2ICKA

Human isopentenyl diphophate isomerase complexed with substrate analog
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
220
structure length
220
Chain Sequence
HLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isopentenyl-diphosphate delta isomerase
publication title The crystal structure of human isopentenyl diphosphate isomerase at 1.7 A resolution reveals its catalytic mechanism in isoprenoid biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 82
structure length 220
sequence length 220
ec nomenclature ec 5.3.3.2: Isopentenyl-diphosphate Delta-isomerase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2ickA00
3RH7A 5ANUA 3SONA 4HFQA 1PUSA 4NFWA 2YVPA 1RRSA 1VRLA 4ICKA 1VK6A 2A8QA 1KTGA 1VHGA 2ICKA 3A6VA 5C8LA 2O5FA 3A6SA 5FSOA 4JZVA 2GB5A 5ANTA 5FSIA 2QKMB 5I8UA 1V8IA 3EXQA 3GRNA 4YPHA 1JRKA 1SJYA 3A6UA 3BM4A 3Q1PA 4N1TA 1HZTA 5GHIA 1MK1A 2QJOA 5GHNA 5LPGA 1G0SA 3O6ZA 1PPWA 1KT9A 1X84A 3KVHA 5FSLA 1VHZA 3ID9A 5ANSA 3AC9A 1RRQA 3GZ5A 3GZ6A 1PPXA 1SOIA 3I7VA 2J8QA 5FSNA 3GZ8A 5ANWA 3G0QA 4IJXA 4C9WA 3QSJA 5CFJA 2KDWA 1MQEA 2O5WA 4HVYA 4DYWA 2YYHA 5FSMA 3X0IA 5DD4A 1V8TA 1R67A 3COUA 1Q54A 2I6KA 3Q91A 2I8UA 1IRYA 2DSCA 5HZXA 1TUMA 4KTBA 2O1CA 3MDIA 2I8TA 3X0RA 2A8RA 3P5TA 3HYQA 3GG6A 1Q27A 3FK9A 5BS6A 3ZR0A 4JZUA 1PPVA 3ZR1A 1MQWA 3SHDA 3X0LA 2A8SA 3N77A 3MDGA 1RYAA 1VCDA 3U53A 1NQYA 2R5WA 2GT4A 3X0SA 3O8SA 5IW4A 3J7Ye 3DKUA 1VIQA 1V8VA 2FMLA 4S2WA 4V14A 1SZ3A 5GHMA 3MCFA 3OGAA 1G9QA 1XSBA 2XSQA 3N9UA 5ISYA 2RRKA 2A6TA 1V8YA 1MR2A 1HX3A 5C7QA 3FFUA 4S2XA 2G74A 1K2EA 1V8LA 3I9XA 3P6YA 2DUKA 3L85A 3X0NA 3WHWA 1SU2A 3Q2SA 1KHZA 3HHJA 4YPRA 1GA7A 1OW2A 1V8WA 2GT2A 5DPKA 1X51A 2Q9PA 5FSKA 3BHOA 3X0JA 1V8SA 2FKBA 3O61A 5DEQA 3F6AA 3FSPA 3MGMA 2A8TA 3CNGA 5C7TA 3FCMA 4YOQA 5GHJA 5IW5A 4KG3A 4JZSA 4JZTA 2AZWA 4K6EA 2A8PA 3E57A 2YVOA 3X0KA 3X0QA 4MPOA 3I7UA 1U20A 3O69A 2DSBA 3EEUA 3Q93A 5ANVA 5GHQA 1PVFA 2JVBA 3EF5A 3R03A 1JKNA 4ZG0A 1VC9A 2ICJA 5DDGA 1NFSA 2B0VA 5GHPA 1XSCA 1MP2A 2DHOA 1K26A 2FVVA 1QVJA 3DUPA 3GWYA 2VNPA 1V8NA 3FJYA 3BAPA 3X0OA 4NFXA 1V8RA 1X83A 1NFZA 1V8UA 2B2KA 3H95A 1VIUA 1PUQA 1VC8A 3X0PA 5CFIA 2QJTA 1NQZA 2B06A 2DSDA 1V8MA 4S2VA 3X0MA 3Q2TA 2KDVA 2PQVA 4S2YA 2G73A 1Q33A 2PNYA 1XSAA 2YVMA 4ILQA 1MUTA 1I9AA 2VNQA 3ACAA 5GHOA 4KYXA 1F3YA 3EESA 4KG4A 2W4EA 3O52A 2YVNA 2CL3A 3A6TA 4C9XA 4N1UA 1PUNA 3SMDA 3F13A 5BONA 3Q4IA
chains in the Genus database with same CATH superfamily
3RH7A 5ANUA 3SONA 4HFQA 1PUSA 4NFWA 2YVPA 1RRSA 1VRLA 4ICKA 1VK6A 2A8QA 1KTGA 1VHGA 2ICKA 3A6VA 5C8LA 2O5FA 3A6SA 5FSOA 4JZVA 2GB5A 5ANTA 2CZRA 2QKMB 5FSIA 1V8IA 3EXQA 5I8UA 4J7GA 3GRNA 4YPHA 1JRKA 1SJYA 3A6UA 3BM4A 3Q1PA 4N1TA 1HZTA 5GHIA 1MK1A 2QJOA 5GHNA 5LPGA 1G0SA 3O6ZA 4J7HA 1PPWA 1KT9A 1X84A 3KVHA 5FSLA 1VHZA 3ID9A 5ANSA 3AC9A 1RRQA 3GZ5A 3GZ6A 1PPXA 1SOIA 3I7VA 2J8QA 5FSNA 3GZ8A 5ANWA 3G0QA 4IJXA 4C9WA 3QSJA 5CFJA 2KDWA 1MQEA 2O5WA 4HVYA 4DYWA 2YYHA 5FSMA 3X0IA 5DD4A 1V8TA 1R67A 3COUA 1Q54A 2I6KA 3Q91A 2I8UA 1IRYA 2DSCA 5HZXA 1TUMA 4KTBA 2O1CA 3MDIA 2I8TA 3X0RA 2A8RA 3P5TA 3HYQA 3GG6A 1Q27A 3FK9A 5BS6A 3ZR0A 4JZUA 1PPVA 3ZR1A 1MQWA 3SHDA 3X0LA 2A8SA 3N77A 3MDGA 1RYAA 1VCDA 3U53A 1NQYA 2R5WA 2GT4A 3X0SA 3O8SA 5IW4A 3J7Ye 3DKUA 1VIQA 1V8VA 2FMLA 4S2WA 4V14A 1SZ3A 5GHMA 3MCFA 3OGAA 1G9QA 1XSBA 2XSQA 3N9UA 5ISYA 2RRKA 2A6TA 1V8YA 1MR2A 1HX3A 5C7QA 3FFUA 4S2XA 2G74A 1K2EA 1V8LA 3I9XA 3P6YA 2DUKA 3L85A 3X0NA 3WHWA 1SU2A 3Q2SA 1KHZA 3HHJA 4YPRA 1GA7A 1OW2A 1V8WA 2GT2A 5DPKA 1X51A 2Q9PA 5FSKA 3BHOA 3X0JA 1V8SA 2FKBA 3O61A 5DEQA 3F6AA 3FSPA 3MGMA 2A8TA 3CNGA 5C7TA 3FCMA 4YOQA 5GHJA 5IW5A 4KG3A 4JZSA 4JZTA 2AZWA 4K6EA 2A8PA 3E57A 2YVOA 3X0KA 3X0QA 4MPOA 3I7UA 1U20A 3O69A 2DSBA 3EEUA 3Q93A 5ANVA 5GHQA 1PVFA 2JVBA 3EF5A 3R03A 1JKNA 4ZG0A 1VC9A 2ICJA 5DDGA 1NFSA 2B0VA 5GHPA 1XSCA 1MP2A 2DHOA 1K26A 2FVVA 1QVJA 3DUPA 3GWYA 2VNPA 1V8NA 3FJYA 3BAPA 3X0OA 4NFXA 1V8RA 1X83A 1NFZA 1V8UA 2B2KA 3H95A 1VIUA 1PUQA 1VC8A 3X0PA 5CFIA 2QJTA 1NQZA 2B06A 2DSDA 1V8MA 4S2VA 3X0MA 3Q2TA 2KDVA 2PQVA 4S2YA 2G73A 1Q33A 2PNYA 1XSAA 2YVMA 4ILQA 1MUTA 1I9AA 2VNQA 3ACAA 5GHOA 4KYXA 1F3YA 3EESA 4KG4A 2W4EA 3O52A 2YVNA 2CL3A 3A6TA 4C9XA 4N1UA 1PUNA 3SMDA 3F13A 5BONA 3Q4IA
chains in the Genus database with same CATH topology
3RH7A 5ANUA 3SONA 4HFQA 1PUSA 4NFWA 2YVPA 1RRSA 1VRLA 4ICKA 1VK6A 2A8QA 1KTGA 1VHGA 2ICKA 3A6VA 5C8LA 2O5FA 3A6SA 5FSOA 4JZVA 2GB5A 5ANTA 2CZRA 2QKMB 5FSIA 1V8IA 3EXQA 5I8UA 4J7GA 3GRNA 4YPHA 1JRKA 1SJYA 3A6UA 3BM4A 3Q1PA 4N1TA 1HZTA 5GHIA 1MK1A 2QJOA 5GHNA 5LPGA 1G0SA 3O6ZA 4J7HA 1PPWA 1KT9A 1X84A 3KVHA 5FSLA 1VHZA 3ID9A 5ANSA 3AC9A 1RRQA 3GZ5A 3GZ6A 1PPXA 1SOIA 3I7VA 2J8QA 5FSNA 3GZ8A 5ANWA 3G0QA 4IJXA 4C9WA 3QSJA 5CFJA 2KDWA 1MQEA 2O5WA 4HVYA 4DYWA 2YYHA 5FSMA 3X0IA 5DD4A 1V8TA 1R67A 3COUA 1Q54A 2I6KA 3Q91A 2I8UA 1IRYA 2DSCA 5HZXA 1TUMA 4KTBA 2O1CA 3MDIA 2I8TA 3X0RA 2A8RA 3P5TA 3HYQA 3GG6A 1Q27A 3FK9A 5BS6A 3ZR0A 4JZUA 1PPVA 3ZR1A 1MQWA 3SHDA 3X0LA 2A8SA 3N77A 3MDGA 1RYAA 1VCDA 3U53A 1NQYA 2R5WA 2GT4A 3X0SA 3O8SA 5IW4A 3J7Ye 3DKUA 1VIQA 1V8VA 2FMLA 4S2WA 4V14A 1SZ3A 5GHMA 3MCFA 3OGAA 1G9QA 1XSBA 2XSQA 3N9UA 5ISYA 2RRKA 2A6TA 1V8YA 1MR2A 1HX3A 5C7QA 3FFUA 4S2XA 2G74A 1K2EA 1V8LA 3I9XA 3P6YA 2DUKA 3L85A 3X0NA 3WHWA 1SU2A 3Q2SA 1KHZA 3HHJA 4YPRA 1GA7A 1OW2A 1V8WA 2GT2A 5DPKA 1X51A 2Q9PA 5FSKA 3BHOA 3X0JA 1V8SA 2FKBA 3O61A 5DEQA 3F6AA 3FSPA 3MGMA 2A8TA 3CNGA 5C7TA 3FCMA 4YOQA 5GHJA 5IW5A 4KG3A 4JZSA 4JZTA 2AZWA 4K6EA 2A8PA 3E57A 2YVOA 3X0KA 3X0QA 4MPOA 3I7UA 1U20A 3O69A 2DSBA 3EEUA 3Q93A 5ANVA 5GHQA 1PVFA 2JVBA 3EF5A 3R03A 1JKNA 4ZG0A 1VC9A 2ICJA 5DDGA 1NFSA 2B0VA 5GHPA 1XSCA 1MP2A 2DHOA 1K26A 2FVVA 1QVJA 3DUPA 3GWYA 2VNPA 1V8NA 3FJYA 3BAPA 3X0OA 4NFXA 1V8RA 1X83A 1NFZA 1V8UA 2B2KA 3H95A 1VIUA 1PUQA 1VC8A 3X0PA 5CFIA 2QJTA 1NQZA 2B06A 2DSDA 1V8MA 4S2VA 3X0MA 3Q2TA 2KDVA 2PQVA 4S2YA 2G73A 1Q33A 2PNYA 1XSAA 2YVMA 4ILQA 1MUTA 1I9AA 2VNQA 3ACAA 5GHOA 4KYXA 1F3YA 3EESA 4KG4A 2W4EA 3O52A 2YVNA 2CL3A 3A6TA 4C9XA 4N1UA 1PUNA 3SMDA 3F13A 5BONA 3Q4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RH7 A;  5ANU A;  3SON A;  4HFQ A;  1PUS A;  4NFW A;  2YVP A;  1RRS A;  1VRL A;  4ICK A;  1VK6 A;  2A8Q A;  1KTG A;  1VHG A;  2ICK A;  3A6V A;  5C8L A;  2O5F A;  3A6S A;  5FSO A;  4JZV A;  2GB5 A;  5ANT A;  5FSI A;  2QKM B;  5I8U A;  1V8I A;  3EXQ A;  3GRN A;  4YPH A;  1JRK A;  1SJY A;  3A6U A;  3BM4 A;  3Q1P A;  4N1T A;  1HZT A;  5GHI A;  1MK1 A;  2QJO A;  5GHN A;  5LPG A;  1G0S A;  3O6Z A;  1PPW A;  1KT9 A;  1X84 A;  3KVH A;  5FSL A;  1VHZ A;  3ID9 A;  5ANS A;  3AC9 A;  1RRQ A;  3GZ5 A;  3GZ6 A;  1PPX A;  1SOI A;  3I7V A;  2J8Q A;  5FSN A;  3GZ8 A;  5ANW A;  3G0Q A;  4IJX A;  4C9W A;  3QSJ A;  5CFJ A;  2KDW A;  1MQE A;  2O5W A;  4HVY A;  4DYW A;  2YYH A;  5FSM A;  3X0I A;  5DD4 A;  1V8T A;  1R67 A;  3COU A;  1Q54 A;  2I6K A;  3Q91 A;  2I8U A;  1IRY A;  2DSC A;  5HZX A;  1TUM A;  4KTB A;  2O1C A;  3MDI A;  2I8T A;  3X0R A;  2A8R A;  3P5T A;  3HYQ A;  3GG6 A;  1Q27 A;  3FK9 A;  5BS6 A;  3ZR0 A;  4JZU A;  1PPV A;  3ZR1 A;  1MQW A;  3SHD A;  3X0L A;  2A8S A;  3N77 A;  3MDG A;  1RYA A;  1VCD A;  3U53 A;  1NQY A;  2R5W A;  2GT4 A;  3X0S A;  3O8S A;  5IW4 A;  3J7Y e;  3DKU A;  1VIQ A;  1V8V A;  2FML A;  4S2W A;  4V14 A;  1SZ3 A;  5GHM A;  3MCF A;  3OGA A;  1G9Q A;  1XSB A;  2XSQ A;  3N9U A;  5ISY A;  2RRK A;  2A6T A;  1V8Y A;  1MR2 A;  1HX3 A;  5C7Q A;  3FFU A;  4S2X A;  2G74 A;  1K2E A;  1V8L A;  3I9X A;  3P6Y A;  2DUK A;  3L85 A;  3X0N A;  3WHW A;  1SU2 A;  3Q2S A;  1KHZ A;  3HHJ A;  4YPR A;  1GA7 A;  1OW2 A;  1V8W A;  2GT2 A;  5DPK A;  1X51 A;  2Q9P A;  5FSK A;  3BHO A;  3X0J A;  1V8S A;  2FKB A;  3O61 A;  5DEQ A;  3F6A A;  3FSP A;  3MGM A;  2A8T A;  3CNG A;  5C7T A;  3FCM A;  4YOQ A;  5GHJ A;  5IW5 A;  4KG3 A;  4JZS A;  4JZT A;  2AZW A;  4K6E A;  2A8P A;  3E57 A;  2YVO A;  3X0K A;  3X0Q A;  4MPO A;  3I7U A;  1U20 A;  3O69 A;  2DSB A;  3EEU A;  3Q93 A;  5ANV A;  5GHQ A;  1PVF A;  2JVB A;  3EF5 A;  3R03 A;  1JKN A;  4ZG0 A;  1VC9 A;  2ICJ A;  5DDG A;  1NFS A;  2B0V A;  5GHP A;  1XSC A;  1MP2 A;  2DHO A;  1K26 A;  2FVV A;  1QVJ A;  3DUP A;  3GWY A;  2VNP A;  1V8N A;  3FJY A;  3BAP A;  3X0O A;  4NFX A;  1V8R A;  1X83 A;  1NFZ A;  1V8U A;  2B2K A;  3H95 A;  1VIU A;  1PUQ A;  1VC8 A;  3X0P A;  5CFI A;  2QJT A;  1NQZ A;  2B06 A;  2DSD A;  1V8M A;  4S2V A;  3X0M A;  3Q2T A;  2KDV A;  2PQV A;  4S2Y A;  2G73 A;  1Q33 A;  2PNY A;  1XSA A;  2YVM A;  4ILQ A;  1MUT A;  1I9A A;  2VNQ A;  3ACA A;  5GHO A;  4KYX A;  1F3Y A;  3EES A;  4KG4 A;  2W4E A;  3O52 A;  2YVN A;  2CL3 A;  3A6T A;  4C9X A;  4N1U A;  1PUN A;  3SMD A;  3F13 A;  5BON A;  3Q4I A; 
#chains in the Genus database with same CATH topology
 3RH7 A;  5ANU A;  3SON A;  4HFQ A;  1PUS A;  4NFW A;  2YVP A;  1RRS A;  1VRL A;  4ICK A;  1VK6 A;  2A8Q A;  1KTG A;  1VHG A;  2ICK A;  3A6V A;  5C8L A;  2O5F A;  3A6S A;  5FSO A;  4JZV A;  2GB5 A;  5ANT A;  2CZR A;  2QKM B;  5FSI A;  1V8I A;  3EXQ A;  5I8U A;  4J7G A;  3GRN A;  4YPH A;  1JRK A;  1SJY A;  3A6U A;  3BM4 A;  3Q1P A;  4N1T A;  1HZT A;  5GHI A;  1MK1 A;  2QJO A;  5GHN A;  5LPG A;  1G0S A;  3O6Z A;  4J7H A;  1PPW A;  1KT9 A;  1X84 A;  3KVH A;  5FSL A;  1VHZ A;  3ID9 A;  5ANS A;  3AC9 A;  1RRQ A;  3GZ5 A;  3GZ6 A;  1PPX A;  1SOI A;  3I7V A;  2J8Q A;  5FSN A;  3GZ8 A;  5ANW A;  3G0Q A;  4IJX A;  4C9W A;  3QSJ A;  5CFJ A;  2KDW A;  1MQE A;  2O5W A;  4HVY A;  4DYW A;  2YYH A;  5FSM A;  3X0I A;  5DD4 A;  1V8T A;  1R67 A;  3COU A;  1Q54 A;  2I6K A;  3Q91 A;  2I8U A;  1IRY A;  2DSC A;  5HZX A;  1TUM A;  4KTB A;  2O1C A;  3MDI A;  2I8T A;  3X0R A;  2A8R A;  3P5T A;  3HYQ A;  3GG6 A;  1Q27 A;  3FK9 A;  5BS6 A;  3ZR0 A;  4JZU A;  1PPV A;  3ZR1 A;  1MQW A;  3SHD A;  3X0L A;  2A8S A;  3N77 A;  3MDG A;  1RYA A;  1VCD A;  3U53 A;  1NQY A;  2R5W A;  2GT4 A;  3X0S A;  3O8S A;  5IW4 A;  3J7Y e;  3DKU A;  1VIQ A;  1V8V A;  2FML A;  4S2W A;  4V14 A;  1SZ3 A;  5GHM A;  3MCF A;  3OGA A;  1G9Q A;  1XSB A;  2XSQ A;  3N9U A;  5ISY A;  2RRK A;  2A6T A;  1V8Y A;  1MR2 A;  1HX3 A;  5C7Q A;  3FFU A;  4S2X A;  2G74 A;  1K2E A;  1V8L A;  3I9X A;  3P6Y A;  2DUK A;  3L85 A;  3X0N A;  3WHW A;  1SU2 A;  3Q2S A;  1KHZ A;  3HHJ A;  4YPR A;  1GA7 A;  1OW2 A;  1V8W A;  2GT2 A;  5DPK A;  1X51 A;  2Q9P A;  5FSK A;  3BHO A;  3X0J A;  1V8S A;  2FKB A;  3O61 A;  5DEQ A;  3F6A A;  3FSP A;  3MGM A;  2A8T A;  3CNG A;  5C7T A;  3FCM A;  4YOQ A;  5GHJ A;  5IW5 A;  4KG3 A;  4JZS A;  4JZT A;  2AZW A;  4K6E A;  2A8P A;  3E57 A;  2YVO A;  3X0K A;  3X0Q A;  4MPO A;  3I7U A;  1U20 A;  3O69 A;  2DSB A;  3EEU A;  3Q93 A;  5ANV A;  5GHQ A;  1PVF A;  2JVB A;  3EF5 A;  3R03 A;  1JKN A;  4ZG0 A;  1VC9 A;  2ICJ A;  5DDG A;  1NFS A;  2B0V A;  5GHP A;  1XSC A;  1MP2 A;  2DHO A;  1K26 A;  2FVV A;  1QVJ A;  3DUP A;  3GWY A;  2VNP A;  1V8N A;  3FJY A;  3BAP A;  3X0O A;  4NFX A;  1V8R A;  1X83 A;  1NFZ A;  1V8U A;  2B2K A;  3H95 A;  1VIU A;  1PUQ A;  1VC8 A;  3X0P A;  5CFI A;  2QJT A;  1NQZ A;  2B06 A;  2DSD A;  1V8M A;  4S2V A;  3X0M A;  3Q2T A;  2KDV A;  2PQV A;  4S2Y A;  2G73 A;  1Q33 A;  2PNY A;  1XSA A;  2YVM A;  4ILQ A;  1MUT A;  1I9A A;  2VNQ A;  3ACA A;  5GHO A;  4KYX A;  1F3Y A;  3EES A;  4KG4 A;  2W4E A;  3O52 A;  2YVN A;  2CL3 A;  3A6T A;  4C9X A;  4N1U A;  1PUN A;  3SMD A;  3F13 A;  5BON A;  3Q4I A; 
#chains in the Genus database with same CATH homology
 3RH7 A;  5ANU A;  3SON A;  4HFQ A;  1PUS A;  4NFW A;  2YVP A;  1RRS A;  1VRL A;  4ICK A;  1VK6 A;  2A8Q A;  1KTG A;  1VHG A;  2ICK A;  3A6V A;  5C8L A;  2O5F A;  3A6S A;  5FSO A;  4JZV A;  2GB5 A;  5ANT A;  2CZR A;  2QKM B;  5FSI A;  1V8I A;  3EXQ A;  5I8U A;  4J7G A;  3GRN A;  4YPH A;  1JRK A;  1SJY A;  3A6U A;  3BM4 A;  3Q1P A;  4N1T A;  1HZT A;  5GHI A;  1MK1 A;  2QJO A;  5GHN A;  5LPG A;  1G0S A;  3O6Z A;  4J7H A;  1PPW A;  1KT9 A;  1X84 A;  3KVH A;  5FSL A;  1VHZ A;  3ID9 A;  5ANS A;  3AC9 A;  1RRQ A;  3GZ5 A;  3GZ6 A;  1PPX A;  1SOI A;  3I7V A;  2J8Q A;  5FSN A;  3GZ8 A;  5ANW A;  3G0Q A;  4IJX A;  4C9W A;  3QSJ A;  5CFJ A;  2KDW A;  1MQE A;  2O5W A;  4HVY A;  4DYW A;  2YYH A;  5FSM A;  3X0I A;  5DD4 A;  1V8T A;  1R67 A;  3COU A;  1Q54 A;  2I6K A;  3Q91 A;  2I8U A;  1IRY A;  2DSC A;  5HZX A;  1TUM A;  4KTB A;  2O1C A;  3MDI A;  2I8T A;  3X0R A;  2A8R A;  3P5T A;  3HYQ A;  3GG6 A;  1Q27 A;  3FK9 A;  5BS6 A;  3ZR0 A;  4JZU A;  1PPV A;  3ZR1 A;  1MQW A;  3SHD A;  3X0L A;  2A8S A;  3N77 A;  3MDG A;  1RYA A;  1VCD A;  3U53 A;  1NQY A;  2R5W A;  2GT4 A;  3X0S A;  3O8S A;  5IW4 A;  3J7Y e;  3DKU A;  1VIQ A;  1V8V A;  2FML A;  4S2W A;  4V14 A;  1SZ3 A;  5GHM A;  3MCF A;  3OGA A;  1G9Q A;  1XSB A;  2XSQ A;  3N9U A;  5ISY A;  2RRK A;  2A6T A;  1V8Y A;  1MR2 A;  1HX3 A;  5C7Q A;  3FFU A;  4S2X A;  2G74 A;  1K2E A;  1V8L A;  3I9X A;  3P6Y A;  2DUK A;  3L85 A;  3X0N A;  3WHW A;  1SU2 A;  3Q2S A;  1KHZ A;  3HHJ A;  4YPR A;  1GA7 A;  1OW2 A;  1V8W A;  2GT2 A;  5DPK A;  1X51 A;  2Q9P A;  5FSK A;  3BHO A;  3X0J A;  1V8S A;  2FKB A;  3O61 A;  5DEQ A;  3F6A A;  3FSP A;  3MGM A;  2A8T A;  3CNG A;  5C7T A;  3FCM A;  4YOQ A;  5GHJ A;  5IW5 A;  4KG3 A;  4JZS A;  4JZT A;  2AZW A;  4K6E A;  2A8P A;  3E57 A;  2YVO A;  3X0K A;  3X0Q A;  4MPO A;  3I7U A;  1U20 A;  3O69 A;  2DSB A;  3EEU A;  3Q93 A;  5ANV A;  5GHQ A;  1PVF A;  2JVB A;  3EF5 A;  3R03 A;  1JKN A;  4ZG0 A;  1VC9 A;  2ICJ A;  5DDG A;  1NFS A;  2B0V A;  5GHP A;  1XSC A;  1MP2 A;  2DHO A;  1K26 A;  2FVV A;  1QVJ A;  3DUP A;  3GWY A;  2VNP A;  1V8N A;  3FJY A;  3BAP A;  3X0O A;  4NFX A;  1V8R A;  1X83 A;  1NFZ A;  1V8U A;  2B2K A;  3H95 A;  1VIU A;  1PUQ A;  1VC8 A;  3X0P A;  5CFI A;  2QJT A;  1NQZ A;  2B06 A;  2DSD A;  1V8M A;  4S2V A;  3X0M A;  3Q2T A;  2KDV A;  2PQV A;  4S2Y A;  2G73 A;  1Q33 A;  2PNY A;  1XSA A;  2YVM A;  4ILQ A;  1MUT A;  1I9A A;  2VNQ A;  3ACA A;  5GHO A;  4KYX A;  1F3Y A;  3EES A;  4KG4 A;  2W4E A;  3O52 A;  2YVN A;  2CL3 A;  3A6T A;  4C9X A;  4N1U A;  1PUN A;  3SMD A;  3F13 A;  5BON A;  3Q4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...