2ICWJ

Crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal structure of a complete ternary complex of TCR, superantigen and peptide-MHC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 28
structure length 113
sequence length 113
chains with identical sequence L
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2icwJ00
4JY5L 2ZOLA 4X80H 2HVKB 2Z4QA 1RAMA 2KBGA 3OR6B 1LD9B 5E4EC 4HFUH 3O9WC 3S4SG 4HZLA 2HKHH 1KEGL 2H3NA 4JFQA 5HHNB 5B4MD 3QUMH 3O3DB 5E8EA 4K2UH 4EBQH 2XQBL 3FOMB 3VFVA 25C8H 3ARVA 3AXLB 1T1YB 1N5YL 4R0LA 3L5IA 1MLCA 3PJSB 2HN7A 5I75B 3MYJA 3SDAB 3U0PB 5HHOB 3G5YA 4OTXH 1S3KL 5H37G 4M7ZB 4NUJB 2P5WE 2HAZA 3TBWA 4N8CH 1E4WL 4LIQH 3VXSE 3UJTL 3KPOB 1CT8A 1EGJA 4B5EA 5F71A 1F45A 5ID1A 2BSRB 2VLME 1EAPB 4QTHA 4LLMA 2XN9B 1EEQA 4NPYA 1FHGA 3SGEH 1K8DB 5F7YC 5IFHL 5CZVL 1G84A 4NQEB 1NMCB 5C09A 4RNRB 2VDPL 5J0BA 4FQJH 1YEHL 1R5VA 3GHEL 1D9KD 1JGLL 5LGHH 5D2LB 5IB5B 1CFVH 5CP3A 4JFFE 4HHAA 4G7YH 4M5YH 3RGHA 2X09A 4JO1H 3ALPA 3OGCA 3MGTB 4P4KB 1P6AB 1I9IL 3REWA 5C70A 1IKNC 3QR2A 1HEZB 4M7JL 1IARB 3DO7B 4XVUC 4D9RD 2CMRH 3DUSB 5BRZA 3WNOA 2ZCLL 4WHYG 3KLSA 5ITFA 2E7LC 1OAUH 3I2CL 1NAMH 3L3OA 3RIFK 1B0WA 4PLJD 5HHQB 1R3HA 4GRWE 3QUKA 2HVJA 4X80L 1YMHA 2NY4C 1OQXA 4MNQE 3RVTD 3VFRB 5L2JB 4WFGD 2FJGB 4XMPH 3U7WL 1MWAH 1FZKB 2HKHL 3WFHB 1B3JA 4RMRA 5DJAA 5GS2H 3QFDB 5L8LB 3ARFA 5DRNB 4K2UL 2FSEA 1AR1C 4KI5D 2H32H 3HG1A 25C8L 2X7LA 5L8JB 1ACYH 4X7SL 3O4LD 1FIGH 2WNGA 4DZBA 2YPLA 4HT1L 2NQCA 4WFFE 2J7LA 3HI5H 5KSAB 2DMKA 4R4FH 3RIAF 2IANB 4N8CL 4LIQL 3QEQA 5FUZL 1VPOH 5B8CB 4PJ5E 4U6VH 3MRJB 4XCEB 3W11D 3VXTA 3QDJA 1HDMB 3HC0B 1JWUA 5TPWH 1I4FA 4NQCB 5I8CB 4BFGA 5IW6A 4MDIB 5DD5L 4FQJL 4KDTC 4MA3A 4BKLA 3VGHA 4CU6A 1EFXB 1NEZB 5C3TA 1YN7A 4ORZC 1R0AH 4M5YL 1W0YT 1I3UA 3BDXA 4LSQH 4DUVA 3DBXA 3BP4B 4LGRB 4PJ7A 3U36A 1S9YB 5F96L 1C8PA 1MFDH 1OT1A 1ORQB 2WM0A 3NPSC 5H37H 1IQWH 4OZIE 5E7BA 1JE6A 1GGIH 3FQUA 2CMRL 4XBPA 1NC4A 2B1HL 5ACZA 5J1AB 3UBXG 3QBTB 5GZND 1N2RA 2R23A 5LJYH 1FNEA 1YJDH 1I85C 1I1FA 4GRLC 4WI3A 4YO0A 3V2AR 3QIWD 2MJWA 1NH6A 4JRXE 3LEYH 5JO5A 5HDLA 4XMPL 1N26A 1CLYH 4XNYL 3D0VA 1MWAL 1WTGT 3EJYC 4F33A 2GJ6D 3TZVA 1OB1A 2NPLX 4IRSC 1HHGB 2CRIA 3MBEC 2Y6SC 3DURB 4GS7C 3ZTJG 4HULB 4FZEL 3RGVC 1FIGL 2XZCH 1RJLA 4WHYH 3WL9B 4LVHB 1YC8A 3HI5L 3T2PA 1PG7H 1MVUB 2ITDA 2YR3A 3C6LC 4TUKH 3KYKH 3BN3B 1RURH 4DKEH 1NCCH 1RJYB 1VPOL 2DM4A 5E24E 4CADA 2VQUA 4U6VL 2UVEA 2XKNB 4PREA 1X5AA 2YEZB 3RWHB 3FQNB 5ESAA 2VDNH 4HJJH 43CAB 4WUKL 2DQUL 3BZDA 3DV4B 5FDWB 4XI5C 2GAZA 2FECL 2WW8A 3ORJA 3BKJL 4Y5XB 2VRAA 1A02N 3T0VA 1R0AL 1C5CL 4F9PA 4LSQL 5H2BB 3T65B 5EU6B 3X11A 4HWZB 3RNKA 5DHYA 3MV01 3RU8H 3TESA 3WFEL 1IQWL 2I07A 2GITA 3QEUB 3O8XC 1WQVT 4WI9A 3C2SA 1S9VA 3RJDA 3RVUD 3IVKA 3CUPA 2DLIA 2NXZB 5HI5D 4FA8A 5I1CL 4XTRC 1OHQA 5E9DB 1GZPA 1HE7A 3RWGB 5E4IA 4G43A 3OAUH 1TDQA 4DVBA 3GSQA 5J57B 1HCFX 4J3VA 1J10A 4OZFH 3RWEA 4H1LH 1ZLWH 3CDYA 1CCZA 1JF1A 4LF3B 1CLYL 4P2OB 4P3CL 2Z31C 4ZO7A 2NY7H 3GIVB 5EUOF 1CDUA 4Z7WA 5IHZB 4FG6C 4ZUVA 3VWJD 3DXAB 4HGWB 5HVFB 2X9WA 3N06B 5I1EH 3DSFH 3KYNA 1AD0B 1FO0A 1VDGA 3AAZA 5JORA 4RA3A 3RVXC 1JP5A 4OCLC 1EHXA 1HILB 4J4PC 4R2GC 3SDCC 2YSSB 1RVFL 5IB2A 3KYKL 3QIUC 3Q5TA 4OCNC 1EHLH 1RURL 2NY2B 2ZUTA 2H2SD 1NEZG 4OV5A 5DJDA 3GBNH 3FB8A 3FN9A 3IJYB 4PJXE 4XNZC 4KMTH 4CN4A 5FO8A 2F15A 5DJ2B 4F15B 3QULA 1IBGL 3NGBC 5DZOA 2HT3C 4HJJL 4IS6A 3HE7C 3WFCL 1AGBA 2X1QA 3ZTNH 1DQTA 1J8HA 1JPTH 3UPRA 2NXYD 5TGBA 3LPGA 4CN6A 4ZO8A 4ONHA 1W8NA 3ZTJH 3TBYA 5E8PA 1U36A 4L1DA 1T66D 1QSFE 3DX9A 1Q0XL 1ULVA 5D5MA 3RU8L 5J13B 3EYOA 5A2KH 2V7NA 3D18A 3ARBC 4PRBA 4R26H 4OUOA 1KBGH 3RNQA 4ZXBB 3JWOC 2W0LA 2Q86A 3CK0H 2XA3A 1M6OA 2R8SL 1QLRA 4MB4A 4KDVA 4KKNA 4PB9H 3U0TA 4Y5VA 3IDJB 3QJHA 1MFCL 3V6BR 5MHSE 3ZE1E 1BIIA 1QLFA 4M9PA 4AIZB 1XCQA 1DVFD 2W0FB 3T0AA 3BD3A 4PRHD 4FRWA 1INEL 4EEEA 1BF8A 3B3IA 4X0KB 5DMIL 3OKEA 1KF9B 3CCHA 5ANME 1FP5A 2F54D 3QFJE 4ALAL 4WIQA 5FO9B 1BX2A 2R9HC 3L95B 4IOFC 1P5UA 3GSUA 5GS0H 4HXBH 1GGCL 1JWSB 3LQMA 4U1SB 4I13B 3DSFL 4IIQA 1FNHA 4GH7B 4WHTB 4ODUA 4KMQA 1KIPB 3S5LB 1RZJC 5DEFA 5CMAB 5EU4A 3QQ3A 5GSRB 3Q6FB 3IDNB 3RL2A 3BMVA 1EHLL 4FQ1H 5E5RB 3KPPB 3RL1B 1HXMA 3GBNL 2H1PH 2I26N 3CSPA 3VXMB 2CLZA 4KMTL 3VGBA 1S7VB 3VMPA 4UU9B 3X12A 1XF2A 1AXTH 4Y4HC 4JHWH 3TO4A 4X4ZA 3NFNA 1CGVA 1ONQB 1FFNA 3Q3GA 2X9XA 4IRZL 2Z8RA 4UZGA 2QADB 1EX0A 3G6JE 4FXGA 5FFLA 2P49B 1OAZL 4L9LB 2B1AL 4AG4H 3NN8A 5AG8A 4GAYA 5CJ8A 1CBVL 5GHWH 2DIBA 3PWVB 5GGQH 3DVNB 1MCHA 5KSUA 2DWEB 4YE4L 3DIFA 4JB9H 1V8HA 4V2BA 3FHQA 3BEVB 4XVSL 2CKBL 1C08B 2B0SL 4PUBL 3PDDA 5GRZA 1CFTB 1IC1A 5JZ7C 3QUXB 1MRFL 1QFWL 2BX5A 2MQ0A 3PDGA 2R2BA 4HUXB 2JB6A 2OX5A 4M8VA 4WO4C 5JIHA 4QRRE 4PJ7F 3UTSB 1UC6A 4OCSL 4O2EB 3FQRA 2IWGA 5EBWB 3BZEA 3RPKA 2RCSH 4H26A 5LWYL 2DQGH 1AGEA 4ZD3L 3HZMB 5GS0L 2ERJB 3O4OB 5T1DH 2HKFH 1T0PB 3GM0A 4Y1AD 1MPAH 1JYXA 4K07A 4NJAH 4I0PA 1TTFA 1JIBA 3H6JA 4HFWA 2DJ4A 4MWFB 1HYSC 4FQ1L 1ZHBA 1NGPH 1ZS8A 2OL3L 3KWWA 5BOZG 4YIQA 1ZA6A 1QO3B 2YPKA 1WBXA 1YNTA 4OQTA 3KLAA 5E94A 5GRXG 1TTUA 4ELKB 3KPSB 1IAIM 1YEDB 5GGUB 2ARJQ 4J12A 1AXTL 2IPUK 3B9AA 5GGRB 4JY6B 3NFPA 4JHWL 3RVWD 1IE5A 3DETD 4WU5B 1G6RB 1JGEB 3ECBB 5DD0H 5IM7B 2NZ9D 1TVHA 2L4OA 4GW1A 4KI1A 4KTEH 3F12B 4AG4L 1MHPH 1TLKA 3KPMB 3O6KL 1BBDH 2O26U 5GHWL 1M7DA 2EEBA 4U6XB 3NFSH 4XZUB 4JB9L 3LN5B 5JHDB 3VWKB 4RGNE 5FGBA 5KANG 1JZ2A 4KY1H 2XG4A 5GGSY 4LHUA 2DRUA 3EZ8A 1RJZA 1I7RB 1OM3L 2QL1A 4YEFA 4OD2B 3CDCA 1N3NA 3GSWB 3MRDB 3MRLA 2ZSVB 2AJVH 1WAAF 32C2A 2KUTA 4PR5A 4I4WB 1Z9LA 3S5LG 4TNVK 5EZOL 4K9EC 4C58B 1WBZB 1F3DJ 3V4UL 3IJSA 3EHBD 2RCSL 3ARGA 1A6ZA 3GUTB 2PTTB 3KPRD 2XFXB 3UPAA 4U1NA 4NUGH 1LE5B 3VXSD 1X5IA 1TCMA 4P2RE 4AENB 1K3ZA 3C60C 3ZZ1A 3V6OC 4NJAL 5I76A 1IAOB 3D3VE 1IM3B 1HHIB 1MF2H 1U8HA 2VLMD 4LK4A 2NY3B 3MLSL 4MSWB 3IRZA 1NGPL 3MROB 1NGXA 4X5LA 1OGTB 3OAZH 4Z7WF 3B9KC 4WUUD 4IRJA 3SE8L 3LS4L 4J3TA 3ETBF 3MFFA 2ADGA 4PJ8B 1NKRA 2FHFA 4LIQE 4JFFD 1YMMB 2FGWH 2DL2A 1ZTXL 5D7IA 3SKNA 1OP5H 1G9MH 2FEEL 4P2QB 1DSFH 4U6HA 4JJHA 2DYPB 1A9BA 3FOLA 3QDMB 5DFTA 2FR4B 1A7PL 5J6GA 1L0QA 1P2CB 1MHPL 4W6XB 5D70H 1ITBB 1BBDL 2C4FU 3O6FA 3O3EB 2ENYA 3NFSL 2DIJA 3EO9H 4OLWL 4ZAKB 1EEYA 2CXGA 2QQLH 1MCOH 2FL5B 4KY1L 4LMQE 2CGRH 4YGVA 4LLVA 5A16A 1BBJA 2AVGA 4Z5RB 2DBLH 2P7TB 2GSGB 5ESQB 5C0JA 1MI5E 4EVNA 1EK3A 2EDOA 3BH8A 2AJVL 3V0WH 2HG5A 5LXGL 4UINH 3FQWA 3HZKA 4GW4B 4MDJB 1RZ7L 2HRPL 1JFQL 4BSJA 4LBEB 1OPGL 5HGHB 3L5WB 2D03H 1U3HD 2G5RA 2H41A 4JANA 4ZNEE 5IR1B 2R0WL 5EUOB 4WW2C 3WHE1 3K1KC 2DM3A 3QPQD 2BVQA 2ZOLB 3BSZH 2BNRE 4WFFD 5CP7A 2D7PA 4JZJA 3C08H 4NUGL 2Z4QB 4MVBC 3FAXA 3FMGH 1U3JA 3QXTA 2XY1A 1OSPL 2YN3A 4HZLB 2EDXA 3H7LA 2UZIH 3UTQA 4ODTH 2C4FT 2H3NB 3L5HA 3MSPA 4Z78A 4JFQB 1TQCC 4N0UE 4X7DC 4PIRF 5E8EB 3W2DH 5L88H 4X6FA 3C5ZD 4RGMB 1ZT7A 1UWEH 3VFVB 1QEWA 1NFDE 4ONGH 2XWBA 3SDXA 4R0LB 1YZZA 2FGWL 1CN4A 1MLCB 2HN7B 3BDBA 3MYJB 4GSDL 2P48B 1OD7A 3G5YB 5HHMD 1QTYT 1VA9A 1G9ML 4L4TA 1YA5A 2EE9A 3TBWB 1BD2D 5CEZH 1F4WH 3O2WL 1CT8B 4PRIA 5ID1B 1HWGB 1T7ZA 4QTHB 3MCLL 4LLMB 4R90H 3RJQB 4NPYB 5CZXD 4PJDE 3K4DA 3RDTD 4TVSa 4Y4KA 3A6CH 2DI8A 2QQLL 5C09B 4CGTA 4HCRA 4POYA 1R5VB 3TPUA 4HIJA 4JRXD 4HIIA 4ZPVA 4L3CA 4HHAB 4BK4A 1ODAA 5ADPH 1NBVL 3ZYIA 3OGCB 3REWB 5CJXA 4XPTL 4WV1A 3BP5A 1KCUH 5IIEA 3ZE2F 5HI4C 1SBSH 3WJLC 2D03L 3CLFL 4LLQA 4QRPA 1QHPA 5BRZB 1FIEA 2VLKE 3MRFA 5ITFB 2VZSA 3MXVH 4ZDHA 5KBNC 3L3OB 2ZP0T 1BMGA 5D1QD 2CSPA 1R3HB 1PDKA 3QUKB 5CINL 2HVJB 3BSZL 1TZIA 5F1NA 1YMHB 3T3ME 3C08L 3OX8A 3FMGL 5DJ6A 4ZYKA 2R1YA 1I1AD 2AERT 4LRNL 4PV9A 3QWRD 5MEPA 1KJVA 2X6MA 5DJAB 5KTEH 3W2DL 3ARFB 5L88L 4GAJL 2FSEB 2DJUA 4MMXC 5HDOA 1UWEL 2FLRT 3HG1B 4ONGL 2X7LB 4KV5F 4DZBB 2VUOA 3QQ9C 2YPLB 5TDPA 4OFKA 4KQ4H 4XPFL 4XNXH 3W0WA 1F4WL 1OARL 4MA8L 3QEQB 1T7XA 3QEGH 5HI3C 5KOMC 2BY3A 5D7JD 3GMMA 3L5JA 1F90H 3VXTB 3QDJB 3OMZA 4R90L 4XNMA 1JWUB 4IRSD 1I4FB 3NACH 5IW6B 2Y6SD 1G6RH 1MIML 3IFLH 2FH8A 2IQAA 4JVUA 2XZAH 3QCUL 3U4BH 1LO2L 4MA3B 1SMAA 3SDAC 3RGVD 4BKLB 1IT9L 2DQJH 4M7ZC 1YN7B 2AJZA 1N59A 5HPOA 1MHEA 1A6UL 3T0EE 3C6LD 5ADPL 3DBXB 2FJHA 4GAGH 4G8GE 3B9VA 4YK4B 1ADQA 4PJ7B 1FNFA 5E8DL 3U36B 2XRAH 2EIEA 2ESVE 2XNAA 3VG0L 5DTFA 1MCJA 4G3YH 1SBSL 2XT1B 1EBPA 3FQUB 4A2MA 4XBPB 5DUMH 1NC4B 5ACZB 4ZODA 1A5FL 5JW3L 4JQVA 1OGAD 4OZGA 3EYQD 1N2RB 2R23B 1FNEB 4GG6F 1I1FB 1WEJH 3HAEA 1KPVA 4D0CA 3NIFF 4YO0B 1IKFL 5H35A 4DJMA 1I1YA 4LLUA 5JO5B 4OCXH 4F33B 5E6YA 1TNNA 3D0VB 3FN0L 3L7FA 2WBJC 2EECA 2BOCA 3TZVB 1OB1B 5CJBA 4DOHB 5GZOC 2UV3A 5KTEL 1WFOA 4Y2DC 2C1PA 1BIHA 1W2KT 2OLDA 4PLNC 4XPAL 4L1HA 4FQIH 1RJLB 2M8XA 4XTRD 4OCWL 4OFYA 3DOSA 4OD3L 1VADA 1QSFD 2ITDB 4KQ4L 5A2IH 1V7ML 2VN4A 3GFUA 3MV7A 4AMKL 4CADB 4CW1A 4OLZH 5DURD 1A7QH 4PREB 3ULUF 4ZOAA 2XZZA 3E3QE 2I24N 4FG6D 4L5FH 4RCAA 4Q2ZA 3IXAA 4AZ8A 5ESAB 1G6RL 4ODSL 3IFLL 5EIQA 3L3KA 1J1PL 1I7ZA 3BWAA 3U4BL 4WI8A 1GAFL 2GAZB 5D7IF 3K3QA 4NQEE 5ICZA 4FQCL 4FFVC 5IJKC 4XNUL 3SDCD 3PNWA 4G42A 3F8UB 3QIUD 3X11B 5JMRA 2XRAL 5DHYB 3RNKB 1F3DH 1AE6H 1RHFA 3TJEL 4G3YL 2I07B 2MHAA 2GITB 2V7HA 4C59B 4DUWA 4QCIA 3LSOA 2AEPL 4PJ9C 4PJCA 6FABH 1S9VB 4CU8A 4X6EA 3S8WA 3IVKB 3CUPB 4UTAH 3AS1A 1WEJL 2ATPA 4XRCA 1GZPB 4GXUM 4G43B 4GMSL 3CX2A 4DVBB 4QHKJ 3GSQB 3LRSA 1Q38A 3RWEB 1JF1B 4OCXL 4YXLL 1F8TH 4NWTH 1H3GA 3EIFA 5C08D 2OMNA 4Z7WB 1WWBX 2DDQL 2W07A 4ZUVB 1XMWA 1WC7A 2QSQA 3BFOA 3KYNB 2F58L 1FO0B 3AAZB 5JORB 2BXZA 4LVEA 3IU4L 1ZHNA 3L6FA 3ES6A 3WV0A 5IB2B 2WQRA 4JZOA 5I19L 4OV5B 1I3RA 4XCFH 1ES0A 5DJDB 5DZLA 3FB8B 2PXYA 2IANE 4OLZL 3MLRH 1A0QL 4OCMC 5FO8B 3VCLA 5KSVA 3QULB 1UCBH 3SDXF 2CDGA 3FFDA 5EOCJ 4IS6B 1EA9C 3KLHD 4NQCE 1AGBB 2F5BL 1NCUA 3QISA 4QRRD 1J8HB 3G6DL 3Q2CA 1EGJH 4LPCA 3UPRB 3EDEA 5TGBB 1YNKH 4ONHB 1J18A 3OAYH 3OKKA 4ETYA 1B88A 3TBYB 5E8PB 4JPWL 3SJVE 1UENA 5J89A 3DX9B 1DBKH 3ZHKA 1AE6L 5D5MB 5TF1L 3EYOB 2V7NB 3D18B 4PRBB 3S96A 1KC5H 3RNQB 4AEHH 2YPVL 5CP3H 3P9WB 4X83A 2Q86B 1M6OB 6FABL 1QNZH 1QLRB 4MAYD 3VXUD 3U0TB 4HUWA 4Y5VB 3QJHB 2ZG3A 3AREC 1A8JH 1BIIB 1QLFB 1XCQB 4QKXB 1YPZE 4K94H 1JL8A 3UXFA 3CAFA 1U8IA 1WT5C 2P4AB 3B3IB 2G60H 3MJ7A 3OKEB 2Q8AH 3B2VH 3CCHB 1PG7X 5DMGC 1BX2B 4K3JH 5F89A 3GSUB 1ZK9A 3SE4C 1RUAH 1G7LA 4IIQB 3CFCL 4LVNC 3U6RA 4ODUB 1PFCA 4NO3A 2YD9A 5DEFB 4P9HL 4N8PA 5EU4B 3QQ3B 3OL2A 3RL2B 5B38A 3LEXA 2A6JA 4XCFL 5FYLH 4WCYH 1HXMB 2BRQA 1UB5A 4IBLT 1RD6A 3TPKA 3DTXA 3MRBA 4RGND 4ODVL 2CLZB 4GOSA 3SCMD 1L7TH 4N0FA 3X12B 1XF2B 4NO5A 5T1KD 2DICA 5DC0A 3VXQA 5DF0A 4POZC 3TO4B 3NFNB 2OR9H 2O5XL 1Q8MA 4JFHD 1J8KA 1FFNB 3B8SA 3Q3GB 3QRGH 2R15A 2CR6A 4MD5A 1OAXL 4PJIA 1YNKL 4TSAL 4XP6H 4FXGB 5DT1H 2HH0L 3K46A 1GSMA 5D1ZA 4LPVA 4UIKH 1HYSD 3NN8B 1EPFA 3BD4A 4GAYB 1DBKL 1MFAL 5C0ND 4P5TA 2EH7H 2XQYG 4MNGA 4AEHL 3DIFB 5KSUB 1FAIL 4P2RD 1QNZL 4N5ED 3B5GA 3BN9D 4QRTA 1QBML 3RZCC 3REVA 3D3VD 3TVMC 3LEVH 2EE3A 4YWGL 1CXKA 2X44D 2R2BB 2JB6B 4MJ6A 4PJAE 4Z95H 5E9DE 1DQLL 5DA0B 4NZTH 2G60L 4A2LA 3FQRB 2CUIA 1TITA 2Q8AL 2X2YA 1QA9A 3BZEB 4XP1H 1KYOK 4H26B 4ZXBC 4HLZG 2FEDC 4OZGF 1AGEB 1DR9A 2A6KA 5I15H 3MYZA 1M1SA 3WUWA 3U1SH 3HMWH 5E1HB 1BZ9A 1CYGA 4NN7B 5ADOH 3MRPA 3TO2A 1L4IA 1G9NL 2Z9TA 4F9LA 1QBAA 4I0PB 5C0BE 1UWXH 1CGSH 1CQKA 5J9PA 3EFDL 4HFWB 1ZHBB 1ZS8B 2YA1A 3KWWB 4HDIA 5F3HA 4KPHH 4WCYL 1WZKA 3FKUS 4YIQB 1ZA6B 5JLZA 2DQTH 3BUTA 2YPKB 1RHHA 1WBXB 1YNTB 3KLAB 3LKOA 5E94B 4KZDH 4MQSB 2GT9A 2JKXA 1U95A 3TT1L 3QAZB 5MERA 2J3SA 1IQDA 7FABH 2J8UE 4G9DA 1MI5D 1CIDA 3NFPB 3LCYA 3L3JA 3QUYC 4PGZA 3SE3A 2OR9L 1LO5A 3A6BL 2XTJB 3QRGL 2D2OA 4I5BA 1TVHB 3QSKB 5DGRA 4GW1B 3TN0D 4XP6L 1IGMH 4JO2L 1MSPA 3JXAA 3BH9A 5CWSA 1M7DB 2BVTA 2A77L 5M95B 1IZJA 5C9JA 1KJ2A 2BNRD 4UT7H 4K3GA 3CZFA 2RGSA 1ACZA 2IH3A 4BH8A 4LHUB 1IM9D 4FFWC 1RJZB 1ZVSA 2GIYA 2EC8A 2VO5A 1KSRA 2AXGA 1N3NB 5FHBH 5DMYA 3LEVL 3MRLB 1VFUA 1QFUL 32C2B 4LKXA 4PR5B 2R4SH 1UJTA 3SBWA 4WW1A 3C2AH 4TYUA 2EIDA 5T1LA 4LCWA 4ZFGL 4LNVA 3IJSB 1GGBH 4XP1L 5HGBA 1UH4A 3ARGB 4PJCF 5GGVH 2OR8A 1A6ZB 3O81A 4M4PA 4U1NB 2A0LD 3ZKNC 3U1SL 4P4RA 5T1MA 5L2KA 5E2WL 1URLA 3LN4A 5I76B 3AMKA 1U8HB 5DJYA 4NFDA 1NGXB 4IRJB 4N9GA 3SGKC 3DWTA 1FO0H 3MFFB 1DLFH 2ADGB 4YHLH 2XWJA 3VXME 5CEZE 7FABL 3S34H 1CD1A 4UT6L 4NNPL 4W81A 2PW1A 4QLRA 5D7IB 3SKNB 5EZJA 4CVZA 4U6HB 1YY9C 5DYOA 4Q74A 2C7UA 3V6FA 1A9BB 1HHKA 1OL0A 3FOLB 2AI0H 5KSBA 3P11L 5J6GB 1IGML 2D7TH 3CFEA 2VLKD 5FXCH 2AEQH 3O6FB 4P46D 1QFOA 1F3RB 1DQJA 1EEYB 1SVZA 4X7TA 4PP1D 4YGVB 5ENWA 3VGAB 2P45B 4LLVB 1GOFA 2E8YA 1BBJB 5A16B 2UYLA 3QP3A 5C0JB 5FHBL 4EVNB 3LDBB 2I60L 4HF5H 3BH8B 1MCQA 4XP9H 2HG5B 2R4SL 1TQBC 5KZCD 3FQWB 3HZKB 1G1CA 1WITA 4GG8A 3C2AL 2DWDA 3Q48A 1BM3H 3O9WA 4ZUUA 3UTSE 4JANB 1I9RH 4UNUA 5IGXL 4LOUC 2KZ1B 1GGBL 4D3CH 3EO1A 2BVQB 3HKFA 3QCTH 5CP7B 4NN5C 4JZJB 3GI8H 4WEUD 3G5VA 3PGFH 1F2XK 3O3AA 4YDKH 4U1LA 5CZKA 1YEIH 4M48H 1CXIA 1A64A 2J8OA 3UTQB 4Z78B 4HH8A 4KUCF 4JR9L 4OM0H 1D5IH 3MQIA 1FO0L 4M6OL 4X6FB 5EOCH 4C55A 4AK1A 1ZT7B 4ORGA 3PP4H 1QEWB 1U8QA 2XWBB 3SDXB 1JYNA 2DQEH 3KPSE 3KPNA 1CFSA 1RFDH 1ZV5A 1J12A 4RMVA 4G8GD 3UPCA 4L4TB 4LHUG 2ESVD 5HYJE 1HH9A 4NRXA 2H9GA 5IVXE 1QQDA 1X6LA 2NY3C 3MODH 5C0RH 5JTWA 3QUZA 4PRIB 1IRAY 4QHKI 2WK2A 2AEQL 4RRPA 4C56E 5L0QC 1IKNA 5INDA 2R56H 3HN3A 4GBXC 4PJ8C 4BYHA 4Y4KB 2BNUA 1UT9A 1KN4L 3PHQA 4X4XA 4XMKH 3SKOA 1UXWA 3TPUB 1FZJA 4HIJB 4HIIB 1OT2A 4L3CB 1I9JH 4ZPVB 4PJIF 2HT4D 4N1EA 1DUYA 4AEIL 3BGMA 1P69B 3ZT7A 1A7RH 4WV1B 3BP5B 4D2NA 5IIEB 5SWSE 3ISWA 4L4VA 3F6LA 4LLQB 3X3GL 2AV7A 4QRPB 1U3ZA 1BPVA 3MRFB 4PS4H 4D3CL 4ELMF 1TJGL 4ZDHB 4ZAKC 1BEYH 4TNVF 1H3PH 2GUOA 1OOAA 1SYSA 3D9AH 1TZIB 5F1NB 1JTPA 3VFPA 2DLFH 3SDAD 5D6DC 5HHOD 3OX8B 3TV3H 5DJ6B 4ZYKB 1DQDH 2R1YB 3QHZH 3ULVE 4Y4FC 5FF6A 4MGXA 4M48L 4PV9B 5MEPB 1KJVB 5HYSA 2EYRA 5F88A 1NCWH 4I3GA 1J5OH 1D5IL 2QBWA 1OSZA 1VFAA 2XN9D 2ZCHH 3CPLA 4NCDA 4K7PL 3FRPA 4MB3A 4NQED 1OAYH 1AO7A 4ZO9A 3PP4L 5EWIH 5I71C 4PG9A 4PJEA 3SQBA 4XH2A 2MCPH 4JPKH 3PABA 5DRWA 5FO7A 1YMME 1KCRH 4PBVC 3NABH 5TDPB 4PGBA 5I1KH 3G08A 4KDTA 4P4KD 5CIPA 4OQTH 1C7SA 1PKOA 3W0WB 4I3SH 1KNOA 3QXVA 4P9HC 3GMMB 5LCVH 3ARDC 5JW4R 3QDME 2DN7A 4Y16C 4JPIA 4XNMB 3QB7C 1EO5A 2Z8VC 2DLGA 3VMNA 1RK0A 2IQAB 3LQAH 4L8DA 4XMKL 2CLRA 4B7LA 3MV9A 5CD5C 1I9JL 5GS0D 2AJZB 1N59B 4QOKE 5A2JH 1MHEB 1YECH 3P0VL 4RWYH 1HZHH 1U92A 1I85A 4GRLA 2CRZA 2FJHB 4V1DA 1LK2A 4M7LH 1QLEH 2XNAB 2K7PA 5DTFB 3WFDH 4WTXA 2AKRA 3TFKC 2EO1A 4I3RH 2AQ3A 1BEYL 3ESUF 4OZGB 4MXVF 4K71B 1TENA 1JMZA 2ED7A 3MBEA 3IFPA 5LQBH 2DLFL 3MRQA 3WFBL 2FATH 4JKMA 5D7SL 2V6HA 4YR6A 3RHWK 3EDFA 3HAEB 4Q9QH 1KPVB 2HFTA 3RY5A 4KAQL 5KSAD 1DQDL 4JCLA 3VFWA 4D0CB 4M03A 5H35B 2IAND 2PTUA 1I1YB 4LLUB 2MSPA 3FFCE 3CMGA 4EI5C 2VTFA 2VLLA 1PKQA 1KTDA 3L7FB 4L8SA 2CQVA 3ZDZF 2BOCB 2N56A 4NO2A 5K9QG 4NQCD 5BV7B 2C1PB 2UZXB 2X4UA 2AQ2A 43C9A 1OAYL 5SWQA 3ZYOA 1MHHA 1IAKA 2FBJH 3VH8A 2J4WH 4K55A 1EFXD 1KCRL 3NABL 4RMQA 2Q6WA 4Y88A 1FNSH 1IEHA 1VADB 1QKZL 4ZUTA 2IGFL 3QQ4A 3RRQA 1F2QA 3CDFA 1QSEA 3ULUH 3MV7B 5LCVL 4CW1B 1G9NC 1WSST 4OUUA 5T3ZH 1RIVH 2FRGP 1A3RH 5DS8A 1JNHA 4Q2ZB 3IXAB 4FMKA 3GEWB 3L3KB 3LHPL 1G7PA 1I7ZB 3BWAB 3MA7A 3O8XA 5E2VL 3D0LA 4J3UA 5ICZB 4UOW0 5MI0B 2FCBA 3MOBH 2G75A 5GRWA 5E03A 1HZHL 3PNWB 1MJ7H 2X42A 2A74A 4G42B 2AJ3A 2EDEA 1J86A 5DSCA 4M7LL 1LGVA 3VFOA 3ALWA 1WWWX 2MHAB 4LLDA 4XCYA 3RY6A 2V7HB 3WFDL 1B2WH 4QCIB 3CLEH 3LSOB 1T5XA 1KIRA 1CVRA 2Z31A 3LB6C 4OFDA 4PJCB 4XBEH 4X6EB 5BRZE 1PAMA 2FATL 1KFAH 2ATPB 4XRCB 2CH8A 3CXHJ 3PL6C 3V5DA 4HMEA 5C8JA 2NY0C 3LRSB 3HC3H 4YK4C 1TVBA 4J4PA 3RWCA 1FC2D 4UAOB 4WFHE 3R0MA 4JLRA 2LAGB 2UY7A 1W72A 5M94B 1FBIH 2QHRH 3VA2C 1TETL 4OLUH 5BO1L 1WC7B 2HWZL 1CXHA 1PX4A 4IDJH 5FYLE 3QHFL 3HG1E 4HWUA 4CUCA 2J4WL 2KQNA 3HE7A 1ZHNB 4JG0H 3SKJH 4HIEA 4LSVH 3L6FB 4RSVA 3ES6B 1G7IA 4KQ3H 2FGZA 4OIBA 4JZOB 3ULUL 1MCBA 5EU6D 1I3RB 2X89D 5C0CE 1ES0B 4JVWA 3R1GH 2PXYB 3TZVC 1UWGH 2CDFA 2W9DH 3FT4A 3QEQE 5DMGD 3D85A 3VCLB 5KSVB 1NLBH 2P24A 1FAKT 1WV7T 4ENEC 2CDGB 5ITBH 2HLFC 3FFDB 3QDJE 4HS6A 4YUEL 3ARBA 1ZLSH 4N0YL 4MS8C 2NXZD 1V3MA 3VRLE 3CVIH 5E9DD 4NFCA 2BSSA 2DTMH 4S1DC 5AWNH 1VESA 3BPNC 4LP4A 3OKKB 4M61A 4LSTH 4U1IA 2ARJA 4FFYL 3SKUD 5HDQL 4P2OD 1UJ3C 1U8MA 1J1OH 4YXHH 1K6QH 1P53A 4HCRH 4LGPB 3S96B 4G8FA 1D3CA 4I1NB 1XEDA 2IAMA 3DXAD 3DRTA 5FYKH 4POZD 3B43A 4BA8A 3U0WH 4HUWB 4P5KA 1KFAL 3ULSA 4Z7OE 1WZMA 1AY1L 1IAIL 5I8OL 1NBZA 3VG9B 2NY2D 3GMQA 3HC3L 1U8IB 4MQXD 1FNAA 3MJ7B 4S0TD 2YOCA 4HWNA 5FHAH 1FGNH 5IKCA 1FBIL 2QHRL 5F89B 2R4RH 1D5BA 1QYGL 4FXLA 1G7LB 4X5XA 1UCTA 2F5AL 5HBBA 2R39A 3U6RB 4Y5YC 2N4IA 3H9SA 5JDJA 4NO3B 1MCWW 4Y4HA 4JG0L 3SKJL 4RIRA 1FVEA 4HKZA 5B38B 2B8OT 5CILH 3LEXB 2A6JB 2HTLC 4LCCC 4ZFOL 1UB5B 2VR9A 3R1GL 4I0CC 1QFHA 3DTXB 1RUPL 3MRBB 1JZ7A 3WNLA 4ZXBD 1IGTA 2MPAH 2FEDD 4N0FB 4GFTB 4NO5B 3U9PH 5ITBL 4HMDA 5IROC 3MUHL 3VXQB 1ZLSL 4XPGH 4NQXA 3CVIL 4MD5B 1QSVA 1Q9OA 1KGCE 5AWNL 4PJIB 1B0RA 4LSTL 5D1ZB 4YC2C 1DBAH 4K23H 5HJ3A 4WO4A 3GNMH 1T4KA 4GUPA 5HXMA 4P5TB 4QXUL 3KVQA 1E27A 4JG1H 1RJCA 4MNGB 3DO3A 2FIKA 3OR7A 5E08H 5DZNA 4QRTB 1MLBA 3U0WL 3REVB 1ADQH 4NKDA 1A3LH 1QD0A 4MJ6B 4NRYA 3RQ3A 4JFOA 3KLDA 4HPYL 3TCLA 2IC2A 4D9QE 1AXSA 2P44B 1X5HA 3VXMD 5F9DC 1QA9B 3RA7H 5JPNA 4CBPA 1FGNL 1MCNA 3HAEH 2R4RL 4LSDA 4Z7WE 4KRPB 2A6KB 4HUUA 3RKDC 5E1AA 3PV6A 4JQIH 4FFWD 5B3JE 2ICCA 4Y5VC 1F11A 1JMXA 4HJ0D 3WUWB 1BF2A 1BZ9B 1BGXL 3MRPB 2VDMH 2QADD 3S35H 3TO2B 5J12B 5EOQL 4W4NA 3UJJL 3QPXL 4MXQD 5BV7H 5F97E 5J9PB 5CILL 5F3HB 4HDIB 4OM1L 1T6WA 5JLZB 5ALCL 4OSUL 3BGFB 1JUFA 2DD8L 1RHHB 4YZFF 3LKOB 1EJOL 3UTTA 3L3DA 3AU1A 3H9YA 4UTBH 2GT9B 2MPAL 1U95B 4X4MA 3MLYL 5MERB 3U9PL 1IQDB 1N4XH 4G9DB 4XCCH 3JSSA 3WXWH 1N6QH 5MEOA 4JE4B 5CJOH 3VXNA 3INUL 1NANH 3L3JB 4IIQC 4LHQB 4XPGL 3C8HA 4NC0B 1KELL 1LO5B 3ZKND 2J2ZA 3KNBA 3N1PC 1LEKA 3T09A 2NX5A 4I5BB 4EIGB 3QUXD 1OP5K 4PJBA 4HXAL 1J8HE 4U1GB 3UTSD 4L3AA 2JIXA 1TZGL 4K23L 4TRPH 3GNML 3BH9B 5CWSB 2GCYA 4MAUH 3EOBA 3ARWA 4DVRL 4LPXA 5C9JB 1KJ2B 2VR5A 4H5SA 5JW5A 1S7WA 3CZFB 4R9HA 5D5ME 2IH3B 4BH8B 1B4JL 5HHVH 1UZ8A 5IQ9A 1UEYA 2EZ0D 5E08L 3NIDE 2F19L 1ZVSB 4E5XA 3GB7A 3KGRA 1ADQL 2AXGB 3MV8A 2PW2A 1A3LL 4TQEH 2RFXA 4KRLB 4ODHL 4G6KH 4LKXB 2VXUH 4CDGC 3R8QA 3IRPX 1H3WM 5ISZE 3C60A 3B2UD 3BIKA 4WW1B 3V6OA 4Z9KB 1U8OA 15C8H 5T1LB 4LCWB 5BW7C 5B38G 2NR6D 1NCDH 5HGBB 3KPSD 4NJ9H 2OI9C 5DD1H 1D5XA 3B9KA 3B5HA 1OTTD 3B9EA 4MZ3A 1CR9H 4LDOB 3NA9H 2FX8L 1YNLL 3O0RH 2AS5M 2GJJA 3P4MA 4P4RB 5T1MB 5L2KB 2VDML 3S35L 5F8RC 1KV3A 3LN4B 1MJ8H 4G6JH 3DV6A 3NCMA 5DJYB 2X1OA 5E8OA 3W9DA 4MJ5A 5KVMC 4HBQA 4N9GB 3BXNA 2G9HA 5HHPA 4UTBL 5JHDD 3VWKD 2XWJB 3PXHA 1N4XL 4XCCL 3WXWL 1CD1B 3QEHA 3EJZD 3S3PA 3KG5A 4RMSA 2OS7A 2PW1B 5CGTA 5EZJB 1MCPH 4CVZB 2ZUQB 4NN7C 1D6VH 4YBHA 5A2LH 3RTQC 5DYOB 2C7UB 2BFVH 4HSQA 1HHKB 4FTVA 1A1NA 1QSZA 4I0PC 3V6FB 5KSBB 1H8NA 3BOVA 2HP4A 3WNMA 3CFEB 4X9FA 2IG2H 4AT6A 3KPTA 4ZMAT 3HNVL 3P9MA 1T1WA 3FB6A 1DQJB 3OZ9H 3MUZ1 3ZE2E 4X7TB 5IT2H 1IC7L 5FCUL 5HHVL 3LH2H 3FTGA 4FZ8H 4WW2A 5ENWB 4X6DA 2V17H 5J3HC 2UYLB 2R2HA 1CICC 4TQEL 5DRXA 1L7IH 3NCEB 4PP2A 5DQDH 4G6KL 5BXFA 2NY3D 4DKFH 1UG9A 3WUWG 2IALA 3JZ7A 4GG8B 3GHBL 3OF6D 4I0KA 3LMJH 5E4EB 2DWDB 4ESKA 1Q9WA 5K59E 3O9WB 4ZUUB 2Q8BH 1N7ML 2Y5TA 3N85L 4NJ9L 3EO1B 3S98A 4PJ8D 3PWLA 1EEUA 5DD1L 3L3HA 1LDSA 1YMMD 5FV1L 1F3JA 3GBLA 4OLVH 1BQSA 4N5UA 4PJGE 2B20A 1CR9L 2VH5L 3NA9L 3DYOA 4BELD 3G5VB 3O0RL 4XHJC 2BXYA 1ERNA 1WGOA 4P2QD 3O3AB 5D2NE 4U1LB 2DYPD 1MJ8L 5EA0H 3QDMD 4G6JL 3MV11 2X4QA 4KV5E 1BREA 5DHVH 4Z7NF 4PYHA 3V0AC 5CCKH 1JF5A 1FV1A 2EKJA 2YA0A 4NC1E 2MWCA 3ZKQD 3H0TA 4ORGB 4ZAKD 4KMLB 1U8QB 1A7NL 3SEPA 2R2EA 2HFGL 3KPNB 1CFSB 3NIGE 4XX1G 1UM5H 4M4RA 3RIAK 5JOPE 4BFIA 4HK0A 1UEMA 1HH9B 3K2UH 4RGOL 2BFVL 2H9GB 2VISA 4NRXB 5JXAH 3JVGC 1QQDB 2XTJE 3ZL4L 2OJEA 3QUZB 2AK4A 3MJ8A 5IMMA 2IG2L 4IRJC 4XWOD 4WI5A 4X99A 3ULUC 5INDB 3VI4F 3THML 4CJ0A 3SQOL 1J0JA 4C57C 2JELH 2BNUB 3MNZA 3GO1H 1YQ2A 3WJLA 2X4RA 5IT2L 3PHQB 4X4XB 3BRDA 3E1F1 3SKOB 1UXWB 3IYLW 1JHTA 1FZJB 2V17L 2UWEE 2PO6A 4MNHA 1A4JA 1EDQA 1DUYB 3OGOE 1Q1JH 3BGMB 3SOBH 2NY4B 4KKBD 5FK9A 4DKFL 4YHOL 3GKWL 3BD5A 2CR3A 3LMJL 4L4VB 2VQ1A 2HYMA 3O6FC 2AV7B 3AS3A 4XC1L 3MACL 3R06A 5JW4Q 4F8TA 4M43H 4M6MH 4JO3L 1NMBH 2GUOB 2X1WL 1SYSB 3VGAC 1HKLH 2UY6A 3VFPB 2WSKA 1EAJA 2APTA 2YHGA 3P77A 1GL4B 5EBMA 3K80A 3F5WA 1P4BH 4PRPA 5FF6B 5EA0L 4JRYA 4QTIL 5HYSB 5J11C 2EYRB 2CXKA 5F88B 4CVUA 4RX4A 5CCKL 1OSZB 3J8F7 1VFAB 3CPLB 1C5BL 4UUJA 5J7CC 3LZFH 4HV8A 3UBXA 4P57A 1AO7B 5C09D 4KJQC 4PG9B 3DARA 5E2UL 4PJEB 4NWUH 4XH2B 5SV3A 1VACA 3FAWA 3STLA 3V4PL 3PABB 1OTSD 5DRWB 5FO7B 5T3ZE 1BQUA 4PGBB 3G08B 3KYAA 2MFNA 5CIPB 3MZGB 5D7IE 2FD6H 1KNOB 1I75A 1MHCA 1MIEH 2ZJSH 2KDGA 3BZ4A 1F58H 4JPIB 5CAYB 1ZE3C 5BRZD 1ZA3A 2CIKA 1RK0B 3NPSB 2VSCA 4HGMA 3NAAL 4LLYA 1RUKH 1NAKH 1CL7I 4L8DB 4U49A 3JBG7 3QO0A 2BP3A 1UACH 2CLRB 1T20A 2FX7H 5D7LA 4EN3C 1OW0C 4U1JA 3MV9B 4LCYA 4PJBF 1CTNA 3V8OA 1U92B 3WNNA 4GRLB 2EDTA 1Q1JL 2DQHH 1GJIA 1KJ2H 4V1DB 4WJ5A 1LK2B 2ADJA 3MJGX 4KHXL 4KKAC 5ID0A 1KULA 2CKBA 2I5YH 1IZKA 1U2HA 2AKRB 3ARFD 5FYLD 2WBJA 3HG1D 4DQOH 4PV8A 1DN0A 1X5XA 4KK8D 5FKPA 3KJ4B 4Y2DA 5I2IA 1HKLL 2B4CC 3MBEB 4G7VH 3IFPB 1JYVA 3I6LE 3MRQB 4LRIC 4GMTL 5CSGA 1FNLA 4YR6B 2YPLD 4K7PX 4GS7B 3VFWB 5F72S 4X5WA 5CJXC 5DLMH 1P4BL 3RI5F 5HVWA 2VLLB 3QEQD 1PKQB 1KTDB 3PWPA 5DJCA 4L8SB 4F57L 5F1IA 3O2DL 4R7DA 4NO2B 5DD3H 3QDJD 1LQSR 4FQHA 1WCBA 5T3XH 3U79A 4B53A 5GGVY 2X4UB 5IESL 43C9B 4H88H 5SWQB 1JI2A 4ZOCA 4TOYH 1MHHB 4K7FA 1IAKB 2OL3A 2H8PA 3VH8B 1LP9A 2Q6WB 1T3FA 4ZUTB 4ZG1A 3QQ4B 1QSEB 3F7PC 2FD6L 4KKLC 1MIEL 1IAMA 2ZKHH 3RVVD 4OUUB 1F58L 2E7HA 5GRUL 4I9WE 5DS8B 1JNHB 5EU7E 1A7OH 1NC4D 1PQZA 4PRIE 4BZ2H 2Q7NA 3FL7A 4YGAB 1RUKL 1NAKL 4R4BA 1G7PB 3MA7B 3O8XB 1INDL 1UACL 5GGTA 3IJHA 3D0LB 4HGKC 4U3XA 1RQ5A 4PJ9A 3DNKA 3HR6A 5F8QC 2DI9A 1VGKA 4R6UA 2G75B 4NDMA 4X9IA 3PV7A 3O6LH 2A74B 2DQHL 2AJ3B 2V2XA 3OSKA 1AQKH 1T21A 5DSCB 5FYKE 1CXFA 5EO1A 3TZVD 3VFOB 5AG9A 1L6ZA 4LLDB 2I5YL 4XCYB 5MEQA 1J11A 4Z7QF 1T5XB 5HYSG 1KIRB 1PSKH 2Z31B 1JYWA 4DQOL 4ENED 2HLFD 4WW2F 4QRPE 1KTLA 4JPVL 5GRVL 4U33A 1P7KA 3TM6A 4G7VL 1WIUA 3FRPG 4FHBD 1MELA 1T04A 2Y25A 3AM8C 5F9OL 2PR4H 4LASH 1BQLH 2L0DA 3H3KA 4MA7H 3V5DB 3H3PH 1UGNA 5C8JB 3CFIC 5JQ6H 5DLML 1X4YA 4RFOL 1TVBB 1JZ5A 3RWCB 5A40E 4R2GB 3I9GL 1FPTL 1I3GH 1X9QA 5GJTL 4QHNA 4JLRB 1SVCP 3A6OA 4WY7L 5C9KA 5DR5L 1W72B 2JLLA 3QO1A 4Z7VF 3ALXA 4N1HB 4H88L 4XNZB 5F6IC 1CS6A 5JIIA 1KGCD 1KYOJ 1I8LA 2Z8WC 1QACA 1GZQA 4RMTA 5I1GL 2AJYH 4D9RE 1BOYA 3HE7B 5F7FA 4P9MH 5IW3A 2DLHA 4HIEB 2HMID 1G7IB 4Z8FH 1CLZH 5BZWA 1PLGH 2ZKHL 3W5MA 4PPTA 1PG7W 2CDFB 3W0WE 3T1WA 3FT4B 4YDVA 3D85B 1CF8L 4FQLL 1KCKA 1JGUH 4WFGE 3GMNA 2P24B 2E9JA 5FYJH 4BZ2L 5BS0A 4MHHG 4LDEB 4HS6B 4M1GH 3ARBB 1OCWH 3JV6A 1X5LA 5C0DA 5IB1A 4ONFL 2BSSB 4PBXA 4D9QD 3CD4A 3O6LL 4HS8L 2Y1VA 4M61B 4U1IB 3ZE0F 5IBUB 1BZQK 2ARJB 1G1YA 3AREA 2HTLD 1UM4L 2BHZA 1U8MB 2YRPA 3MFGB 5KS9A 4G8FB 1QRNA 1WT5A 2WINA 1PSKL 2IAMB 4KFZC 1P4IL 1HN1A 4PTUA 3DRTB 3KR3H 1RIHH 1JRHH 3AMLA 4ZUSA 4FQQA 3ZSSA 5C7XL 2PR4L 4LASL 4P5KB 2P5WA 2E27H 3ULSB 3SE4A 4DTGH 3R8BB 3V0VA 3H3PL 2YUVA 4YLQT 1NBZB 2WIMA 5FUCC 3VH8G 3GMQB 2WUCH 4XVTH 2R29L 3L9RA 1FDLH 1BVKA 3T3PE 2XY2A 1MCWM 3HUJE 4B7IA 4G9FA 1MY7A 1MAJA 3ARXA 5F7LB 5IKCB 2QQKH 1MCIA 3VD4A 3RX7A 1D5BB 1WLHA 1I8KA 3ARTA 4U7MA 4X5XB 3WKML 1MFNA 1J8HD 1KCLA 4DN3H 3H9SB 2AJYL 4Y4HB 1KJ3L 4RIRB 4YDIH 1FVEB 2L7JA 4LEXL 4HKZB 4M6NL 1UWXK 4Z8FL 1CLZL 3VFTA 3KJ6L 2EO9A 1SEQH 3MV7E 1IGTB 4YAQA 1UZ6E 4YFEA 1YYMH 4C4KO 1CGUA 4M1GL 1OCWL 4KVCH 1S9WA 4NQXB 1QHOA 5CIPH 3PP3H 4MNQA 1U6AL 1U2CA 1UYWH 1R6VA 1Q9OB 1CD9B 3FCTA 5FM5O 3RZCA 1B0RB 2ZSWA 4F7CA 4M1DL 1CLOH 3TVMA 3EOTH 3K74B 4M7KH 2YA2A 4EXKA 3ARUA 5HJ3B 4WO4B 1T4KB 1T2XA 3BJ91 4GUPB 5FKAA 3VU2A 4S10A 3DVGA 1E27B 5IF0A 1N0XH 2CD0A 2NY1C 2IEPA 1ZXQA 3NCBB 1IEAA 4JDVA 4XP4H 2FIKB 3BKML 3D39A 4O02H 3QZWA 5D96C 1CXEA 3OR7B 3F7YA 3ULVC 1RIHL 1JRHL 3IDXL 3LRGA 4U7SA 4BFBD 1MLBB 1QG3A 4MJIA 3C09B 3EGSA 4S1SL 1O5DT 4NKDB 2E27L 3GJFA 1O0VA 3MUGA 1DE4A 4P59H 4DTGL 1WF5A 4P2YA 2BSED 4NRYB 4JFOB 3E2HB 4KH2A 4KJYA 4PJ5A 3TCLB 1AXSB 4R4ND 5GGSA 7CGTA 1IMHC 1FDLL 4PY8I 4BQBA 5JPNB 2JCCE 2QQKL 4J6RL 4OJFL 1NGYA 5ABDE 4HUUB 2EEAA 1WCQA 3PV6B 5E1AB 5HPMA 4P3WA 3TO4D 1QUNA 2YD4A 3HE6A 4Q9RL 4X7CC 1F11B 5TDOA 2XQYK 3QUYA 4YDIL 1NGQL 2VDQL 2E7BA 4HKJA 2D7QA 4U0RC 3NOIA 1JUFB 1JPSH 1SEQL 5IBUG 3CH8A 3UTTB 2APXA 3L3DB 3AU1B 4Q7DA 3K0WA 4UI2A 1YYML 4XNQA 5MEOB 3V4VL 3VXNB 1PY4A 3WE6A 1LP9F 4JEGB 4JHAL 3KNBB 5IBTH 1LEKB 5DC9B 1UYWL 4WHDA 2NX5B 4Q6IC 4PJBB 2LAAA 4JN2A 5AAMA 1CLOL 5C0FA 3G9VA 3ZDXF 2IFFL 2JIXB 1DBJL 5E56A 1FYHB 4R8WL 1J87A 1GGYA 2EDRA 3EOBB 3NCYS 5JW5B 2AEIT 4H5SB 4YFLF 1N0XL 4LPWA 1S7WB 2JJWA 1FE8H 2HJFA 4EI6A 3U83A 1UZ8B 5IQ9B 4DKDC 4APQC 4E5XB 2X05A 3GB7B 2AJSL 2LU4A 3IFOA 4AYFA 3MV8B 2PW2B 1S5IL 2RFXB 1U93A 3QXDA 1J7VR 4I0PD 1S7TA 2YN5A 5I1LA 3C60B 4KJPD 3BIKB 1H3UA 5KJRH 3WIIH 1U8OB 5EB9A 1IJ9A 4P5TC 4I77H 4Q58C 3BT2H 2R1XA 1U58A 2ICWA 3QJFA 3UO1L 1D5XB 3B9KB 5FGCB 5JOPD 3FJTA 4YQXH 3ESVF 4U05A 1FC1A 2O93L 2XTJD 2G2RA 4WI4A 3P4MB 3HB3D 5I1JH 3GBML 4FFZL 5EU5A 3DV6B 1W72H 5E8OB 4RA0C 4YEEA 4ZO6A 4WGWB 3W9DB 4MJ5B 3BXNB 4OLYL 1JPSL 2G9HB 5HHPB 5KG9A 5HD8D 4XWGH 4Z77A 3MA9H 4LHUD 4M3JA 3QEHB 1CI5A 5HY9A 5HGDA 4XHJD 4K3EH 2F54E 2A2QT 2V9TA 5ETUA 3RWFA 4FTVB 3RAJL 1A1NB 3ZMRA 4EDXA 5KVDH 2Y4SA 4PJIE 2DQCH 4AT6B 1JNLL 2PYEA 4NN6B 3BGFC 2WLZA 4MQ7A 5E8NA 2K9UA 2WLYA 2YUWA 1CTOA 2FHBA 3P9MB 3JWOH 1T1WB 1XGRA 3ARGD 4JQXC 3FB6B 4QF1A 2WZPD 1GYAA 3FO0L 3FTGB 4WW2B 4N0CC 5FM5M 5C6WH 4MNGE 2KPNA 4F3FA 4X6DB 4DGYH 2AXFA 2R2HB 1UVQA 4G6FB 3KXFA 5DRXB 4PP2B 4U1GC 5BXFB 2DQIH 2IALB 1RY7B 1IILE 3CDGA 1P6FA 5KS9F 1Q9WB 4OLXH 5FAAA 4IRJD 4YFDB 3S35X 5F1KC 4I77L 1U8LA 3ULUD 4JREC 2Y5TB 4GJTB 5JPMA 5DUPH 1A1MA 4LARH 3PWLB 1ZEAH 2KZWA 1TQCB 3L3HB 1F3JB 5T3ZD 5HDBE 4LCUA 2VZUA 2OTUA 5DJZA 1I7TA 1XIWA 2BY2A 1RZJH 4FP8H 4YDLB 4HPOL 5I1JL 3I6KA 2X4QB 3B6SA 2GHWB 4H8WC 1W72L 1QFPA 4HIXH 3I3EA 3O6FD 2HTKC 1FV1B 1HYRC 2VXQH 2PNDA 3H0TB 4PLKD 1MEXL 1X5ZA 4X6CE 3ZKMC 5A43C 2R2EB 2QSCL 2FJFA 2XQBH 4DFIA 5JHLH 4GBXA 2F53A 4BFIB 1UQSA 1IC5H 4HK0B 3VI3E 5EZIH 2FIRT 2VISB 5KVDL 1BFVH 4PRAA 4KZEH 1CDHA 2OJEB 5IMMB 2AK4B 3MJ8B 2DQCL 1FJ1A 1S9KC 3UJTH 3QFJA 4X99B 4LLWA 1UM6L 5MENA 4NHUA 4GRWF 3I6LD 4NNXA 3MNZB 3TYGH 2X4RB 2YD7A 3ILQC 5IFHH 5CZVH 4Z0BH 1JHTB 1Y0LA 3Q6GH 4DGYL 2PO6B 3MRRA 3MGAA 2VDPH 3QIBA 4MNHB 1A4JB 4N8VA 1MRDL 1MCKA 3GHEH 2ITCA 5D6DA 1ZT1A 3MLTA 5FK9B 5TQ2L 2X41A 5GSVA 3DYMA 3OPZL 2VQ1B 3PG2A 4Y4FA 1AGDA 2DTSA 3R06B 5DRZA 2E6JA 2PN5A 1OF2A 5DUPL 1J0YA 3VFMA 4M7JH 1BVLA 5EUOA 2QSTA 4PTTA 4PGCA 3BDYL 4KK5C 3I2CH 2E9IA 2X40A 1RZJL 1VEMA 3P77B 4L4TD 4FP8L 3OKOA 5T3XE 3EYUH 5EBMB 2VWEE 3T04D 3F5WB 1RZGA 4YHYC 4PRPB 1NDGA 4JRYB 3IXTA 4I9WD 4DKAA 4OGYL 5L2KE 2WP3O 4PRID 4HIXL 4KKAD 1PEWA 1KUMA 3N9GL 3U7WH 3AUVA 2VXQL 5DC4B 2Y5EA 4UUJB 4HV8B 3ARDA 3UBXB 4P57B 4Y4KD 5D72H 4Y16A 1JBJA 1P9MC 4OB5H 1VACB 2D31A 1NJ9A 3STLB 5JHLL 4LFHG 4NYLA 3T4AA 1IC5L 4X7SH 3P40A 5EZIL 5FYKD 5CGYC 3WBDA 1N8ZA 1BFVL 1NCTA 4HT1H 4LVOC 4F7EA 4KZEL 3TGXA 4D94A 3KPRE 1MHCB 2YKLH 3BZ4B 5KSBE 1RZFL 4Y19A 4JJ5A 4QRPD 5FUZH 1ZA3B 1Q9LA 2CIKB 5L7XH 2ZNWA 3L1OH 4LLYB 1W8OA 1K3IA 3TYGL 4QYOA 1Z5LA 3QO0B 2RHEA 3FO2A 1T20B 5D7LB 5DD5H 4Z0BL 4U1JB 3Q6GL 4WUUE 2HLAA 1JTTA 4LCYB 4BQ8A 3W82A 4IMKC 3SGDH 3WLWC 4WJ5B 4KKLD 3QUZC 2VDOL 2ADJB 4K9EH 5ID0B 2CKBB 1XCTA 4GLRH 4EI5A 2ZUYA 1PBYA 5F96H 1JNJA 2WBJB 1LHZA 4OCYL 1DN0B 4PV8B 4GXVH 5GJSL 5TFSL 3T4YA 2B1HH 5FKPB 1XGUA 4QGYA 4Y2DB 5I2IB 4PD4K 2H2PD 1CDCA 2EIZA 3DUUA 5HHXH 3V79C 4NRZA 1DQML 4CDHA 3PWJA 4X5WB 3EYUL 5GIRA 5LVEA 3MRGA 3W0WD 2Z92A 3PWPB 1U91A 5DJCB 4YX2L 3LRHA 5F1IB 5I1AA 4PBWD 4R7DB 4FQHB 3K8LA 1WCBB 3BW9A 4XNYH 2BVPA 5ELIA 3P4LA 4FQXC 4BZ1L 5D72L 3IFNL 2W65A 3QNYA 5D4QA 2NYYC 4YHZL 4K7FB 4GRMA 4OB5L 2OL3B 3T0DA 1XGYL 4J3SA 1RU9H 2H8PB 2XXCB 1LP9B 5EC1A 1T3FB 3LKSA 4FZEH 2GJZA 1LMKA 3ZLQC 1FCCA 5FYJE 3SGEI 6CGTA 4NQVA 5JXEA 5D1XA 3WO4B 1EUUA 2IJ0C 1NUNB 2YKLL 3Q1SH 1FSKC 2AV1A 1PQZB 4G8IA 3GK8L 4WWKA 1T1ZA 5L7XL 2W38A 3L1OL 2WWKT 1WWCA 4ZS6D 4R4BB 3AY4C 4X9HA 3IJHB 4LMQI 4GLRI 4PJ9B 4WUKH 2AK1L 2DQUH 5C3LD 3LKQA 1T2QL 1Y6KR 4HG4J 1VGKB 1MFEL 4NDMB 3BKJH 1FQ9C 3BVNA 2V2XB 1NC2A 3PL6A 1DZBA 1T21B 2C4XA 3DYPA 1C5CH 4RFEA 3DGCR 4K9EL 4DGVL 1P5VA 3IF1A 5EO1B 1KB9K 5AZ2L 5HHME 4Y0GA 5MEQB 4AY0A 5E00A 1AI1L 4L4VE 4M8QA 1AGFA 1BD2E 3WFEH 1G0XA 4DAGH 4GXVL 2VOTA 5DFVD 1KTLB 1P7KB 4MQTB 4PJFA 1H3TA 2O61A 4N68A 1T04B 3UEZA 5HHXL 1S7UA 4OFYD 4DFHA 4U0QB 5I1CH 2L7UA 3IKCA 3MV7D 3H7BA 2XZQL 4PJXF 5IVOA 5E99H 4QHNB 5DDHA 1RSFA 5I74B 3UYPA 3QI9A 4P3CH 4D9LL 4KJWC 1JCKA 3QO1B 2EXWC 1HHJA 1LE9A 1KACB 3LAFA 5IMOA 4HC1A 1MJJA 1TPXC 3KJ4C 4P23A 3UC0L 1GZQB 1RU9L 1CDBA 4PJEE 1ZGLM 2X70A 5IV2A 5IEKA 1HI6A 1NAMA 2NY6B 1MUJA 1J9CT 1RVFH 4JGJA 4L8SC 1S7XA 4WVRA 5BZWB 4ZNEA 2XPGA 3Q1SL 4LSPL 1ZLUH 1A21A 4EJ1C 1DUZA 4YDVB 3D87B 4NT6A 1UJ3A 3GMNB 2O5YL 5BS0B 2GW5A 3NMEA 3V7MA 3UAJC 1IBGH 3JV6B 4J3XA 3ZE1F 1MAMH 5C0DB 3PHSA 2FYYA 5IB1B 3OKNA 2ZZUT 5ALBH 3WFCH 3MV9E 3MREA 2Y9RT 4Y8DC 3AREB 3B9DA 1ZLVK 3O3UN 1KEMH 5BMFH 1WAAA 4XCNA 5KS9B 1QRNB 2WINB 1Q0XH 1NFDA 4H25A 3LKRA 1MCEA 4DAGL 4PTUB 5I8EA 1E4XH 5ECJE 4ZUSB 4FQQB 4ZS7H 2BVEA 2W9EL 1GPOL 2BY1A 5I8KL 1A6WL 2R8SH 2P5WB 3V0VB 2Y06H 2Z91A 1EO8H 4LVNB 1MFCH 4Y5YA 3OKMA 4OLEA 1V7NH 3L9RB 2PXYD 4B50A 1BVKB 4V2CB 4G9FB 5E99L 1INEH 3RY6C 3IS1X 2MOVA 1HOCA 4LCCA 3L5XH 4Z7UA 5DMIH 1CDIA 4XVJL 1BJMA 3CSBA 4TVPH 4QHMA 1I8KB 4ALAH 4L9DA 2M2DA 1SJVA 4FABL 5GQBA 2YWZA 1GGCH 3G6JF 5IROA 3EBAA 5A3ID 3OQ3B 3RP1A 1OGAE 3OG4B 4UBDD 1J0HA 4QWWD 3VFTB 3BQUC 1QSEE 1OAKL 1ZAGA 3P73A 3J7HA 1INQA 4M6AA 5DK0A 4YAQB 4J3WA 2IBGA 3NCYP 4GRWB 1QR4A 3PDOA 1N6VA 1S9WB 1FN4A 1MAML 4U6YA 4AQOA 4MNQB 5ALBL 3FCTB 3RZCB 2ZSWB 4F7CB 1HK6A 5I18H 3TVMB 4IRZH 3JUYA 3T0WA 2LABA 3WD5L 2JF1A 5FKAB 1OAZH 5JW4M 1KEML 3DVGB 1A1OA 2WWMD 4KUCD 5BMFL 2B1AH 3S6CA 5IF0B 4LNRA 1CBVH 4QHUA 2OK0L 4JDVB 1IEAB 3PHOA 3D39B 3QZWB 4AIOA 1E4XL 2Y07L 3F7YB 4YE4H 4ZS7L 4MJIB 4J1UA 3EGSB 3HNTL 3LOWA 3GJFB 4XVSH 3MUGB 1DE4B 2Y06L 2CKBH 1EO8L 2B0SH 4PUBH 4M93B 1QZ1A 4KJYB 4PJ5B 3SDYL 1MRFH 1QFWH 1V7NL 5GGSB 1TMCB 4OCSH 3MUY1 3P4OA 3L5XL 2IAMC 1NGYB 4MYWB 4TVPL 1KIQA 3UBXI 5HPMB 5LWYH 5IW1A 2DLEA 3HE6B 4KHTH 4ZD3H 2ZUSA 5TDOB 3NA4A 5DO2C 3T0EA 4KU1A 1OTUD 3QUYB 5CS7A 2VC2H 5D1ZD 2G5BA 4HKJB 2ICWJ 4UQ2A 4P5TD 1H8OA 3V52H 4F37F 3WDIA 2OL3H 3U48A 5IHBA 3TA3A 4XNQB 4OZFA 1IGYA 3IU3A 4LSRL 4L29A 5F6HJ 3WE6B 2IFGA 2CRYA 5C08E 3BMWA 1CG9A 5K9OA 5CD3A 3CVHL 4QRSA 1YEKL 2MKWA 1PVHA 3K7UA 5F7MC 1LNUA 2HA1A 4JN2B 5C0FB 5I18L 3B8YA 2HJKA 3CFJA 4NP4L 1A9EA 2C9AA 4NQUA 1EEZA 3TJHC 3O6ML 3UZVB 4C54A 4QEGA 5GGTH 3WS3A 4G6AD 4PJHE 3O6KH 2HJFB 2BDNH 4EI6B 4ZSOE 1QFWI 4KRPD 5BW7A 1BAFL 4PG2C 3CXHK 3O2VH 3IFOB 2M26A 1U93B 3QXDB 2D7NA 1OM3H 1S7TB 5I1LB 2W9LA 4YNYA 3DGGA 1J1XH 4JKLA 2R1XB 1U58B 2ICWB 5EZOH 1Z6JT 4D0BA 3QJFB 5T33L 4Z7NE 1WVZA 2ZG1A 3WXVH 4PJFF 4MD0A 3V4UH 1QR1A 1A6VL 1Q0YL 3C09C 4KHTL 2G2RB 4H0HB 3VFSA 3G5XA 2JJSA 3MPCA 4RQQA 5EU5B 3K4ZA 4YHMH 4O9HL 2EDNA 3H9SE 2VC2L 3E2HC 3D1MC 5JIKA 3RTQA 3CFKA 3VXUE 3MLSH 3K8MA 3V52L 1Q94A 5F3BA 5KG9B 5B4MC 3MZTA 4YHKL 5GS1A 3SE8H 1EHNA 3LS4H 1DFBL 4Z77B 1GGUA 4JDZA 4RAVA 5TH2A 4JN1L 5F7KC 5HY9B 5HGDB 3QZWG 1ZTXH 5ETUB 2GK0A 3RWFB 4EDXB 5C2UB 1CICA 3EJJX 4JM2A 3QHTC 3H2WA 3ARZA 1JHKH 2PYEB 5T1LD 4LCWD 1TQBB 4MQ7B 1A7PH 5E8NB 2IQ9L 5GGTL 4I8DA 1XGRB 4L3EA 4QF1B 2BDNL 3ZKMD 3P0GB 3MCKA 5T3XD 4F3FB 4OLWH 2AXFB 1DN2A 1UVQB 3IGAA 3O2VL 3KXFB 1D9KC 5L2KD 4NN5B 5AEAA 4GG6A 4HWBL 5INCA 1J1XL 3EOAA 3CDGB 4JFHE 3GSXA 4JO4L 5LXGH 3BRGC 5KAQF 2R0ZL 4ZUWA 1U8LB 1RZ7H 2HRPH 1NFDF 1JFQH 4BSWA 5JPMB 4G6ML 1A1MB 1OPGH 5DGQA 2VDRL 1T5WA 3I6GA 3WXVL 1X5GA 2R0WH 4JAMA 4LCUB 2OTUB 3C9NA 1GHFH 5DJZB 1F02I 1I7TB 1XIWB 3TBVA 4QNPF 4PLJC 5BVPH 1AHWC 1HSBA 2A1WL 2YRLA 3WKNA 3I6KB 1FL3A 5IVZA 3RVTC 1A2YA 1I1RA 3SJVA 4YHML 3B6SB 3FQXA 2MQ3A 3LY6A 3RZWA 1OSPH 4PJDF 3JVGA 3ZKSD 3HMXL 4Z7UF 5IB4A 2A38A 1M4KA 2FEEI 1MOEA 5L0QB 3GMLA 5ILTL 4JFXA 4KI5C 3UTTE 2FJFB 4X4ME 1Z3GH 1YYLL 4GBXB 1C1EL 2F53B 4WFEE 1UQSB 2ZNXA 2ZWLT 1YPZA 4IJ3B 4GSDH 2DB8A 2OJZH 2LFGA 4PRAB 2NX5E 3NVQA 3SDDA 4PJBE 2X1XR 4GRWH 1FJ1B 1JHKL 3O9WD 1TZHA 3O2WH 3QFJB 2YD3A 2H26A 1ND0A 4LLWB 5MENB 4NHUB 3JWDL 3W11C 3CFDA 4UDUA 4NNXB 3MCLH 3T3MF 4CAGA 4TTDC 1WISA 2BOBA 2ORBH 1Y0LB 4PLOB 4HAGA 3N1QC 3MRRB 1FZOA 3QIBB 5H8DA 5C07A 4OFIA 4N8VB 1H3VA 2ITCB 1JWMA 5B22A 5CGYD 1ZT1B 3MLTB 1GOGA 3NH7L 3C5JA 5GSVB 1NBVH 3K1DA 4NN6C 3KPLA 4Y4FB 1AGDB 4XPTH 2F9BT 4XXCC 5DRZB 4XBGA 3V6OE 1OF2B 3VFMB 1WBYA 3CLFH 2ZOKA 1BVLB 4PTTB 3MLUL 4CMMA 1GHFL 2R0KH 2FDBP 4PGCB 5GRVK 5BVPL 2EIBA 3GM8A 5GZNC 5FYJD 5I71B 1IGCL 5CINH 3OKOB 1RZGB 4POUB 5CLWA 1NDGB 2ZUXA 4NZUH 1K8IA 3LKPA 2CKNA 3D2UA 3IXTB 3QUZD 3QIWC 2I9TA 4PFEA 2PKDA 4NOFA 4LEOA 3QQNA 4LRNH 3P4NA 2VLJA 3ARDB 4MCYA 5I1IH 3QXUA 4XVUD 4Y16B 2J88H 4HAFA 2EKSA 1R5WA 4GAJH 2D31B 1Z3GL 1NJ9B 4ZFOA 4NYLB 5JR1H 3T4AB 4YDLC 4PJAA 1NL0L 1U0QA 1CGYA 2IBZX 4LGSB 3TCXA 4EN3A 1OW0A 2NY4D 1N8ZB 2OJZL 4F7EB 5JUEL 2E6QA 1AP2A 1CFBA 2Q76A 4L4VD 3DUHA 4LSSH 4XPFH 1CZ8H 1JN6A 4Y19B 1VFMA 1OARH 3EDJA 4MA8H 4JJ5B 5E5UB 1Q9LB 2FHCA 2GKIA 3QA3A 2VXSL 3I3DA 4QYOB 2NTFA 4KTYA 1Z5LB 3QG7H 3GZKA 3ZYZA 2NYYD 4JFPA 3FB5A 3FO2B 4M9OA 2BSTA 1AR1D 2ORBL 1UKTA 1MIMH 1YEGL 2HLAB 4J2XA 2BERA 1WK0A 3QCUH 4JRWA 1LO2H 4X6DE 5C0BA 4BM7A 4WENB 1IT9H 4LRIA 3MOAL 5B3NA 1H15A 5KN5A 12E8L 1A6UH 3BZFA 2MNUA 1XCTB 4EI5B 2DF3A 3IDIA 5E8DH 4O2CA 3VG0H 1AO7D 2J8UA 3SHSA 1KLGA 2LVEA 3N1FC 3T4YB 5KANI 1XGUB 2XWTA 4NNYA 1A5FH 5AYQA 2R0KL 5JW3H 3MRCA 2EIZB 2PO6C 4NM8H 3DUUB 4NRZB 1GC1L 1C7TA 5HYQA 2WMPA 3RVUC 5HI5C 3PWJB 1OQOA 5GIRB 5E0QA 3MRGB 4NZUL 1UB6A 5DVLA 2Z92B 4U4BA 1U91B 1IKFH 1R3KA 3ARPA 5IMKA 5I1AB 3E6HA 3EYSH 3GI9H 3BW9B 4K8RL 2BVPB 3FN0H 2BMKA 1Z9MA 2K3TA 4U2ZA 1BOGA 2W65B 3QNYB 5I1IL 2J88L 2VAAA 4LDLB 4GRMB 5F93C 3MV9D 1I9EA 5EC1B 5JR1L 1RI8A 4XPAH 2P43B 3LKSB 2O5ZL 4JGMA 2GJZB 3TH3T 1KB5A 2EEDA 2AJXH 4GRLD 2GTZA 4V1DD 4OCWH 3UTZA 4OD3H 4N8VG 4N9OB 2AABL 4NQVB 1KCVH 5D1XB 1A6PA 1FG2A 4LSSL 2H2SC 1CZ8L 1T89A 1V7MH 2AV1B 4G8IB 4AMKH 3EJYD 2AK4E 3LD8C 5DJ0A 2YS4A 1T1ZB 4WWKB 1B6UA 2EXWD 4DWHA 1ORSA 3P9LA 2GYSA 3QG7L 3MBED 4GKOA 3MBXL 4ODSH 4HQQL 5LAXA 3LKQB 4NGHH 3FQTA 1J1PH 3VRJA 4KK6C 1FLRL 4PB0L 1AC6A 1GAFH 3AM8A 5HGGS 3BVNB 4FQCH 1NC2B 3PL6B 4JM2F 2NXYC 3GGWA 4XNUH 4RFEB 3CH1A 2NY0B 3IF1B 1UA6L 4YBLC 5E00B 1NUFA 4M8QB 1AGFB 1TJIH 5EOTA 3TJEH 4C4KT 3TWCH 4O58L 3UAJD 3SPVA 4PJFB 2AEPH 2O61B 5MP6L 2VUYA 5F7EL 4NM8L 5ESVA 2B2XH 1S7UB 2A9NH 5AD0A 2NW2A 1AKJA 4XI5D 1QSED 5AYUH 3IKCB 1X5FA 5IWLA 4GMSH 4TVPE 3H7BB 4N1CA 1MQ8A 1DVFC 1ZOXA 4PRPE 3EYSL 5DDHB 4JRYE 3GI9L 3TIEA 3QI9B 4YXLH 5IK3A 1R3JA 5I73B 2VXVL 1HHJB 1LE9B 5IMOB 3BPLB 2DDQH 1MJJB 3O8XD 2V5SA 4P23B 2B5IC 1P1ZA 5EG6C 2UUDK 4I2XA 3WN5C 2F58H 2X70B 5IV2B 5DJXA 5IEKB 4JFDA 1KENL 1HI6B 1NAMB 2AJXL 5IFJA 4OF6A 4KKCC 1MUJB 3IU4H 1KCVL 1S7XB 3S97C 3BPNB 2XPGB 5HHOE 1RZKL 2BNQA 1DUZB 2W91A 1PX3A 5I19H 2Y36H 4NT6B 1UJ3B 3WSQH 2Z31D 1A0QH 4OT1L 4UOJA 3ZKXC 1N64L 2LVCA 4ZTPH 3TT3L 5L9DH 2FYYB 3OKNB 3PP3K 4AIXA 4NGHL 2XN9E 1YPZF 2YC1A 2F5BH 2R0LL 3DX8A 3FONA 4HEPG 3HLAA 2DL9A 3RVXD 3G6DH 3MREB 4J4PD 4R2GD 2B39A 5GRJH 3WO4C 2CO6B 2LU3A 5D2LE 1YN6A 4UV4H 4XCNB 4JPWH 3MLZH 2FNBA 1HNFA 2AAVA 3DJ9A 1NFDB 3ILPA 4H25B 5TF1H 1TJIL 3LKRB 1G6VK 1YY8A 5I8EB 3TWCL 1R3LA 2HT3D 2DAVA 5E6IA 2YPVH 2B2XL 2VDKL 3MJ6A 3G04A 3HE7D 2A9NL 4FN0A 5HYJA 2Z91B 5IVXA 3NCFB 4Y5YB 3OKMB 5AYUL 3UROR 2QV2A 3FZUC 4C56A 4BUGA 1X44A 4XXDA 1ROWA 2NNAA 3D85D 4XAWL 3RKPA 3PWPE 1HOCB 4LCCB 4PRDA 4TULL 4Z7UB 3ARQA 3ARBD 4QHMB 5GPRA 4UNTA 1BHGA 2ZG2A 4OZ4A 4JGUA 1KXQE 1U8PA 2IPTL 1T2JA 1Y6NR 2WBWB 3VXPA 2ZPKH 3L3GA 5SWZA 1QBLH 3CFCH 3DX6A 1IEBA 4Q0XH 3F6IA 1VKXA 4AH2A 4P9HH 5SWSA 2LQRA 2CJUL 1NFIA 3HNSL 5TE7H 2IH1A 3P73B 5I74C 2Y36L 1V3KA 5TE6L 4YC2B 1INQB 3FO1A 3WSQL 2JK5A 5DK0B 2IAMD 4ODVH 1CDJA 2YK1H 3PDOB 5FOBA 2AW2A 1YEFL 4LAQH 2R9HD 2FH6A 1FN4B 4IOFD 1I8LC 4ZTPL 3UZQA 4U6YB 2FBOJ 4OGXL 5L9DL 2FX9L 4DN4L 4DZ8A 4PJAF 3DETC 2O5XH 1T03H 2NY6C 2NZ9C 3QDHA 1DL7L 1FVCA 3BJLA 4CJ1A 3BWUC 1OAXH 5GRJL 2DLTA 3MXWL 4TSAH 1YEJL 2HH0H 1A1OB 4UV4L 3ME0A 3UTPE 3MLZL 3DHMA 4LNRB 4QHUB 3CU1A 1MFAH 1G0DA 3PHOB 4S1QL 1T7WA 4EDWL 1DEEA 3JWDC 3S36H 1HINH 1NCNA 4W68A 1FGVL 4J1UB 4YXKL 1FAIH 3H9SD 1SEBA 4Y4HD 1QBMH 3BE1L 4NC2B 3P2TA 4PY7A 4YWGH 1OP3H 2ZUWA 1DQLH 4X8XA 5E2TL 4NKQB 2J8UF 3P4OB 3O11A 3ZHLA 4JFEA 3EHBC 4CNIA 1KIQB 2C3WA 2R2CA 5IW1B 1H5BC 2CK0L 4QOKA 3T0EB 3JTSA 2ZPKL 5F9WC 1QBLL 2VIRA 5DWUL 4Q0XL 1FFQA 2EYTA 5JZ7D 2G5BB 2H45A 1G9NH 4Q6IA 4WO4D 5F44A 5TE7L 4UQ2B 1F42A 4KK9C 3EFDH 1A4KA 5F9JA 4AQ1B 2E7CA 5J1SC 1SM3H 3TA3B 4O51A 4OZFB 1IGYB 2W0KA 2YK1L 3IU3B 4HUKB 4L29B 5KAQG 4LAQL 3TT1H 4KTDH 1CG9B 5K9OB 5CD3B 2DMBA 2R69H 4QRSB 3RFZC 5A2FA 4APQA 1LNUB 4U31A 3FFCA 3BO8A 1RIUL 1T03L 3A6BH 1P84K 2HJKB 3NCJH 3RX5A 3W39A 3CFJB 1A9EB 1EEZB 2ICES 3STBA 4MZ2A 1CQYA 4QXTA 1UH3A 5FOJA 3RPIA 5ACMA 2X9YA 4JO2H 3WS3B 2ADIA 1DBMH 1FLTX 2A77H 2EE2A 3NZ8A 5KS9E 5EU6E 4E41A 1QRNE 3S36L 2OI9B 1HINL 3JTTA 4ELMA 5LBSL 4Z18A 1VCAA 1JK8A 1E6JL 3EFFA 4M62L 4YNYB 3DGGB 2V5YA 1QFUH 1KT2A 2MTPA 1A47A 4GXUN 3UTTD 4D0BB 1U3HC 3MRKA 3PIQA 4G9FE 4ZFGH 1CGWA 2XACC 4WFED 4MD0B 1QR1B 5K33A 4NQDA 3QPQC 3GMRA 3EDDA 3UZEA 2NY5L 2PF6A 3O2DA 2NX5D 3VFSB 3DMMA 2F74A 3G5XB 2UZYB 3HI6L 4RQQB 2Y7QA 3Q5OA 4M93C 3DXAE 1GC1C 2JIXD 1VERA 5E2WH 3RTQB 2W59A 3CFKB 4HC1H 1ZSDA 3UTOA 1Q94B 5F3BB 5I9QC 1SM3L 2IADA 4MXWH 5D8JL 2DI7A 4X9BA 5GS1B 3C5ZC 3WJJC 4JDZB 4K8RC 4RAVB 1H3XA 4JQXA 2E7MA 5TH2B 4KTDL 3HE6C 3CMOH 3VDCA 2R69L 3MV8D 4UT6H 5DJ8A 4NNPH 2GK0B 3WO3B 4X7FC 3M45A 2R1WA 4KRNA 1AC0A 1CICB 3C60D 3NCJL 5KVGH 4JM2B 4HFUL 2WP3T 1QPXA 3P11H 1ZANH 5EPMA 1U3YA 4L3EB 1SHMA 5AUMA 3B9KD 3QUML 1DBML 5CZXC 3BP7A 3RDTC 1D6EA 3MCKB 2VXTH 3BIBX 3T0XA 4EBQL 2ILLA 4NO0A 3EO0A 3D39E 3IGAB 2C1OA 4HUNB 4MJIE 4OTXL 4GG6B 5I17A 5C0CA 2I60H 5KW9H 5INCB 3X13A 3EOAB 2D4DA 3GSXB 1G7QA 2OSLA 4ZUWB 1XF5A 5C0AA 4BSWB 5JMOC 4IEFB 1T5WB 3I6GB 4JAMB 5IGXH 4GKZA 4TTDD 3C9NB 3TBVB 5D1QC 1HSBB 4XAKE 4OZFG 4X9GA 2YBRA 4H1LG 3WCYA 3F7QA 1EFQA 5HYIA 5IVXF 5LGHL 3IB4A 2IPKA 1I3VA 5HVHB 1ZWIA 1CFVL 1BQHA 4FTVD 4PD4J 1FL3B 5IVZB 4G7YL 1A2YB 3SJVB 1I1AC 3FQXB 1X4XA 4JO1L 3I50H 3O41A 1MREH 5EIIA 4HC1L 1KTKE 1AR2A 5IB4B 4JR9H 4LFHD 1UKQA 4MXWL 3GMLB 4JFXB 4M6OH 1LEGA 1OAUL 5FUOH 1NAML 3VE0A 3TC9A 3CMOL 1RZIA 4G6FD 4XPHH 3I85A 1YPZB 3G9AB 3T8XA 4MVBD 5FA4A 2ADFH 4HLZH 4QT5A 4KROB 3FHAA 5CEYA 3SDDB 4WTZG 5KVGL 1TZHB 3IAGC 1ZANL 5D7JC 2H26B 1ND0B 3CFDB 4UDUB 5GS3A 2KQMA 1RZKC 2VXTL 2BOBB 3QT2A 4X8JA 3ULVF 1T0MA 4RMUA 1FZOB 1KN4H 5C07B 4X6BA 1ACYL 1JWMB 1P7QA 3UYOD 5IHLB 5CSBA 4R4FL 3C5JB 3TBTA 5KW9L 4LSUH 4AEIH 2JJVA 3DVFA 3KPLB 2PYFA 1ZHKA 2EDLA 4L8CA 1T7VA 4XBGB 1TTGA 5J11B 4F8QA 1G7JA 1WBYB 3D48R 5TPWL 2QHLA 3OHXA 3X3GH 2ZOKB 4L8BA 1E0OB 1KB9J 1K9TA 4CMMB 3IDMA 1TJGH 2RQ8A 3EYQC 3RI5K 1P9MA 3RX8A 3PWUA 4ETQA 3SGJC 1K8IB 3LKPB 3AFLA 3ZSTA 3D2UB 1QOKA 3VMOA 2GEEA 2AK4D 2I9LA 1L6XA 3AB0C 5FGSA 2I9TB 2W1NA 3I50L 4LEOB 1VFBA 1MREL 5EH1A 3P4NB 3V9FA 1MFDL 1MCFA 5B21A 2VLJB 2MQCA 4S11A 5TE4H 1EUTA 4MCYB 4LP5A 5HI4D 1GGIL 1ZHLA 1F6LL 2EKSB 4K7PH 1R5WB 1XIWC 5FUOL 3IDYC 1QBBA 4ZFOB 1S78C 2PO6D 4KXZH 2V9QA 1YJDL 4XPHL 4PJAB 5JOFA 4EN3B 3VXRA 2Q3AA 2ADFL 3BUYA 1AP2B 2Q76B 5CEXA 3OKDA 4IMKA 1XGTA 3LEYL 1HSAA 2DM7A 3CX5K 1JN6B 3MCG1 1SBBA 3KAAA 3QA3B 2PYEE 4ODXA 2NTFB 1GGTA 4JFPB 3FB5B 2YUXA 2BSTB 2YD8A 1AFVH 5D93C 2HT2C 4TVPD 1JGDA 2XZCL 4IJ3C 5C0BB 4PRPD 5JHDE 3QQ9D 4JRYD 1H15B 3KXFE 1PG7L 1RPQA 4TUKL 5KN5B 2XKUA 3P0VH 4KUZH 3BZFB 4LSUL 1NPUA 4DKEL 1NCCL 4RX4D 3IDIB 4O2CB 5HI3D 2J8UB 1KLGB 1BFOA 2PCPA 2VB5A 3EOYG 2DS4A 2X4SA 2XWTB 2VDNL 4FQXA 4NNYB 4WRLA 3ZDYF 1EV2E 3MRCB 3QIBC 5HYQB 4IOIA 1VENA 2D0FA 1HWHB 4KK6D 2CLVA 1D5ZA 1BJ8A 2P47B 3WFBH 1A3QA 3N0PB 5D7SH 1UB6B 4QXWA 4KAQH 2VITA 5DVKA 1R3KB 5IMKB 4KXZI 3E6HB 3QDAA 2BMKB 4RFNB 2V2WA 5TE4L 4M1CC 1BOGB 3BI9X 1KG0A 4F80A 5C2BH 2AEWA 2VAAB 4ERSH 3AROA 2YD5A 5D7LD 4XB8A 5LGJA 3RUGA 3VFUA 5CBAA 3BKCH 5JA9A 2HRLA 3AY4A 1NCAH 4YHNA 1U42A 2XTLA 1KB5B 2GTZB 1JJUA 5ISZA 2F53E 5H94A 1GXEA 1AGCA 5LKNA 3UTZB 3OAUL 3SY0A 1QKZH 2IGFH 4CN1A 1FG2B 2J1KA 1GIGH 4ZFZA 1WUNT 1ZLUK 4P2QE 5DJ0B 2NY7L 2WBJD 4WI2A 1I8MA 5GZOD 1ORSB 1XH3A 3P9LB 2UVFA 4Y2DD 5MENE 1EMTH 1AFVL 3O3BA 5LAXB 3KLHC 3FQTB 5I1EL 3VRJB 3LHPH 1NDMA 3HS0A 5E2VH 4KKCD 3GGWB 4NQTA 3PWPD 4KUZL 1Z9OA 3WHE0 3CH1B 3WNKA 3TIDA 2EXYC 3WMSA 5EOTB 1OLZA 3SPVB 2OM5A 4OF7A 5ESVB 1MFBH 4MAYC 5F6IB 5EUOE 4ISVA 5AD0B