2ID7A

1.75 a structure of t87i phosphono-chey
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
127
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title The structures of T87I phosphono-CheY and T87I/Y106W phosphono-CheY help to explain their binding affinities to the FliM and CheZ peptides.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 44
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2id7A00
2XDYA 2JVIA 3DBIA 3SNKA 4EYGA 3NHMA 4S05A 4Z9AA 2HJ9A 3QK7A 1D1QA 4KNYA 1NTRA 3N53A 1FFWA 3Q41A 4G0QA 5ED4A 4YLEA 3F6PA 1MVOA 3CU5A 3KYIB 4Q6WA 4L4UA 5TPZD 3RVKA 1ABFA 3MYYA 5GOTA 3P9YA 4JB2A 1JFTA 1QPZA 3LMKA 1PNRA 4RY9A 4LE1A 3FMVA 3MIZA 1LJLA 1RXEA 3BILA 2FQXA 4KK3A 3CG0A 3H1EA 4YS6A 2E4VA 1EWTA 4OBBA 1ZN2A 2L17A 2W42A 2B1JA 3R0JA 3A0RB 1QMPA 3N0XA 4ZMSA 1FSPA 3RVQA 1SXGA 2JK1A 4Z4EA 3C97A 1Z17A 4WUTA 2LIVA 4Q6BA 3L49A 4WT7A 3QX9A 4H3HB 1NXVA 3UKJA 3O21A 2GI4A 4MQFB 1LJUA 1DJMA 1BA2A 1FFGA 1W9HA 3HUTA 3JVDA 3TB6A 3G85A 5KQGA 1MB3A 3OLWA 3H5IA 3H5LA 3HCWA 3QLTA 3EULA 4G0XA 1K66A 1C0EA 5HKOA 3JPYA 1DCKA 1QP7A 4Z4CA 4RKRA 4MR9A 1GCGA 3GRCA 4JB0A 4D74A 3HS3A 4Y9TA 1YVUA 2WRZA 1C4WA 1PUXA 4ETNA 3CHYA 3N75A 5JS2A 3KYJB 2M98A 3CNBA 2IPNA 4NV3A 2PAFA 4OG2A 3RVRA 3Q7TA 5FWYB 2FMIA 2QW1A 4KK4A 1NXWA 3HUUA 2GBPA 3L6UA 1APBA 1YS6A 2QR3A 3NNDA 1I3CA 4PYRA 4EVRA 1JBEA 2PJUA 3H5VA 3NBMA 4XASA 3IP7A 4L85A 4TN5A 1TJYA 1M5TA 4N0QA 2PUAA 3H6HA 5EWLA 5D2CA 2PLNA 4EVQA 3MMNA 3Q7RA 5B3JC 2P4UA 2I6FA 5IC5A 2R48A 3NNSA 4RZSA 2L2QA 5DCLA 4RXUA 2X7XA 2JVKA 2HQBA 3JY6A 1QKKA 4XXHA 4MS1B 1KMIY 3DLHA 1QQAA 1S8NA 4W5RA 9ABPA 3VNAA 4RXMA 3T38A 3TX6A 1Z2DA 5PNTA 1KRWA 4MS4B 3K4HA 4JOQA 4Z4FA 5EWMB 1JL3A 1EFAA 4QPJC 3UUGA 5TPWA 3QEKA 1DCMA 2L19A 3RVNA 2E4YA 2FN8A 2FSPA 4E7OA 1TVMA 3BREA 1ZESA 4ZYLA 8ABPA 1BVHA 2NZVG 4EGSA 1PEAA 3LUFA 3OQNA 1EWVA 2QV0A 1ZH2A 4YV7A 1A2OA 1JHZA 3GYBA 4YP9A 1IIBA 2N9UA 1FQWA 2FQWA 1PHRA 3OMWA 2MYNA 1VLZA 3CZCA 1P6UA 2WB4A 1VPWA 3CFYA 5EWJB 1XHFA 2HQRA 2WJWA 1USIA 1QNLA 4PICA 1P8AA 1L5ZA 4DN6A 4IILA 5CNJA 1D1PA 1OXKB 1ZITA 1EWKA 1U04A 3IP6A 2ZWMA 4HNSA 4RY8A 4EYQA 4KFCA 4KREA 2QSJA 3OO1A 3JVIA 3HO1A 1U2PA 2V0NA 3IP5A 4TLLB 1Z12A 5JNVA 5TQ2B 1YMVA 5FWXA 4QYWA 2PL9A 4WZZA 5T7BA 1U8TA 2FMKA 2IYNA 3SG0A 3IP9A 4Z9BA 3DGEC 2FEKA 2ZAYA 1NXSA 3KG2A 5F64A 3LUHA 3JTEA 3O2SB 1QO0A 1DBPA 2FVYA 3LUGA 3I42A 2FN9A 4ZPJA 1P2FA 2QZJA 3QEMB 5IEJA 3A3KA 2VYCA 3SM9A 6CHYA 2VUHB 5HM6A 1YS7A 4RKQA 4ETMA 4WWHA 1E2BA 5C5CA 3ROTA 1ZHHA 5HQJA 5JNTA 2P9HA 4ZJPA 3EODA 4YWHA 2PKXA 5JNWA 3RVOA 4G86A 2OQRA 2ID9A 5ABPA 4KZKA 4NCAA 4W5TA 2FXIA 1NXTA 4Z4GA 5B3JA 4RK1A 3C3MA 3S99A 2HSGA 3KJXA 5IEBA 4IGAA 4F8JA 3F7NA 4RXTA 5JS1A 4MQFA 5IX8A 3QELB 3O1IC 1JF8A 3URMA 1SXHA 2QXYA 1Z15A 1M2FA 3LKVA 4MPTA 2IKSA 1PEYA 4KQ9A 3C6QA 5KQMA 1T34A 4D6XA 1RZRA 2IPLA 3FGZA 4CBVA 1A0OA 3KHTA 2NZUG 3GBVA 1BDHA 4N41A 1SD5A 4PZ0A 2OENG 4YCSA 3OMXA 4YO7A 3Q7SA 2B4AA 2RJNA 4F06A 4P1ZA 5CNMA 1BAPA 3EQZA 2JBAB 4TMYA 3EAFA 4G0ZA 1NY5A 4KVFA 4YR7A 1U2QA 4WXEA 2AYZA 3TO5A 5FWYA 5TQ0B 2MYUA 4Z0NA 4NICA 3M6MD 4MR7B 1MIHA 4S04A 1WETA 1GUDA 1DCFA 3RVMA 3OQMA 1R8JA 2MSLA 3CLKA 4GNRA 4HNRA 1USGA 3FFXA 3O75A 1D5WA 4YRZA 1QO0D 3HZHA 1ISSA 5TQJA 4DQDA 4W5QA 3W9SA 5KQLA 1GLGA 1JFSA 1RNLA 4Z4IA 2E4UA 2NUBA 3Q15C 1DG9A 5DLEA 3KS9A 2E4XA 1SXIA 2JRLA 2YHBA 4G0PA 3T95A 4B09A 1MB0A 2F8SA 2TMYA 3GT7A 3O74A 4O1IA 1A04A 3CRNA 4MS1A 1KGSA 1XWWA 5T3YA 3N0WA 3QLUC 1DBQA 5IULC 3O2QB 4FE7A 4MRMA 5KQPA 4YGXB 1DC7A 2LUOA 3HDVA 2M1ZA 4UHJA 1EAYA 4N47A 3MQ4A 3LOPA 4MS4A 1NXXA 4MQEB 2PUFA 5BQ3A 1ZY2A 3HSYA 3MF4A 1B00A 1NXPA 3H1FA 3A10A 3SQNA 1L5YA 1VRVA 4H3KB 1QP0A 1ZAYA 3TMYA 4IMIB 1CHNA 3RH0A 4MR8B 1QP4A 2CHEA 3CTPA 5EWLB 5IUJC 3HDGA 4LDZA 1Z25A 3FFTA 4RK5A 4MS3B 3HXMA 2WWVD 1RXIA 2H3HA 1JDNA 1ABEA 2QU7A 2IDMA 4F3TA 4XAQA 2R4QA 3LUDA 3H6GA 2FTKE 3EDCA 1GCAA 1RZRD 1MAVA 3A0UA 1SRRA 3H5TA 3LKBA 3M9WA 4M88A 2CWDA 5EWJA 1URPA 4TLMB 3KLOA 5JNSA 4LRQA 1VKRA 3BBLA 2FMFA 2FEPA 6ABPA 2PUBA 3N0RA 3FFWA 4MAAA 4HYEA 2J48A 4LDAA 1D4ZA 2RGYA 4O5AA 3HV2A 1Z26A 5TQ2A 2BGGA 4ML3A 3I45A 1DRKA 2FMHA 7ABPA 2MYPA 2LBPA 4ETIA 2A9QA 2JB9A 1TM2A 3DGFC 3LFTA 3IDOA 2F8TA 3C3WA 1Z18A 2PL1A 4O1HA 5HSGA 1F4VA 4IF4A 3RVLA 3GBPA 3LUKA 3IPAA 4XLTA 3BRSA 1LBIA 2AYXA 1J56A 4JASB 4HNQA 2FEWB 1LBHA 1YK0A 5DGCA 3OM1A 5FWXB 5KC8A 1JX6A 4XFKA 4KPYA 1W25A 5BRAA 3BRQA 2A9PA 3DLBA 3I5AA 5TE9A 1M2EA 3C3KA 2VUIB 1NXOA 3I09A 1TMYA 4LZLA 2QVCA 5IUKC 3H5OA 3LTEA 3DZDA 1DRJA 1Z13A 3QLUA 4GPAA 5CNKA 2A9OA 2L18A 4RK7A 1BDIA 4XARA 3OLZA 5DTEA 3QELA 4N03A 5KWSA 4G97A 4PE5B 3HM9A 1JH9A 4RSMA 2KYRA 1JFVA 3FDFA 2DRIA 1XHEA 2RJOA 5I4CA 1ZGGA 3O1HB 2WJAA 3T8YA 4MYRA 4FB4A 1DZ3A 3OO0A 1M5UA 3HJFA 3OQOA 1Y1LA 3H75A 1ISRA 1K68A 3KSMA 4RK4A 4Z99A 3T6KA 3G1WA 3ILHA 3HK2A 3CZ5A 1F51E 3D02A 2O20A 3QLVA 4MLCA 2JBAA 1E6KA 1QQBA 5KI6A 1U0SY 4QICA 2PMCA 2QVGA 4W5OA 4RS3A 3E61A 2MSKA 5TQ0A 3UK0A 2FW0A 2HPHA 3KCNA 4MR7A 2IPMA 3RQIA 1FFSA 3JPWA 3GL9A 4LX8A 2GKGA 5GQSA 4EVSA 3LUCA 4WXMA 3H5WA 3VNBA 3E3MA 3QX8A 4D6YA 2PUGA 2JVJA 4JAVC 3OM0A 2IPAB 3HVRA 5JNUA 2CD7A 4P98A 3GA5A 1USKA 2FLWA 3ILYA 2PUEA 4LE2A 4NCBA 4FE4A 2GWRA 1GUBA 3KTOA 4IRXA 4MR9B 2FQYA 4OATA 1BDJA 4QYMA 2FKAA 1LK0A 4EUKA 4MGEA 2PUCA 2NT3A 3GV0A 3H1GA 3HEBA 1AB5A 4OLAA 3MA0A 4E7PA 4LE0A 1JWLA 5DKFA 1ZDMA 1YIOA 2IOYA 4MQEA 4MLDA 4Q7EA 3RVSA 4UHKA 1DC8A 2FLKA 2R25B 4G0OA 1CEYA 5EWMA 4G0YA 1E6LA 4OTZA 2WMYA 1Z2EA 3TD9A 2Q5CA 4N0PA 5FBKA 5E3JA 4EYOA 4KQCA 4W5NA 4MR8A 1ZGZA 5C5EA 2JCGA 2RDMA 4RDCA 1PNTA 2MSWA 2ID7A 3N6VA 3QLVC 4MS3A 5BRJA 1TLFA 2E4WA 5TPZA 3M9XA 2H0AA 5FBHA 2PUDA 1H9CA 4NQRA 1KRXA 3OLXA 2LPMA 4RK0A 3CS3A 4RU1A 3Q9SA 4MRMB 5CNIA 2WY2D 4IMJB 2MYTA 4RK6A 4RY0A 3RVPA 3B2NA 5IBQA 3EJWA 4RWEA 3EQ2A 3CG4A 1JLKA 3K9CA 4RV5A 3F6CA 2CHFA 4Z4HA 4N76A 1UDRA 2A9RA 3KKEA 4KMRA 1ZVVA 3LUAA 2GX6A 5TPWB 5IUNC 1P6QA 3OLYA 5JNRA 3IPCA 4JP1A 1JYEA 5BR1A 1JYFA 3F73A 1YK1A 1DBWA 3D8UA 3MM4A 3ROFA 3SY8A 4EY3A 2NT4A 1AB6A 2E4ZA 2R47A 3EGCA 3NNNA 3OLVA 4JA2A 2HQOA 4OLBA 4G0MA 3O1JC 1Z16A 4F11A 1HEYA 1OXBB 3LUJA 4ZMRA 1CYEA 3SAJA 1ZH4A 2PE5A 3CKMA 1YTUA 2VK2A 1NATA 3QEMA 5CHYA 3KLNA 1E6MA 3JS5A 1YMUA 4KRFA 1DP4A 1RPJA 1EHCA 4H60A 3RVJA 4F12A 1D2AA 3N8IA 3NHZA 4KV7A 5KC9A 3GWGA 2LP4Y 3O2JA 4PEVA 4DADA 4EYKA 2YHAA 1JDPA
chains in the Genus database with same CATH superfamily
2VOJA 4CKEA 1HKHA 3R9KA 3C8MA 4HWPA 1MDFA 1K2WA 1V41E 3O0DA 5J4HA 1EESA 1KZ9A 1KTVA 1BU8A 3IAM6 2DH5A 1S2GA 2QAGA 3IIEA 1G20E 3HJUA 5KOJA 4XYLA 4QEZA 1GA6A 4KE8A 2EZUA 4G0QA 4EHAA 1KI3A 4X00A 3ADCA 5JCXA 1MVOA 5C18A 2MSNA 3OEHD 4M9CA 2ANBA 1MPTA 4WTOA 2WEKA 4BHTA 1CQPA 1E60A 3A2LA 1YA6A 3FR8A 3MCAA 4J16C 1N8KA 4R16A 1MABA 1ZN8A 1TMKA 2VATA 2HDWA 1P0FA 2VDNB 4HNAB 2P35A 1MVLA 4OMFG 3DT6A 4Q47A 4RX1A 1I1HA 2H2AA 4YY3B 2G09A 3CEPB 2C4WA 2VBGA 3AF4A 3OT1B 5A04A 2YXNA 1XSEA 1UC4B 3O92A 2PTHA 4V0SA 1ZA2A 3HN2A 1B8VA 2LTAA 4MHSA 5CVJA 5DGTA 5CA0A 3LC0A 2P4SA 4GMKA 4NP6A 1UEIA 3AHCA 4J49A 4KE9A 1VSBA 1BE0A 2ETVA 4DREA 1XJQA 2GI4A 5HF9A 5K45A 4TV9A 1ZMTA 2ZZKA 3FB4A 4RPKA 4WVLA 3FTQA 4H4CA 1P0MA 2R1VB 4OHPA 3L4JA 1IC6A 1IONA 1GUYA 1E20A 2GSDA 5F51A 3EXG2 1DCKA 1Q0QA 1R16A 4I55F 4IX9A 4PO8A 4D0SA 3K1ZA 1QFJA 2WU3A 4O0LA 5FR1A 1T24A 4MDFA 3BHIA 1DINA 5C8YF 3R7LA 1K6MA 4G85A 4Z7NB 1AQNA 3CHYA 5LQKA 1TA0A 3L6CA 1D1SA 1G42A 2WTXA 1UAGA 3F4BA 3U3XA 4YV0A 1DPGA 1HGXA 2REOA 3DCJA 1X9HA 2CFSA 4ZVTA 2P30A 3JZDA 4B48A 5JCOA 2QUJA 1SPBS 3DM5A 4CMJA 3NOQA 5FI5A 2PD4A 5HFJA 3D7MA 4D92A 3ZV5A 4J90A 1W5AA 3IRUA 3TG2A 3PZBA 1OASA 1JWAB 3NNDA 2WUDA 1E1RD 4N6NA 1L2TA 2QPOA 3BC1A 3NWPA 3G0CA 1TQ2A 1DSSG 2ZUEA 2P41A 1NVGA 1UQUA 2BGLA 3ZI7A 1C7IA 2XUHA 4AJLA 3IERA 2KBEA 2GPWA 3JQDA 1DAHA 2FSUA 3FG9A 1WQ1R 2ZEJA 1NOKA 1XEFA 2HQBA 3OKPA 2V0CA 4MUFA 2PU7A 3ZTWA 3ODGA 4QDOA 1Y42X 1W19A 3KM0A 4C4RA 1W2HA 3E22B 3T38A 5MF6A 1YFJA 2ZPUA 4LJYA 3Q3EA 1VP9A 4JUDX 4U02A 1PFVA 2GJ9A 3K4HA 4JOQA 4JUBA 4MPDA 4X6UA 3E2IA 5AVJA 3VR6D 4CN8A 5C7LO 3T99A 4KR3A 1YBMA 4D0RA 4IIJB 4TXLA 2E4YA 2OGUA 4NFSA 3OOHA 1X9IA 1PLLA 4E7OA 1J8MF 4OJTA 4DLKA 2H1OA 1XRRA 2HV8A 4WN3A 4U2CA 1ZESA 1G59A 1EUCB 4GM1A 1U7WA 4YDHB 2Q28A 4ENTA 2FEXA 2ZQYA 3WXBA 4DWOA 3VR3A 1A2OA 1RAFA 2ZE5A 2RGUA 3GYBA 5LXTB 3AL2A 1P7YA 1MOQA 2QN1A 4B31A 1XQ6A 5E4JA 1LV8A 2YNMD 3ZXUB 1ZJ5A 2ZB7A 3KQVA 3OF2A 5HF8A 1G3UA 1TC1A 2WB4A 5IC4A 4UDXX 4MROA 5TEVA 4YHHB 2JAOA 3EY9A 5T6BA 4M0MA 2HK6A 3N59A 3EWAA 2FVXA 3I23A 1E62A 2P77A 2ZBPA 4IG9A 3RBVA 4BKPA 3ES9A 3B7PA 1Z6QA 2CMHA 3GWZA 2EG9A 4I2VA 3L6DA 3K30A 4TMKA 1MTZA 3RB8A 3IP5A 5JVDB 3BFKA 1KEWA 3W2IA 1CP2A 5TQ2B 1VC2A 1WXIA 1AUPA 2WD7B 3AESA 3WL3A 4IH4A 1CZHA 1GTVA 5AVTA 3IB3A 4BNLA 1V25A 2HWUA 4Z9BA 2JHFA 3DGEC 1ZHFA 3AZOA 2HCJB 2ZSHA 2N46A 3EVNA 3LWNA 3M82A 4MW9A 5CJPA 3U4QA 2X15A 5AK6A 3S8EA 4PLWA 1ZW1A 2MU1A 2FHPA 3CCFA 1QH0A 3DNFA 3BCRA 3DDNA 4ZPJA 4QECA 1WPRA 2HRRA 1SNYA 4BO4A 4UEOA 4RFSB 4OB8A 4BFYA 3B2QA 4ZZ1A 3FCCA 1HDZA 2IBTA 2CL7X 4INJA 4OH1A 4F91B 5JNTA 4UMEA 1B6SA 1N1EA 3FRJA 4YRLA 2JLYA 1I30A 1N1DA 1Z5GA 2CF6A 1MX5A 5JNWA 1GR0A 2Q21A 4TTIA 4U2GA 5EHQA 4ZYTA 1SEVA 1XMQB 1JS1X 3PT9A 5ABPA 3TUIC 3MG9A 3D2AA 4XQEA 2WIBA 3Q3HA 4NWIA 1WMDA 4Z4GA 1NVWQ 5MFPA 3ICVA 3B38A 3U3OA 1VHWA 1OGYA 4I1YA 1EX7A 2PH1A 2Q5HA 3KR1A 1BMFA 3OE5A 4PLCA 4Q05A 3V4FA 5IAKA 2G3YA 1QHXA 3R76A 4DXDA 2QJWA 5EE9A 4GGMX 4TWZA 3ZE9A 1BJTA 2P0AA 3O8QA 1I5RA 3L92A 2R7MA 2HADA 1W4BA 1KQGA 1LDEA 2I65A 2P9YA 1E8NA 4ND8A 3GDOA 3WADA 1K7FB 2VRBA 5A2GA 1A8IA 3HWRA 1ZUHA 1Y6GA 4WPGA 3X1ZA 3I6ZA 5CA0F 1BKYA 4N40A 1F7VA 5T4HA 5J2UA 5CK5A 1QS0A 3FY4A 1MJNA 2X40A 2PSDA 5KAPA 3WK9A 7ADHA 3IIIA 3UA4A 1W85B 4MTCA 5K3EA 4DY6A 3V3KA 2C9YA 5SYAA 16PKA 2C2XA 3WO1A 2X0IA 4TV9F 1VJ0A 5L6MB 3DE7X 4RM3A 2JA1A 2WB2A 2R96A 3DKPA 3WWCA 3GFRA 1GEEA 4I6GA 1LVUA 4C0HA 5BPFA 5JROA 1W0KD 2Q0XA 1V8DA 2VH2A 2XMZA 2J08A 4LOAA 3U7JA 1AT1A 2BGRA 1AKNA 2I3GA 2JJ2A 5FL7A 3L0CA 5TQJA 4PWYA 1MG0A 3HU1A 3W9SA 2PGDA 3T7DA 2CVHA 2KE5A 3NAQA 1EDDA 3A36A 3CLSC 2QD4A 3KXDA 1B15A 1QYRA 2P1ZA 5KX5F 5BWBA 4FMBB 3HYSA 3GT7A 3V7YA 8OHMA 4BN5A 1LFAA 4RD0A 2BI4A 3DR5A 4JLPA 5IJZA 5JAZA 5JYCA 2V1UA 1QCZA 3V8PA 1QF6A 1JKJA 2J3KA 3THSA 1O54A 3ND7A 5CTAA 3GLUA 5LKRA 2B8TA 2VHWA 2O2ZA 3OPYB 4C3VA 4V0QA 3TDNA 1NBWB 2D8MA 4YBRA 4ZANA 4RGQA 1Z47A 3WKCA 4C05A 3MTIA 1ZY2A 1LGYA 4YC7A 3E8SA 3ODPA 3UUWA 5H02A 2GF9A 1FLNA 3MJFA 4QDZA 2XTAA 4PQGA 1UK7A 4HFNA 5IJAA 4KR2A 4BU1A 5IF9A 4M8LA 3LRTA 3B1JA 1PD1A 4YQZA 3EYAA 4MA0A 2CEAA 3H18A 4IYRA 4O8ZA 1XZCA 4L9WA 4U63A 1CUHA 1RWKA 3FH0A 3K05A 3KZMA 4MYSA 4R9RA 5AHWA 4WUVA 5LOVF 2CV1A 3S81A 3SZ3A 3AJAA 3FFTA 2HWWA 1ZH8A 4INAA 1P4HA 1Y8AA 2XDQB 4B71A 1ABEA 3ZGLA 3LUDA 4DCOA 3MS4A 4J1SA 4HGZA 5A7HA 1HT2E 1DVRA 1L5RA 2GZ1A 1Y3IA 2PS9A 4RL6A 4EFKA 4XD2A 1MOZA 2IF0A 1P3DA 3F6BX 3KSAC 4J1NA 1GITA 5GJWC 3AR8A 3N8HA 1A50B 2FMFA 4N0EA 3MILA 3JQAB 3JD1A 1JALA 5DNVA 4JLMA 2KLBA 4MLPA 1FNMA 1SQ0A 4IMPA 2QZZA 5EYPA 3GLIE 1OF1A 2R7KA 3EDYA 1O77A 4MQMA 3V4PB 4C7MA 5JMTA 3IDAA 3L84A 4DAOA 1XP8A 3H2HA 3EMKA 3MD0A 2W90A 4W6ZA 3MRSA 3U80A 2A4MA 7ABPA 2Z5GA 5H7XA 4EJMA 5ALPA 3I4LA 2PO7A 4Q19A 3V1KA 2Y76A 5JZVA 3HB7A 3BH0A 1A98A 3IDOA 1FZTA 1RAHA 2P3SA 4ED9A 3DWFA 1PZNA 3L93A 2VPYA 1EDBA 5KJCA 1XYGA 3WBFA 1CUFA 3LUKA 3Q6IA 2WHPB 4MUGA 3TLZA 3M6FA 2HBQA 2JGNA 4Y6PA 3BRSA 1Z4PX 4ZVPA 3AINA 1ECJA 4G5HA 4WXYB 1OBHA 3B53X 1XJWA 3LY8A 4WFJA 4Y30A 5AOVA 4BKRA 3P27A 2RD2A 4PQFA 4KPYA 4UU7A 2WYIA 1ULBA 4HPXB 1W25A 4XFKA 3NV9A 5C4GB 4ZYZA 3FNQA 3ZHXA 1SU4A 1SVIA 3IIKA 4AYWA 4NBKA 2ZI9A 1BWSA 1M7HA 1WZUA 4LJ9A 5BWCA 1BDMA 3W5CA 3QXSA 1IBSA 5LWQA 5JXHA 3D31A 4B2PA 4IY1A 1QANA 5LZ4A 3H0KA 3U37A 5LWHA 2L18A 4JJZA 4B8ZA 3PJDA 1EZZA 3V1LA 4G0NA 4UASA 4G8DA 1NMXA 2J3IA 1JR6A 1J2UA 1H4QA 4Z0HO 3ND9A 3OQJA 4R51A 2YWEA 3SIPA 4B3TB 3HHEA 4KLCA 3MIIA 1CB7A 1BJRE 1Y9EA 3TQQA 2VEDA 3KJHA 4LHEA 3BSYA 5B2EA 1T0HB 4RPCA 1CR4A 1DDGA 2XMSA 3TQTA 5FPQA 1TF2A 3QE4A 4DSTA 3JWGA 1T25A 2HUPA 3OJEA 4DA8A 3P2IA 3B3GA 2O50A 2QPAA 2W93A 3IUSA 2AFRA 1DRVA 1XRSB 4IWXA 5LQNA 2CT8A 5B58C 3T3GA 3TUJC 4FLEA 2IELA 3U16A 2IEBA 1EVJA 2EQAA 3DDWA 1QKJA 3OH8A 3ZE6A 1V3TA 5BSGA 2RE8A 2ZYVX 4WZBA 4AN0A 5L53A 4B4DA 1P5RA 3BG5A 3G2NA 2RHBA 5ICMA 2ZBEA 2IHKA 4MPRA 1W88B 3EA5A 2IYOA 3CBQA 3EBLA 2GF0A 1J1ZA 2ZRJA 3HRIA 1QCYA 2JVJA 3W7AA 4QG3A 4AJ9A 4DFDA 1JXQA 3DEIA 3F7MA 1V8OA 2XAAA 5CB4A 1SOAA 4AULA 2KS6A 1B3RA 4HD8A 5J2UF 2PD6A 3MFQA 5E0OA 4DMMA 3WWYA 5F23A 2NX2A 4NCBA 1GKIA 2HNBA 1ZINA 2H5LA 3KKPA 4F9GA 2XZPA 2O2DA 3F9IA 3WDLA 4E31A 4GVLA 4F5WA 4H1VA 2B6NA 3TRKA 3GH1A 2GRAA 3AI2A 4GICA 2BFFB 3A28A 1FPMA 3HEAA 5FIUA 2OV1A 4UJ5A 1MAUA 5JLJA 1AKTA 1QX3A 2X14A 2RKBA 3A2KA 1NQAO 1NN5A 1Y5NA 3UAVA 2C96A 4UHKA 1KFKB 4G0OA 1N0UA 3VU3A 2VQFB 3KHSA 3CLSD 1FMLA 5KU7A 3ED1A 3ETDA 2BDEA 1ZCZA 1E2MA 4G81A 3BE4A 5KB3A 4IMRA 1R12A 4S1VA 4YRCA 4KIFA 1H6BA 1E58A 4J2OA 4P81A 4HLQB 4N0PA 1LTQA 1NPDA 4ZCQA 4KQCA 4AN1A 1RU3A 4CCWA 5DMXA 5F98A 4WZAE 2R1ZA 2Y0CA 2Y27A 4KQJA 4R2KA 5AM1A 5C5EA 3DH0A 5KREA 1JAYA 1ZC3A 5CK4A 3UXMA 3IUYA 3SJAA 3H8SA 2BF7A 3EIWA 4IGIA 5IAEA 4PLYA 4F3RA 3MQ2A 3V7WA 5B7PA 4OHXA 2PZGA 1IZ7A 3OFJA 5DK4A 5LQJA 1S96A 2CJWA 3S5JA 5BURA 2BLLA 3OT4A 3QPVA 4MIYA 2XCUA 2VPIA 1DAKA 3IEVA 1F06A 4BFUA 4G5SA 3S2FA 1PDOA 1TUIA 2PG3A 4HVCA 5A4DA 3D2CA 4QXAA 1WD5A 3P96A 4ZVUA 2ZDQA 3CCCA 3KOOA 3A6GA 2NWQA 3BT7A 2OSVA 1EX9A 5HMMA 4EY5A 2O2CA 2XCQA 1WMAA 3L6EA 1YNOA 2FE1A 2QL7A 4BVHA 1SCAA 1P6QA 1PTJA 2ZT5A 3FGNA 5COAA 2GARA 4IUDS 5JNRA 1I7NA 2A5GA 2JGDB 2ZUSA 1U4NA 1U3CA 1FVHA 3CPSA 3EZGA 3PC7A 4O2AF 4YO8A 1KK1A 3WYNA 1MJ5A 1ZH6A 4NMMA 4F11A 2A5DA 1HEYA 1OXBB 2AN1A 2X8BA 4QFBA 3CKKA 3BGOS 5KVQA 4U00A 3SAJA 4B3IA 1Z22A 1PWXA 4Q66C 4FSHA 3WB0A 1E1CB 2WC1A 4F3NA 1DKUA 1WJGA 1KQFA 2ARKA 1Y80A 3IKJA 4EI9A 5EUCA 2AOXA 5ECGC 2RIPA 3CWQA 1HMYA 1ATZA 3EVAA 2NU9B 4ZYXA 2G0AA 3RANA 5AW4A 4LN1A 4UU8A 1TZCA 4TYYA 3QXGA 4LG1A 3WL4A 3TKLA 1Q83A 5FBQB 5HJEA 3GVCA 1XZAA 1W36D 1J0BA 1KDRA 3PYXA 1IY1A 1OREA 1UFVA 2IYVA 1OLSA 1KJNA 4KNWA 5ECDA 1MV8A 5A9RA 2D5AA 5HZHA 3RSCA 1OH7A 2H4YA 4EYGA 2PN1A 1EWYA 1KQPA 5GONB 4H7JA 3SR4A 3ONVA 2ALJA 3PVCA 2ERXA 4UTZA 5CLHA 3UAWA 4PF1A 4BNDB 4IQFA 3VHXB 5C7OO 3DLIA 5CXQA 2BP7A 1U3WA 2V45A 4YLEA 2VF7A 1JKIA 2CZCA 2EFJA 3W8DA 4EZIA 3UUFA 2CMFA 4BBZA 1CHDA 4CW7A 5KPDA 1I7LA 1QIMA 5JFOA 1N2OA 3ESZA 3H11B 5DX8A 3V4ZA 4Z5XA 4JQYA 2O8NA 5DHUA 3E81A 4RKFA 5JS6A 5ILOA 1DKOA 1TEVA 4DCGA 3HFSA 1R6DA 2PLFA 2PZBA 2IS4A 2XRMA 2D3WA 2IXBA 1NT2A 1SXJE 2EGHA 4ZVSA 3TLGA 5AD1A 3ZHSA 2L17A 5JMWA 1V6CA 2AE1A 2YH2A 3I8XA 4FC7A 3TWOA 1R0BA 2LCFA 4GWLA 3EDRA 1OGIA 4P3YA 4U5QA 4X54A 1QMPA 3N0XA 3V48A 3MT9A 3L04A 4K6FA 1EEHA 2OMKA 2X6TA 5CM2Z 3NDBB 3VU9B 3O95A 1JTVA 1NRJB 4CQMB 3PRJA 1GTJ1 4WK6A 3N05A 1S2OA 2H0QA 4DIFA 2VO1A 2CXXA 2GO1A 5TF4A 4P2GA 5BVGA 4JS0A 1TCVA 2QVBA 4MQ5A 2Y9MB 5CGZA 2NQTA 4YX9A 2C7BA 2ZXFA 4W82A 1RC8A 2XGGA 1KAMA 3PR2B 4HAIA 4MV3A 1RP7A 3ETHA 4TS1A 4YUAA 4Q1CA 4E07A 4YCMA 1MB3A 4MKGA 3LA6A 4XGNA 3OD1A 3BMOB 1JSXA 1XV5A 3ACBA 1X8KA 2VUSA 1D7AA 4DCTA 5DWDA 1C9DB 5ALXA 1PYOA 3CB2A 3OM9A 4UU0A 1FTNA 2DPYA 2Z4TA 1U8YA 4GL2A 1SBTA 1BX1A 1YVUA 2V65A 2N3ZA 4QFCA 4G1FA 1K5GA 2ZUVA 4BDSA 6REQB 1M5RA 5JS2A 1SBZA 3A3PA 2YL2A 2I1VB 3ER6A 2IPNA 2PAFA 3OPNA 3QJ5A 2AFIB 2R68A 1FC0A 4V2UA 4UW9A 1JEEA 1YRHA 5CB4F 3GVXA 4I1IA 1E4EA 1EHYA 2AQKA 2HLNA 2SHKA 3L6UA 3OY7A 5K99A 1NM5A 4Q4CA 3NWOA 4AU1A 4HGRA 3IP7A 4L85A 4ZOAA 5DW0A 2W2OA 1AXRA 2CXSA 1HZZA 1P2GA 2H4FA 3DLCA 3F6SA 3DM9B 3GBSA 3DFZA 3IV7A 1X7XA 3L7KA 4LVCA 4OHZA 1R3DA 3WLNA 3KUCA 3CZAA 5B3JC 3A14A 1H0SA 2P4UA 3O4HA 1JKMA 3LT2A 1WXHA 5JCJD 2YVUA 5I4BA 1BHO1 2QMYA 2RARA 5FPSA 1YL6A 2BEKA 3MZ0A 5FJIA 1JDBB 1L4GA 3WLSA 1ZISA 4EMTA 2I7DA 4A82A 2I7CA 1Z2DA 3HKCB 2RHHA 3EUFA 4UFPA 5U1PA 1DLIA 3RUHA 2GYUA 1EFKA 1EKXA 3S1AB 4BMDA 3T9AA 1UBCA 3ANLA 3A6LA 2B30A 2C29D 3MCVA 4UTXA 3W34A 2JLBA 4E5UA 3D7RA 3GEGA 1HNZB 4R2JA 2O54A 1RXSA 2ZKIA 3H5NA 2Z9BA 1P4AA 3FHTA 3LCCA 3OE4A 5LVAA 3KLPX 2QTNA 4PCVA 1OIVA 2NVUA 2KQUA 2VP3A 1CQZA 2VSQA 2MCFA 2HR1A 4NL4H 2R6GA 3LPCA 4PV7A 3LUFA 3UWDA 3K1AB 1MX9A 2AK2A 1I9CA 2ZB2A 2HXYA 1JVNA 3P2JA 4MP3A 4CDNA 4OQFA 1JHZA 1FU4A 1OXXK 1YMQA 8ADHA 2DPMA 2HZBA 3CR8A 3P97A 4J0EA 3I30X 4WLVA 1ACJA 5E8RA 3ZWWA 5C31A 2JAQA 3UAOA 3MS2A 1VLZA 2Q1YA 1P6UA 2IITA 3CZCA 1XZJA 3LQRA 3NC1C 3VSEA 4UDNA 4CN9A 1U63A 2AHRA 3NRCA 2BISA 2G28A 5BMVA 4PICA 1J8DA 4Q1FA 1I0LA 4FT4A 4TXJA 3HBFA 1WEHA 4ESEA 3HP4A 1WXDA 3VOTA 2QSJA 1BHJA 4R8MA 4AP9A 3JARB 3QUQA 1ONSA 1LBTA 5KTRA 4NU6A 2C2GA 4R4JA 1NUAA 1VA5A 1L8AA 2H52A 1OE0A 2YVQA 4ZA2A 3USES 1LBSA 1NW7A 4FINA 3H42B 3ZU6A 5SV2A 3SG0A 4RV9A 3LDHA 2X4GA 4KXYA 3HP7A 3V2UA 3WK7A 3QFCA 4BQNA 3O8OB 3E5RA 2QRVA 5CEEA 4BAZA 1ZPDA 2C82A 3LUGA 2XRZA 3A2MA 4RIIA 1T6XA 1V2HE 4H15A 1G3MA 4F5YA 4BX3A 2M6RA 4GWGA 4IJVA 5D5PA 5EJ9A 2HT6A 1VZ3A 2CE7A 2JZCA 2Q2WA 3DQZA 3EGDA 2BMDA 1Y63A 3KZOA 1TL7C 1SIWA 5EINA 3WNVA 4F7DA 4FM9A 4INOA 4KXMA 3ROTA 2IP4A 2Y67A 4B6EA 4TQ9A 4Y6QA 2WTBA 4B4VA 1XZEA 2F2TA 2X19A 4PAOA 3AMVA 3ZIAA 1ZC4A 3EEIA 3O8LA 2PXCA 4KZKA 4LZZA 1B7GO 1NXTA 2GK4A 2BUAA 1D5CA 2VHJA 3BM5A 4MQLA 1JDSA 1M6VB 4RJKA 3STYA 3I1FA 3SOPA 3TPZA 2XUQA 3M5WA 4RSRA 1E0KA 1SKMA 5TRTA 4JGIA 1P74A 3EC1A 3F7NA 4LV8B 3I52A 1UBKS 3R6DA 3I8SA 1JFFB 5DYNA 4K81B 4ZQHA 2GASA 1UBTS 4M83A 4PG5A 3UATA 3RPEA 1TKRA 2BIFA 2GRUA 4A0HA 3WB1A 3QF4A 1Z15A 1M2FA 1QFSA 4QJBA 2IKSA 3CLHA 4UBLA 5U4XA 4F8EA 2RCNA 2XPCA 3C5WP 5L3ZA 4A7PA 4DR5B 4MCHA 5K1ZA 1N92A 2OD9A 2PQ2A 3MWFA 1Q1EA 1YR7A 3W5UA 1L4EA 1XNJA 2QMUA 4QHTA 3OIDA 3KR2A 5C7IO 3NUGA 1BGWA 1QO7A 3OMXA 1FNSA 3O7WA 2E87A 2XQFA 3FNBA 2IV3A 2VAMA 4PXAA 4TMYA 3D6VA 3K94A 5DTQA 4KVFA 4Q7JB 3GN2A 3K0EA 3OETA 4J9VA 4X8HA 5DULA 3F5SA 1O8CA 3C4QA 4TRNA 2FWPA 1LUAA 3RHFA 2PKWA 5JAUA 4EY4A 5I51A 4I8XA 1KOJA 1LS6A 3ESXA 4P93A 5H0IA 4OXYA 2H5EA 3RVMA 2PRSA 4MQ6A 2XMDA 1AKVA 3U3ZA 1PS0A 1JQ3A 1QAMA 1NF9A 2I1LA 2RBKA 2EKDA 4MI1A 2ZCJA 1SBQA 1Z74A 4R68A 5HS6A 2VJLA 4L5JA 4BO2A 4FKBA 2O59A 2JFYA 1TZ2A 1KK2A 1YB5A 1GQ2A 5AKKA 2GBIA 3OJLA 1XRMA 4K3VA 2I7VA 2YHIB 3E1KA 4JBGA 1M54A 3TOVA 1EI9A 3AY7A 2CXHA 3BL6A 3WYEA 3K0SA 4GI2A 3Q40A 3P9SA 3NCTA 4Z9FA 4NE7A 4XVCA 2CLKB 5C8VA 2ZS8A 3PHJA 5BOVA 3E22A 2F67A 4MA5A 5KQPA 2A92A 4FP9A 1QOZA 1B6RA 1FRQA 2BLNA 4EYEA 2FSHA 2X23A 4YJKA 2C07A 4WDRA 3MF4A 3TBFA 3VC7A 4B79A 3UM9A 1LZKA 1T3ZA 2WILA 1T10A 3A10A 1AXGA 4PO9A 3K09C 1Z4QA 4ZT7A 2PANA 1QZ3A 4NDNE 3D6UA 3KXIA 4O2BB 4PYLA 5IKOA 3C3AA 1GGVA 1LWOA 2ENUA 3FDZB 4OU4A 3TMYA 4EHIA 1CZLA 3UENA 4KXUA 2XYQA 2OSBA 4NK5A 4MR8B 3DL0A 1EUCA 1SQ5A 2QTFA 3BWBA 4UAUA 6AT1A 5EHZA 3HDGA 4ZCPA 1KKMA 3NETA 1QHNA 2Y1KA 4LDZA 2P6RA 2P6PA 4PCUA 5LXTA 2VBFA 2J5RA 2PUJA 4OI0A 4DSUA 1QRUA 1P1RA 2C9DA 3L18A 1WLSA 4M88A 5EIWA 1CJUC 4BNJA 4LRQA 2CXNA 4AXXA 3G0HA 2PUBA 2VRCD 5TMPA 1GTRA 4HL6A 3UB2A 4XYMA 4KO3S 3DYBA 1LPBB 3FI0A 4O5AA 3QUAA 2YOHA 3OC6A 4FOOA 5I8ZA 4WBXC 5TQ2A 5JVDA 5K0JA 2WD7A 1ZVKA 5AOBA 3I45A 5KTMA 2AN4A 4AY5A 4E94A 4HB4A 4K28A 4NDAA 1I24A 1ZKMA 4M1KA 5J1SB 2CFIA 5BNWA 3RS2A 1IUOA 2B21A 3DKKA 3IAEA 4H59A 4IAOA 1S8OA 5ERGB 1ZGAA 1SCUA 1U0FA 2H9AA 2WF6A 5FLYA 3TOCA 5JO9A 5BOSB 4NEHB 4NHEA 5JYBA 5BMVF 3EXAA 4LZAA 1GLNA 4NCNA 5H70A 3RJTA 3ZWDA 5G02A 1F2DA 2WF7A 4L6CA 3UWKA 2RHWA 4DT1B 1IUPA 3SZOA 3W04A 3EFOB 3EXEA 4GUAA 4NLLA 1AKEA 2Z5VA 4KVGA 2P2CA 1J56A 3LXRA 4LOIA 4IEIA 4KYTA 4Q3CA 5IZCA 2R8PA 2JASA 5A3VA 4AQ7A 2HEGA 3ANMA 5C1PA 2EEPA 2UKDA 5BYBA 3H2KA 4BKOA 1G7CA 3FLMA 5ALTA 4I5DA 3I5AA 3ZDDA 4BX8A 1C9MA 3NTVA 4DCMA 4EGAA 4P3KA 1TMYA 1HFWA 4PYOA 1R4MB 1V1MB 3ZJYA 4DKJA 4XCVA 1N2XA 2CZQA 2PKYX 3KXKA 4UU1A 5JG7A 4CMHA 2ICAA 4GPAA 3QLUA 1E1YA 4LXXA 2A9OA 3ASVA 2GPAA 2IX3A 4XARA 4K9PA 4MW6A 1YQDA 1XYVA 4G97A 3ZHOA 2VYQA 5FOTA 3UOAB 3VO9A 3TG8A 4M1QA 4GHWA 4R1MA 2CN1A 3T5GA 3HY3A 4L9AA 4KLAA 1RBMA 5G0TA 4FGLA 4B3JA 4Z8XA 5HK9A 4JHXA 1JQBA 1J99A 1K7SN 4FYHA 2P7HA 3HJFA 3HYLA 3MLEA 3IUNA 1KFEB 3NTLA 5TGZA 1M2KA 3ILHA 3PFWO 5FYQA 2JZOA 2WLTA 3U9LA 5D3KA 5K0GA 3E4CA 2WJ4A 1GZVA 1W85A 5JJ5A 1F4PA 1Y5IA 4RS3A 3VOSA 2YXPX 5E4FA 1VL2A 3WZ2A 4AO8A 3D64A 1QJCA 4MVJM 2HDHA 2W4MA 3H4VA 4PZCA 2OQVA 5JXIA 1AKMA 4UUOA 4Z1MA 1W2WB 3ABRB 4FFLA 3ZKWB 1A8QA 1RHKA 2Q1XA 1IHDA 3B3JA 1XLTA 1PR4A 4PWZA 4P9NA 1A8SA 2H92A 3AZQA 4K6KA 1P75A 4RQBA 1BO6A 1YVEI 3RRYA 4EB3A 5HKKD 4DY4A 4C7JA 3LC1O 5CFQA 3OJFA 3PUIA 3IEMA 3TD2A 1X19A 4OHKA 3AR6A 3T15A 1ZWLA 4FE4A 1T13A 1ZW6A 2JFWA 1BD4A 1DAPA 2XUFA 3MYRA 1BFUA 1LW6E 4Z0TA 1QWOA 3QWBA 4Y6SA 5JEEA 4JI7B 2ZRGA 4JWTA 4XIYA 3MAGA 3NRBA 1AB5A 4FZRA 4H9GA 1Y3BE 4C0SA 4HCJA 5IU6A 1LPSA 4WFQA 2IOYA 3UIEA 1IEVA 4DIDA 3EZ7A 2QB5A 1XYYA 1MGOA 4BWYA 3JRNA 4DB2A 2C61A 4PLZA 4ZTZB 2CNBA 2HU8A 1FFBA 3TEMA 4QPNA 1STOA 1YS1X 3L01A 1IN1A 5HPYB 5C4MA 1JJ7A 1N5OX 4GXQA 3G8BA 2OLJA 2FCRA 2QUZA 4O25A 3O0TA 4TLAA 1R5BA 1V1JA 2F3SA 3CCBA 3FOWA 4TT8A 4Y1EA 3N70A 1Y5LA 2XDQA 5IVDA 3TIVA 2XTZA 3IESA 4H0FA 5DBFA 1F8UA 2IYTA 4KQ2A 4O5OA 1O0CA 3ABIA 3HBLA 3U4IA 1GPKA 3QI2A 4RDIA 4BNVA 1AGPA 1UBOS 1GL7A 3JQ9C 1U02A 5CLIA 3OCUA 3NH6A 1R6XA 3FAKA 3H8WA 1NBME 4IIJF 2Y1LA 3B2NA 1EFCA 4KW7A 1TFRA 2NO9A 3HY6A 4LY9A 1EXMA 5E9QA 3RW9A 2R87A 4EG8A 4AKGA 1DXYA 1U7UA 4LQ4A 2R4UA 4KTTE 1UDRA 4PRKA 3KTDA 4Y2VA 4F5DA 5JS8A 2QQ5A 1HQCA 4QUJA 3FXAA 1KYQA 4P83A 2J0VA 3CPHA 5LXTF 1NURA 4IRMA 3PQFA 4N5LA 4AX4A 5A4AA 3IOYA 2Y0PA 4MKFA 1J0EA 2J59A 1XO1A 2H1HA 4NBLA 4Z2AA 2NT4A 5IBCA 3SEFA 5FULA 2ODBA 1VL0A 3FIJA 3M1AA 4HDSB 3HU3A 5K2OA 1Z16A 3Q88A 1E92A 2JAHA 2Q2VA 3EIEA 3GIDA 5AK5A 2F7SA 3A1CA 4X63A 3BORA 3Q5DA 5CHYA 3UO8B 4B2LA 1T8PA 3EXHA 3UPDA 2O8VA 1D2GA 4IM7A 3DWEX 5F1OA 4ZZ3A 2YFKA 2WHPA 4G9BA 1Q3KA 5JVDF 2JJ8A 1LRKA 3OU7A 1J97A 4YRRA 2HHJA 3OU6A 4XRRA 2EKZA 1C3EA 1D2AA 3SKXA 3GCZA 4IDCA 5JJIA 1AZLA 1EFPB 2OO7A 1ZQ9A 1FDWA 2PGAA 4Y7CA 5H3CA 1THMA 1Z73A 1F8YA 4MWGA 1L5HB 4J03A 3HNPA 4UE3S 1CZRA 1GQRA 2QP9X 2HTEA 4YRJA 4AJHA 2GA8A 4HXYA 1IOVA 2JVIA 4NBTA 4DYDA 5CB0A 1FUYB 2Q8NA 4WY8A 4CMKA 3S2UA 4WGFA 1W44A 3U3KA 5KWJA 2CSUA 3A58B 5F77A 3AQIA 3QSYA 3DCYA 2ZLBA 2PD3A 1O8BA 1KSJA 3DAFA 3ZV6A 2XMQA 1UK9A 1GNLA 5TPZD 1U5CA 1CDEA 2Z43A 2ZYTX 3ITDA 4GPBA 3PEEA 3FZYA 1KAQA 4EDFA 3MBKA 4INZA 1J25A 2QZ9A 3DVQX 5JALA 1VMKA 1ZLYA 4HRYA 4OYHA 3DWIA 3QPUA 4NV0A 5F2OA 4QUHA 4F56A 2DTDA 1PFWA 3QVGB 5CLQA 2Y66A 4ZD6A 3M5PA 1RRKA 2FZWA 3GFQA 2VTBB 2QI9F 1G55A 1SVSA 4IVNA 1CW2B 3OCWA 2GCOA 4GX0A 2OMEA 1P1CA 2OWDA 2PSEA 1EQAA 3WAKA 4RD1A 4Y9DA 5COQA 3KQOA 3OMLA 2BE9A 3OD5A 4G84A 3WC4A 4C7BA 3FSRA 1I94B 1KYXA 4ITRC 1N57A 2C3UA 3PQ8A 5J4LA 2PV7A 3DUFB 3BWEA 4MKRA 3CZ4A 4RA9B 1C0LA 1O6FA 2BAGA 1W88A 2ST1A 2VZLA 1YT5A 3T5PA 3LDFA 4D9FA 3JVDA 2XB6A 5AI0A 2FCAA 2I2CA 4U9UA 3ESQA 3B1YA 5CU7A 1E7YA 4YT4A 5JSUA 3RFCA 3GPLA 1MC1A 4IXMA 2X9QA 4V0KA 4Z4CA 2P4QA 3KZNA 3FTPA 3L06A 4NVRA 4Y1FA 2P9FA 1Z8NA 2PVSA 1FUUA 2YV3A 4WLNA 2WRZA 5CPBA 2BFFA 2J8ZA 2P78A 3BA6A 1DIOB 4NZZA 4Q93A 5HWSA 1OI7A 3RSFA 3RIMA 3IQXA 4BCBA 4QTYA 4PRLA 1WBJB 2WM8A 3LE8A 4ZP1A 3ZZUA 3KIPA 5TX7A 4I9GA 2AUTA 1NDHA 1M6WA 2FZGA 1DE0A 1NXWA 2L42A 4IJKA 5EERA 1NVAA 2XD4A 2YV2A 3WMFA 2ZTUA 2I3BA 3HMQA 3Q85A 2XH8A 4ECAA 5EJ7A 3ENVA 4HTFB 2BEVB 3OF5A 3DOJA 5CJ2A 3IE1A 4TXHA 3S2GA 1Y4UA 1CVRA 2NSJA 3MMNA 1F5SA 1KKLA 5T3YA 4MVJA 4LXTA 3NHWA 4LEIA 4DANA 3R3SA 4RXUA 3ZHYA 2ZZMA 3NHLA 1WBDA 3K8QA 1QQAA 4W5RA 3CNLA 2EZ9A 2GEKA 2MOKA 4YEDA 1KU0A 3M3HA 5AIAA 4K9RA 3AOEA 4NZOA 2DY1A 4AS3A 4DWJA 1V35A 2CDCA 5PNTA 2HU5A 4DQUA 2Q4DA 2VRWA 3C14C 3WWEA 3SJ7A 4JGBA 1RT9A 1INLA 3IHWA 1AQ6A 1GAQA 2L19A 2NZYA 3T1YB 1S3IA 1U9IC 1R27A 1E2NA 2JGDA 3G88A 5DM0A 4RANA 2HIAA 4Q34A 1OU0A 3GFSA 1PEAA 2PEZA 4R2WA 3DO5A 3M1LA 3FRIA 1I1OA 1Z83A 4BNKA 1P4SA 1MRNA 2VR1A 1IIBA 4JJGA 5ITVA 1KPHA 3STVA 2RHCA 3D7NA 5DP2A 3PV0A 4KKXB 3GI1A 2XXAB 2W6CX 1JGTA 1P5ZB 4WOKA 3DEJA 3KVNA 3SR0A 1AUOA 4KUHA 1X3LA 3GJTA 1P2BA 2I29A 3HJAA 1UKZA 2BUCA 4P86A 4DF3A 1KC3A 3R6GA 4FYMA 4B4WA 2Q7XA 4YDQA 5KHAA 4IEEA 4R2LA 3DMPA 3T7TA 1JFRA 1O94C 2HSWA 4LDRA 3OA0A 3IJPA 1H85A 1NBOA 3OO1A 4E3ZA 3Q98A 3V1YA 2BYTA 1UQTA 4MZDA 3ASUA 3HO1A 4H7EA 4R01A 5IMBA 3I3SR 3U7RA 2Z2IA 4EMBA 3KKZA 1AK2A 3BDAA 5J43A 1QGUB 3KDPA 1NKVA 2V4ZA 3Q5EA 4MVXA 1SB8A 1KJ9A 1M2VB 2OL4A 3NTRA 5F5XA 3KVRA 3K3PA 3O2SB 4TLEA 3K70B 1YR6A 2VTVA 2IP2A 3PLAE 1EK0A 4A16A 2FN9A 3HFGA 1BXRA 2YJ5A 1JBKA 1GA1A 1LTKA 4FBLA 1MXHA 3QGMA 4YP0A 1WPQA 4HXGA 1VIDA 3GRFA 4MCAA 1ZM3A 6CHYA 5HM6A 1IG3A 2NLOA 3NO4A 2ZSIA 3H11A 1MTOA 4DR2B 3ZD6A 2AMVA 3ZYCA 1U0BB 1M73E 4H18A 4RTLA 3EODA 3R5SA 1RIFA 4GI1A 4P8RA 1T1EA 3RVOA 5JDCA 3INNA 3IQIX 3SEQA 1GNRA 4BNWA 5BN4A 4HWKA 4JELA 5AO9A 1NXQA 5JYDA 2QRLA 1VL5A 2VSXA 1V6AA 1L8LA 1QFMA 2O0LA 3E3AA 4YN3A 2PS3A 2R5NA 2H1LA 3C3MA 3VU9A 1KWGA 5THQA 5IEBA 1J24A 4G09A 1W5EA 4PFJA 1M66A 2C5FA 3QBDA 2JATA 5AKZA 3QELB 2H1RA 5KYYB 1JF8A 1S3SA 2AJBA 5KYGA 4JYPA 1OX4A 2ZSUA 1C7QA 1ZGCA 3NBKA 3W5DA 3MMZA 4MPTA 3OZIA 2PA0A 4DBLE 3GROA 2V4MA 5KNCH 1HH4A 3BMOA 4NK4A 1W4RA 4DC1A 1WXFA 5JANA 4W7IA 2DULA 2Z3VA 4KO8A 4II2A 1K9VF 4NTZA 4NYJR 3NTOA 3AW8A 5H80A 2FWMX 4YDSA 3VNVA 1TIKA 1R0ZA 4YO7A 4X20A 1CJMA 3B3QA 3QUBA 4MW1A 3C98A 3ICCA 3E84A 4MYTA 3TZKA 3UXYA 2P2GA 1ZR4A 3WNCA 1EE2A 4MWEA 2EFEB 1II9A 4KWTA 4BFXA 2ZJBA 3H9EO 3K5HA 2MYUA 3WWOA 1IPHA 1L1FA 3DOOA 5CDSA 2ZCUA 3DZHA 3BEDA 2FGKA 4BJ5A 4CLHA 5BT9A 1QTNA 3CLKA 1KK0A 4HGPA 4TS3A 1UBHS 3HZHA 4X1OA 3C70A 5EPOA 3PUWA 3B8HA 2VRNA 1WCV1 3MFYA 3DT8A 1BX3A 4KR9A 5IVPA 1DU4A 4MGYR 2A7XA 2E4UA 3Q15C 1BN6A 4XLZA 4QDUA 1Q0ZA 3S2EA 1I2MA 4CUJA 4ZQIA 5KYXB 2VFAA 5JMPA 4YWJA 1AD2A 4CTMA 3K71B 1PFGA 3JALB 2Q27A 2YJ3A 4ZOBA 1FEZA 1YACA 1XMVA 3X44A 2H2DA 3OTOB 1VMAA 2CXTA 4HDRA 5LQMA 3EPLA 2WU4A 3KQWA 1D0IA 1EVEA 2DQZA 4AUNA 4Z6KA 4IIVA 2GAJA 2LGJA 4KXWA 4XIJA 3RIGA 3S1AA 5HTOA 4ARAA 3GLIA 4HS9A 3I0NA 1GQYA 2WYUA 5FAKA 3U5ZB 3IJRA 2PX6A 1TYEB 2ZE8A 4E0BA 1PG0A 3JYHA 1M2WA 2QIOA 4BNZA 1W36B 3I5MA 3NBZC 1JB9A 1BWRA 2WTUA 2R7AA 3ZWQA 2WT4A 3B85A 3PHBE 1HDRA 1UDWA 4JITA 1LEHA 1OXMA 3IAHA 4WNAB 4MVJF 2HF2A 4XYBA 1JTFA 3OWXA 4JEHA 5AJHA 1RQGA 3K2QA 5DM1A 3UF0A 5BWOA 5C35A 1R0LA 3K1AA 4YI5A 3TKAA 1Z25A 3DV0A 4MS3B 1XNGA 3LHIA 1CCWA 4DLWA 3D7LA 3IVCA 4II7A 1U1FA 4DV7B 1GNVA 1MAVA 2AJTA 2NXWA 1L3IA 3A1TA 3AV3A 4FGZA 4FIZA 4M9XA 2VG8A 1QU3A 1DIBA 1TM7E 4KIWA 4PLHA 1OMOA 3ZD9A 4DR1B 2VKQA 3ZHZA 3OZXA 4ARZA 2A1TS 1FYEA 2BJWA 3GDWA 3F1LA 3JSAA 4E70A 1ECFA 4CCAA 2Q07A 1F0NA 2WQZA 4IL5A 2IS1A 1E7RA 5FPKA 2ZYRA 4NBNA 1YFLA 3JARA 1CRZA 1X70A 2C5SA 5KMGB 2O48X 3FPFA 9GPBA 4AUKA 2AW5A 2ZU6A 4NX2A 4IJ5A 1LC3A 1MDBA 4UE2A 4BLWA 4C21A 2BSXA 2OOSA 2FMHA 3OBIA 4RVHA 1IVSA 1NNSA 3FWNA 4A1OA 3LBIA 1YV9A 3O8OA 4GSLA 4IV8A 3TMAA 4ETIA 2OZEA 4K6MA 2Q9BA 4K6OA 1O94D 3PLRA 3O8NA 2MINB 3GCWA 1PVOA 1NQXA 1DAEA 1PFYA 2Z8ZA 2UUOA 4O1HA 4QASA 2JW5A 1JAIA 1U98A 1ZL2A 4HNHA 4D4LA 4F60A 1RYHA 1R00A 3HGMA 2XOEA 3FRHA 4NOMA 4EJSA 3WNBA 1Q1NA 1ZEJA 4EGFA 1IQPA 1YC2A 4RGBA 4NFHA 3TM4A 2NPOA 3F49S 1L7AA 4RHYA 2Q45A 4LF8B 1B8OA 1UFQA 3BRWD 4FUTA 3BOSA 2FEWB 4HNQA 1GZ5A 1X1CA 4UHCA 4IS3A 5GONF 3SDSA 3TEFA 2HIMA 1WQ3A 1E2JA 5T3UA 1OYYA 4J3FA 1H1LB 3G9TA 2FU5C 2DPGA 4MWBA 5D6NA 1E9FA 5TR9A 3HU5A 5A1JA 4JT2A 1GZ4A 2VC2B 3K70C 3PQEA 2IY7A 3UGTA 1VI5A 3KYDB 4N49A 1FX0B 2BFDB 4ZCTA 3KUDA 1VL6A 4M9UA 3K0AA 1YDGA 4GWKA 1QTIA 4N03A 5F73A 3HSKA 3AETB 1WS6A 1DEXA 2RK3A 2WWWA 2B37A 5I9LA 2NZ8A 2IHBA 1GPAA 2P9BA 4QGFA 2K7ZA 2YQZA 3CNOA 2ONKA 2DWQA 4ALIA 2DRIA 3GCDA 3N2NA 2O5VA 4OUKX 1BVUA 1PJZA 1AZTA 1SCBA 5KQSA 1FBNA 2RAFA 1J70A 3P52A 4J4BA 3VA7A 1U9YA 4AJ2A 2QIPA 1J33A 1E9CA 3DMFA 3IBCA 3UXEA 4YR9A 1BW9B 5ALFA 3G1WA 4I1VA 5HBRA 3CZ5A 1F51E 3G0BA 3GRYA 3HG7A 4JC5A 4MULA 1N78A 2FYTA 3R6LA 4ZT4A 4YREA 1TA4A 2ZJ2A 3Q1LA 1GGHA 2MSKA 1XOIA 1B42A 1QGOA 3H1AA 3M6LA 1XU7A 4X84A 1G2OA 2JBHA 3UJDA 5J47A 2XCTB 4NG5A 3PENA 4YGYA 1IUNA 3M5DA 2F9MA 4NDZA 5LN1A 4M2LA 4BEVA 1H9AA 1VYVA 2IXGA 5HQTA 4L51A 1WEKA 3LX6A 2PUGA 2GEVA 4CMIB 3ZWCA 4J1TA 1KOGA 3KEGA 3K8OE 2ILVA 4TL6A 5JT1A 1BMDA 4AT1A 1Z45A 2BZGA 1MX1A 3H83A 4UNNA 3S2IA 2PX3A 2YHIA 1ISGA 1W48A 3M3PA 2Y6UA 3G9XA 3CNHA 1PZGA 3PSHA 1PSDA 4UUNA 3UWOA 3RV3A 4PBTA 4XGRA 1LK0A 1ML3A 3B52X 2Q7OE 3RREA 2NYVA 4I8DA 5JTUA 4CM8B 2D2FA 4DNFA 5JNLA 1NIPA 4QGAA 5DKFA 2M6LA 1GL9B 3RASA 4R98A 5K3SA 3UQYS 3W5SA 5JZOA 4C0BA 4KR6A 5CVDA 2BHSA 2D2XA 4NI5A 2EFYA 2G07A 4I08A 4WZBE 5FAXA 2RH9B 3DTYA 3ISVA 1L7QA 2ZRHA 4GPZA 1E6LA 4JQSA 3QZUA 4O2BA 4M87A 1JPVA 4CE6A 3W5BA 1PGQA 1Y8ZA 1J5XA 4ZREA 4N54A 3QVJA 4EBBA 4EA6A 4ZV7A 1LB1B 1O5TA 1PT5A 3KVVA 4QOSA 4MR8A 2VTEA 3BF8A 1E1MA 2PZFA 4R8LA 3TYXA 2Y1DA 3N58A 5C8XA 1PNTA 3I3OA 3BWYA 1JILA 3BERA 2CNWD 3N2KA 3QA3E 3OEHA 3EEFA 3AHEA 1YHYA 2HU2A 3D8RA 1GVHA 3IIMA 2R97A 3AKCA 4OO3A 5DI3A 1WUIS 3S6JA 2YKGA 3PGLA 4RC9A 4QOJA 1K86A 2OHHA 5GJCA 4YVFA 3ZN2A 5LBTA 2D74A 4LRWA 3QBJA 3ENZA 3U13A 4UTRA 2OGSA 3CG4A 3AVVA 4CG3A 1J9GA 2P91A 3K9GA 1P7WA 2IWHA 3OQIB 1ZD5A 1KFJB 2FRDA 4CMEC 1ZVVA 5TPWB 3HCBA 2NTNA 4XM0A 3CH7A 2IODA 1NU6A 2XT9A 2CNNA 3VXKA 3T12A 3IAS1 1X7GA 1A8PA 5SYNA 5BR1A 2NQ8A 1QWSA 2HA3A 1Q84A 1XEXA 2QUHA 3BKWA 3MAAC 3MM4A 4GF5A 2CXRA 2PS1A 3GELA 4UEKA 5K20A 3T7AA 1VG8A 2ASVA 4RTPA 1RLOA 2Q3LA 3L79A 4IEFB 1OVGA 1WMFA 1UKYA 1L1EA 4XLLA 1I1QB 1YDHA 1Z6TA 4QQNA 4XQ0A 4MYHA 1H05A 5AKXA 3WGHA 1XVUA 4HDKA 4RENA 5I7HA 2PE5A 3GJ0A 2VK2A 1UDAA 2A2ZA 3ELDA 3S1SA 3UQZA 1EB9A 3KLNA 1ECGA 3IJEB 5EOVA 4DT1A 4CEJB 4P4SA 1E0AA 1W93A 1DP4A 1HF3A 3LY9A 1L7RA 2H8GA 4H7HA 3ANXA 1HYEA 1DKRA 1EJ2A 2EJBA 5LYJA 3GH3A 4G2TA 1MQSA 1RW4A 3TIFA 4PW0A 5A9TA 2EJCA 2DG2A 3L7AA 3P4YA 4EHJA 3LVRE 1C14A 1XXHA 4XTRA 2WHEA 4F6CA 1WCIA 2XZOA 3H19A 3X2FA 9LDTA 4IQ0A 1QOPB 1R4MA 1WRBA 1EH5A 2GD6A 1E1RA 3QVXA 3OCXA 4ALLA 2Q6IA 1UKEA 4J6FA 3TXAA 1GNSA 1X8XA 3D8TA 3D1LA 3EE6A 4FWBA 3Q2KA 1L7VC 2ZJ8A 4RS4A 3GAFA 1YRBA 3DMHA 3ZHRA 3GRUA 2YIMA 4K9MA 4ESVA 3LMKA 5LCXA 3WDMA 1YHNA 3MTDA 1NJSA 1UCFA 1V4NA 3PKZA 1HE8B 5IJ9B 1D9XA 2C5AA 2H11A 2HJRA 2PXAA 3F5FA 2FQXA 3VV2A 1KSFX 2A0YA 1ZL0A 3GRVA 3I0ZA 3DPIA 2IWRA 3DKIA 3K0FB 2ID4A 4UZFA 1DJNA 4DG5A 3BJMA 1FLAA 2R11A 3VR6A 4C2BA 5AW1A 3QBTA 1C9KA 3C6BA 3G6KA 1QHEA 1QG2A 3WYBA 1PR2A 4PHFA 1RRGA 1POXA 5CTJA 4V0RA 4R6WA 3D4LA 4C3ZA 4Y1GA 3I9OA 1E2KA 4G9GA 3UK6A 1VHDA 5E6RB 3RNLA 3R8FA 3Q6NA 4FD3A 3IAM1 4V0NA 2FFAA 3RAJA 3ZKWA 5LFAA 2WQ6A 4Q82A 1EFUA 3D7SA 2JAUA 4P7GA 2FOIA 4Q3EA 5D7BA 3RU2A 4RUKA 1WVMA 2Z6VA 3HUTA 1ZEMA 3A1FA 1Z2NX 1WXWA 3ETGA 1P8JA 4G2NA 3ZDXB 3OLWA 4UPDA 1PNOA 3H5LA 5KNDD 5EXSA 2GILA 4GG1A 3REQB 1XZMA 3G7SA 4BV8A 1TEZA 4PR0A 2YNMA 1M2HA 1RJEA 2WDZA 4AMZA 1HX7A 4A8HA 4KMMA 3KQKA 3FZGA 3Q8LA 2WMOB 4GXTA 3L8MA 4S0ZA 3UHFA 2YN4A 4IGKA 1UIMA 3N75A 1IAVA 3BMQB 2BEWA 1O9HA 2BR5A 4H6XA 3EYWA 3L6RA 3U0BA 2V7PA 3KUUA 1ZONA 1NBEA 1UAYA 2EDAA 2QTHA 5DBEX 5FWYB 1TTPB 5B6IA 2FMIA 5BSVA 4GRIA 1ISHA 1J20A 1VLMA 2IUEA 1H22A 2PX2A 3HUUA 1J00A 1T0BA 1OSNA 2GBPA 2QQGA 5JBIA 1XE3A 2F1RA 4YMGA 1KI8A 2EZTA 2QR3A 2VNIA 3NT2A 2Q50A 2VJCA 1HWYA 2ZYSA 3KPUA 3QKTA 3R5JA 4QTTB 3PXGA 2UVPB 1OWNA 2GOYA 2J5QA 4FZJA 4LISA 4QWWA 1E3WA 1I2BA 1MAWA 4ZCRA 4E32A 1DWPA 2PBLA 2GN8A 2F3PA 3N86A 3AI3A 4R7TA 3ZCRA 1P9OA 4XWOA 4MLZA 2G8LA 2WM3A 4POAA 4XI9A 1U11A 4CVNA 2YWFA 3V7UA 1P7ZA 1DPFA 4DDUA 5K8LA 1QONA 1V16B 4FNAA 5HP4A 1ZFNA 3HFRA 2GPYA 1SVMA 4RW0A 2EJUA 5AOCA 2W8ZA 2OGWA 2P3QA 3PUZA 4O2BF 4Q0MA 4XGQA 4BLVA 5JWOA 2YWXA 4RQUA 1WB4A 2XUGA 1HE4A 2Q4BA 4BQIA 3LT0A 3E58A 2H1SA 1I7SB 2O8DB 2DC1A 5IZ4A 1O89A 5CT4A 3BCUA 3ZXSA 4EEKA 2DX7A 3PXDA 4EUSA 1M6NA 1EHIA 4DTCA 3GLFE 2V6JA 2SKCA 3BREA 1BVHA 2AMFA 1DKPA 3FWYA 5B30A 3C6ZA 1W75A 4XR4A 3L8ZA 4K9KA 4P34A 4KSBA 2ZAIA 3OQNA 3AONB 5HIMA 1ILEA 2C97A 4HDSA 5JASA 5IANA 1AS2A 4B45A 2HX1A 5E9AA 1VE6A 2QR2A 4PSUA 5L8VA 3F9CA 3VOAA 4ZCSA 2PT6A 2JK0A 2R79A 3OMWA 3QVVA 2W6QA 1S4QA 4P0QB 2ACWA 1ZSVA 4FEGA 5DNUA 4YYEA 3E1GA 3KSBC 2C92A 5FUBA 1KO7A 3H1PA 4IILA 5CNJA 1R4NB 4GKBA 3WK4A 3QMMA 4MIEA 2GVDC 1IHXA 5EQTA 4FE3A 3WRYC 4F86A 1U2PA 2BPOA 3T34A 5F1PA 4Z49A 1ZNWA 1NN1A 1KRHA 4AB1A 1T5HX 4U3JB 5FLXA 3AB7A 5T4EA 4CT5A 4YAIA 2H06A 4U7TB 1YZ3A 5G1OA 1V5WA 1W0KA 1YQ9A 1O4WA 1PR6A 1IN6A 1Z68A 1T9GR 2JFZA 4UUAA 3WWPA 3ZE2B 3DVSX 2EP7A 1NP7A 4TXNA 4YMTA 4RFVA 4QOEA 3BJEA 4UNQA 5EMMA 2VJKA 2QJFA 1U0HC 3DBVO 3I34X 5TMEA 2QHXA 3JX9A 3QEMB 4JB8A 2LKDA 4TTAA 3UMBA 3UT0A 1Z82A 1CQXA 1I8TA 3NKVA 3UCXA 5TMBA 1VTKA 4HY3A 4ALNA 2FW7A 2PRJA 1EX1A 4RKQA 3EUAA 3T1TA 2Q7DA 4CDMA 5C5CA 1Z4KA 4EOGA 5G40A 1ATIA 4KLRA 1ECBA 3PS9A 3EFBA 1QZZA 2HHAA 4KE7A 3W9YA 2W98A 3WBKA 3FTNA 3QVGA 3TSCA 3MTAA 3C43A 2OQRA 1GXSA 3SHFA 4CV3A 1M72A 2VKTA 4MGKR 3DP9A 3AF2A 1NUTA 2H2HA 1VXOA 3ZYZA 4K87A 1EINA 1F3OA 4TKVB 1OBCA 1X0VA 2PT7A 5K3BA 4EENA 1CQJB 2G1KA 4K5QA 2BGWA 3A9RA 2N1BA 2P9ZA 1VMDA 1N3IA 1ST2A 5D3MA 4WLEA 3ZY4A 4RXTA 5ULLA 1ZK1A 2BD0A 1WP4A 2FSVA 2CBGA 4PYKA 1JHMA 1HA3A 3CXRA 2C2WA 1Z7WA 1RWWA 3DBRB 3HY4A 3L3BA 1BA3A 1DG3A 1SWVA 1W5SA 1F8XA 2BR3A 3D5EA 1USUA 4GBED 3ZH2A 3AU8A 3LXUX 3N07A 4XUGB 4KQKA 3ELYA 4M7RA 4D25A 2ODTX 1PEYA 2CFRA 3C6QA 1PZHA 3KPJA 2BTQB 3S55A 1RADA 1QYDA 2IPLA 1DL5A 2DLCX 2QAJA 3SOZA 3QVMA 4HDOB 2WE8A 4OYLA 1VCIA 4Q9KA 3TNDA 3ZBPA 2IHNA 2Y1GA 4UNRA 4U6SA 2GUGA 3ESCA 1U2RA 3NC4A 3QBEA 1UDXA 4EHFA 1XTPA 4WH0A 3Q3CA 2AR9A 3D5TA 3A3OA 1UZNA 4JUAA 3EQZA 3LK6A 2R6ZA 3VPAA 2IKQA 2OHFA 3CX7A 4OJKA 2WAAA 3M2PA 5HTKA 3OKAA 4D80A 4EPXA 3TO5A 3UYLA 3TFOA 3EIFA 5CDTA 3AL0C 4AS2A 5I3CA 4NHOA 1EP3B 4IXDA 3FPAA 5EIBD 5JYEA 4F1WA 1J5EB 1OCEA 2F3UA 2P1DA 3DYVA 3M4NA 3UVEA 4GNRA 3TQFA 3VSBA 4JDUA 5DT9A 4YRZA 3IO5A 5C3MA 4HG2A 1BHQ1 3ZWPA 1QUEA 2BEVA 1Z8DA 4AF7A 4MJXA 1JFSA 2I6UA 3RFXA 3P0EA 5AVWA 1NE7A 3SEAA 3NJRA 4PLPA 4HRXA 2YY5A 2DUUA 3CUYA 1KZ4A 1Z0SA 2EDCA 1QV7A 2IXTA 2R60A 1RYDA 1S9HA 4LMRA 4BS9A 4MV4A 4U2BA 1G66A 2I03A 5DNDA 3WZMA 2ADOA 5K3FB 4NQZA 4YGXB 4HS4A 1JHDA 3QH4A 4B81A 5EGNA 3PHLA 4JI8B 3DZJA 3Q1KA 1FW6A 3DHVA 1VYTA 3E7WA 1MX3A 1G8YA 3H1FA 3INTA 1SU7A 3M2TA 3M7IA 4E5PA 1L5YA 1VHQA 1VRVA 4BYGA 3VKUA 1E2HA 4N5DA 4EB6B 3WY9A 4BFCA 1EG7A 4XZ3A 2GM4A 1Q20A 2ZIWB 3JYPA 2A67A 4MUMA 4CU2A 1GD1O 2F8MA 3W9BA 1YJAA 2AJLI 2I6XA 3GLHA 4IFBA 4HX9A 4QPPA 4RK5A 4WJKB 1SBNE 1TAHA 3VAZA 3FPGA 2FE4A 2R4QA 4H17A 1IPFA 3UG7A 3TSAA 4AZ3A 5G1PA 1E99A 1SHKA 4Y9RA 4DSOA 4WEOA 1ETUA 3GPDG 5ILGA 2C9CA 2GPNA 1LD3A 4I4CA 3ZZMA 2FDRA 1PZMA 2XZDA 4MWTA 4DZRA 3VO2A 1GZ6A 2FEPA 4QZVA 3AH8A 1WDLA 4NZMA 1GSOA 3FFWA 3OTIA 4HYEA 2J48A 4DMHA 1OC2A 4UHDA 4DG8A 3AVXA 4RHFA 2HCBA 4MEAA 1GADO 3PNQA 2VIIA 4YALA 2ZYGA 2H1WA 5ALYA 3UGKA 3UV6A 4O59O 5A3RA 4OQEA 4RTJA 1WP9A 2ODEA 3PJFA 2YRXA 5BN1A 2OAP1 3LOQA 4N3CA 1OQAA 3P5SA 5IVKA 3CUVA 3RE1A 4EIWA 3RU9A 3PK0A 3GAZA 4A27A 5IWAB 1ORDA 5I9IA 1E5QA 1V96A 2A0XA 5C0OE 4L4YA 3OM8A 3AY3A 2VSNA 1E89A 1RI4A 1F4VA 4DXAA 1JSZA 4RKYA 3ZH9B 4OI1A 1K3UB 4HQNA 4J7UA 3TE6A 1JT9A 2VQ3A 3AWIA 3GEMA 4UVGA 2W00A 2G4VA 4H1TA 3WIEA 4C87A 2MJLA 3QKSB 4ITVA 3AI7A 1XEWX 3PRHA 4GI3A 5HCIA 5CFNA 5C37A 2A9PA 4ZHQB 4OXKA 2PYDA 2HY7A 2P2NA 2WMNB 4FBMA 2GZSA 3BJIC 2XV1A 1CT9A 1HV8A 2NYRA 4MZXA 2X0DA 1MCZA 1XP5A 3LFUA 3TLMA 4DJ5X 1C4XA 4LZLA 3K9FC 3VV3A 1DUVG 2M9MA 3BMCB 3H5OA 3TZHA 3DOEA 3QW2A 4QOHA 2I0FA 4J0DA 3LDAA 1Z13A 5CNKA 5TT1A 3W6PA 2AG1A 2F1OA 1NIJA 2G63A 3QELA 2UUBB 3AVPA 4QAJA 4H4DA 3LL7A 5A3JA 4LMPA 1LLDA 2FUCA 4RMGA 5NULA 3SPXA 2JIDA 1FY2A 1SQSA 5K03A 1QYCA 5BVHB 1XI2A 1YU6A 1F3LA 1I3OA 1DZ3A 1KYTA 2EL9A 2CL0X 1TO2E 1CNFA 3BMXA 5DTMA 5EE0A 3ZZTA 4B43A 4CM9D 3OQOA 4M86A 2WT8A 3F3MA 4IZIA 4O08A 4UUPA 1UEXC 4ZU6X 1DAIA 3RYHB 2P27A 5CB8A 3FOZA 3MJEA 4ABYA 1ZXXA 1ZKDA 2XWBF 4TKMA 2Q5QA 2IY8A 1M6HA 1G8HA 2NAPA 3O3CA 4QICA 1CZNA 4OHUA 5E1MA 4DTIA 5JR3A 1P2SA 1UJ4A 1XMPA 3KCNA 4MWDA 4MGHA 3WBBA 5B5SA 3RQIA 3NKFA 2R5WA 3GOQA 3JPWA 4EVSA 2XUOA 4N8EA 2QW0X 4PPQA 3ZCXA 1EUYA 1X42A 3HUDA 1M74A 1QB7A 2NTEA 2IHYA 4QNMA 4RKWA 3INYA 4D6YA 2LIPA 3B51X 1NTOA 4PBRA 3PG5A 1UPTA 3WV5A 1VKOA 2FLWA 2C7PA 4L50A 3RT9A 8MHTA 1J07A 2DSNA 2PUEA 1V7PC 5KYXA 2J31A 3IAXA 2P8JA 4IRXA 3B6MA 2PL3A 3WNZA 5LIPA 5GJBA 3JALA 1DQNA 2A78A 3AGQA 4WKCA 2NP6A 3GX1A 4ER7A 1KAEA 2EYUA 3ONNA 4KH1A 5B58T 5ALKA 3VR2D 5M3BA 4A5OA 2YIDA 2O5CA 1UZLA 4KQEA 3N5KA 5AXDA 1XZPA 2AEFA 3W4KA 4M3NA 3LGAA 3SX2A 3V6MA 2DAPA 2WKPA 1EUZA 5EWMA 2ZR8A 3W2EA 1XD2A 5BP7A 1CUDA 3I6IA 5T67A 4JJEA 2QRKA 2Q6VA 1P0IA 2QTBA 4WNCA 3DG9A 3FOAA 2V96A 4BLUA 4AS1A 4LKRA 2AOWA 1SURA 3S2SA 3MJTA 3IUPA 3BB4A 3V34A 5EUMA 1R4ZA 4KGZA 5L3QA 1IVNA 2ADFA 1H2AS 4MS3A 2H3EA 3H99A 1NAHA 3KOXA 2YWDA 3DONA 3DW1X 1GTG1 4DUGD 5ESDA 2JLSA 3GVHA 1E4VA 2OZLA 4MW2A 1GGJA 1EDEA 3CPJB 4FX5A 3DBOB 3TSZA 2HFKA 2VNJA 3EHEA 4WBNB 1EK1A 2CWWA 5EJEA 1NNUA 4FU0A 1TMGE 2C5LA 1ADFA 1GVNB 4N12A 5JSKA 3LBAA 1E1QD 5AKJA 3E2PA 2MYTA 4RK6A 5D1HA 1QPBA 4WDQA 1QBGA 4ACAA 1WNFA 3BGVA 5A06A 1JLKA 3K9CA 1VCHA 3HDJA 3WKEA 2X86A 2NN3C 3NRJA 3NHUA 3IUMA 4R2HA 4BNIA 5DGDA 5CFOA 3IELA 5KMGA 3H1TA 4WCFB 1YXMA 2YBDA 4G37A 1CDZA 2O2GA 4KBYA 4CQJA 3IULA 3EARA 2GKSA 1E1NA 3TTTA 1IOZA 1JYFA 4HBGA 2Y3IA 2XWJI 3WLMA 2C00A 2GZ3A 3DE5X 1EYZA 1RR6A 1BRMA 3CVJA 4HF7A 2E4ZA 5AWFC 4JA2A 3RRMA 2XE4A 2O19A 1N1GA 5H68A 1GFIA 4Y6GB 1P9NA 2BT4A 2MINA 3BWVA 3H7AA 1PWEA 2XVMA 5C81A 4NCXA 4BCCA 2JJ1D 3KQHA 3LAWA 5KTNA 1T9AA 1UINA 4BATA 4UVIA 2CHQA 1ML4A 3G9QA 3LXXA 4N5NA 1N0HA 1VSTA 1YMUA 3TRHA 4PG4A 3VQTA 3PNBA 2W6OA 4A6XA 1G98A 1HK7A 5B53A 3K9HA 1L5NA 3KR0A 1NW9B 3BH6A 1A7UA 4XGKA 1QIGA 2WFAA 4IG4A 4K9NA 4DA7A 1ST3A 3WGMA 2VWGA 1OLXA 2J3JA 3IMCA 4H1HA 1QX4A 1HT0A 3IKVA 3T4PA 4KBFA 2GVNA 4P3NA 3LQ1A 4TOIA 3KYDA 3NHMA 4A2PA 2WKSA 4TVSA 4X62B 2BFDA 2PZKA 5EVJA 2C99A 2UYGA 2ORWA 4D0GA 1H1TA 4O33A 3AETA 4H6VA 1AQYA 2K2QB 1UODA 2AEMA 3U7FB 3U19A 5HG0A 3ZHQA 2OFWA 1TZJA 4W5TA 1DS6A 3FGOA 1ZD1A 2GXSA 1BDHA 4LE1A 1ENZA 4B3SB 4BKQA 4X61A 5JCJA 3VSCA 4ZN6A 3PFBA 1JP7A 3CMMA 3C48A 4JLDA 4KXFB 3ZU4A 5IKMA 1H2RS 1PYGA 4KK3A 2QENA 1I2AA 2ZR9A 2ZTMA 5CX4A 5KEIA 5L6LB 2ZBVA 3QM1A 3E7XA 2GEJA 2XVXA 1UXKA 1U2DA 3V7FA 1HL3A 2W42A 2ZJ0A 1T2AA 5D5HA 5L40A 3T0GA 3TLKA 1SXGA 4JVNA 3G82C 2G7ZA 3P8ZA 5CIWA 4QGGA 2LIVA 5J1TB 2QPTA 3HPQA 3I83A 3AYZB 1W581 2YJ6A 4HEQA 4HXFB 1GV1A 1NXVA 1UM9A 2PPVA 3DS8A 2HJSA 2X2EA 4GMXA 4EWLA 4LK3A 1YU9A 5DOVA 3AVQA 1V26A 4B87A 1OT3A 3ND6A 1W9HA 4RA9A 5LLSA 4PZYA 5AI9A 2OFFA 3CB4A 3SICE 4AF6A 1L4FA 4DM3A 4DNPA 1PT6A 4HX2A 1MW8X 1GTZA 5LMNB 3O93A 2C8VA 4GMHA 3H5IA 4ND1A 2BMVA 1TC2A 2GN2A 4HVAA 3ZHUA 5DCWA 3JPYA 3HWSA 2EJWA 4BE7B 1UMKA 5ERXA 2WNHA 2JD0A 3RFTA 3SJBA 4EW2A 2I6QA 2WSYB 4G5FA 2IU0A 4E13A 5EQDA 3BXOA 3TW8B 3D3EA 3ENKA 3QMPA 4L8GA 2QROA 4NE9A 4NMWA 3KZXA 4CM8A 3P32A 4KWHA 2VCYA 3CLTC 4DGSA 4EHHA 2CF5A 4RVNA 3PWZA 4FFDA 3RVRA 2ATEA 3Q7TA 3GN1A 4HQ6A 3NH9A 1GZUA 1JU9A 4OHOA 4CUKA 4KRXA 5D51S 2RGDA 1U8FO 4YYZA 1ZR2A 1XTQA 3D3JA 3VX3A 1O6GA 3ONEA 4FFRA 1A88A 1OZFA 1Y6RA 4BUZA 1TJYA 1M5TA 4PSAA 3O9ZA 1T0UA 3L1UA 3JYQA 3E27A 6ADHA 5H5JA 2GHQA 5IC5A 1K0FA 1N9GB 4RD6A 4Y2XA 3E3NA 2XB4A 4B6PA 1QKKA 3RM3A 4ONEA 1KC1A 2FWNA 5AK3A 1TYAE 1IRXA 1CUUA 2DU8A 2PVPA 2HJWA 3PTAA 2WVJA 1I4TD 2Y05A 3ZDBA 3W0LB 1TRHA 2NTJA 4V0ME 2IV2X 3A7EA 2RGRA 3U4GA 4PXSA 3VPHA 4KTVE 1REQA 5B1IA 3VYVA 3OQIA 4R1OA 2PY6A 2F62A 3T9FA 5TPWA 2P2DA 3EJ6A 2FN8A 1E64A 1MAHA 2FPIB 1BVRA 2ZCVA 4HPJB 1K08A 4OA8A 3LVBA 4MA4A 1JG4A 3ANNA 3MRVA 1HYQA 3Q7IA 1PX0A 2IPXA 1J2EA 4MVJE 5JWRA 4AZ0B 2J67A 4BMCA 2BSAA 3LPLA 4ZWNA 4G8CA 1M34B 1O57A 3QEOA 5GM2A 4WOBA 2NZ2A 3KAJA 4UC0A 3OE7D 2Z1DA 3OUZA 3VYRB 2X76A 4ZCMA 2D5BA 4LW8A 1SCQA 2HQRA 3RF6A 1QZTA 5EPUA 2PZ8A 2FZ4A 4KFTA 2VYVD 2ODQA 5IP5A 3BD7A 1OFVA 2A84A 1I33A 2YVAA 3EZ9A 3F4KA 3BAZA 1Y82A 1W0JD 4KFCA 4RSHA 2VPWA 1LW7A 5FWXA 2G06A 4L95C 3WHPA 1IULA 1H6CA 2VHYA 4Q3DA 2ZBRA 4B7CA 2ZJZA 4B84A 2FETA 4HMPA 2NV0A 4GOXA 1N5MA 1VBNA 1Y7PA 4KX3A 1YB6A 3CSUA 3T7CA 3BFVA 4JLAA 5B2ZA 2OT3B 5GADl 4V0LA 3AUFA 4NBSA 2Y1XA 3AOGA 5AW2A 5GV7A 2PKCA 3ZE8A 4BECA 3NWJA 4HDNB 3V33A 1SC6A 1ORHA 4N5HX 2QT9A 3EVFA 2BFMA 4F3CA 2DFTA 5L4NA 4Q1AA 1Z6PA 2F1IA 2FW9A 4BZXA 3WQSB 3SP1A 1HBJA 5FDFA 1ZJWA 4W8HA 1EJBA 3IEKA 2V7TA 3O8DA 1T5DX 1D2EA 2FNAA 3T3IA 2WD8A 2QS9A 5FTNA 4YRMA 5B3JA 4CWAA 4MQ4A 1SG6A 1XROA 4CM1A 1MD9A 5E6RA 1TKAA 2ZP1A 3FTDA 4AIIA 4QBTA 3HADA 1I4LD 3Q6MA 1F5NA 2HD4A 4A4DA 1SUWA 1I36A 3JTMA 3A4TA 4UNPA 4B44A 4E5MA 2O8FB 3HB1A 3IJ5A 1HURA 4GR5A 5HM8A 1JEYA 1YB7A 2ZRQA 5ENDA 3SI7A 4B8WA 1RXVA 1YBHA 5EKXA 4G25A 5JECA 4E5KA 2XVZA 1C1XB 1KO5A 3OIVA 3OOYA 4EHNA 5KQMA 1YJ5A 3B82A 1A0OA 1FDRA 1A9ZA 2FWRA 2GZDA 4I9NA 5FXMA 2OENG 3VISA 4IUBS 1HPLA 1P18A 3C15C 1CIVA 3QY9A 4JA0A 4UPEA 5MDHA 1TF7A 1XD9A 4RTRA 1Z6AA 1QH1B 5JE8A 2VRCA 3BMQA 2O06A 2WIDA 3AU9A 1IMJA 1NFRA 2AYZA 2VDWB 5FWYA 5TQ0B 4BVAA 4HDAA 4MR7B 2BN4A 2QTZA 4XKJA 4HLUC 1F0KA 2NAFA 2AN5A 1X7HA 2ZRDA 3DDOA 4HLNA 3TAHA 3W3ZB 3THWB 2YXEA 1V11B 5DISB 2RHJA 3O75A 1D4FA 2DUNA 2W6JD 1DGQA 1QO0D 1MH9A 3G23A 5BSEA 2UVPA 1L4MA 2R6R1 3I4CA 4HH1A 5J63A 4FR0A 2LWIA 3KKOA 4MO2A 5GMOA 2APJA 1HORA 2QN2A 3CLTD 4AY2A 2YHBA 1XMIA 3CJRA 3VTAA 1PI3A 1N25A 1Y81A 2AQHA 3GRAA