB 5JW4Q 1A9BB 1Y6MR 2G5DA 1RUAL 3KLAA 5K33A 2VL5B 2ARJB 4XNZB 4AG4L 1A7BA 3OX8A 4YHNB 2QHRH 3LKQA 3RNKA 5BQ7A 1NQBA 2VKXA 2WKLA 4Z7IA 1FNHA 3FU5A 5K9JL 1WZLA 3GM0A 1PRTF 3RHWF 5I4DA 3LRKA 3O2WH 2GJZB 1CGUA 1QSZA 3NSYA 4YBLB 3WIFA 5HPMB 1X5YA 4JS7A 4QR7A 5C08A 1HCZA 4XI5D 4A3LH 4KI5C 1SQ2N 2WYTA 4GKLA 1UADC 2K03A 4Y4KD 3T09A 3DOSB 3QG6A 4OWWB 2YD2A 1FGVH 1SJHD 3HVDA 4OIIL 4KI0A 3VR5A 2C5DC 2J43A 3AU0A 4GSUA 5C09D 2WP3O 3UIYA 4BH7B 4ZQKB 1HZ9A 1AI1L 3LNNA 1OAQL 4MNHA 4M4RB 4LSTL 1OAUL 4GG8B 2KEEA 3VI3F 3EHBD 3QARA 3VYNA 2XVGA 5B1JA 3KPRA 5CV4A 1FGUA 5DNFA 4LPWA 1MFNA 3RFZC 4XCYA 3RKDC 3KWWB 1QKZL 4PUBH 2EECA 3MLWL 3QWRA 3SGDI 4AGLA 1PA6A 1QBBA 4OR1A 4N2DA 3LN4B 4UILH 2OYKA 5A16A 4HGWB 3A5VA 1JAEA 4UT9L 3MV01 5BCAA 1EIFA 5JHDD 5MENB 5EZJB 2BHYA 2DM2A 5GS1A 1L2FA 3BDOA 3MA7A 2IPKD 3FU0A 1Z9NA 1NR4A 1IGML 4L9DA 4CU6A 3T2QA 2Y36L 2E27L 3ZYYX 5F0MB 4NQQA 4HXBH 4ZDHB 1CE6B 4LL4A 4CC0A 3CDGB 4KJYA 3ZRSA 3IDNB 3FB8B 1B2TA 4EZLA 4NSKA 5KS9B 5KVDE 1PTZA 1ZS2A 1FL0A 3E80A 1DHKA 2XN2A 3JAML 2BVQA 2YLKA 3NPZB 4A7GF 3UADA 4K3JL 3W11D 1CFSA 2B2UC 3TN0C 3BLPX 3T5WA 5MEQA 3VGBA 4XPBH 2O5IC 1A2YB 1I7ZA 5FKAA 1EVTC 3TBWB 1EHLL 1X4XA 3H9SA 4URKA 4JPIB 1UGNA 5E24E 3FT3A 3VXNB 5E3FA 1HSBA 1PAMA 1D5ZC 2UY7B 4KTEH 4MIUA 2VM4A 1F18A 4ZTOL 4H7BA 5EN2B 4OJFH 1FORH 4V1DA 4O5LL 1UVQB 2ZYHA 4Z7OE 3R1GL 4WUKH 3GO5A 4XX1E 4HWEH 1ZLVK 2AHOB 5I6LA 4DCQB 1OP5K 4PWJA 3X1EA 5AUMB 3LQAL 4ZMPA 3QQDB 4FJ6A 2AXJA 4Z0XB 1UCBL 1B6DA 1P4LB 3HS8A 4RFNB 3DXAB 5CZXC 4W1TA 3NH7H 5T5FA 4PVBA 15C8H 5GGTL 1H3TA 2MCMA 3GKZA 4RMSA 5CD5C 4GSDH 3S17H 3KG5A 2WO2B 3OV6A 2VDQH 1RZGB 2BRRL 3QUZD 4WTZA 4P2YA 1UOWA 1JWMA 1CLVA 2J5LC 5I1LA 3D0VA 3KL3A 3SKMA 5MEOB 2JEBI 1HNWL 3LZQA 1O7ZA 3IMSA 4YL4A 3FP9A 3QORC 4PP1D 5CHNA 5CP7A 5ICXA 3SGJA 3PV6B 1SYVA 3GS4A 1L0YB 3MGTB 1J48A 4TUJB 2HFFA 4ME5A 2PPDA 3ZY7A 2NQCA 1F2MA 2R7DA 3RZCC 3T0WA 1XAKA 4HAGA 4Z0BH 3V0AC 1E27B 2ZKHH 3CFBB 3MV9D 1B3QA 3P0YL 2V2XB 5CJOL 3H85A 4Y19D 2ATAA 4HJEA 4JRLA 5IQOA 3QIUA 4Z7VF 3U7WH 2V2TA 1QTPA 4HBCL 1TQBC 4TM9A 1U8IA 5HHMB 2YOAA 3MRQA 2FJFA 2F0OA 3L4VA 4CJ1B 4BZ2H 4G9FE 4LO9A 1FUNA 4OD1H 3WN6A 1H0DB 1SNPA 1FGBD 3RJQB 3J80c 2D5DA 3Q6GL 1PRTC 5EBGA 2KCNA 4HV8A 3NXWA 4EBQL 4ZFGL 4ZMOA 5HDBF 2C3HA 1P16A 3PU7A 3BAIA 5CIPH 5EIQA 2A73A 4PV9A 1L1OB 4URTB 3WFHB 4RDQF 1TQCB 3OJMB 4PMWA 4L8BA 1LNUB 1PS3A 2FJ2A 4H8VA 2A38A 4F1ZA 4Z7NE 1Q9LA 2W0KA 4PB0H 3SPVA 3H9HB 3L5XH 4J3OC 5G4NA 4XMPH 2CFMA 3QI9C 4Q9RL 4MMZB 5DMGD 4FQLL 2ID0A 5HYSB 1WPCA 2IAND 4LRNH 5IYBH 4N9GB 1A7PH 3MV8E 2Y5EA 4JMXA 2YRBA 1YYLL 2UY6A 3BVNA 4ICXA 4UQIM 3EOBB 1FFNB 3GTTA 2VLJD 3UJIH 4JW3A 1E5AA 4XMWA 3FUFA 1C12B 1QZNA 2JNZA 4Y1AA 5AFAA 2XKSA 2WB1B 1CBVL 3AMKA 3BEWB 5CV6A 3LWEA 3IETB 2NLJB 5IFJB 2QGDA 4XPHL 5I0VA 4JDZA 5CS7A 2O6CA 5E08H 2AQQA 2CDFA 3IMUA 2JA7H 2I7SA 4C4KT 5FYKD 1N70A 3VMPA 4MD5B 3EJCA 4I5BA 2JCCF 2AF2A 1RZJL 3B2VL 3MLXL 4K3DH 1NC2D 1VDZA 5ITBL 1RTOA 3NIFF 3ARWA 3OMIB 4KNUA 5IV2A 4RWHA 4ZUUB 5TK2A 1NUGA 4UQ2B 3ZL1A 4U0RC 4BFNA 1AD0A 5DF0A 5A2QL 2XY1A 1NFDB 3BT2H 1EAJA 3H55A 1QSVA 1G87A 3QJTB 4GKNA 5LCVA 4DEUA 3MFYA 1AFPA 2ZD0A 4PJ9C 4DV7L 2X2YA 3UZVB 3O6ML 1U3HA 3FRPA 4AYDC 4KZDH 2O6DA 3WE6B 3ICEA 5D96B 3O2DL 3V8OA 2D03H 1AY1H 3CVHL 4EIUA 2BOBB 1EH9A 4QXGL 2XTJE 1PIFA 3OXRB 3RWHB 3M7FB 2RVLA 1ZEQX 2HXAA 4K5MA 5HHNB 4GW4B 4RA0C 5CR8A 1LXMA 3TVMA 3FAWA 1JOOA 5JUEL 3BP6A 1NGYB 4G7ZC 3OKKA 1Q94A 3Q8AA 3OKEB 1N12A 5D2NE 2NYZA 3IGFA 4NC0B 4O2FB 3TCXA 3FPPA 3M4YA 1TITA 2EY5A 4ZAKB 3BHBA 5TD4A 4Q0XH 1RAMA 2VXVL 2VDPH 4JKPH 3S37L 1B0RB 4Y4HD 3SZ6A 4AQZA 3D6GA 1ZLWK 3IDMB 2YD0A 4DPRA 5J12C 4BY7B 3WIHA 5EZOH 1H15B 2CGYA 4NKOB 5E1IA 3GBLA 1WICA 1JE4A 2CNYA 2H0FA 3BAXA 1A3VA 3C5SB 3QW9A 1QSFD 3C08H 5EGTA 2K8QA 2JN4A 3K80C 3UJJL 3FULA 5FB8B 1IAOB 3MHZA 3VSVA 4E41A 2EP6A 3AUVA 2BX5A 2WYZA 2QMJA 1A8VA 3KF6A 5J1ZA 1N36Q 1VQIA 1D7QA 1BZQK 4UU9B 4X6DB 2OYLA 3KGRA 5F7UA 2TRYA 1HEZA 2EDXA 3APCA 1GOGA 5I8EB 5JHMA 3KJ4C 4YHKL 1I9IL 1INEH 3HGBA 4CHTB 3MEFA 2IPUG 4U7SA 4K8JA 4MJ4A 2EE2A 4CN1A 4GJTB 2AK4A 2VGLM 3BH8B 1V3JA 1U8OB 1KXVC 4XT3B 4UB0L 4X42A 5DVOA 4FMFA 1VGEL 3D69A 1CKOA 2F7QA 2APFA 5KNCA 4AE1A 3BKML 4R4ND 2XIBA 1YBYA 1EZLA 1XGPA 5L7XL 1YMMB 3B7UX 4FEIA 1PH5A 4ZO8A 1NFIA 2N0MA 3QZNA 1WISA 2RHQB 4PD4K 1DE4B 5EUKA 2XV2A 1UACL 3FMCA 1FAKT 2SDFA 2X9XA 2P8PA 3A6CH 2X6CA 2ZUVA 2BH0A 2DQJH 3NABL 4IKNA 4PGDA 2A74B 2IQAB 2YZ1A 2FSEB 5E9DA 5HHOA 4B0MB 4U6VH 2MO1A 5T1KA 4CVZA 1BMWA 3KVDD 4LNRA 1KLFA 5DK2B 2JKIS 1QUPA 5AOKA 3BWAB 1I1AD 2Z92A 3UG5A 2VRKA 2Q3AA 2F0DA 2IPTL 5FYJL 4HWBH 2FYYA 3HFZB 2J2ZA 3VH8G 3OR7A 4JFTA 1IKFL 3GO1H 4GXUM 1CZGA 2CBOA 5JHDE 4M9OA 5DR5H 1CICC 2R8SH 4CMMA 4EZMA 1FVDB 3WEXA 3DWAA 1AHWB 4OWTB 3IF1B 4FG4A 3U0TB 1I8IB 1P6AB 1A6ZB 4Z78B 4JFYB 4NM8L 1R47A 4DEPC 1PZCA 4OY9A 4POZC 1HX0A 5GROA 4YVUA 1OXXK 4GN4B 4C47A 2V37A 4WK2B 1S5FD 1HKFA 4U0QB 4KJQD 4G70B 4DV4L 2NY4B 2WSDA 5DMJB 1NCCH 1UD3A 5DA0B 4PG2A 3PE9A 1XNRL 1F9QA 2ZOOA 3X3FH 3DURB 1MRDH 2A9ML 3VFMB 1Z66A 2OW7A 4K4KA 4GXUN 3VR6A 4JZJB 5IROA 1MI5A 1QA9B 1L6PA 1J1XH 1LWHA 4NNXA 1EAOA 4PJ7E 4WU7B 4I8DA 3J7AV 3PAUA 3W2DA 2LXKA 1CFVL 1DVFD 5M3MG 1YEKH 3ZSSA 4GQPH 1LM8V 3OF6A 1LTXA 1MIML 3SD5A 1GMEA 4LDEB 4C56C 2APVA 1ZA6B 2SODB 3BDCA 1DVQA 4OGQC 3QNXB 3CP0A 4K9EL 3KJOA 3FQTA 1EJFA 1II3A 5E4OA 5A3IC 1OAZH 4DV5L 2OPCA 2XVBA 3B3IA 5F7BA 2OJZL 3T0EC 3VXPB 1K8DB 4F37F 2VR8A 4O1NA 4MVBC 2JKTM 3PQYD 3BUYB 4UV4H 3TTYA 4XVTL 5F6HJ 1CE1L 2EEFA 4HUUA 3OZ9H 5FW6A 4PI2A 4N86A 5LNDA 5IFAL 4LCCA 5FDYA 1R4PB 4A3MB 2CRIA 2EZ0C 3BD3A 5DZNA 4QYOA 1A8ZA 4NQXB 1RK7A 2GN5A 2XUWA 1AQDA 1N9WA 1KCWA 1F4YL 2XWTB 4L1HA 1A6AB 5AVQB 1I7RB 4C55A 4MA1C 3VNZA 2VLKB 1FG9C 1MFAH 1JZHA 3IXTA 3OD3A 5FWRA 3S3SA 5I23A 2W8CA 1E28A 4ZX5A 4RMWA 3GXDA 5JXEC 2AUJD 1S8DB 2R29L 2WNGA 4JC0A 3MMEB 3D05A 1EOTA 1QABA 4LXFA 3L1GA 4U1GB 4HJSA 3MRHA 5IMMB 3S88H 3CMOL 4MCNA 4HJIA 4Y19E 5ALCH 4NQVB 3PIP3 4JO8A 1NUNB 1F11B 3CVCA 2B29A 1I8AA 5CINL 5EORL 3C5ZD 4X64L 2CRYA 3KAAA 4YBQC 2CRMA 2YAPA 4BQ6A 2JI1A 2D2OA 3B7SA 4PWKA 5A7BA 1IQWL 2N7BA 3QRLA 2C1PA 3AU1B 4FQPA 3T2NL 4HUVB 1MHHA 4OGXH 3RUGE 3QOLA 4NQED 1DBKL 2IAMD 4L29B 3QQ9D 5ANHA 2J6WA 3UPRA 3TJHC 5HYEA 1MAMH 1L9TA 5AB0A 3E6HA 3I2CH 4P2OD 6FABH 3D0LA 3U2SA 1H3WM 3VO0A 5ISZE 2XNAA 3QZBA 4OO1G 1F3RB 4F5CE 3QFDA 1JVOA 2BC4A 2NTTA 5ADOH 3ZKND 4P2AA 4L1TA 3CCHB 1HYRC 4N8VG 5FHBH 2OMXA 1DBJL 3GS0A 4MA3B 1NCWH 4TNGA 5K93A 1RIVH 3STLA 4PTTB 2HJLB 1XQ4A 1SN0A 2PYEB 3HTLX 3K4DA