2ICWJ

Crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
b'EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVLSSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal structure of a complete ternary complex of TCR, superantigen and peptide-MHC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 28
structure length 113
sequence length 113
chains with identical sequence L
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2icwJ00
2R15A 3DVGB 5E99H 4PRID 3QUZA 5I0DA 1E28B 2FR4B 3TNMB 4P2RB 4QT5B 1JWMA 4PJGB 5EU6D 4Z0XA 5DJZA 1NLBL 2VLME 4R7NB 2QLVB 3MRIB 5DRWB 1OAKH 1SYVB 1PJ9A 1K9TA 4TNVF 4DTGL 2NTFA 5KANI 4X99B 1MWAH 3CFEA 2VABB 5HDOA 4HLJA 3RWFB 4RBPH 3V4VH 4RX4D 2QADB 4H1LA 2XZQH 1JGUH 4TQEH 3D3VE 3W9DB 4E41D 1YC8A 4JZJB 4PYGA 4NC2B 1KTDA 3I75A 1O5DT 5EZIH 2B1HL 5CILH 4GS7C 2Z9TA 3GK8H 2AXHA 2R1XB 4U1KB 2LVCA 3SJVD 1JWUA 3P30H 3TA3A 2HKHL 2WQRA 1X4ZA 4ZFGH 4I0PC 1IKFH 3PABB 5FKAB 1LO3H 4NNPH 4XMLL 1TQCC 1D5ZB 1OP3K 2CRIA 3CPLA 4Y16A 4TOYL 5JZ7D 3K2UL 4KTDH 3WS6A 2X1PA 3HMXL 1WGOA 3D39E 5BS0B 4NRYA 2WNGA 1FNFA 1NGWA 2NY6D 2APVA 1WBXA 4PJ8D 3S37L 4XPGL 5HYQA 5E6ZA 3Q1SH 2FX7L 3WNKA 2W9EL 3QQ3B 4NO3A 4QHMB 2EKJA 5JIPA 1SBSH 1JGVL 2UWEB 1DN0B 1DN2A 5CP7A 5FYJE 5SWZA 1KPVB 2F8VA 4IEFB 4P5MA 2H1PH 1A7PH 1TCMA 2BRQA 1DEDA 2NX5A 3RWDB 3MLWH 1K6QH 4ESKA 2V5MA 4FQPA 3PP3K 3PGCB 3VH8A 3FB6B 5JA9A 5JPNB 1UKQA 1LO0L 3O6MH 3ARGD 4RGMC 2FNBA 5C2UB 4S10A 2QL1A 3CH1A 1RURL 2VDKH 1F6AA 4I3SL 3RVXC 5EORL 3SKOB 2ICCA 3C9NB 3VXOB 3QUYD 2CUHA 5DTFB 1KEML 1NLBH 4V2CB 3CUPB 3ET9F 4HPOH 3VRJB 4KRLB 5TGBA 4PRAB 1RK0B 1G7IA 1F4XH 1M7IA 4LIQL 4FQHB 5E4IA 3VXNB 4RFOH 5J1AA 4NQUA 1H3UA 3IDNB 1LGVA 1BVZA 5HBBA 2VTFA 5L2KA 1DQTA 3DSNA 4H0HB 3C6LB 4ZXBA 1FGNL 3GFUA 3A0OA 4Z7VA 3PP4H 2MFNA 4YZFE 1YDPA 5BRZA 3G6AA 4Z9KB 3BQUB 5GGQL 5DVLA 1NGZA 1FHGA 3JWDL 2EYTB 1W72H 1S7WB 3RIFK 1QA9B 4JPKL 2X4OB 3DO3A 2LQRA 4OKVA 4S1QH 4ONHB 4FFVD 3RA7H 5GRJH 4YJZL 5ADOL 1TTFA 4NNXB 4R96B 4UDUB 1I9RL 1A3LH 3EYFB 2XTLA 3KS0J 2GJ6E 2LU3A 1QD0A 2C7UA 5F7FA 5IOPA 3VXSD 2EE9A 4LSSH 3EDEA 2YKLL 4Y2DA 3RUGE 4F7MB 2Q7YB 1JHLH 4ELMF 4L8BB 1DBJL 4ZQKA 5CBAA 3V52H 2CO7B 2JLLA 1ZTXL 1AD0A 2P5WA 3CC5A 3TT1L 2Z92A 3MYJA 2A0LC 5M7QA 2P45B 3ZE1F 4P59H 1OWRM 1W0VB 3VD7A 3NH7L 1FO0L 1Z0MA 3DX7B 3IJSA 4Z7NF 2ENSA 1N3NA 3QI9A 1T89C 1CGTA 5ISZD 1UXWB 1I7UA 4GKNB 2BVOA 3OKOA 5C3LD 2JB5L 1XGUA 2ZWLT 1QSEE 5IIEA 4ZFZA 2V9QA 3WIIH 1ZHBA 3QO1B 1DVFB 2YPLB 1QEWB 2Z93B 1IGFH 1NDGA 4RGNE 4U7MA 4EI5A 4EN3D 1IM9D 2CMRH 5ALBH 5T5FH 2IPKA 2WW8A 1YQ2A 1ORSA 4KI5C 1J87A 4DGVH 3I84A 4P5TB 1IGCL 3GJFK 1BJ1H 2WWKT 1BM3L 5I66A 1UB6B 3A67H 1P84K 3L5XH 4JM4H 3MBXH 2J88H 3G9VA 3ARED 3GIVA 1U2HA 4PJ7E 3SGDI 2GTZA 2ENYA 4YHLL 3PL6A 2MSPA 1BBJB 4OV5B 4UIKH 5CWSB 1WFNA 1JGDB 3DETD 1J12A 3VGFA 3OJDB 1TPXB 1IC5L 1AJ7L 5AUMB 3CXDL 4OZIA 5FKPA 2F5BH 1UWXK 2VDRL 3PWNA 3C60C 4HJJL 5D70L 3L5JA 3MRFB 3JWDH 3ZTJH 1RZFL 1BQHG 5IVXA 8FABA 5KSBF 1QSED 4JFEA 4MDIA 1UZ8A 3QUZB 2AV7A 2VITB 1JWMB 4JY5L 1K2DA 1AD9B 3ZE2E 4X98B 4Z0XB 1E4WL 3KYKH 5JNYA 2FECI 4X6FA 2XN9D 1WT5C 4KKLD 2PYEA 3QFJA 1AHWC 4OZHE 4U6HA 1J1XH 1WIPA 2NTFB 2ZCHL 1TQBB 3NGBB 5IV2A 1T83C 1A6WL 1P4IL 2DL9A 1ZGLB 3PXJA 2O61B 1OGAE 4P2RD 5CJQL 1OTTC 3WJLA 1UZ6F 5BS0E 5DR5L 4F7CA 4U1NA 1IGIH 2COQA 4RWYH 2AABL 2FHCA 1NFDF 3QUXC 1KTDB 3I75B 1CR9L 4ZG1A 5ITBH 5K93A 3BT2L 1QBLH 3MRGA 4IOSD 1H8NA 2FBOJ 1HI6B 5DT1L 3S37X 3AC0A 4HCRA 2QADD 3TA3B 4ZNCD 1RIHH 4NDMA 1JNLL 3IDIA 2JJSC 3NCYP 5C92A 1YECH 1XGYL 5IFAH 1OY3B 1Q9KA 3B2UC 4WFFE 3W2DH 5DA0B 3CXHJ 2IPUG 4P57A 1NCBH 3ZDXE 5C0FA 3OKDA 4NRYB 5DD3L 1NGWB 3EDDA 4TRPH 3MBEC 3BD4A 4HLZG 5C07E 1CWVA 7FABH 5HYQB 5GS0H 2VOTA 1GZPA 2VXTH 2YWYA 4NO3B 4OLYL 4PB0L 5DD0H 2EE3A 1AO7A 2NW3A 3QDAA 4NFCA 4NM8H 2KDGA 2GSGB 3IDUA 5SWZB 5KJRH 4P5MB 1A5FH 3LQZA 4ZFOA 4RMWA 4FFWD 3L95A 2NX5B 4NZTL 5GZNC 5TE7L 3GNMH 1VFMA 3EYQC 3PDOB 3W9EA 1L7TL 4PJAE 3CH1B 2EEAA 1F6AB 3I6KB 3IDMA 3PHQA 3ARSA 4D3CL 1WITA 4Z5RA 3OSKA 5FUCE 2Q76A 2FJFA 4Q9RH 1PKQB 1MJJA 4UAOB 2XI9A 3H9HA 3SGEI 2N56A 5TGBB 2H3NA 5D6CA 1G7IB 5BV7C 4KMTL 1M7IB 5ESAB 4LLYA 4JRYB 5J1AB 4U33A 1N59A 4ELKA 2OR9L 4RA3A 1CZ8L 3E6FB 4X0KB 1KJ3H 5L2KB 3UTPD 2PCPA 5KVGL 4ZXBB 1P4BL 4Z7VB 4MA7H 5BRZB 1YDPB 3G6AB 5C09D 3S98A 4RDQF 1P7QA 4NZRL 4OQTH 1INEH 3KWWB 4KKAD 4GLRH 4WW2C 3UBXA 3MRRA 3OB8A 5ID0A 4ZTPL 4RRPA 4ZSOB 5CUSH 3RNKA 1Z2KA 3IDGA 2VXSH 4S1SL 4R8WH 3OG6B 3C6LD 4OKVB 1MIML 2IBGA 5D7KE 4LLUA 2X09A 3MOAL 5C0EA 4W81A 3BQUD 1LMKA 5IOPB 2I5YL 4XTRD 2MPAL 3V95A 1DUYA 2FGWL 5LGJA 4Y2DB 3LQAC 1NCAL 4QRTA 1F58H 1HHJA 5CBAB 1JFQH 3QWQB 4NQXA 4PB0H 5C0AD 4JVUA 2R1YA 2P5WB 2VZSA 3CC5B 3DO7B 1F90L 1CL7I 4ZPTB 1Y18A 3Q48A 3Q0HA 1TCRA 3LV3A 1PEZA 4YXKH 3SGJA 4I9WE 1VGKA 3IJSB 3ULVL 2BC4A 3QI9B 4OLWL 3VG0H 3HCVA 3S4SB 4PY7B 4Y8AA 4YXLL 1JGEA 2IANE 1I7UB 2BVOB 1U8JA 1CN4A 1KLFA 1DP0A 3N0PB 5KN5A 2EKSA 1KELH 4ZFZB 4X6CA 1N5AA 4XPBH 5F7DA 2FIKA 1H9VA 1IGML 3RWJA 3QEGL 1ZHBB 3E8UH 5HY9A 3M45A 2IH3A 3QUMA 4HBCH 3RX8A 4Q97A 2YPVL 1KJ2L 4HIHA 4EI5B 2YUXA 3QHTC 1ORSB 4OFPA 5IW3A 1FRGH 4PP2A 2C4FU 1FYHB 1JF6A 5I66B 5JZ7C 4WV1A 3T4AA 1MCEA 3GIVB 2YPLD 4YBHA 3C08H 1E4XL 1HEZA 1I1FA 2GTZB 4IMKC 2YA0A 5D1ZA 1WWCA 3INUL 2OMBA 3PL6B 3PXHA 4XX1E 2NY6C 4F33B 4PJ8C 2OTUA 4Y1AA 1DANT 1U8QA 5FF6A 3MLPA 4RFNB 4WI8A 2MQ0A 4NKDB 1GHFL 4LHJB 1ODAA 1T80A 4ZAKB 4EUPG 5HHMB 4P5TD 4OZIB 4M6MH 4GMTH 5DEFA 1LK2A 3LOWA 5JORA 1RMFL 4KVNL 4L4JA 2FLBT 1CD9B 3KJ4C 5E5MA 3GO1H 5F7YC 3GDBA 4WHYG 4X4XA 1GSMA 2OZ4L 4QHKI 5I1KL 5IVXB 1KEGL 8FABB 1FG9C 4JFEB 3O2DL 4MDIB 2AV7B 2YS4A 2ITCA 1IVLA 4LOUD 1BAFL 4HPYH 1K2DB 1VEPA 5JW5A 4C56A 5JNYB 1E4JA 2YEZA 4X6FB 3D1MC 5C0DA 3F6LA 4LRIC 1XCTA 5ANMA 1NPUA 3WFHB 1NCAH 3QFJB 3RWEA 3RL1A 4LSVL 5IJKC 4U6HB 3EYOA 1I85A 1OP3H 4F58H 5IV2B 3BN3B 3RGVA 1MFNA 3HG1A 2FL5A 2C4XA 3MLSL 3QUZD 3VXQB 1TMCB 4HXBH 1DBKL 3MJGX 3TIEA 3MR9A 1SJHA 1OM3H 1WSST 4KHXL 4F7CB 4HIIA 4U1NB 2XWTA 5F21B 4OZGB 4RAUB 1DZBA 3UJJL 1C5DA 4UT6L 1GGIH 2MQCA 4PJHE 3LRGA 1AXIB 2Y5TA 3OR6A 3VJ6A 2DKUA 2A9NH 3U4BH 3FCTB 3MRGB 5C86A 4A6YH 3WXWL 4OAWA 3WFDH 1XF2A 3UP1A 5K9KA 2UY6A 4MAUH 3TH2T 4OJFL 4NOBA 5D1XA 1MFAH 3MLYH 4KGLA 4NDMB 4OLXL 3IDIB 4NRZB 1QP1A 5J8OA 3PP3H 4LLQA 3LMJL 2Y06H 4NKQB 3QXDB 1Q9KB 1BGXL 3GSNL 4Q6IC 4P57B 5ERWA 3OKDB 3V6FA 4FFVC 4LCYB 2OXGA 3OG4B 2E27L 4ODSH 3V4UL 1J88A 3WO3B 4DCQA 3TA3D 4UDTA 1GZPB 2W0FA 1OP9A 4CVUA 1J0HA 4JN1L 4IRJA 1HYRC 3RUGF 4Y16D 4UMGA 1MVFA 1AO7B 2NW3B 1PKQE 2DQTL 2OP4L 1G7LA 4Y7MA 4ZUSB 1AGEA 3HUJA 3P4OA 1LEIA 1M05A 4ZFOB 3D18A 3L95B 3JUYA 4JRYE 2LV4A 4XVJL 2VDPL 2WSKA 3JZ7A 5F97E 3VWJA 3P40A 1YEIH 3W9EB 2BOBB 4LU5L 3S3JA 5JHDA 1GGBH 5SWZD 3MA7A 3IDMB 4PB9H 3PHQB 4JN2A 3MLUL 4Z5RB 3BXNB 2NX5D 2Q76B 2FJFB 1JK8A 1MJJB 3JUZA 1KCKA 1DE4A 3H9HB 2H3NB 1RIUH 1OTSD 5D6CB 2EDBA 4ZSOE 3ULVF 5D93C 4EN3C 4MHHI 5I30L 2X41A 1MREL 4CGTA 4KMQA 32C2A 1N59B 5CGYD 4ELKB 2G5BA 2MCPH 3RP1A 3D87B 4KHXH 3SQBA 4Z7OE 3U7YL 1KIPB 5CZKA 1JRHL 4W68A 5DFWH 1IILE 1EV2E 3AREC 5I18L 2PCPB 3UJJH 3X12A 1IQWL 3KPLA 4F15C 3ZKND 1WLHA 4LSPH 4KVCL 1A6TA 4LCIL 2BK8A 1LE5B 3DETC 1S5HA 4G8IA 4G8GA 3FONB 5J4MA 3UBXB 5FOBB 3MRRB 3DIFA 4O2EA 5ID0B 3RNKB 3QJHA 5DRXB 1KB5L 4I3RH 3IDGB 5EUKA 5L2KD 1IC7H 4ZXBD 3LS5L 4JFFE 4ZOEA 3X3GL 3LSOB 1R3IH 4LLUB 2FWOB 5BRZD 1NANI 5C0EB 2OJZL 4G6KH 1DL7H 1ZLVH 3I6GA 1FFPA 3STZA 4PJFB 4GAGL 1M71A 1FH5L 4QRTB 1HHJB 3SPVA 3TJEH 4NQXB 3B9VA 1GL4B 3HE6A 3T0EB 2R1YB 5LGKA 1Y18B 3C5ZA 4KKLC 4AZ8A 1TCRB 3SCMA 3GJFH 4ODHH 4X9GA 2VERN 4P23A 1VGKB 4UT9L 5IB5A 4Y2DD 1W8OA 2BC4B 3HCVB 1JGEB 4N8CH 4Y0GA 1U8JB 3KYMA 3RIFF 1IC4L 2P5WD 2ED9A 2EKSB 2P42B 1DQJB 4X6CB 5GRWA 2FYYA 1N5AB 1GC1C 4G6JH 5F7DB 3QCVH 3MFGB 3MLRH 5IMLA 4NBYB 1UWXH 3WD5L 4BZ1L 4X4ME 1KSRA 1UYWH 5CEZL 5HY9B 3QUMB 3QI9D 3H9YA 1K4DA 2H9GA 2QADC 1FFOA 4YWGH 4CW1A 5KVEH 2EIDA 1KT2B 2OYPA 5IEHB 4HBQA 4LQFH 4PP2B 2L4OA 2YMXL 1B4JH 3RHWK 4JZJC 4WV1B 4J1UA 1R3LA 3ZDXF 3KXFE 3K4ZA 5I1EH 1HEZB 5D1ZB 1JTPA 1DCLA 5AZ2L 3BEVA 3UJTL 2DQEH 4KJQD 4EI5D 4O02H 2NLJB 3VXUE 5FF6B 4HIXH 4Y1AB 5MP6L 3LEYL 5T3XE 5I18H 4C59B 1CFSB 1NLDH 4DK3A 4LCIH 5DEFB 1LK2B 5JORB 4XNXL 3UJIL 3FQRB 5E5MB 3GBNL 4N1EA 3FB8A 4MXVF 4X4XB 2QSTA 4YFDB 5FUZH 3M8OL 2ZUYA 5JO5A 3PL6D 2E3VA 1ITBB 3CMOL 3FOLA 3BZDA 4CRPA 5F7EL 1C7SA 1ROWA 4YDLC 4HK0A 5HHMD 4Q9CA 3RI5K 3V6OA 1SEQL 4N68A 5JW5B 4KY1L 4C56B 5GGUA 2YEZB 5C0DB 1RVFH 1WTLA 1XCTB 5ANMB 1F5WA 3F7QA 3GSOA 5LVEA 5LCVL 4YHIA 3RWEB 3RL1B 4KPHL 3ELAT 3EYOB 1R3KB 35C8L 4TNWK 4TUJA 3RGVB 4JFED 3HG1B 2FL5B 1LP9A 3NTCL 3BI9X 1CLZH 2J8UA 4TVPD 3MR9B 1EZVX 1SJHB 3O3BA 5J11B 1IEAB 4JANA 3VD5A 4K9EC 5E8EB 1SVCP 2VMFA 2PYED 3QFJD 3UPCA 3C09B 4I77H 3VGAB 2Y5TB 3OR6B 3VJ6B 4DGIH 3G6JA 4OAWB 3VXPA 4HG4J 5K9KB 3CVHA 1HHGA 5C6TL 2XXMB 5EZJA 5B3NA 5D1XB 4M7LL 1OWWA 4KKAC 5AG9A 4LLQB 4OCSH 4BH7B 2EXYD 4LSRH 3PJSA 4XNZC 3MREA 5E56A 1HE7A 1WEJL 2O93L 4O4YL 4J3WA 5M95B 5ERWB 4XNMB 3FRUA 3ZKMD 2VISB 5L8JB 3C6LC 4JFOA 4KK8D 4HKZA 2YMXH 4OZFH 4GFTB 4GKZA 4LMQE 4DCQB 1BIIA 2W0FB 3BQUC 1ERNA 3CU1A 1G9EA 3RU8H 4IRJB 1X5ZA 4XTRC 1QFPA 1NCTA 5DHVA 4WHYH 3LZFH 1G7LB 2EE6A 5C71A 3B9AA 4NIKB 3PV6A 1AGEB 4LASH 1O0VA 5KW9L 3HUJB 1TLKA 1F4WL 1M05B 1U6AL 4WJ5A 4FQ2H 3K1DA 2F53B 3D18B 2DN7A 2WP3T 4PJIE 4MJIE 4PJ9B 4P9HH 3HPLA 3DI2B 3VWJB 4K3DL 4JKKA 4D9QD 1AO7D 2HH0H 5B21A 5D71H 4LLMA 2E9JA 5JHDB 3MV9E 3MA7B 4FNLL 2CUMA 5SV3A 1MAMH 3MV7A 4Q9QH 4M4RA 5J56B 4LEOA 1ADQA 1KGCD 4NCC1 5EZOL 1JK8B 3NBNA 1DE4B 4CMMA 2A9ML 5MEPA 5F6HI 1N0XL 3QIBA 4IOIA 5TE6H 1JF5A 2E9WA 1IGJA 4PGEA 1T3FA 1JP5A 5I1JL 4G6MH 1IAIM 1PW3A 4JGMA 32C2B 2HT2D 3LDBC 4F9PC 4LLDA 5IB3A 2E9IA 4K3EL 2JTDA 2G5BB 3QJFA 5GRXG 5AAWA 4UTAL 1NBVH 2QQKL 3VXME 5D5MA 5ACLA 4PJFE 3X12B 3KPLB 5A43C 3MXVH 1A6TB 2DLFL 4WCYH 3T0EE 4MA8H 3QP3A 4G8IB 4YHYB 4G8GB 5EWIH 1RZKL 3DIFB 2ZCLH 4P5TC 2ICWI 1CDHA 5I9QB 4YQXL 3QJHB 5L0QB 3IFOA 5EUKB 1YPZF 1AGDB 4O4YH 4OUUB 1WK0A 4U1SB 4AH2A 1TPXC 3I6GB 3RWHA 3STZB 5EO0A 1XCQB 3CSGA 1KBGH 1WIUA 1QRKA 4LOUC 2HN7A 4PJEB 3D25A 4FQ1H 1J7VR 1RZIA 2BMKA 3HE6B 5DMIL 4N0FA 3BHBA 3C5ZB 1FGVL 4M48H 4QO1A 5GHWL 3SCMB 2WLYA 3QIWA 1CCZA 1KCRL 5BMFH 5I1CL 2HA1A 4XVTH 4P23B 3QUZC 4IRZL 4NNYA 5IB5B 2D3VA 4NUJA 43C9B 1FL5A 3R8BB 3DGCR 4IS6A 4E5XA 2YWZA 1P7HL 4U6YA 1NL0H 3KYMB 3MJ8A 3EJYD 3QO0A 4KK5D 2FYYB 4Y4KB 3MODL 5IMLB 3CNKA 1TQBC 1CD1A 4XP4L 1C5BH 1BX2B 4TSBL 3LKRA 4X6BB 5E7FA 1INDH 1L0QA 4U1LA 5EZOH 4J8RA 2WWKO 3S35L 3VI3F 3W81A 1MEXH 4G9FE 2F58L 1FFOB 2IQ9L 1YMMB 3BJ91 1HDMA 5DD1H 1ZEAL 1TJIH 1FIEA 4ALAH 1FNAA 2YRLA 3Q6FA 5I1JH 3U36A 3DX9A 4CVXA 1IM3A 1R3LB 5EIQA 3DECA 2ZNXA 2AEIT 2LFGA 5DUPH 4R90L 3BEVB 5KOVC 1Z3GL 3HZMA 3NIDE 5E2UL 4ZTOL 2ZUXA 5F89A 1F00I 3TA3C 2Y36L 2ILLA 4XC1H 5JOPE 1A7OL 3VGHA 4Y16C 3KNBB 2AQ2A 4JQVA 4PTTA 3WS6C 1BBDH 1MAKA 3SEPA 1FPTL 5D1ZD 1NGXA 1YNTB 5JO5B 1TJGL 5FGCB 2YN5A 4XP5H 1YEFL 4X6DF 4Y1AD 3FFDA 4K23L 1RUKH 1HZHH 4X7EC 3O41A 5F1SA 2AJVH 2UZYB 1T7WA 5GGUB 2BSRA 2VDOL 4LSTL 4W4NA 4OLVH 3GSOB 5K9JH 3O11A 4WGWB 4E0RA 1BOGB 3MQIA 1KV3A 3DRQA 4NGHL 3QQ9D 5T5NG 5I8KH 3NIGE 3S3SA 4FQIH 3P4LA 4R3SA 2J8UB 1OTSC 1Q9OA 2VJXA 3O3BB 4UINL 3UYRL 2MNUA 4C56D 2E9BA 1CBVH 4JANB 4O9HL 2AQ3A 5F3BA 5CGYC 2HFEA 1E4XI 3RGVD 4Y2OA 1U2CA 3HG1D 4UAOC 5H8DA 4U6VL 3IDXH 2J6EL 5DC0A 1DEEA 3G6JB 1ORQA 3GB7A 3MA9H 3MODH 2C5DC 3CVHB 3ZKNC 2X4PA 5CP3A 5EZJB 3WEXA 3VWKA 4PRHB 4FP8L 1MFDL 3LKNA 5GGTL 2FO1A 5T3XH 4MA3A 3PJSB 4NJAL 4P3WA 3MREB 5J6HB 3GBML 1RUPL 4FS0A 2EDHA 3IKKA 3FRUB 2WBJA 4ZNEA 5MENE 5JXAH 4JFOB 4ZXBC 4HKZB 5E8DH 3HI5H 1MQ8A 1Z9LA 4DZBA 1FLRL 3W5MA 4GKZB 3QDMA 1BIIB 3BAEL 4LPUA 5D1XD 5B3JE 5LXGL 2BVEA 3BUYA 4XPAH 1XGTA 5DHVB 4AL8H 2DBLL 4ZTOH 3ZMRA 2Z0BA 4LK4A 3TN0A 2NY3B 1AQKL 2DMKA 3PV6B 1T1WB 1ZAGA 2BJML 2XZCL 1YMHA 4WJ5B 5ACZA 1GIGH 4MQXD 3PNWA 1F3JB 4ZOBA 3HPLB 4HW6A 4IRJD 1XZ0B 3WLWD 2GT9B 4Y2DC 3BE1L 4GXVL 4GUPA 4GAJL 3L1OL 4Y4HA 2JK5A 2J7LA 3MV7B 2R0ZL 5GZOD 2F53D 5A3ID 3TPKA 4LEOB 2AJ3A 2BX5A 2XWBB 3OKEA 5IW1B 4W4OA 4XNQB 1DUZA 4H25B 4L8DA 1B6DA 4IM8A 4CMMB 5BV7L 2GW5A 5MEPB 3PUCA 4IOIB 4JG1L 3VWJD 1V3KA 4Y8DC 3QI9C 1IGJB 4PGEB 4R26L 4NGHH 1AQDB 2O5ZL 3LH2H 2QQLH 1ZT7A 5JHDD 2R56L 3JV4A 2VLKA 4HEPG 4LLDB 2HLAA 3VFTA 3QJFB 5FYLD 2AEPL 1OL0A 5EOCL 5D5MB 3MCLL 4PJEE 1HK6A 4KJQC 3TZVA 4EI5C 4KI5F 5F9DC 2DJSA 1QACA 3O0RH 4WFGE 2VLJA 1MCSA 1NCDH 3AROA 4M1GH 3O4LA 3HAEA 1XH3A 2YXFA 1MFCL 2P5EA 2GCYA 3WIHA 3IFOB 2BVTA 3SN6N 5C0GB 3MLZH 4M4PA 1EO8H 2LVEA 3BN9D 4QGYA 1H3WM 4KHTH 1K3IA 3PL6C 3GBMH 1HSAB 4TUKH 5IEKB 4RFNC 1UCBL 1DJSA 4G8GD 4AH2B 3RWHB 4YHOH 5EO0B 3BRFA 3LQAL 4YDJA 1IE5A 3MROA 3V0WL 1ZS8B 2HN7B 3ARUA 3HNSH 3D25B 2A2QT 4GT7A 3EOAA 4NOFA 3VW3L 2BNQE 4NN6C 5HHVL 1KN2H 4N0FB 3S5LG 3BHBB 5D8JL 4K71B 2PR4H 4JDVA 3ULUD 1AXTL 1YMME 3QIWB 5FYKD 3QR2A 2C4FT 1JPGA 4KAQL 2R69L 4NNYB 1ZGLM 3U0TB 4NUJB 1CLCA 4FZEL 4F2MA 4MNQA 4U6YB 3S35X 1NUNB 3HE6D 3CDGA 4QGTA 3MJ9L 3QO0B 5D7IA 3EJZD 3C5ZD 1JRHI 2Q8AL 1A3RH 1JE6A 5KSAB 2Y9RT 2JF1A 2R0WL 3ARXA 4GXVH 5F8QC 3SCMD 5DVOA 4JRXA 1CD1B 4JGJA 3PQYA 4P23D 3B9EA 4Z7QE 3QWRA 4A2MA 2Q1EA 2HJFA 4M7JL 3U7AA 2E7MA 4JFHE 1IAOA 3WJLC 4J8RB 3BO8A 1LO2H 1E27A 1EGJH 5CCKL 3DXAA 4YGVA 4L3EE 3ZT6A 5HYIA 1OGTA 2EXYC 2A77H 2UV3A 3BPCA 3U36B 3UO1L 4TSAH 3DX9B 4CVXB 1RAMA 3FRPA 1YQVL 2C3VB 3ZKMC 2HP4A 3LCYA 4LQ1A 1D5XA 4KK8C 3MO1A 3HZMB 3UZQA 1CTOA 2ZUVA 2LE9A 2ADGA 1ZGLP 5F89B 3MCLH 4OD3H 3TO4A 2IPTL 4QHKJ 1DSFH 2A73A 1EJ6A 4PTTB 5HGAB 4LVHB 2C1PA 1WAAA 5CGMA 3P0YH 1SMOA 1NGXB 3WDJA 1UVQA 5IG7A 1RZGA 3FFDB 3J8F7 4KU1A 1KACB 2BVQA 1HHHB 4RMTA 3VFMB 1Q8MA 3O41B 4NYLA 3DYOA 2F19H 3VFVB 2CXGA 4L4TB 5CINL 2BSRB 2Q20A 1TTUA 5IBTL 4JO2H 4NQEA 5MHSE 4Q74A 4DKFL 2HG5B 4E0RB 1I9IL 3X17A 4PRHE 4O58H 3DRQB 1UM6H 4PBVC 3QXAA 2VR4A 4QRPE 3GMMA 1ZE3C 3FT3B 1Q9OB 3MRJA 1X5LA 4LSUH 4LAQL 3LIZL 3NIFE 1G6RH 4ODUA 5F3BB 1FN4A 2HT2C 1HKLH 2HFEB 4OF7A 5J7CC 1W0WA 1OB1A 4HC1A 5FYJL 2AJXH 2YD7A 1UEMA 3QEHA 3H9SA 3N85H 2R39A 3VFGL 1DEEB 3GB7B 2HFGL 3BIKA 2X4PB 2F54A 2Z91B 1QFOA 3M17A 5KVDL 3WEXB 4DVBA 3MRLA 3VWKB 5J12B 3ROLB 1UWGL 3HI1A 3LKNB 4V1DA 4MA3B 3ILPA 1WBYA 3AAZA 2RJMA 4HWNA 3FKUS 2WBJB 1U36A 4NQCA 3P4NA 3FT4A 1HH9A 5E2VH 4DN4L 4HH9A 4DZBB 1Q72H 1I1YB 1S7UA 2G60L 4WW2F 4X8XA 4ISVA 3BUYB 4U1JB 5F9AC 1QZ1A 3QPXH 1XGTB 3T3ME 3I2CL 4C55A 2R4SL 4P2OB 3UDWA 5BOZG 2PTUA 3TN0B 1FNSL 1JPFA 3RWIA 2RR3A 1D6EA 4JQIH 5ACZB 3PNWB 5IJVA 1TENA 4G6FB 4OCRH 3REWA 4PJXB 5DJYA 4BSVB 3MNZB 2V5RA 2YD2A 4ZFFA 1MCHA 4Q9BA 1MCCA 3S34L 4JM2A 4MXWH 4XRCB 1T04B 3STLA 4GUPB 2R0LH 4UTBH 2NY3D 4AMKH 1HH6B 3T2NH 3TGXA 3VMPA 2JK5B 3EJYC 5IVNA 4KK5C 5DS8A 4P2QA 2Y07H 4LSDA 1KCUH 2AJ3B 3OKEB 1J0ZA 1NAML 5IQ7H 2A6JA 2CKBH 1MFEH 1OW0A 1VGEH 4P5KA 3FFCE 1ZWIA 3SGJC 1I9IH 3ZE0F 1SY6H 4KQ3L 3VFPA 4N8VG 1ZT7B 4GW4A 3JV4B 1EHLH 4P3CH 1QVOA 3MV7D 2HLAB 4LAQH 3SKUD 4EBQH 5BZDA 3RWCA 4FZ8H 3BKCL 1VESA 3NIDF 5JHLH 3SDXF 4U31A 5J89A 1IAIL 2DMCA 4WHDA 1DBAL 4AIXA 1F8TH 3SOBL 4U3CA 3BP6A 2V17L 3O4LB 3VFOA 3GMRA 5EIIA 2GCYB 4KQ4H 4LHUA 3SE8L 4WV1C 3MV8E 4BH8A 4K3HA 3NABL 1RSFA 4JHAH 5D1ZC 4XMPL 1ZHKA 1H3XA 1XGRB 1N4XH 5AZEH 2P8LA 1JMZA 2OJEA 2DM4A 4ETQA 3VRLE 1J10A 3MROB 4UOW0 3T0DA 4UNTA 2JE8A 4HWZA 3T8XA 3EOAB 3LHPL 4JZOA 2VC2H 1A1OA 1NC2B 3S97C 1T2QL 1BJ1J 2CLZA 4JDVB 1B6UA 1KFAH 1KLUB 2AS5M 4OGYL 2ADIA 2C3WA 3QQ9C 4ODVH 3TPUA 4B0MM 1IBGL 1C08A 1KNOA 5T5NF 2VQTA 4YXHL 4R4FH 3RVWD 4CDGC 1Z5LA 1YYLL 4MNQB 4F2MB 3OAUL 3CDGB 4XMKL 5D7IB 1A7NL 4D9RD 1GC1L 5DSCA 4YK4C 1I85C 3QIWD 4JRXB 3RGVC 4N0YH 3VE0A 1S3KL 1IZKA 3OKKA 3OMZA 2HJFB 3VGEA 1IAOB 1B2WL 3BO8B 3QXVA 4F9LA 3CLEH 4XVUC 3DXAB 1KTLA 4J6RL 4UV4L 4YGVB 5KSAD 4QTHA 3BPCB 1GOFA 3C09C 1P1ZA 3VGAC 3MRPA 3QG7L 1MELA 2BCKA 4JFDA 2A6KB 4WVRA 3MO1B 1OSPH 5HYJE 2HT3D 5D1XC 2PKDA 1G7MA 4HFWA 4HX1A 2OL3B 2XQYK 3Q2CA 3TO4B 2SEBA 3NCEB 2A73B 1BFTA 3O6LH 1F4YL 4XAKE 1DQLH 3TBVB 3CFCH 2C1PB 1RZJC 3H42L 5IESH 1CXLA 1IT9H 2IADB 5IG7B 4NJ9H 3G6DL 3BESR 2BVQB 3EO9H 3OXRA 3MLVL 4MQXC 4F57L 3O3EA 1CLYH 4IRJC 4J3OC 4KI1A 4Z8FH 4Y19B 3WLWC 4B7LA 5E6IA 4UOW1 3GSVB 3LQMA 5I71B 1FG2A 2DQJL 1NBYA 3QRGH 4N0UA 4OIIL 1GPOL 3MV01 1P53A 5GZOC 5A3IC 4ZDHA 3TYFB 4XCCH 5E8PA 4KH2A 4XPTL 5EZLB 2CK0L 3VXTA 3VWJC 3MRJB 2C3GA 5C0BA 4OGYH 4L4TD 4K9EL 2R8SH 3QXTA 1I8MB 1FIGL 4ODUB 2VB5A 1SYSB 3KPRB 2D7MA 3KPTA 4EUPA 4MQSB 1E6JH 2DJUA 2E5EA 3UZVB 1OB1B 4L9DA 4LBEA 4XMKH 3LEVH 1RHHA 3QEHB 3H9SB 12E8L 2QQQA 2CLRA 5T1DH 3M17B 1FNLA 4DVBB 2D0HA 3QDGA 3EDFA 4GJTB 3HC0B 3HI1B 3JWOH 3ESUF 4MJ6B 4V1DB 3GZKA 1J0KA 2ZCKH 1FJ1B 3HN3A 2FHBA 2V2TB 4D9LL 3DARA 1MI5A 3ILPB 5CJOH 4U2ZA 1RUAH 1WBYB 3AAZB 4PJXE 2AXJA 1CF8H 5SWSE 1Q9LA 1K85A 5IB1A 4NQCB 3P4NB 3FT4B 4HH9B 3BN9C 5I1GL 1UH3A 1MJUL 1P6AB 1S7UB 3W39A 4GRWE 3QFDA 5ID1A 1XF4A 4MX7A 3VWKD 4ISVB 5H37G 3ARZA 4YHYC 3ZT5A 5DGQA 2EEDA 1AFVH 3FQWB 5L0QC 3EFDL 4OFDA 2XA8H 1U8IB 1JPFB 2WP3O 2WBJD 3RWIB 4IJ3B 4UQ2A 2AXFB 3H7LA 1ETZA 4KROB 1F4YH 2D0FA 3RZCA 2HFFA 3X11B 3ULUC 3QDMD 5TQ0H 1WWWX 5IHUL 3REWB 5DJYB 5HPOA 4MQ7B 2D03H 4LGSB 3OKNA 4ZFFB 3AGVA 2YZ8A 3MRBA 4MWFA 4JM2B 3STLB 4XCYA 2NY5C 4NQDB 3TN0D 4AIOA 2QQNL 4JE4B 3HE6C 1L6ZA 2MJWA 1I7RA 2FZ3A 4WY7H 1UA6H 4BSWA 1HOCA 1KYOK 4G3YL 5DS8B 3EJZC 4P2QB 3C5ZC 2NY4B 5EA0L 5F6HJ 3P3YA 3WFBH 3SCMC 2A6JB 1VA9A 3F58L 3L9RA 4G6FD 4P5KB 4Z7QF 4CDHA 4JRWA 2P44B 4P23C 3QNYA 4OIIH 5EU7E 2CJUH 2NY7L 1EJOL 4DW2H 3VFPB 1INQA 1EA9C 4HG4K 5JQ6L 4GW4B 1CK0L 2CK0H 3PHSA 4L8SA 1DBBL 1LO5A 1MH5A 4LSQL 1QVOB 2AI0L 2HRPL 3GUTA 1RUML 3IKCA 1QSFB 1HXYA 5BZDB 3RWCB 3S4SG 5I19L 3TEUA 1W0YT 2WLZA 4FQLL 4XAWH 5MERA 5D2LA 1RULH 5E8NA 3RFZC 2ICWJ 5E95B 5IMOA 4NO0A 3FO9A 3OZ9L 3IAPA 2VLKD 3BP6B 1QRNA 4OT1L 3VFOB 5C7XL 3GMRB 2L7UA 5EIIB 4LHUB 2AJUL 1KN4H 3TYGL 4QWWD 1XT5A 4BH8B 1ZHKB 4HFUH 3FMGL 3TZVD 4RWHA 2DQUH 2DIAA 2P8LB 5D7SL 2VLJD 2OJEB 4HH8A 3V4PH 4WFHD 4ACPA 1UM4L 3O4LD 2P5ED 2VN7A 1PZUB 3JVGA 4HWZB 3PE9A 3TVMA 3KPOA 1SM3L 1A1OB 4H88H 1JHTB 4BZ2L 5HYSA 1PKOA 3FAXA 4Y5XA 3MACH 4PJDB 3TPUB 3WLBA 4GMSL 1C08B 2UWEF 5BVPL 1KNOB 3V6OC 4I18A 4PGCA 1T03H 5E6YA 1VERA 1D6VL 2ZG3A 1LO4L 2W9DL 3GRWA 4JPVH 3IT8D 5DSCB 2NMSA 1PG7H 2VQUA 1YN7A 2QQNH 4PGZA 3VE0B 4G3YH 3OKKB 2CDGA 4MS8D 3D9AH 4Z7WA 2DDQL 4M5YL 4MNQD 3VD4A 4DUXA 5CFHA 3EOTH 1MVUA 3R0MA 4IRSA 2ZUQB 1TNMA 3BEWA 1EJOH 4QTHB 1C5CL 2R1WA 1P1ZB 5F9JA 4PLNC 3MRPB 4JRXD 1RZ8A 1DBBH 3PQYD 2OK0L 4JFDB 3QWRD 4Y19E 5T1MA 4GSDL 1IZJA 4QRSB 1MWAA 4Z95L 1EPFA 4Q0XL 1G7MB 4HFWB 4HX1B 5LGHL 3DXAD 1J0JA 3VG9B 2X7LB 1F02I 2IH1A 2SEBB 1CXKA 2DKSA 2DLIA 3Q5TA 3HLAA 1UEYA 2Z31A 3UC0L 1S9YB 1MCWM 1KOAA 2BNRE 1N64H 4WGVB 4KXZH 4RCAA 1QFWL 3QDJB 5GGSA 3OXRB 5HTSA 1ZLSL 3QZWA 4IMLB 3KPRE 4QLRA 5FA4A 2B2XH 3TO4D 2FBJH 4KZEH 3DX6B 5KS9F 3AMLA 5DEGB 5FGSA 5CD3A 1FG2B 2NY3C 3LRSA 1QOKA 1NBYB 3CK0L 1H3GA 1HQRA 3L5IA 3N1PC 4N0UB 1BD2E 1REIA 5GISH 2XT1B 2FCBA 3JV5A 4U6XB 4PGBA 5E8PB 3CDYA 3SE3A 3VXTB 1M7DA 5C0BB 2Z35A 3BMWA 4KUCF 5SX4H 1GJIA 5H35A 4OFVA 3B4NA 3REVA 5AWNH 4NQED 1JYVA 4NUGH 3L3IA 5BVPH 1WF5A 3C8DA 4S1RH 5C0CB 4LBEB 1RHHB 4JQXA 5FB8B 1DQMH 2CLRB 4XP6L 3LB6D 3QIBC 5GS3A 2RFXA 5JW3H 3QDGB 2BY0A 2JCCE 3VGDA 3GMLB 5EUOE 3NCBB 4H1LH 1MI5B 3ZDZE 5FO7A 2XTJE 2CD0A 2VZVA 1Q9LB 3I85A 5IB1B 1J1OL 3SQOL 3H9SD 1WC7A 5CLTA 3ALXA 3FB7A 4NQDE 2F54D 3W39B 1JZ8A 5ID1B 1XF4B 4PLKD 5D96B 4CKVX 4WUKL 4TPRL 1IRAY 1YEKL 4V1DD 4WEBH 1RJLA 1J5OL 4OBRA 4NP4L 3IU3A 5DJDA 5BW7A 5C9JA 4Q0XH 5EBWA 4JDTL 1JCKA 4DAGL 1OCWL 3ULSB 4FQXB 1C16A 4NQCD 4K7PL 4UQ2B 3UBXG 1ETZB 4OF3A 3RZCB 2HFFB 4RRPG 4HEME 1UB5A 1OAZL 3HC4L 3OKNB 1QFWH 2P48B 1QSFE 4MVBD 4MWFB 2DTML 3QXUA 4XCYB 3RVWC 3CZJA 4K07A 1I7RB 2FZ3B 4NT6A 4MLSA 4KROD 1A8JH 4K71C 3OJMB 2DI7A 4OLUH 4Y5YA 1UGNA 3QIWC 1LD9B 3PGFL 3L9RB 4L4VA 2QHRH 5FV1L 4KRNA 2GJZB 1MPAL 4PJCE 3RVTD 4JM2D 5KSBA 1BVLB 4IIQA 1INQB 4AEIL 2NY1B 1JYWA 4OI7A 5GSRA 4OSUL 1JYXA 4YUEL 1YUHA 1MH5B 4L8SB 4YX2H 3WFEH 3GHEH 3ZKXB 4P2QD 1HINH 3U4AA 3GUTB 3IKCB 2NY4D 2HFTA 5D7LE 1HXYB 2VN4A 1Q0YL 1K5NA 2YUVA 3KDMA 3F7YB 5DEZA 3BP7A 1YEJL 5MERB 4ODTH 5D2LB 2G75B 1JHKL 1M7XA 2HT3C 4GRLB 3LVEA 1P84J 5IMOB 1FBIH 4NO0B 3TBWA 3FO9B 2B1AH 1VPOL 2O5XL 3MCKB 2EDOA 4GRWH 5JW4R 1OPGH 1A1MA 4NKIH 2PYFA 3TC9A 3P0VL 1AGFA 4PJDE 2IFFL 4PP1D 4NM4L 2A6DA 1MJ8L 3A6BL 2HAZA 1S78C 3LKPA 3BWUC 2VNCA 1MCNA 2AK4B 4PUBH 2EDNA 3DUUA 4M1DH 3HI6L 4LHUD 2NXYB 1A0QH 4JQVC 3KPOB 4LVHC 1JPTL 1ZANL 1V7NH 5FOJA 2GK0A 5T3ZE 4XVSL 3WL9A 1FAIL 4FN0A 1I8IA 3JXAA 5HYSB 2CR6A 1NAKL 1NCCL 4ETYA 1A3QA 3VDCA 4Y5XB 2WANA 3WV0A 4I48A 1FYTA 1KCSL 2JELL 3WLBB 3NCYS 5E1AA 5E03A 2B8OT 1HHIA 3WKML 3UTSE 2G9HB 4PGCB 1R6VA 1OAZH 4MB5A 1R0AH 1J86A 1XMWA 4I2XA 3QB7C 3BDYL 1JZ5A 3RY5A 3HZYA 5I1DB 1YN7B 1IAII 3IU4H 4U1GC 3W0WE 5F3HA 5CMAA 4Z7WB 2GTWA 4QXGL 1PYWA 4FQJL 5CGTA 1NCWH 1MVUB 2VXUL 4IRSB 1MHPL 4S0TD 4EI6A 2FJHB 3QDJE 4TNVK 2R1WB 1G6VK 3JWNC 3BUTA 2R2CA 1RZ8B 5T1MB 3IRPX 2XRAH 3E3QE 3BJLA 3RAJH 1CDGA 1MWAB 4HCRL 3R4DA 1B0RA 1FC2D 4XP1H 3VWKC 3CX2A 5J12C 4M9PA 4NPYA 2GIYA 5DRZA 5C08E 4LLWA 4UOJA 3U82B 4CVWA 3D69A 4QY8A 1KIQB 3IXAA 1KPUA 2Z31B 4JFDD 2WBJC 5FHBL 3CDFA 1QKZL 4Z7VF 2EIZA 3I50H 4MZ3A 1G7PA 5GGSB 3NMEA 4UIMA 1VFBA 3QA3A 3QZWB 1J1PH 5KTEL 1EZVY 4FXGA 3L3OA 2GITB 2VUOA 3UTTA 1A47A 1U8KA 5C0CE 2BY1A 5BVJA 2YA1A 3TN0C 1T7XA 5CD3B 3LRSB 4ZFOL 3BP5A 4JJ5A 5E9DE 3S96A 5GRUH 4NO5A 4P48A 3EYSL 3IFLH 3TV3H 4PGBB 3FN0H 3SJVA 1U42A 2OL3H 1EX0A 3B5HA 1F3RB 1M7DB 1KUMA 2Z35B 3OQ3B 3U4EA 5E6ID 5H35B 4TVPH 3REVB 3L3IB 6FABH 2X4NA 4ELMB 4P49A 1G9NH 2RHEA 5CEZD 1A6VL 2RIKA 1QG3A 3HZVA 4W4OC 3GSXA 4FG6D 3VCLB 4OFKA 4EXPX 4Y5VA 5KSUA 1IFHL 2RFXB 5ALCL 5C0BD 3PDDA 3KLAA 5GJTL 1I3RB 4I0CC 2DQFA 3O6KH 4XWOD 4P0DA 3H7BA 5FO7B 2YK1L 3L7FB 4QWWC 5BJTA 3D3VA 3L3GA 1NCUA 4K7PX 5MEOB 2FX9L 3FB7B 2P8MA 4O2FA 3AS3A 4HWBA 3TZVC 1LWRA 3QDGD 3CU7A 2E8YA 1N6QL 2YBRA 3KYOA 3ARGA 4ORGA 3KG5A 1MAJA 1MRDH 3K74B 1MI5D 2X05A 1RJLB 3MRQB 3D2UA 3IU3B 2DQCL 5EBWB 5DJ6A 4X7SL 3QUYA 5EG6C 1C16B 1RUQL 3ZL4L 4GBXA 3GMOA 3LN5A 1TZIA 1CFQA 4HS6A 3OR7B 4F37F 3D39A 1RIVL 4IDJL 4PS4L 3BH8A 4OQTA 4GAFB 1FL6A 1K4CA 15C8L 1Z9SA 4AEHL 4BQ8A 5EBGA 1W72B 4U1MA 1F2XK 5IVXF 5A2FA 4NT6B 5J6GA 4YDIH 3RZCD 4Y5YB 1CT8A 1A6UH 1H3PL 1QHOA 3LEXA 5GS2D 1OAUH 3KYAA 2Z8WC 1YZZA 3G5VA 1BEYL 2ICES 3HC3L 3I02B 5KSBB 3SE4A 4IIQB 4XNUL 5GSRB 5BO1L 1PSKH 3RTQA 2XWJA 1YUHB 1LVEA 3DVNB 4WUUB 1V5JA 2FD6L 5EBLA 5K59F 3AB0B 3UTQA 3QQ4B 1ITCA 1A2YA 4JHWH 2AJSL 3P11L 3QUML 2AK4E 3KDMB 4JDZA 3O3AA 2EIEA 4HZAA 4GQ9L 4OM0H 3VXSA 2EDFA 3QWOA 5IBLD 3G5XA 4ZO7A 4KV5F 5I8CA 1RI8A 1A1MB 5LBSH 4UV7L 4HWEH 5C0IA 4O2CA 1AGFB 1PG7W 4YH6A 3BZFB 3BRDA 3BISA 2A6DB 4G7YL 4HT1L 1XEDA 3LKPB 2JJUA 1R5VA 4GRLD 4NO0D 1NUDA 4BK5A 2DTSA 2B0SH 1QRND 5DJ0B 3TO4C 3DUUB 5DQJA 4X7DC 5I75B 1FCCA 3EZ8A 4PG9A 4EDWL 4XZUB 2GK0B 1WICA 2PO6A 3WL9B 4RISH 5HSFA 5IFHH 2HKFL 2R0KH 1I8IB 1NAMA 1VFOA 1HIMH 1IL1A 4WI3A 3TH4T 3MRNA 4I48B 4U1HA 1FYTB 5I17A 1CXFA 3HE7A 4K3JL 5E1AB 4K8RH 3S8WA 3IVKA 1RIVH 2ZSVB 2YOCA 1VADA 2GJ6A 2NXYD 2R29L 2UVEA 3DOSA 5L88L 1EHAA 5JDJA 3CCHA 4JKPL 5I71C 4GG6E 2WUCH 4I2XB 1T22A 4XI5D 1A21A 1MLCA 4K94H 5F93C 3RUGA 5JTWA 1VKXB 1U95A 1W2KT 3T0WA 1P2CA 1G7QA 1C8PA 1G9ML 3V79C 1IARB 3ZZ1A 5F3HB 5CMAB 3FZUD 2ZPKL 1A7RL 3LB6C 4P99A 5DVKA 2A1WL 4OB5L 1NMBL 2GFBA 2GTWB 2JCCF 2DYPA 2PW1B 4PJBE 2FX8L 1PYWB 4AT6B 1CQKA 1GOHA 3QEQE 1DLFH 4JFZH 5AD0A 1P5UA 4JG0H 4P4RA 4KTEH 4RFEA 2UY7A 4XBEH 3QCUH 3V5KA 2XOTA 1QSEA 4XP9H 1TVHA 1H8SA 2FD6H 2W0LA 5DK0A 5E8OA 4CNIA 3Q6GL 1B0RB 5F7UA 4PLKC 5FA3A 1BJ8A 1KCVL 5DQDL 4IRSD 4NFBA 4NPYB 4OGZA 1MCLA 4DZ8B 2GI7A 5DRZB 4LLWB 1FNHA 1QYGL 1YN6A 2FO4A 1RZJL 1I3GL 1R24A 5E08H 1CGSH 4L5FH 4LVNB 4ZUTB 4QY8B 1KPUB 4M7KH 2CGRL 3BIAX 3DVGA 1T20A 3WFCH 5SX5K 2EIZB 1I3UA 4A6YA 4XNYH 2ESVE 5DD5H 5B8CA 3O2WH 5T3ZH 1E28A 1G7PB 2FR4A 1ZXQA 3MGOA 4UIMB 1VFBB 2DIJA 4PJ7A 4QT5A 3SGDH 1QFUL 1ZA3A 1FZKA 4FXGB 3L3OB 4JVWA 3UTTB 5JIIA 3LKSB 1U8KB 4ELME 4MVBC 4RA0C 3AM8A 5DRWA 3NFPA 5CLWA 3UDWC 2Z31D 1JVKA 2XY2A 3DRTA 4JJ5B 4IJ3C 5C6WH 3S96B 5IB2A 3MLXH 4KROC 4OGXH 3ZE1E 4NO5B 1HNFA 5ECJE 2Q3ZA 2JIXB 2RCSL 1A14L 4QHNA 2VABA 2NCMA 4OLZL 3RWFA 4Z7NE 5E24E 2DLTA 4HAFA 4BQ6A 3WBDA 4M5ZL 3RVTC 4JM2C 4C54A 4HS8L 3W9DA 1PY9A 5TPWL 1BZ9A 4U0QB 2DL2A 2J4WL 1T4KA 3H9ZA 5FYLL 3BGMB 2NY4C 4MCYA 3HZVB 1CDYA 3GSXB 1EAPA 1JGLL 1OW0C 5ESQB 4Y5VB 2VH5H 2ZOKA 2EYSA 4RSVA 5EU5A 5KSUB 4OZHA 3C5JB 4FFZH 1OTUD 1FE8L 2FLRT 4EOWH 3BPLB 1D5ZA 2V5YA 1OGAA 5FEBA 3OJ2C 4X6CF 2A1WH 4NZUL 3H7BB 5BS0A 3S36L 4BUHA 1NGPH 4APQA 5BJTB 4PP1C 1QFWI 3L3GB 3KHQA 2ZKHH 2WZPD 4O2FB 3BP4B 3B5TA 3QQ3A 1X4XA 1WCQA 5F96L 4GRMB 1UWEH 2XZAL 3KYOB 4ORGB 1PD6A 1S5IH 4LCUB 4YE4H 3ECBA 3IS0X 3GHBL 2IQAB 4X6EA 3FO0H 5E94A 3RWDA 3W11D 4GBXB 3ULUL 1QYGH 3GMOB 3L3DB 3LN5B 5FYKL 3PGCA 1CFQB 3FB6A 1NUFA 3D39B 3U9UB 4XPFL 5E2TH 3J7HA 3BH8B 1T21A 4O5LL 1ACYL 1FL6B 4LKXA 1K4CB 4WUUE 2NY5L 1FZJA 4L9LA 5C07A 4U1MB 1HXMA 1GCFA 2NY2B 5AYUH 3C9NA 3TWCH 3ARDA 5DTFA 3X3FL 3KR3H 4MQTB 5FCUL 5J6GB 2Z8SA 3R8QA 2EDLA 1CT8B 4PRAA 4EKXA 3LEXB 2DWDA 1AE6L 2H41A 4NWUH 3G5VB 3NCMA 3NZHH 3MUHL 1JV5A 3OV6A 4YNYA 2OR8A 5D2NE 3RTQB 4ERSH 5IWLA 4LPWA 3B2VL 5JMRA 2F8OA 3SDYL 1NFDE 4PJAA 4JPIA 5GRVL 5EBLB 3SDAA 3UTQB 5IUSA 2VDNH 1A2YB 2ZUUA 4L4VD 4DN3H 2F74A 4P9MH 5E5RB 1UC6A 2WM0A 4LIQE 4ORZC 3O3AB 2GK2A 3SY0A 1BQLH 2FJGA 1Q1JL 2EYTA 5TQ2L 4F9LC 3QWOB 3G5XB 1MFBL 3RX7A 1YEEH 2ZUQC 5I8CB 5FO8A 5C0IB 1U92A 3V5HB 4K2UH 4O2CB 4ZUVB 3TT3H 5DJ8A 4GG8A 5JUEL 1CU4H 4KDTA 3T1FA 4NHCL 1MQKL 1R5VB 2V7NB 2J3SA 5D72L 4XGZB 4JFQA 5I15H 2AK1H 3UCRA 4L8BA 3VG9C 1UKTA 5DQJB 4B5EA 3L7EA 1X44A 3U1SH 1MCPL 4PG9B 2ARJQ 2XZAH 4NN5B 5IMKA 3VFRA 2BNUA 2PO6B 3WNMA 5TF1H 1T1YA 2I9TA 3LY6A 1QBBA 4NC1E 3DX7A 3QHFH 4U1HB 3CFDA 3HE7B 2JJWA 1K3ZA 2IBBA 2R2BA 5K9QG 1EEZB 2WK2A 1VADB 2GJ6B 2XFXA 5EOCJ 2IG2L 1MNUL 5I8OH 4KZDH 5E6IC 3CCHB 2GUOA 3O3DA 2R2HA 1FNGB 5A2KH 4PJ5E 1T22B 5DRNA 3RUGB 5KVFH 1DVFA 2YPLA 3PWPE 4NHUA 5M94B 1P2CB 3EZJB 4FG6C 3LKOA 2R4RH 1FYTD 4OM1H 1EUUA 4NKOA 1AI1L 1KC5H 1KENL 3HRPA 2GFBB 3BKJH 2DYPB 4NWTH 4EVNB 5AD0B 5C2BL 2FIRT 2IANA 4XWOC 4TUOA 1IAKA 2MMXA 5HDQL 2WIIB 4R9HA 4LNRB 3V5KB 1XGQA 1TVHB 3CVHL 1JGDA 5DK0B 5E8OB 3GIZH 4CNIB 4WHTA 3VU2A 2FB4L 5FA3B 3N9GH 2B4CC 3DV6B 3QSKB 1JMXA 2BSED 3AU1A 4LEXH 3GGWB 4FFYL 4M3KB 4RGNB 5CEYA 1OAQL 3SDDA 4XPHL 5DMGD 2FO4B 3SHSA 3MRFA 1R24B 5TQ2H 4QOKB 4FTVB 1T20B 9CGTA 4WNQA 4A6YB 4WI6A 5B8CB 1KCLA 2X1QA 2X6MA 3NFSL 3MGOB 4PJ7B 5D96C 2VITA 5JUEH 1BFSA 2WBWB 1ZA3B 1AD9A 2P49B 3KJ6L 4X98A 1FZKB 4NCDA 5EB9A 1HCVA 1JNNL 1URLA 5LWYL 3NFPB 4BJLA 5FM5O 2EH8H 4KMLB 2Q8BH 1DBML 3DRTB 4QXTA 3WUZA 4XB7A 4TSCH 3ULUF 3F65A 5IB2B 4PRBA 4OZFA 3RZCC 1ZGLA 2O61A 1CXHA 4PY8I 4QHNB 3A6CL 5DLML 1GGCH 2DQGL 3UTTD 5C0RH 4BZYA 4M6NH 2H2SD 3I6LE 4ZD3L 4U7SA 1J11A 3QEUB 5HD8D 1BZ9B 3TNNB 1T4KB 1EK3A 4LF3A 4FRWA 1ADQL 5AYQA 3DX8A 4MCYB 3S36X 3L6FA 1EAPB 1HI6A 1S9KC 2ZOKB 2EDEA 2EYSB 4KDVA 2BDNH 3HNTL 3IRZA 5EU5B 4OZHB 5FHAL 2FATH 2GSIA 3WMSA 2XKNA 3BVNB 2EICA 2OXHA 1WWBX 3AXLA 1OGAB 4L8SC 2GYSA 1AI1H 1RY7B 1QPXA 3RZWA 4BQ9A 4DQOH 4M8QB 2VLMD 5GSVB 4APQB 4HQQH 1MJ7H 4PJHA 4KRPD 1I9JL 4XH2A 2ZSWA 2W92A 1NSNH 4D8PA 3O2VL 5ABDE 3ECBB 4OCYL 2GSGA 4ZS7H 3IFNL 3I9GL 5SV4A 1N5YH 2X4QB 3KPSE 2HWZL 4X6EB 4JB9H 3D3VD 2I60H 4RNRA 5E94B 4FABH 5D9SA 1TJHH 3HAEG 1WVZA 3GSUA 1MLBB 1MRFH 3PDOA 2ARWA 1T21B 3I3BA 3L5WA 4JPWL 4LMQI 5DURB 4LKXB 3VFUA 5HI4D 2ERJB 1FZJB 4FMFA 4L9LB 5C07B 3TP4A 3D2UD 3I6KA 1MUJB 1HXMB 3QHZL 2NXYC 3JVGC 4GG6F 3TVMC 3ARDB 4Y89A 2VO5A 4HMCA 4WEUD 5I1HL 4GBXD 4XI5C 4LVEA 1PKQA 2KKQA 3K4DA 3D39D 4YIQA 3WUWB 5E2WL 4JREB 4Y5XC 4JY4A 4DTGH 2DWDB 3N1FC 5ESAA 3EOYG 4DGYL 1MHHB 3BZ4A 4MD4A 3I3DA 3FZUC 1S7QB 1IEBA 1JV5B 4JRYA 4PJBF 2KPNA 4I18C 2NY2D 4YNYB 4UT7L 3N1QC 1J0YA 2W38A 2YD8A 3E6FA 4PJAB 4JPIB 4MZ2A 4WI9A 4X0KA 2QJDA 3SDAB 3NAAL 5FYJD 1LP9F 3NA9L 3GJFB 4YAQB 2F74B 2J8UF 3IDYB 5C0ND 5DZOA 2B1HH 1ADQH 2LAGB 3UBXI 2AKRA 3CFJB 3KWWA 4AENA 3SY0B 1BWWA 2D7TL 2FJGB 3FQTB 1UKSA 2WUBL 3RTQD 2BERA 5ESVA 4ZSOA 1RZKC 3ME0A 2HJKA 4IRSC 2HKHH 4NBXB 3BDBA 4LARL 1NFIA 4UQ3A 5CZVL 5FO8B 1U92B 4XMLH 3U7WL 1FVDA 2XA3A 4TOYH 5DJ8B 3K2UH 4GG8B 3G6JF 3MRCB 1NEZB 2VWEC 3HMXH 5MI0B 5EOQL 3L3HB 2HYMA 3T1FB 1F45A 4PLJD 3S37H 1U58B 5C8JA 4JFQB 4XPGH 3FRPG 2XQBL 3RVVD 2FX7H 4YHML 3EBAA 2W9EH 4JFYA 2H45A 2EDWA 5DMJB 3KPMA 3L7EB 3ZDYF 3WXVL 1UJ3B 3DO7A 4B53A 4X5WB 5IMKB 3VFRB 4ZPTA 2BNUB 2Z31C 1JGVH 3GI8L 3OL2A 1T1YB 2I9TB 2C26A 1SQ2N 2HWZH 2ORBL 3CFDB 2AEQL 3S4SA 3H8NA 4PY7A 5DI8B 1LDPL 2R2BB 1EVTC 2XFXB 1NANH 3BYTA 1LO0H 4BUGA 3S88L 2GUOB 3O3DB 2R2HB 2PO6D 5A2JH 1RURH 5DRNB 4I3SH 5EORH 1I8KA 1ZLVK 4NHUB 4K7FA 5L6YL 1IAMA 1FV1A 3BGFB 1KEMH 3LKOB 5DA4A 3ULVE 3HE7D 1CE1L 3SE3C 4QYOA 4NKOB 4EEEA 1C1EL 5SX5H 2GJ6D 4KRMB 4QOKE 1OTUC 4KJWC 5ILTL 4FTVE 4LIQH 1HILA 2J8HA 3VGGA 4PBWD 4OD1L 3MXWL 2LU4A 3K0WA 5EO9B 2IANB 4TUOB 2Q87A 1IAKB 4Q7DA 3TBSA 2MWCA 3TJHD 3CJJA 4JQXC 4F33A 1XGQB 1AY1L 1T6VN 5DWUL 4PV9A 3LAFA 2WV3A 4XCEB 3KHOA 4NKDA 1D5MA 1FSKB 1FGNH 2DYPD 4WHTB 4ZAKA 4X4MA 5L9DL 1H8OA 4AQOA 3C2AL 3AU1B 5CEYB 5GGQH 3F8UB 3SDDB 1T7YA 4O00A 3FL7A 2E7LA 5D5MF 2W91A 4JPKH 3PIQA 4LARH 5EBMB 1PVHA 4H20L 1SBBA 3W11C 4WNQB 2DQDL 4AQ1B 3U7WH 5ADOH 3KXFA 3VA6A 3TBTB 1I9RH 1EHNA 2VUYA 3GJEA 4YPJA 4ONFL 4RGND 4ENED 1S8DA 3VXUA 1CXEA 1GYAA 3F7PC 1P5VA 3FN3A 2YKLH 5BW7C 1E6OL 3BZEA 4CN6A 3WFHA 1DBJH 1NMCB 4QXTB 5GGVL 3H3PL 5F7WC 5L7XL 1ZTXH 4OFIA 2AJYL 4PTUA 1BWMA 4PRBB 4OZFB 3VXQA 2A6IA 2WAHA 3HA0A 4OUOA 4OF8A 3TT1H 1XF5A 3WNLA 4KGJA 1YPZB 5CJXA 5ICYA 4YHPA 4OIAA 3NH7H 1FO0H 5HHXL 2CDFB 3SKJL 4OZGA 4RAUA 1ZA6B 2YPKA 5KSVB 1TIUA 3D5OF 4LF3B 5E2JA 3NACL 2JB5H 5HI3D 4AY0A 3FCTA 3DX8B 3GKWL 3L6FB 4Y5YC 4DKEL 5HJ3B 3WS3A 3STBA 4HKXA 4YC2B 5GGRA 1HHKB 1AH1A 5C1MB 3TCXA 2GSIB 1OLLA 4NRZA 4IIQC 2XKNB 4M62L 2QHLA 1CE1H 3AXLB 3BGAA 3QXDA 2X9XA 1EHXA 1VSCA 1Y6NR 2EH7L 1FDLL 1IGCH 4LCYA 1BM3H 4YEEA 1ZLUH 3QRFM 3H0TA 4PJHB 5J9PA 2B7DT 1UACL 2XXCB 4XH2B 4YHLH 2ZSWB 5T33L 4ZO8A 1OGAD 4PFEA 4D8PB 1YEDA 1IC5H 1AJ7H 1WZ1L 3WIHL 4ZUSA 5BS0D 3CXDH 4APQD 4MXVE 4RNRB 2VDRH 5D9SB 4J3XA 5ICZA 2BSTA 4HJJH 5D70H 1N8ZA 1RZFH 3GSUB 4UB0L 5JXEA 3JV0A 4LHUG 1U8NA 3FOMB 3L5WB 2BOBA 3VFUB 1OOAA 5EC1A 5I75C 4JY5H 2KH2B 5HHOE 3BXNA 3THML 3LRHA 1E4WH 4PGJA 1YEGL 4U3HA 3SDCA 4POYA 4WFFD 4YIQB 1WZLA 1H0DB 1BJMA 1WISA 3VI4F 4JY4B 2ZCHH 4G7VL 5GGVH 1B3JA 5DURD 2AERT 1A6WH 1P4IH 2AJYH 3BZ4B 4MD4B 5C07D 1IEBB 1EVUA 4PJIA 4MJIA 5CJQH 3ARDD 4F7EA 4LKCA 2K1MA 2VQ1A 3MUJA 2PN5A 1MIEL 5DR5H 4MNGB 1KIPA 4U3XA 4XHQA 2LAAA 1XGPA 3G5ZA 2AABH 3AY4A 1VACA 3V5DA 3OX8A 1CR9H 4JO1L 2AJZA 3NACH 1LE5A 2Y5EA 5ADPL 3BT2H 2N7AA 1VFAB 2AKRB 1DFBL 4AENB 1Z9MA 4AM0B 1X5GA 3FONA 4HUUA 5EDXA 5FOBA 5F44A 1SJVA 4W70A 5DT1H 5F9OL 5ESVB 5DRXA 2HJKB 3UEZA 4RGMB 1JNLH 1NFIB 4UQ3B 3ARYA 3SDAD 5DMGC 3ZHLA 1XGYH 5IT2L 3LSOA 1FVDB 2FWOA 2RAMA 3BFOA 5I6XB 3C8HA 2IMNA 3OAYK 1E4KA 5DD3H 3UPAA 3VXMA 4HMDA 2CKNA 4PJFA 5C8JB 2EECA 2F5AL 4JFYB 3MC0A 3KPMB 4OLYH 3T0EA 4LVNC 3HAEH 3LN4A 5IROA 3MRMA 1IQDA 2ED7A 5HGDA 1TZGL 4KKNA 3DSFL 1HQ4A 4NZTH 4JFFB 2KQMA 3V7MA 5TE7H 4M43L 3HMWL 2H2SC 1VFUA 1YY9D 2DAVA 4Q2ZA 4KK6D 3U6RB 1F13A 1L7TH 1DQJA 1UG9A 5HD8C 4I4WA 1MY5A 4YGAB 3K1KC 1I8KB 3L3KA 1B0GA 4D3CH 4K7FB 3C87A 2VIRA 1FV1B 1K8DA 5I0ZA 5D7KD 4YDVA 4QYOB 5L2JB 5HDBE 3DNKA 1KT2A 5IEHA 3MYZA 4KMTH 4YHZL 4N9OB 4HUWA 1HILB 4BFEA 5DUML 1P4LB 4MJ2A 2BSSA 1DVFD 3TBSB 4HC1L 3RIAK 2OR9H 2NLJA 1T5WA 4Y5VC 1CZ8H 1D5IL 1OARL 3FQXB 1I3VA 4PV9B 4KRPC 5KVGH 1D5MB 1CFSA 5J0BA 3E0GA 4KFZC 1P4BH 4I9WD 1FP5A 1VDGA 4JKWA 1A6PA 4XCFL 2DD8L 5ADPH 4NZRH 3FQRA 1G6RA 1X5YA 2IAND 4G9FA 4QEGA 1ZLWK 1YPZE 4ZTPH 4BKLA 1CFTB 2DS4A 1PX4A 5CJ5A 3PIQB 4XCNA 3UTZA 4S1SH 5FECB 1MIMH 1YYML 3GM0A 4HKJB 3KXFB 4N90E 5HHQA 3F12B 3MOAH 3GJEB 4YFEA 3GI9L 3IDJA 5CIPH 1JPSL 3ARGC 2FSEB 2VXQL 5HI4C 2BY3A 1S8DB 3VXUB 3SDDD 2I5YH 1ZK9A 1YNLL 2MPAH 2FGWH 3BZEB 2VDLL 1RU9L 3QUYC 4C83B 4LDEB 1R3KA 4GBXC 1FCGA 4PTUB 1B9ZA 3ZT7A 1HCFX 2A6IB 2APTA 1F90H 1XF5B 3DVIA 5F7HA 4G5ZL 5ICYB 4YHPB 2VLRB 3EKCA 1IEAA 3UMTA 3QULB 3ULVH 2YPKB 2NY2C 5E8EA 4OLWH 5J06A 1L7IL 1YJDC 1CD8A 4YXLH 4YO0A 1KG0B 2FRGP 2AV1B 3R1GL 5FGBA 5FGRA 4X83A 4G43A 1QNZL 1AKJB 3M1BA 2APBA 4M6OL 3WS3B 2QSQA 4J2XA 4HKXB 1NC4A 5GGRB 1IGMH 5C0NC 3QEGH 4HXAL 3VI3E 3QBTB 3SE4C 2FHFA 4J4PA 4BH7A 1DTUA 4U7KA 1P7KA 1KJ2H 2YPVH 3RTQC 1MF2L 5D7IF 5ICXB 1BIHA 4LRNL 4F3FA 2W60A 3ARFA 3OBAA 1BMGA 1T5XA 4XNMA 4CUCA 2HRLA 2VISA 2X4SA 3GSWA 3ABZA 1VHPA 4DKAA 3ZHKA 2BXYA 4X4ZA 2CKBA 4DVRL 1AHWB 3H0TB 5B4MD 2PF6A 5J9PB 1J9CT 1E4XH 4OCLC 4ZODA 3INUH 3M07A 4EIGB 2YD4A 1KJVA 1SY6A 3CX5J 4PLJC 4X9IA 2X9WA 1OARH 5F7LB 4EQ2A 5MEQB 4PGDA 3RVVC 2LTQB 1A9EA 1TFHA 4ONGL 4JO4L 1YEDB 1GHFH 4NZJA 2K3TA 1MHCA 3WHXB 1RMFH 4KVNH 4Z0BL 2F53A 1NMAL 1XIWA 2DQHL 5ICZB 3QUXB 3N50A 4X6DE 2BSTB 2VXVL 4PJ9A 2OZ4H 5IQ9A 2XACC 1N8ZB 5I1KH 3LS4L 4M93B 1U8NB 1KEGH 5MENA 1G0XA 4MNGE 4G42A 3O2DH 4MAYA 1A9BA 3IJYA 5EC1B 1JI2A 1WAAF 1F42A 3EOBB 1BAFH 2PO6C 4JCMA 3SDCB 3LD8B 2Z4QA 4LSVH 3HE7C 4HF5L 3MLSH 1YEHL 4DJMA 4PJIB 1PEWA 4MJIB 1DBKH 5HYSG 1FORL 4LPCA 4F7EB 4LKCB 2EO1A 3MOQA 1R3HA 2VQ1B 2IBZX 5IF0A 1XGPB 3G5ZB 3MV9B 4UT6H 5INDB 1VACB 3V5DB 3TJHC 3OX8B 4WFEE 2AJZB 3SBWA 2CDEA 1IKNA 4JRYD 5DQ9B 5FM4A 3WXWH 4HUUB 3DROB 5ENWA 1MCOL 4OJFH 4XB8A 4OLXH 4HLZH 3HKFA 3LMJH 4H8WL 1AGDA 1BGXH 3GSNH 4FHBD 4OUUA 1YNKL 3DGGB 3DHJA 4U1SA 1J8HE 3VXMB 1XCQA 2E27H 1BLNB 2M2DA 3V4UH 3SKNA 4QNPF 4PJEA 1EDQA 3BSZL 4KUZL 4RGNC 4ENEC 4JN1H 3ROOA 2UZIL 4OCWL 1AGBA 4QCIB 3LN4B 2DQTH 1WJ3A 2VE6A 3MRMB 2OP4H 1IQDB 5HGDB 4OV6F 3EYUL 2W65A 3T65A 2D9CA 5KBNC 2L0DA 5B8CC 2X40A 3E6HB 3T4YB 3EAKA 1DLHB 1HQ4B 3BKML 5FUOL 1Q38A 1KJMB 1U3HA 43C9A 3C8KB 4XVJH 2VDPH 1X5IA 2XIDA 5D7JA 4BELD 1TNNA 4OTXL 4CL7A 3AM8C 4Z7UE 5LQBL 4Q2ZB 5EC2A 4LU5H 3HZKA 4Y4KA 4I4WB 3QZWG 4YDKL 5FDWB 3DYMA 3L3KB 1B0GB 5HI3C 1BX2A 2BNQA 3MLUH 2VIRB 4X6BA 1K8DB 4JFFD 2R2EA 4NO2B 4JM2F 4YDVB 1YMMA 2APFA 5HHNA 2EEBA 2WWMD 3K80A 4HUWB 4XBGB 4HF5H 1WFTA 5F8RC 3U9PL 5I30H 1ZSDA 4JKMA 1MREH 2BSSB 4NN7B 3P0GB 2VDQL 2VR5A 1T5WB 3U7YH 1JRHH 4KI5E 1RFDL 1J8KA 3WSQL 1IQWH 2HVKA 2B4CL 4D0CA 4KVCH 3CD4A 4FA8A 2Y1VA 3KNBA 1G6RB 1CGYA 2GQHA 5TFSL 1WIOA 5K9QI 4G9FB 1SJEB 1YNTA 4BKLB 4QKXB 4APQC 1P69B 1KB5H 1A1NA 2H26A 4L3EA 2VLRE 4FFWC 4JKLA 3GEWB 4M9OA 4XCNB 3UTZB 1CFVL 5DK2B 2D7OA 5F1IB 2QSCL 3LS5H 3X3GH 3QAZB 4ZAKD 5HHQB 5JR1L 2UUDK 1BFVL 3IDJB 1CICA 2OJZH 3L3JA 4M7LT 4QRRE 1YNKH 3SDXB 4I13B 4X9HA 3FT2A 1UM5L 4GAGH 4HUMB 1AC0A 1FH5H 4PY8J 1BOGA 2UZIH 3KXFD 3B8SA 4OCWH 2IGFL 5JDSB 1FQ9C 1CXIA 3V7AG 2NTSP 3VXUD 1KYOJ 4L9LC 5T3XD 1F11B 4UT9H 5BQ7A 1OAYL 2O5YL 3ARDC 5ETUA 1NH6A 4YO0B 3B8YA 4PRPE 1N0LA 4G43B 1IC4H 4Q6YA 3M1BB 3NZ8B 3WN5A 4JREC 3ZTNL 5KAQG 3RL2A 1EMTL 1NC4B 2H32H 2B5IB 4BZ1H 3WD5H 3UPRA 4LHQB 5CEZH 4PRHA 2E7CA 1JZ2A 1P7KB 4JY6A 4QRPA 5IWLC 4UILL 4ZMAT 5J6HA 1V7ML 4F3FB 1VCAA 2W60B 3ARFB 1ND0A 2XNAA 1T5XB 2DQIL 2X4SB 3GSWB 3SDAC 1AKJD 2ID5A 2HTLD 2CKBB 1CGWA 3IDYC 4EUPH 2PNDA 3RGHA 5FUCC 4N8PA 5B38A 5J1SC 5AZ2H 3UJTH 1KJVB 5FAAA 2O26U 2UVFA 5T1LA 5MP6H 3LEYH 4TULL 4PGDB 3WCYA 1A9EB 4XWGL 1T1WA 4X7FC 3IJHB 1MHCB 4M3JA 4XNXH 1QBML 3UJIH 1XIWB 4Y4FA 5HXMA 1QSVA 4JR9L 3MGAA 3GBNH 5MI0C 1F3JA 4KDTC 5HGHB 5IQ9B 3HS0A 2E8ZA 3M8OH 2DM2A 4HSQA 1GAFL 3SGKC 1XZ0A 5MENB 3CMOH 5ITFB 2GT9A 4G42B 4MAYB 1A9BB 2AGJL 3IJYB 5F7EH 5HGBA 1BHGA 4PPTA 3RPKA 2YR3A 1F97A 5JR1H 1TETL 1YY9C 25C8L 1BREA 2BFVL 4KK6C 1SEQH 1N7ML 4KY1H 3B6SA 2XWBA 3QUXD 5IW1A 4XNQA 4H25A 4Q6IB 5JXED 5LCVH 1EERB 4HKBA 2Z4QB 3CLFL 4KPHH 3KLSA 1DQDL 35C8H 4MB3A 3HFML 1AQDA 5HDBF 4PRNA 3NTCH 4H26B 3WNPA 3OAYH 1I8LA 3T77B 1BFOA 3VXRE 4X80L 3DV4A 3KLHD 3QCTL 1R3HB 4LCWE 4PG2A 3GRWL 1LK3L 5GJSL 1CLOL 3SDCD 5IF0B 4S1DD 5E99L 1DVFC 3N06B 3BGFC 1BQSA 5IBUB 2CDEB 2DMBA 4GKSA 3ZTJG 4MJID 1EEUA 3FFCA 1KTRL 4C4KO 1UXSA 5C6TH 5JPMA 5DJ2A 5ENWB 1OAKL 4M7LH 5C0GA 5CD5D 4FQQB 3MV9D 5CS7A 1GGYA 3T04D 1HSAA 1WEJH 2VR9A 3VD9A 1MWAL 3O4OB 1EBPA 1I1RA 5IEKA 1FSKC 3V4VL 4OF5A 2XZQL 1ZS8A 1JJUA 3SKNB 4V2BA 4TQEL 3ARTA 2QKIA 3SDDC 3ROOB 2Q7NA 3LPWA 5EZIL 5CILL 1AGBB 2HJLA 3CMGA 2ZNWA 2VE6B 3GK8L 4OF6A 3OAZH 2W65B 3T65B 4PRIE 1U91A 5KW9H 1U6AH 3MV8A 1F4WH 2QSVA 2C3HA 3P30L 3VXMD 3AREB 4ZFGL 3U0TA 1IKFL 1U3HB 5EU6E 1LO3L 2V9TA 5D7JB 4ZS6D 2EDYA 4GXUM 3T0ED 1GAFH 4C57C 4KTDL 5EC2B 4K3DH 5KSAA 3HZKB 1N2RA 1XR8A 3NGBC 2D7PA 4FNLH 3CDCA 4RAHA 2BNQB 3Q1SL 4HAGA 3LPGA 3WO4B 4RDQG 2R2EB 1ZLWH 5DHYB 3LPFA 2C9AA 3ZE0E 2CO6B 1MCDA 2A9MH 1SBSL 5HHNB 3MNVA 1N0XH 1DQDH 1JF1A 5E5UB 4E41E 1NEUA 1FC1A 1A7PL 1ZSDB 4CAGA 5HYEA 3U0WL 2C3VA 2CRYA 3MLWL 1K6QL 3KPPA 4K3EH 3SJVE 4UTAH 4I8DA 3SDXE 3FQNA 4YC2C 5DMKA 2QQKH 3F62A 3O6ML 4P9HC 3RDTA 5B4MC 4G8FA 2HVKB 4YEFA 4H0GA 4L8CB 4D0CB 2VDKL 2DLFH 1A4JA 5HGAA 3ZKSD 3DHMA 3MGTA 1RZKH 3AFLA 1U9KA 4YQXH 2N7BA 1A1NB 1X9QA 2H26B 2HVJA 2HT4D 4HPOL 4L3EB 2V5SA 5D2LF 1HHHA 1F4XL 2D9QB 3VFMA 2X1OA 4RFOL 4EDXB 1CICB 2BVYA 5KZCB 4JHBA 3L3JB 3VFVA 4L4TA 5HYJA 4B50A 4G9FD 1LEKB 3FT2B 5L8KB 1FFRA 2H6PA 2HG5A 1D5BA 1MCIA 3RIAF 5CJ8A 3T0VA 5TH2A 5J13B 5DMIH 3PP4L 5SWQA 1FGVH 5GHWH 3FT3A 1DR9A 1KCRH 3VFNB 5I1CH 1IGYA 3GMQA 1W72L 4LFHD 4JVPA 1BECA 2P4AB 4IRZH 5BQ7B 4D0BA 5ETUB 1R5WB 4S1QL 3RA7L 5GRJL 3X13B 5JOPD 3PF2A 1G1CA 1A3LL 2KL6A 2OS7A 4M00A 1ZOXA 3WN5B 3BDXA 3RL2B 2Z91A 4LSSL 2WQ8A 3F6IA 4XP4H 3UPRB 1DDHA 4TSBH 1JHLL 3ZYIA 3ROLA 1X5FA 3KPNB 3V52L 4YDLB 4JY6B 4QRPB 3PWLA 3S35H 1F6LL 2F58H 2IQ9H 1ND0B 2XNAB 1ZEAH 2BVPB 1BQUA 4MSWA 3IETA 4P59L 3ZHDA 2DLHA 1NC4D 1I1YA 1OF2B 3B43A 4Z7WF 3U0WH 5B38B 4U1JA 4R90H 4J4PD 1Z3GH 1P6FA 4WI5A 5DDHA 3QUKA 5E2UH 5T1LB 2P1YA 3WYRA 3IGAA 4P2OA 5DGRA 4DK6A 4WDIA 2Y36H 3ARFD 3NN8B 5EULV 2P7TA 1QLFA 3WIIL 4X5XA 3VFSA 1UCTA 1A7OH 3WIFA 5I6XC 4Y4FB 1IGFL 4YHNA 1LE9B 1FPTH 4ZOAA 4PJXA 3HS0B 4NQTA 1TJGH 5SWSA 2CMRL 5ALBL 5T5FL 3VXSE 4BSVA 3MNZA 1YEFH 4K23H 4XRCA 4DGVL 1T04A 5HGBB 4Z7UF 5CSBA 1HH6A 5C09B 2V2WA 4TYUA 1JZ4A 3A67L 1M4KA 3L5XL 4JM4L 3MBXL 2J88L 3HPJA 3EDJA 1XIWD 3B6SB 4XNZB 2VDOH 4LSTH 4PJ9D 1GXEA 1FZOB 4UIKL 5A2LH 2P24A 4HKBB 1JWSB 3B3IA 5MEND 4CJ0A 2PW2A 5ISZE 4MAYD 4PRNB 3PWVA 2F5BL 3S3PA 2EDRA 1BFOB 1BOYA 3JSSA 3DV4B 2WWMC 4UINH 3UYRH 1N26A 2YD3A 3BWAA 5KS9B 4G6AD 4O9HH 2X4UA 4U1IB 5C0AB 3NA4A 1FVCB 4OI8A 1CGXA 2EDJA 2ADJA 2ARJA 3AS1A 4GKSB 4U6VH 2J6EH 3KYKL 3FFCB 1UXSB 5JPMB 5DJ2B 2IALA 1H3VA 1XF1A 2XYCA 5JW4N 3R0NA 4FP8H 1MFDH 2EIBA 1J1XL 5GGTH 4NJAH 1G1YA 3MX0A 1RUPH 1XGRA 5D6DA 4PRDA 3ZKQD 4N8VB 4MA1B 4WO4A 5FDYA 2F8XC 5F70A 4ZAKC 4HWUA 1FLRH 3EHBD 4FOMA 1IGIL 3BAEH 4CU6A 5LXGH 4RWYL 2QKIB 5ITBL 1NC2A 2E7LC 3P9LA 2DBLH 2HJLB 1QBLL 1BF2A 3LDBB 3IXTA 1KLUA 1AQKH 1U91B 1OVZA 2BJMH 2XZCH 3MV8B 1XFPA 4C58B 1D9KA 1RIHL 5LG1A 1X5XA 4CJ1A 4LLAA 4CN1A 1YECL 5IFAL 4ZYKB 3TBYA 5HI5D 5BOPA 3B5GA 1RQ5A 2XN9E 4WFGD 3W2DL 4EXKA 1KF9B 4LVOB 2IF7A 1T2JA 1NCBL 3BE1H 2OI9B 1BVKA 4GAJH 1N2RB 1XR8B 4TRPL 3L1OH 1B4RA 3ARPA 1NUGA 7FABL 5I1IL 1UT9A 5GS0L 2R0ZH 1KB9J 2VXTL 4P2RE 1U3HD 2WBKA 4PJGE 5CJXC 5IB4B 4MCZB 5D7JD 5DD0L 5F7MC 5BV7H 5KAQF 3MNVB 1XF3A 4JG1H 1JF1B 3NCJL 4NM8L 4R2GB 4ZUUA 2C1OA 4R26H 5KJRL 3CZFA 5JA8B 4Y4KD 2O5ZH 4QHUA 2UUDH 5DJAA 1A5FL 4RMSA 2R56H 4PLOB 2A6KA 2BNQD 3KPPB 3BPOB 3GNML 3CFKA 5TDNB 5B39B 5LAXA 1V8HA 2HTLC 2AEPH 2FH6A 3FQNB 1FVEB 5DMKB 5EOCH 3RDTB 1YMMD 4G8FB 2OL3A 3T0AA 3L5HA 2P8PA 3UXFA 4LGRB 2GKIA 1CE6A 1A4JB 3TBVA 4YFLF 2I9LA 5DJZB 3MGTB 1TITA 4AJ0A 2BZDA 1MFCH 2IADA 4Q9RL 2OCFD 1PZ5A 3JTTA 2HVJB 5DD6A 1G84A 1S9VA 4HWBL 1GGUA 4RAVA 5KG9A 4Y19A 3CFEB 2V6HA 1EUTA 1UCBH 2LTQC 4JFHD 3GSVA 5HYJB 3OKYA 1SVZA 4H1LB 3LQAH 3V0WH 2H6PB 3RRQA 1KJ3L 1V3LA 2W07A 4L3ED 1Z6JT 1CTNA 1D5BB 3VW3H 5TH2B 3TYFA 5HHVH 4MA7L 5EZLA 5JXEC 5D8JH 5SWQB 5DF0A 3T1WA 4M93C 4OQTL 1INEL 1NGQL 1AXTH 1CI5A 5I73B 2BNRA 1CICD 2K9UA 5KZCD 2UWEE 1IGYB 3GMQB 4KAQH 1JWUB 2R69H 5CUSL 1I8MA 3MTRA 1YJDL 2CK2A 1WFOA 1NCNA 1SYSA 2VXSL 3KPRA 4D0BB 3KLHC 4R8WL 4FZEH 4WENB 1T0NA 3CPLB 4Y16B 3SDCC 3OTTA 3MJ9H 4S1DC 1U8LA 3LD8C 4MYWB 2Q8AH 4JGUA 2R0WH 4J3VA 1MCFA 1BD2A 1WBXB 1MSPA 1DDHB 5I1IH 1F58L 3HC0A 2NR6D 1JFQL 4MJ6A 4M7JH 1FJ1A 2V2TA 3WUWG 3PWLB 4U4BA 5JIHA 5CCKH 5CD5C 3NCJH 3UTPE 2JJTA 4QF1A 5CP7B 4MSWB 3IETB 4U49A 4RMVA 3AY4C 4N5ED 4YXKL 3UO1H 5FXCH 5MHSD 1U3JA 5C09E 3SO3B 1YQVH 3VG0L 4PRHD 3TO2A 5DDHB 3VH8B 4QRPD 3QUKB 3F5WA 3FQWA 3IGAB 2W9LA 4WDIB 1U8IA 2P7TB 1KELL 1QLFB 1U8MA 2JCCA 4X5XB 4XPBL 3VFSB 2AXFA 2IPTH 5DYOA 3WIFB 1QBAA 3E8UL 5EUOA 4HBCL 3X11A 1RJCA 4TVSa 4YHNB 4EJ1C 1E4KC 5SWSB 5F1OB 4MQ7A 3UZEA 5EPMA 5T1LD 2Y4SA 3HRZA 4HWBH 5KS9E 1FRGL 4NQDA 1NEZG 2MKWA 4ZS6C 4GRWB 3T0EC 2V2WB 5C0AE 2A83A 4X8JA 3R06A 3HPJB 3C08L 4QHLA 5IROC 4Y4FD 5CINH 5FM8A 5IBTH 2P24B 1ACZA 1B90A 4DKFH 3B3IB 1UENA 4S2SA 1IC1A 2PW2B 2PTTA 3WJJA 1FAKT 4M6ML 3PWVB 4GMTL 1XAUA 2VSCA 1NGQH 4EIZC 3ARVA 5HDLA 1NGZB 3GO1L 3BWAB 4HGWA 3LIZH 1QSFA 1CGVA 1YJDH