2ID7A

1.75 a structure of t87i phosphono-chey
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
127
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of T87I phosphono-CheY and T87I/Y106W phosphono-CheY help to explain their binding affinities to the FliM and CheZ peptides.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 44
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2id7A00
8ABPA 2FVYA 2W42A 4IRXA 3KYJB 3HJFA 2FLKA 1D1PA 2LP4Y 3H5IA 3FDFA 3Q7TA 1LBHA 1USGA 3T95A 2PUGA 2NZUG 1TMYA 5JNTA 3QEMB 1JHZA 4UHJA 5KQGA 4M88A 1TM2A 2IKSA 4MS4A 4RKRA 3FFTA 4KPYA 3QELB 3K9CA 5TPWB 4NCAA 4KZKA 3F6CA 3H5OA 3O74A 4HNRA 4ML3A 4MQFB 4PE5B 3RQIA 3FMVA 2QW1A 4F8JA 3QLUC 1YMUA 3QLVC 4HNSA 4OTZA 3FFXA 3IPCA 3OO0A 4G97A 4G0OA 1QKKA 3O2JA 4EYQA 1YTUA 1BDIA 1Z2EA 4RU1A 3LUKA 1F4VA 1LBIA 3EJWA 4N76A 2F8SA 1M5TA 1QO0A 2PAFA 4EYKA 4QICA 1CHNA 3MYYA 3LUJA 2YHAA 2FKAA 4MQEA 3EAFA 2N9UA 1GUDA 2GWRA 2FEPA 3N75A 3CG0A 3EODA 4WUTA 4JB2A 1ISSA 1MIHA 3SY8A 1BAPA 4E7OA 3CNBA 4RSMA 5IBQA 2GX6A 2VUHB 2JVJA 4IF4A 4O5AA 4XAQA 1EHCA 2QSJA 1BVHA 4H3HB 2LBPA 2E4UA 3SQNA 5TQ0A 1P2FA 1QP7A 3LUDA 4MR8B 2MSKA 4Z4CA 3O1HB 2QR3A 2WRZA 4FB4A 3DLBA 3RVKA 2RJNA 3CHYA 3NHMA 5FWXA 3GL9A 3KS9A 3P9YA 2P9HA 3IPAA 1GCAA 1JX6A 1NXWA 4GNRA 4HNQA 2JCGA 3H1GA 4QYMA 1NXTA 4L85A 2IPMA 3CG4A 2AYXA 3D02A 1U2PA 1DCMA 2FLWA 1SD5A 3O2SB 4LE2A 4MR9B 1PNRA 3M9XA 1F51E 4RXTA 5CNJA 2P4UA 3EQZA 2NT3A 4XLTA 5CNIA 1JFSA 1D5WA 3N8IA 5TE9A 1U8TA 1MB3A 1JH9A 3MA0A 3BREA 1EWKA 1JYFA 4OBBA 1YK0A 4LRQA 1FFSA 2HPHA 4JA2A 3RVPA 4GPAA 3F6PA 1DBQA 3QEKA 4RKQA 4LDZA 4ZPJA 3IP9A 5EWLB 1L5YA 2I6FA 2PUEA 2FMKA 1Z18A 4EVRA 3D8UA 3HEBA 4N03A 4NICA 2PE5A 2RJOA 4O1HA 4KVFA 1TLFA 4RK4A 1JDPA 1YS7A 3VNAA 1M5UA 4P1ZA 1NXPA 3CKMA 3HV2A 3W9SA 2MSWA 1YIOA 2PUBA 2YHBA 4KMRA 3N0RA 4W5OA 1YS6A 2FN8A 4ZMSA 2PUAA 2NUBA 2GKGA 3L6UA 4QPJC 4IMIB 3NNSA 1ZHHA 3EDCA 2WJWA 1MB0A 3O21A 5IEBA 4EGSA 2PKXA 3HCWA 3HUTA 1ABEA 1ZY2A 3JVDA 3CRNA 4MPTA 1JL3A 4KFCA 1EWVA 3Q15C 1RPJA 3I09A 3OLXA 1DBPA 4G86A 4OLBA 4Z0NA 5IX8A 5FWYB 2JB9A 3QLVA 5EWJB 1A2OA 3TX6A 1J56A 4W5QA 2A9RA 5HSGA 2PL1A 5DTEA 4KK3A 3F73A 3QK7A 3S99A 4H3KB 3O2QB 3EGCA 1CEYA 4EUKA 4YWHA 3HM9A 3CS3A 1Z16A 1GCGA 5JNVA 2L2QA 1KGSA 3NNNA 2FQWA 4RV5A 3T38A 1U04A 2AYZA 2E4WA 1RXIA 1EWTA 5TPZD 4WT7A 1DRKA 2A9QA 4G0ZA 5EWMA 2KYRA 2DRIA 4HYEA 2FW0A 2R47A 4PZ0A 5JNSA 5KQLA 3NBMA 2CWDA 2GI4A 4YO7A 3SAJA 4W5RA 2FXIA 1EAYA 1ZDMA 4JB0A 2IOYA 1PNTA 3QEMA 5DCLA 1E6LA 3KLNA 3M9WA 3HDVA 2E4VA 1ZITA 4MS1A 4N0PA 3LOPA 5E3JA 5IULC 3M6MD 4NV3A 4RXUA 4NCBA 4F11A 4MYRA 3OLZA 2H3HA 1DBWA 1BDJA 3C3WA 1Z26A 5HM6A 4MR9A 3OQOA 1I3CA 2ZWMA 5C5CA 1TJYA 2GBPA 4EVQA 1JBEA 1D4ZA 4MR7B 1AB6A 4WWHA 2JVIA 5DGCA 4EY3A 3KSMA 4KV7A 6CHYA 1RZRA 2PMCA 4FE7A 2Q5CA 3KG2A 4MS1B 1JFTA 1ZAYA 1Z25A 2LIVA 5FWYA 5D2CA 1NY5A 2H0AA 5HQJA 1SXGA 5T7BA 5JS1A 2MYUA 3L49A 3MM4A 4IMJB 1JLKA 3O1IC 3GV0A 5EWMB 4LE1A 1PEAA 2PL9A 1ZN2A 5IEJA 4UHKA 4Z4IA 1DG9A 2MSLA 1ABFA 4IGAA 4RZSA 4YRZA 2VYCA 3B2NA 1UDRA 3DGFC 4PEVA 3SG0A 1MAVA 5IC5A 4JASB 1R8JA 1DJMA 2TMYA 3RVQA 1DZ3A 2JK1A 4MRMA 1ZGGA 6ABPA 4N47A 5JNUA 4MLCA 1LJLA 5DLEA 5IUNC 4G0XA 1P8AA 2E4XA 3JY6A 1KRXA 3LFTA 1U2QA 4MLDA 5CHYA 4TLLB 2IPAB 1E6KA 2MYPA 1Z15A 1L5ZA 2J48A 2E4ZA 1DC7A 1D1QA 1KMIY 3CU5A 3NNDA 2IDMA 2WB4A 3TD9A 1RNLA 3MQ4A 4RK0A 3QLUA 4MGEA 5PNTA 3RVRA 2ZAYA 1ZH2A 3HO1A 4H60A 4TLMB 2F8TA 4YR7A 1YMVA 4L4UA 3JPYA 4Q7EA 4N41A 2L19A 1XWWA 3OMXA 3T6KA 3RVMA 3CZ5A 2FMIA 4W5TA 2IPLA 4RY0A 5EWJA 4ETMA 1TVMA 3E61A 1JF8A 2JRLA 3OM1A 3ROTA 5FBKA 1VPWA 3SNKA 2PUDA 4NQRA 1S8NA 3DGEC 1Z12A 3GT7A 3OQNA 3E3MA 2A9PA 4MAAA 1APBA 3RVSA 2O20A 3O1JC 3TMYA 3H5VA 3H5LA 1PEYA 3H1EA 5ABPA 3EQ2A 1NXXA 3KJXA 3GRCA 1LK0A 1VKRA 2FSPA 2FTKE 3QX9A 1QQBA 2FEKA 1DCFA 5IUKC 1FFGA 3F7NA 2M98A 1ISRA 3C97A 3A3KA 4KQCA 4TN5A 2PUCA 1KRWA 5ED4A 5T3YA 1DP4A 2HSGA 3HDGA 3LUCA 4OG2A 3CTPA 4TMYA 4DADA 2NT4A 3Q7RA 1RXEA 4Z99A 2FEWB 1BA2A 1JYEA 3KTOA 4XFKA 1SXHA 5GOTA 2OENG 5KC9A 1URPA 3HVRA 4N0QA 3RH0A 2ID7A 2IYNA 3OLVA 3RVLA 1U0SY 2FQYA 2ID9A 1GUBA 3QELA 3H1FA 3CLKA 3JPWA 1A0OA 1XHEA 4Z4GA 3Q41A 2R48A 4WZZA 4MS3B 4D74A 4KREA 1QMPA 3GYBA 1WETA 4OLAA 5B3JA 4PYRA 1NXVA 4YV7A 5TPWA 5TQJA 2RDMA 1K68A 2L17A 1QP0A 3A0UA 4G0MA 1ZVVA 4JP1A 1Z13A 1BDHA 2QVCA 3K4HA 3H6HA 1ZGZA 3ILYA 2FMHA 3URMA 1YK1A 3MMNA 3C3KA 1DCKA 4ZJPA 1Y1LA 5IUJC 4LX8A 2R4QA 4MR7A 4YS6A 4WXMA 1ZESA 3LMKA 2WMYA 5DKFA 1IIBA 3Q7SA 4JOQA 5JNRA 4LZLA 4S05A 5TQ2B 1C4WA 1QO0D 4RK6A 1DC8A 1USKA 3ILHA 3G85A 3RVJA 3RVNA 4Z4FA 3QX8A 3N53A 4MQEB 5TPZA 4D6XA 3OQMA 5CNKA 4S04A 1PHRA 3H5TA 2WWVD 4MS3A 3DBIA 3BRQA 2HQRA 4RK7A 7ABPA 1SXIA 1P6QA 1NXSA 2BGGA 3IP7A 1B00A 4G0QA 4DN6A 4RY8A 5FBHA 2QXYA 2JVKA 1OXBB 1QP4A 5KI6A 4LE0A 1M2FA 1P6UA 1MVOA 1W25A 3H75A 3CFYA 4EYGA 4YCSA 5KQMA 5HKOA 1RZRD 2X7XA 4Z4EA 3BILA 4XASA 4KNYA 2QU7A 4Y9TA 3JS5A 3KLOA 4RY9A 1Z2DA 1QPZA 3HSYA 4XARA 4YP9A 5TQ0B 4ETNA 1ZH4A 4XXHA 1JDNA 4D6YA 3DZDA 1FSPA 3IP5A 3OM0A 2HQOA 2PJUA 4RWEA 3EULA 4G0PA 4G0YA 3N0WA 1QQAA 3A0RB 3R0JA 1GLGA 3I45A 1EFAA 3MF4A 3A10A 2VUIB 1QNLA 4Z9AA 9ABPA 3OLYA 4Z4HA 1PUXA 1LJUA 2CHEA 3LUAA 4O1IA 4DQDA 4F3TA 1E2BA 4Q6WA 1E6MA 3HS3A 5BRJA 1A04A 2A9OA 4EYOA 2FMFA 1W9HA 3IP6A 3N0XA 4RS3A 3SM9A 3JTEA 3LTEA 3H6GA 2HJ9A 3H5WA 1M2EA 2OQRA 2IPNA 1OXKB 2WJAA 3N6VA 3BRSA 3JVIA 3LUHA 3NHZA 2JBAB 4MR8A 5BRAA 5B3JC 3VNBA 3O75A 4KRFA 3GA5A 4MQFA 2PLNA 3MIZA 3FFWA 4W5NA 3OLWA 4RXMA 3C3MA 3TB6A 1FFWA 3KHTA 3LUGA 4RDCA 4F06A 3GWGA 4FE4A 3DLHA 3RVOA 5BQ3A 3T8YA 2LPMA 1HEYA 2LUOA 2XDYA 5CNMA 4ETIA 3KCNA 3KKEA 1JWLA 4ZYLA 2MYTA 5BR1A 2M1ZA 3ROFA 2NZVG 1CYEA 4YGXB 5I4CA 2FQXA 1JFVA 1H9CA 2RGYA 5KC8A 1USIA 5EWLA 1C0EA 1DRJA 3GBVA 5F64A 4E7PA 1VRVA 3KYIB 5FWXB 2QVGA 2L18A 4WXEA 4LDAA 2B1JA 3TO5A 3HZHA 5KQPA 5GQSA 4F12A 3OO1A 4B09A 3HK2A 4Q6BA 3FGZA 4RK1A 3GBPA 4KQ9A 3CZCA 4Z9BA 5JNWA 1NATA 4EVSA 1NXOA 2CHFA 1D2AA 1Z17A 4PICA 3I5AA 2JBAA 4YLEA 3QLTA 3Q9SA 5KWSA 4RK5A 2PUFA 3C6QA 1T34A 2QV0A 3BBLA 2CD7A 2HQBA 2V0NA 3HXMA 2R25B 1AB5A 4MS4B 3IDOA 5TQ2A 1SRRA 4QYWA 3G1WA 1VLZA 2VK2A 4OATA 5JS2A 5C5EA 2B4AA 1NTRA 3LKVA 3OMWA 2WY2D 1FQWA 1YVUA 4IILA 3LKBA 4P98A 3UKJA 4MRMB 3LUFA 3UK0A 2FN9A 3HUUA 4ZMRA 1K66A 2MYNA 4JAVC 3I42A 1XHFA 3UUGA 4CBVA 2QZJA 2E4YA 4KK4A
chains in the Genus database with same CATH superfamily
4W9RA 2W2NA 1XMOB 4QODA 2D0OB 4LOAA 4B47A 4W8GA 1OXXK 1KDPA 3GGSA 2C2BA 3BWEA 1TOAA 2G82A 2YC4C 1AX9A 1JBQA 2HREA 3Q7TA 4KXVA 3B1YA 1ISHA 1GNRA 1SFRA 5LJLA 5JNTA 5JTTA 5LB2A 1J4AA 3E4CA 2Q5LA 4XIYA 1KVTA 1O95A 5I7AA 4N12A 4ZICA 3K5PA 4CLRB 5ICCA 2I3BA 5TT1A 3KVOA 5G1PA 5EC8A 5TPWB 1CW2B 4M36A 1GPKA 3DHWC 1ZU5A 2OXIA 4NATA 4IPTA 4ML3A 1ONPA 1HO3A 1K06A 1RAHA 1CIVA 3GGDA 4O0LA 5EMNA 2VXCA 1L8XA 3QLVC 4ZVMA 2EX0A 4BNFA 5D5HA 1ZKDA 4G1UC 4LK2A 1PYOA 1AO0A 1H69A 2I7DA 4DQLA 2GEJA 1FP1D 1SXJD 2ONJA 5K09A 5KTPA 3R9XB 1RRCA 3BVPA 1A9QA 2YKGA 1NYLA 4WFQA 1OVMA 4J16A 1E3LA 1JKXA 3A1WA 3OIFA 1BA3A 1ZIDA 1KZYC 3VX4A 4YRFA 3FMGA 4QICA 1KZHA 3KT6A 4Q3KA 4JYZA 2C7RA 4LNUB 3NP7A 1K8YB 2PS0A 4QREA 4UU7A 4CKXA 2HT6A 3C41J 3EAFA 3H05A 4PHCA 2M6LA 3O8CA 1GFIA 4JLPA 3MEQA 3Q11A 1VYHA 4NDNE 5FD8A 3SYKA 1CHDA 1G0OA 3GIDA 4RVDA 4DXAA 1VE9A 3AP1A 3L7CA 5F5NA 1EWYA 3IQFA 4UE6A 4ZQBA 3RTAA 2PSEA 3U31A 4F9FA 4R1PA 1EDBA 2CNNA 1U9IA 2DC1A 3SQNA 2WHPB 3HBLA 2JFGA 3NTRA 4WZBB 1GKIA 4L4YA 3DWFA 5BYBA 1FRVA 3S1AA 5EMKA 1I6MA 1S3SA 4UAJA 3BTUA 4DMFA 4YC7A 2PFGA 3OOWA 1A98A 1ESZA 1H23A 2PX2A 4KFUA 1WULS 1DJLA 1SU7A 3P2IA 4NMMA 4JFAA 1VA4A 4JVOA 2HJRA 1ZOIA 3QH4A 3QPWA 1DIHA 4NHEA 4DQVA 4EO7A 1CJKC 1XPUA 2Z6AA 3T7IA 5KNBH 1Z6ZA 2G9RA 1HZJA 2GM9A 4DWOA 3PJFA 3C14C 1MKYA 1K7FB 2FZLA 1TLTA 1PNRA 3HA7A 2IOQA 3NS7A 4DAEA 2QMEA 3IUPA 1XXHB 1LC3A 1TKAA 3SJAA 3LXXA 4Q1BA 3W5UA 1WVGA 3PWSA 4ESVA 1QM5A 2WIKA 3TIXB 2HLNA 1BXGB 1MB9A 1NVBA 1U8TA 2X4DA 1B41A 3JWJA 3P4UA 4L8YA 3SOPA 3ZE0B 1E1LA 1XEXA 4PLPA 4LRQA 3GH1A 1H4VB 1E3EA 1U0OC 2V6FA 3QSGA 5IARA 1TVEA 1EP2B 2C57A 1WSWA 1ML4A 4LQLA 2XQIA 4RLHA 2FHPA 4AUMA 4EJFA 3QX3A 2VF8A 2NSHA 3L7KA 3CC8A 4JU9A 4O3MA 1U8YA 3ZCRA 1R2QA 1O89A 3ZE9A 4MIEA 3Q72A 1W0CA 1ODKA 3VO1A 4D4GA 3B3AA 4MUFA 4F4UA 4NICA 3H2YA 4Z9XA 4L5IA 2TECE 2ZJOA 5CYGA 5G4KA 2O5EA 5CVCA 3LQFA 2GEFA 4BNXA 1QG2A 3AG5A 4JBXA 3UENA 4X60A 3I1IA 4XWYA 1MC5A 3WK9A 4HLUA 3EF0A 2A67A 2VWGA 3G9UA 4KI0A 4KMRA 5JAQA 4MLZA 4AUKA 2FSVA 4M9XA 1V5FA 1KY3A 3LF2A 3M3PA 3ELWA 3L6UA 4ZMSA 1PR6A 1I3KA 2IQIA 1XIVA 4IMIB 3NNSA 5TGDA 2C83A 4LY6A 3DXZA 5KTNA 1R74A 1HE5A 1WU7A 5IEBA 3RARA 2W6NA 3U4QA 1WXWA 4X91A 4DRXB 4HVCA 2ZYTX 2QLLA 1ABEA 3SN6A 4JKIA 5FI0B 1KA9H 3Q15C 1BXRB 4UZSA 2A57A 4KQMA 2AW5A 4G86A 4OLBA 4PLFA 4F2PA 2IZ5A 4HS4A 5AKYA 3ENQA 3QLVA 1PTJA 4G4SP 5F3DA 1WTAA 4FDLA 4WZBE 2QX4A 4BATA 2ZJFA 2AXEA 4FILA 2GSDA 4DA7A 5JVDF 1O96B 4FYPA 3HRHA 4MWEA 3IAM1 4C03A 1N2GA 1EGAA 1E1DA 4J4TA 1Z16A 4RH0A 4DCJA 1AS0A 2C5EA 1JMYA 1GZDA 1YUMA 5KC9A 4ARCA 1GFWA 1CZRA 3A8TA 3AERB 2NU8A 3B82A 3F6EX 3KKKA 4HNTA 1KBQA 4UU1A 4KC0A 3ZXXA 2R47A 2B5WA 3UXYA 2X0FA 1YSCA 2FZ4A 1NTOA 4LQCA 4H17A 4X7BA 4EJMA 2PUHA 2OM2A 4LA4A 5JU6A 1NQUA 1R5NA 1TPZA 3W6OA 4JX8A 3L8MA 4MS1A 4N0PA 4P7KA 3BB4A 4G1CA 1RYBA 4F11A 4D56A 4A36A 1OAOC 1RW4A 1T25A 2VJAA 2A2ZA 2O2GA 1NW9B 1P2UA 4KEAA 4LZZA 3FVQA 4QUAA 4RW0A 3TDKA 4ESEA 4BGUA 3TGPA 1G17A 1EDZA 5EA2A 5G1OA 1IJEA 1JBEA 1TM3E 2OOSA 4CT4B 1M2NA 2DQ4A 2H0RA 1NQWA 2FPGB 1IRIA 1C0KA 2ERXA 2GZMA 2I2XB 3K05A 4N9WA 4AJLA 4EELA 6CHYA 4KHZA 1BRTA 5LZ8A 1KEEB 4RD4A 3QVTA 3KG2A 5FWYA 1RXSA 1KBOA 1OFHA 4NYMQ 4YALA 2C00A 3JQ8B 1OH5A 4Q1DA 2RHJA 5F1YA 1BO6A 1UXHA 2YMQA 5CJ2A 4UREA 1U7DA 3TUIC 1AQJA 1JT9A 2EWWA 3A6EA 3E05A 2R8BA 2AG0A 1ESEA 1XFDA 5H3HA 4RDHA 4OJMX 1YMQA 3IT3A 3V6LA 3GLGA 2WUEA 3Q98A 5IU6A 1SKAA 2JFWA 3CVWA 3RB8A 1ZNYA 3FRHA 1SVOA 1Q0QA 3JQFC 4J3FA 3RJZA 1D03A 5AOAA 3RLFA 2UYOA 5KCZA 2BFFB 4I4LA 4P7GA 5JWRA 3SBEA 1T8YA 1ODFA 4B3FX 2ZDQA 5I9LA 5CW1A 1ZFNA 2P2SA 6ABPA 1CP3A 4PM4A 2WHEA 2X2FA 3D7RA 5ALIA 1M6HA 1P1BA 2QYSA 4QASA 3R6DA 1JHMA 3GJ4A 5LXTA 1GR1A 1UDBA 3JQGB 4L5JA 3R7WA 3KD2A 3CE6A 4TS3A 1U2QA 2X4GA 4EZIA 4F5EA 1E2EA 4MYTA 4WJZA 4XM0A 4UDYX 3GLIE 1STOA 2MYPA 2RB4A 3D6AA 4ZO4A 2BHTA 3MGCA 1GUYA 4FS8A 1GDHA 2C2XA 2SHKA 2IDMA 2RK4A 5TJ9A 2WB4A 4R2KA 4K0RA 5BN5B 1P2SA 1IN7A 2GQ0A 3BSFA 4N6OA 2ZE5A 1Z2OX 3STYA 2IPXA 2QT0A 3E0QA 5H68A 1NG9A 5EIXA 3U09A 1A77A 2NU6A 3G2KA 2QD1A 2W7TA 1LSUA 1Z6AA 3JW8A 5DJ5A 4QTZA 1XWWA 3GLSA 4N41A 4EVQA 2Y1GA 4KHPB 1M3SA 3DE5X 1HDEA 1SA0A 3T6KA 5DHPA 4KAXA 1EQ2A 4KQEA 5BR4A 3C1UA 3EGIA 2FMIA 1IZZA 4BNYA 2B8JA 4F9GA 1T2NA 4R1MA 1QHNA 3KJNA 4G4SO 3LY8A 4CQJA 3BE8A 1RXCA 2GH1A 4LRYA 2BL4A 2G28A 4TTIA 1SXJC 4D9EA 4EHHA 1S0UA 1E6WA 2Z5LA 3A7EA 1NP3A 1ULTA 2BP7A 4QUKA 1UH5A 2WAAA 2GYWA 1CK4A 1PZGA 1RYFA 2OESA 4JV5B 5BOVA 3RNLA 2NZWA 1I6KA 1PEYA 1XMJA 2BKEA 3NC1C 1N9ZA 1J07A 3RAJA 2ODQA 1CV2A 4NTZA 3AUTA 4WXPA 2CV2A 2G09A 1DBVO 3GPLA 2QUIA 1J2YA 1GD1O 5AI8A 4HXEB 4MEJA 2IZ0A 3QX9A 5KX5A 3DV9A 3K3PA 2FEKA 2GAJA 1EFCA 4FDVA 4D9CA 2H2IA 2A35A 3W8NA 1D2CA 1DPFA 3HCBA 5HIAA 3FA2A 1PJTA 2QMHA 2XJ4A 4G1VA 2XKBA 2VP9A 4QBGB 5HRAA 1BWPA 4LAFA 4C4ZA 3W5BA 5THKA 3V1LA 4M99A 2Q2WA 1IHXA 2DHQA 3F1KA 3NBZC 2W0MA 2OP0A 3FVVA 3HVRA 2V97A 4KJXA 3AOEC 3AY3A 4G4JA 4OY3A 3U4DA 1B93A 1B0UA 1LVUA 2QN9A 2ZRIA 3QXHA 4K9QA 4LTDA 3PNVA 2Q3EA 1BQ4A 1KQPA 2RAUA 3I9MA 4DSTA 1JR2A 3JXEA 2B83A 4WZZA 2K7ZA 1XQXA 2OEPA 1G21A 2QJTA 4P2BA 2I76A 2R5NA 5FPSA 5NLLA 1JSCA 1SHTX 5JECA 1WETA 1XNHA 4NABA 2XCQA 1NXVA 4YV7A 1DVRA 5JCJD 4YRQA 2ZFUA 2WB2A 2UVPA 3BDAA 1QIFA 4FYMA 3BUSA 1ADJA 4G5GA 1L4YA 1QYVA 3F78A 3O4FA 4B45A 4DPKA 4PC1A 1KAOA 3QKSB 1X1BA 3PPVA 1FDIA 2GXAA 2C5FA 1P77A 2OHIA 1V3QE 1RLJA 2PMFA 2VP6A 2XH8A 3AHEA 4HUJA 3KKZA 2E49A 1RWMA 2H2WA 4WXMA 4Z5XA 3GLFE 3IQXA 3B5IA 1HZZC 3A58B 4MKGA 3N8GA 1G5IA 1ADYA 3CEHA 1SRQA 3AJEA 4ERXA 4QG3A 5MN5A 1Y63A 3KV3O 3ECCA 3EYWA 2V6IA 2X1MA 3CUUA 2FWNA 4KWEA 4F6RB 4PN7A 5JSZA 1EHYA 2F8MA 1Z0DA 2FDRA 1ZNWA 1Y5MA 2C2HA 4GSKA 1H85A 1PD1A 2A9FA 1KZ9A 2K2WA 4OI4A 3OMLA 4X20A 1B0PA 1L4KA 1ORVA 4RKEA 3KD3A 3TR0A 2CFSA 2CNDA 4HQ0A 2ZYDA 4DYHA 4BZZA 2WFLB 1U5AA 4FEGA 1N6RA 3W5IA 2H29A 1G3QA 3OKCA 4N8DA 4YAEA 1CY7A 2EP7A 4MMXB 4U1RA 4J2HA 1VXRA 4G5RA 1LZLA 1CUZA 2Q1TA 1X70A 2IOHA 5FWDA 4B79A 1MABB 4DWJA 2BFWA 4JI4B 1F0KA 1VMAA 3FD8A 1U0FA 1UKCA 1FP4B 1E98A 2XIQA 4YCSA 2XA9A 4G8CA 3T3HA 2YY6A 4ZODA 2I6QA 3QJYA 2YV5A 3GJTA 2OCYC 4XYMA 2O2XA 2O19A 1SK8A 4N18A 4EGJA 5JPIA 3BKXA 3IULA 3WS7A 2IS4A 3OTQA 2CBZA 1UMBB 3NHYA 1K97A 3OQIA 1JEAA 3I53A 2J67A 4GE3A 3VOTA 4U6NA 2IXGA 3PKJA 2AQKA 1ZH4A 3MINA 3LS2A 3DPIA 4BMSA 1FSPA 1T8RA 5CCEA 2RHMA 4FDTA 2NWQA 2EZUA 2G63A 2C5AA 3RO7A 3EF3A 5J4YA 4EW3A 3AGPA 2R62A 3EWIA 4IVRA 3BIXA 1NVGA 5DCWA 3PIDA 3P9PA 3GNTA 4JSRA 2NV0A 3H7AA 1MVNA 3DW3X 3PV0A 2OV6A 2HKIA 3AVOA 5IM5A 3SSAA 1JR6A 5BOSB 4LHXA 4Z4HA 3GZTB 1H66A 3HJRA 1L1EA 2JGRA 3KX2A 4Y2GA 5CB6A 2OBBA 4MAMA 1OX5A 2JFOA 2VH5R 3AF1A 3QRWA 5KJEA 3ZWMA 4EEZA 2B37A 1N0HA 2C61A 4YAIA 2JHCA 2ZJAA 2B3DA 2I8LA 3EGWA 1ZUD1 4R81A 5AKLA 3WK7A 3H6GA 3QVWA 2EZ4A 2QK4A 3PL1A 4ZANA 1U8XX 3ORQA 5D1HA 1RWWA 4BNJA 1NWHA 4HDNA 5E4YA 4W5NA 1JLMA 1XQVA 5BYAA 1XD2A 3DHEA 3ESBA 4FHGA 4HXFB 2AZTA 2J8ZA 4X7PA 3ZV4A 1J7KA 1X3LA 2B2NA 1Z5PA 4NG4A 4RDCA 1BCRB 3KKOA 5LQAA 2RBKA 2BFBB 2D59A 3HBFA 2GPAA 3IQWA 4P58A 2B9EA 4XIIA 1GZUA 3ZHYA 1CFZA 4X3PA 2D54A 1M9NA 4O4JA 1CWUA 1HQKA 2NZVG 1EVYA 1SHLA 1AKUA 3L7MA 3PL5A 4PZLA 5KU1A 4GF5A 1Q19A 1YQXA 4G07A 2PNFA 3TBKA 2CGEA 3I4FA 1JFRA 4W7IA 1YFLA 1P5FA 1H9CA 3CBQA 4B6JA 2PDAA 1VRVA 3GLHB 4M8LA 1M0WA 3FHJA 3W34A 4WXEA 4H4DA 3DH0A 4KR0A 1P39A 1ZIOA 5G02A 3GFQA 3Q5DA 2WDPA 2QRNA 2CDBA 3FNQA 1YZTA 2HIHA 3HCOA 5BSRA 4EHJA 4HLCA 4O33A 3CX8A 1N33B 2VAPA 2G0AA 1QTNA 3EB9A 1NRIA 3KB2A 3PQFA 4EFDA 1BKDR 4FYHA 2JJ2A 2VRCD 3CUKA 4TXLA 1VJCA 4ICIA 3C7KA 5J63A 2OPBA 4OM8A 5M3BA 3FHOA 3HM2A 2GKSA 1C7QA 1W47A 1JAIA 3IUEA 3ZXUB 1SOAA 2H00A 1Q7CA 4NLLA 1R3UA 3SQDA 4A0HA 3K1ZA 2AJDA 4CG0A 4EATA 2Q5HA 1PL0A 5DLYA 1P7YA 2B7LA 3EVEA 4IILA 2RC5A 2GN4A 3G23A 4AT1A 5HX7A 5BOSA 4Y2JA 3G79A 3H4VA 5DNDA 3TJZA 4EWLA 4DDHA 1E3MA 2R1UA 1QANA 3AR8A 3GGCA 1XFAA 4EW6A 3MOIA 1JQLB 3RC3A 3VPFA 4AYXA 4B3CA 1LLDA 3AJDA 4US2R 3IDZA 5YASA 3FETA 3UKOA 1D1PA 2IX9A 4GYWA 4XVRA 1NBOA 3FDFA 1FVFA 1LV7A 1ZQ1A 3R24A 1Z0FA 3RTCA 3QEMB 1JLHA 2VJPA 2XXAB 4WGFA 3LX8A 4Z0PA 1EA7A 1F8UA 2CCJA 3F6BX 3GNQA 5AVKA 1USVA 4XPIB 3EUEA 4WV3A 1X80A 3K9CA 4H59A 3ZWKA 1QH9A 2ZBUA 3KEOA 4PWZA 2OM6A 3BXXA 3FLMA 3CVXA 2HK6A 3GJRA 1JWAB 3ANLA 5LBTA 2H1VA 3G59A 5HOEA 5DK4A 3REGA 1QRAA 1UXOA 1YRQA 2OCAA 4KE9A 4G97A 4YJGB 1GADO 5HK8A 3RS0A 4QDTA 1EP3B 1GPJA 1QKKA 3E9ZA 1YTUA 5MGBA 3TSWA 1BQEA 5GM1A 2IFTA 1ZOSA 1DINA 4WECA 2PLWA 1N75A 3QVOA 1CDZA 1ONOA 1W30A 1QH1A 1YUBA 2L82A 2MMGA 3DAYA 3EJWA 4OLHA 2UUOA 4WZAB 5KKAA 1JE1A 4RTRA 1YBVA 2VF7A 2YVLA 3ESRA 3JQPA 4J0CA 4KQXA 5HW0A 1RXVA 1Z6XA 2EFGA 1RU3A 3IA2A 3QOWA 5D86A 4BO7A 2J3KA 2CLFB 3EODA 1I36A 2XDQA 1BW9A 3WGTA 1ZUWA 5A4MS 3IMKA 2C2OA 3QMWA 3FHTA 1E1KA 2OZLB 2QAGA 4NL4H 4Y8VA 3TLKA 3C85A 1SXJE 4TUYF 4EHNA 1T43A 2KHZA 2GPTA 4NVRA 4CCAA 4NENB 2QORA 2MSKA 4AMGA 4QOHA 4BB6A 3DLBA 4GGOA 4RZIA 1JNYA 3QQ5A 3B3JA 4BDTA 1RT9A 1E3JA 5CVUA 4Z9YA 3KB6A 1LK5A 2IY8A 3RC7A 3E58A 1Y6ZA 3TEMA 3D4IA 4IDBA 5AJXA 2OHJA 3TCXB 1D4FA 3UWMA 3I2HA 4Q0MA 1DCMA 1SD5A 1D1SA 2NQ8A 4B4WA 3AHDA 4KZPA 2X8LA 4RVFA 4RXTA 4XLTA 2EJTA 4FFVA 5LQMA 2JHFA 2AHRA 4LHEA 5EIAA 4BO3A 2X9NA 3E9MA 1MB3A 4GX5A 1C2TA 1NOIA 2VJDA 3THXB 1JYFA 4BN0A 2HPZA 1OXTA 3LT1A 4D1YA 4URVR 5KTOA 3RIYA 3CVYA 3F6PA 1W85A 1TYCA 3ONNA 3QBJA 4D9FA 5KVVA 4LW8A 2CNLA 1TJ5A 3TK1A 4ZI5A 4YGYA 3LK7A 1XLTC 1ZVQA 2WYVA 2I03A 4EHKA 1NW6A 4J1QA 2QBYB 4UTPA 2PE5A 4P3XA 3D81A 4K6HA 3ND5A 1TLFA 1KQGA 3GLQA 3IIIA 4LXYA 5JZ9A 3K72B 2VYVA 5BSTA 2VTBA 3FF1A 3PYMA 3WWZA 3VYWA 5EQFA 3N0RA 5C8ZA 1EU1A 3D64A 4NESA 3QQPA 4QNNA 4QYSA 1M2VA 4BP9A 3VBCA 1GPBA 5B2FA 2WJWA 3ANXA 3DMGA 1SELA 2V96A 4BX2A 5DX8A 4A6PA 4XIGS 4QOEA 1RQ2A 3USZA 1P1IA 4YAUA 5BV8A 4U7GA 2XR1A 2G40A 1H8HD 4YACA 2BEWA 2HY7A 5D3MB 1Q7BA 1NG1A 3I8XA 3MAGA 2BGWA 1RWVA 1RCUA 4S12A 3TYXA 4DCOA 1S8OA 1K86A 3EDYA 3E0XA 4HLQB 1L8LA 1P74A 1HT0A 4WKNA 4I1VA 4JLWA 4M9UA 5C0OE 5HSGA 4NS4A 2E18A 2VJBA 3IKTA 1NFQA 3ZHRA 1PKEA 3LUBA 5DULA 2GZRA 4AZSA 1YA6A 2ZIXB 3LP5A 3A1CA 2QHXA 5CG1A 2DOKA 3IIMA 1UDAA 1VLMA 3Q0IA 4IJMA 4TZ0A 1OTYA 3AF4A 4QIHA 4MMYB 2RB5A 3VR1A 4AP9A 2PBRA 1AUVA 1Y9JA 1GEGA 1V95A 2F48A 2J1LA 3NCHA 2B3TA 4L4XA 4QE3A 4YO7A 5I7WA 4EBFA 2PXHA 1VJ0A 3DVSX 4JP8A 4F7DA 5CITA 2HF7A 2I62A 3KPJA 4LJ5A 1M66A 1SC1A 4IIBA 1HH4A 1KR5A 5SY4A 1HI9A 5B6IA 1KP2A 2DBQA 4Y6LA 1HXHA 4HTAA 4KXUA 2C9CA 1D8AA 3A4YA 1T3HA 4H08A 2H3HA 5CB8A 1X87A 1Y3DE 2RIPA 1R5JA 1N5DA 2YNMC 1Z26A 3X2EA 1THZA 3IOYA 4DV6B 3TRHA 2GS9A 3RJ5A 5E38A 4FGKA 4D82A 3COJA 4GAEA 1RVV1 2QTVB 1A69A 4MRAA 5FEMA 5HEKA 4WGGA 3ZE6A 2VIIA 4FYXA 4K9OA 4DZRA 2EKDA 3G02A 4AZWA 1CVIA 1DADA 1Y3HA 3T9FA 2FSIA 2CBXA 2B5OA 5GV7A 4I9HA 1T5TA 3WY9A 5CDTA 5T7BA 2MYUA 3JAKB 1KY5A 3SX0A 3O1IC 3SFVA 2R3SA 2JI6A 2QVYX 4M6WB 4HATA 4HN2A 3UJDA 4E6PA 4E5SA 2HFKA 4IUBS 3KUDA 1P60A 3WLNA 1TLLA 3ZXYA 1ODTC 1MQAA 2PKRA 2MSLA 1YFZA 3NIGB 1AHIA 4LZPA 5JO0A 1WR8A 1O4VA 4DV4B 3CV3A 4HZUA 1PN3A 2NZYA 1LPOA 2XTZA 3BCHA 2RKBA 4MX8A 3ZCSA 2ZTSA 2GN2A 1IEQA 4DBZA 1Y48E 2AS0A 2WQZA 1EESA 3D8RA 2IYXA 4CT0A 5F7OA 1F48A 2Y67A 4KMMA 3IILA 2PRJA 2P6NA 3H8SA 3SXUA 1IQUA 2CDRA 2FE1A 5J2TB 1U2GA 2O06A 2OXRA 3Q7IA 3OCZA 2P1ZA 4MUXA 4MLDA 4OU5A 4B3IA 2DFDA 1J5PA 5D51S 1YR7A 4ZI3A 5M29A 2VBGA 5DYTA 1DC7A 4MHOA 1M2HA 1BJKA 5C1BA 1G9XA 1YR9A 3SC6A 3V8PA 2FOLA 1A4XA 1FW8A 3Q1KA 4L3VA 3U4IA 3WO0A 2CHUA 3P26A 5BXYA 1NNI1 1AA9A 4P3KA 2ISCA 1ISIA 1ZD8A 2QX8A 3LP6A 3KDPA 4QFBA 4HI0E 3TQTA 1I0IA 5EUMA 1MG0A 4MROA 1VPTA 1JAZA 1PR9A 1R12A 1HYGA 2O48X 5SZIA 1M1ZA 3AF0A 2C8VA 3BIFA 1NUQA 4HPWA 4TRJA 4YONB 5JD3A 3M6FA 2D5LA 3EXFA 5CB4B 1I0LA 2B1RA 4R9SA 5FQNA 2JG3A 3OPYI 3UO8B 5DI3B 2XKKA 4GBJA 4PG4A 1Q7TA 4ZDJA 4NI5A 2MJLA 1U0JA 1C41A 3WG9A 1WDWB 2DHEA 3EOZA 4QM7A 1OTHA 2AJLI 2C4TA 2ZXFA 2IIPA 2Y05A 4MAAA 5AQEA 3WKCA 3EK2A 1QYRA 1J5XA 2AN1A 2IUSA 4Y1EA 2IWRA 3SQLA 3WVNA 2BF4A 4C01A 1YB2A 4OXQA 4TKUB 4KN6A 3ZQKA 2IU0A 1PIWA 3RT9A 1E2HA 3KFVA 4V1CI 1MOSA 4YFVA 2G77B 1WZUA 1Z0KA 1XAJA 2B8NA 3DHVA 1UJNA 3GRCA 4GOXA 4HFRA 4OHWA 4BFYA 2PSSA 1SCJA 1R4NB 2WJZB 5L3QA 3EUFA 4Y0VA 4BNNA 2CW5A 1S5PA 1IZYA 5JSQA 3C5EA 4QELA 5H9VA 5LBIA 2BHNA 1ZAKA 2O5RA 3SSMA 1ZN8A 2ZRQA 1GPYA 2WT8A 1DXYA 3ABSB 5A4DA 3V4RA 1QB7A 4U9IS 1GRRA 1IVNA 1ZCZA 3NM4A 1XTJA 4OI2A 3Q7RA 2RHWA 3CCFA 4NCIA 2ZATA 1JYEA 4C4YA 2WWHA 4N3BA 4ERNA 2RBGA 2CLCX 2D1YA 1R8XA 5HZKA 4G0VA 1PNOA 4PZ9A 3I52A 1IQ0A 1UWKA 4BFSA 1NJ5A 2CK3D 3HYLA 5DNEA 2WEKA 3EH1A 4HZGA 5AJWA 4AY4A 1QH8A 3QFHA 4GBMA 1A0OA 4P35A 2C0PA 3KTAA 2FZCA 2OFWA 4O2BA 5ADHA 3CNHA 3K70B 3RW9A 4KREA 1L4HA 3IJ5A 1H4TA 3QVVA 3VHRA 5LWHA 2GYYA 1G5QA 2P62A 4BZXA 1EX7A 1A9OA 4DLVA 1K5PA 4UPEA 5EP3A 5H4HA 2OOKA 5EERA 1XNQB 1DEHA 3FWYA 5FULA 3V32A 3WWOA 5JH7A 1N57A 2CB9A 2G1PA 1NKTA 1T8TA 2FMHA 2H5EA 3BKWA 3IESA 3MTJA 4N8EA 4QPDA 5HCUA 4C43A 5KJCA 4PRLA 5GZ3A 4ZQIA 4XCXA 1UP7A 2FPSA 1C0LA 2P9TA 4G4IA 5AVWA 1R0LA 4N7BA 4P32A 3OTWA 1CRPA 1P73A 5LQRA 4R31A 5FORA 3B7WA 1Z0UA 3RYTC 7MHTA 3BAFA 5FBQB 1D6NA 1O03A 1A88A 3U4AA 2VT3A 1EVZA 1DC8A 2ID8A 1CC1S 2Q3LA 3AHIA 3G85A 3COZA 3K9LA 1KKLA 4B4UA 1OU0A 2RD2A 3RASA 1MA0A 1ECBA 2I4IA 3A2LA 3TD6A 3OPQA 1ISFA 1JDSA 1MNQA 2B1IA 1ID1A 2GHTA 4NKRA 4A0QA 3B38A 3KUCA 3RS3A 2RGRA 2CFOA 1QUFA 2YIMA 2ZJ8A 3D0OA 2W5UA 1NXSA 1G20E 4QJIA 1H2ZA 4UUBA 4F6LA 1I01A 3S2IA 3IP7A 1B00A 4M1WA 1IK4A 2RGAA 2JHAA 3DWIA 5EINA 4CDNA 2JVKA 1PX2A 2ZIWB 3BD6A 2HCJB 2WOOA 3FNRA 3PUHA 4OYHA 4YECA 3CJTA 3ST7A 1QP4A 1V47A 3NXKA 1RAGA 1CJBA 1JWBB 1V2HE 4HQ6A 1H0HA 4CDRA 1E60A 4H7FA 5GIPE 1WHTA 1EFRA 1BHSA 1GA1A 1OI4A 4L73A 5FF9A 3T9DA 1PWXA 1L9XA 2P4EA 3OE5A 3Q6MA 4L74A 4ABTA 3VKHA 2EKBA 3HI4A 5FPHA 5KSPA 5AW5A 3O3MB 4EKGA 5CDUA 4ZYZA 3KOWA 4AO6A 1BE6A 3GUCA 3SJCA 1HRDA 5FUYA 3FZEA 2C1ZA 3V8MA 3BXPA 4YBRA 2OQIA 3LBNA 3NIBA 1ZJZA 3RBZA 4ND3A 1GQQA 1Q21A 4GVPA 2BCGY 3VZDA 4RA9A 4EG3A 4L9WA 4GXRA 4E46A 1HTBA 1QZXA 2HJWA 2VXBA 4CQMA 3ELDA 2BR4A 1HT3A 2XDQB 2CXSA 3BXHA 4YJ2B 5BW6B 3B3QA 3RLIA 3TRKA 4DARA 3U39A 1FMFA 5BQPA 4ENSA 2QNBA 2FSGA 1M83A 3MD0A 4LYHA 3T5GA 5IVKA 1DO8A 2YHUA 2B4KA 3LPDA 4KXWA 4AS1A 1PEDA 1POWA 1LJUA 5DBIA 1XF9A 2O57A 1CULC 3QUQA 1A72A 1XTRA 3KB1A 5C3MA 1Y8CA 1SK9A 1SULA 2A9OA 2XOKA 3BTOA 3RRBA 1OFIA 1A2BA 2VSFA 4Y6QA 1PJRA 1XZQA 2CVFA 2JGMA 4FFMA 4MR8A 3BRSA 5B53A 4UQLA 3IHWA 5FADA 4BO6A 2CLSA 5JWOA 1IOLA 3WGHA 5FBZA 5JH7B 2BFDB 4BFWA 4TOIA 5BR7A 3TSYA 3TM4A 3TQSA 5BN3B 3JYHA 1I5EA 1RWXA 4MUAA 1SHZA 2C3YA 4CL3A 3BSWA 2PK3A 3DLHA 1A97A 3BX1A 1AMUA 2LUOA 3VMMA 3KKEA 3IA7A 1ECCA 2HLDD 3R9KA 3TN7A 1MF7A 4J3JA 5D84A 3UW3A 3VNRA 5BR1A 1FNMA 3D2BA 4FDMA 1OHHD 2FP4A 2XGJA 3PYXA 3NWEA 4CMJA 5AHRA 4PRZA 4DGSA 1RBZA 3OZEA 2FPKA 2Y1XA 3P9KA 3Q3EA 3KWJA 4IQ0A 4S0ZA 5CXXA 5AKKA 2L18A 4YV0A 1PJ3A 3LVRE 4IBOA 3VGPA 1SA0B 2YS6A 1Z33A 3QENA 4DA4A 2FWBA 4J0DA 4M0DA 4NENA 4B09A 4EECA 5E9JA 1KSGA 4V0QA 5FBRB 1V6AA 2JAXA 4B6GA 4EA6A 5ARBA 2CHFA 3LFUA 3TNJA 4B3SB 4MP8A 2D5AA 3RSOA 1I3MA 5IT4A 3ZWXA 2QN2A 4W63A 4MVJH 3MWYW 5EIBC 4YLEA 4CM8A 1QDUA 1ZCBA 3HXMA 2FW6A 1AB5A 2KM1A 3OECA 5TQ2A 1R4MA 1HE3A 4B76A 5CDGA 2B35A 2XSZA 3ZVMA 2B4AA 3QVJA 4R6XA 2OQ2A 4XSGA 3VH2A 3PDJA 2QAJA 2GLUA 3L1JA 5JRJA 3FM9A 4UBLA 1NJ8A 1MA3A 1WCWA 2AMYA 2OCXA 3V4PB 1JIVA 3GUVA 3KP1A 3LECA 4ZO6A 2Q1UA 5IVDA 3AB3A 3V2HA 1G9TA 2QRZA 2QB5A 1ZN9A 3C6KA 5BW8A 2VZ0A 4J43A 1AQ6A 4FDAA 1D0SA 4OA8A 4O4HB 4ZCSA 4CV1A 3JZMA 3H99A 5E7JA 2V7WA 5KYWB 4BGDA 3NP9A 2BTQB 1V1JA 1M0TA 2EZTA 2GN9A 5HIKA 4Y2QA 4YJFB 5K01A 3T94A 2RARA 1MZPA 3LG2A 3PC7A 1I6WA 2JIBA 3FMOB 3TRFA 3VZRA 2ZIFA 2PD6A 1ZGHA 2QWXA 1M34A 4C4RA 3K0HA 2ECFA 3KJIA 4NS1A 1K6JA 2GA8A 1TQ8A 5LLDA 4OYLA 5ESRA 4OCZA 4WKOA 4F8JA 5J3JA 1TYAE 1MQSA 2C4WA 4OTZA 4MHSA 4XDGA 4YDHB 3WICA 4G0OA 2FUNB 3QEOA 4GX1A 5LLTA 3GIWA 3NBFA 1OWOA 2PQ0A 2PVSA 4KODA 5F4ZA 4I9FA 4DBLC 1FFBA 5F51A 4WKBA 2K6GA 1YA8A 2IL1A 3IPRA 3TS1A 3R5TA 4UUPA 4FOLA 2WKRA 4FC7A 4DV7B 4BLTA 5HWSA 3IIKA 3MXOA 3FYHA 1CZKA 3PCXA 1Y7HA 5LL6P 5GONF 4Z7OB 1PV2A 4X85A 2HD4A 3FAKA 4XR9A 4R3WA 1U3DA 3FBWA 3WNVA 4L8GA 1SCQA 1KTIA 3GJ3A 4DL9A 4RF4A 1RC8A 3SY8A 1N5MA 5H80A 1W0JD 3TL3A 2E6UX 3ZE7A 3AUSA 3G9XA 4I8DA 4HADA 3V1MA 1JBKA 1R0KA 1V48A 3I5UA 2MINA 4IY1A 4OGKA 3C4QA 3OKPA 4W1PA 5CA1A 1N0UA 1K0FA 1VA5A 2Y0DA 4M76B 5EJ4A 4JBNA 5FWXA 5H3LA 4PZCA 1UWVA 2XUHA 4H7EA 1H2YA 2VWQA 2XV1A 2YQ5A 4IHJB 4DMLA 1UOQA 3EE6A 2PH5A 2Q41A 2QI9C 4PQGA 5FB3A 1PLLA 1PJLA 4HNQA 3EQ8A 3I4LA 4V0LA 3UH1A 1M1YA 2VNIA 1KP9A 1YJQA 4QYMA 4ZOLA 5FHQA 2EZ9A 1FIUA 4J7AA 4OUDB 1M72A 4R3UC 4EJ6A 2HRCA 3EIXA 3O2SB 4BE7B 1JLLB 2PBZA 3MIIA 1E6CA 3IMCA 3EQZA 3KQPA 5DT9A 1I7LA 1WKBA 3RUAA 5JAHA 2QTLA 5IYZF 4PQYA 3GJ5A 2BMJA 4YJ2A 2B6HA 2V5VA 4BEVA 2X9VA 3P45A 2HSDA 2ZRHA 3BXZA 5LZ2A 2UU9B 1P8JA 4Z9FA 2HPHA 2W8BB 3OQIB 4C6TA 3Q6NA 3AVVA 4C7OA 4R0MA 3WLIA 3QVSA 5CT4A 3E70C 3K9HA 4K8RB 3O93A 2HI0A 3DYVA 2JI8A 5EI5A 5JQGF 4TKMA 2HWUA 1R3DA 1WX1A 4NOMA 1UJ6A 3MYRA 4O4HA 2Y1OA 1EE1A 1YVDA 3HEMA 3D4BA 5T67A 1E63A 2WPNA 2ZSEA 3TI7A 1SBIA 2C2ZA 1Y81A 4HZUB 4V3BA 4ZVOA 4EUSA 2UV8A 3IAUA 4QL3A 5SZHB 1C8LA 1JU4A 3EFEA 3C8MA 3HWSA 2XTNA 3U61B 2IHKA 3CCBA 1CNEA 2DGDA 3GDOA 4RC9A 1V2GA 4XOIA 4BTEA 2XA1A 3WLMA 1J9ZA 1UPUA 1N5KA 1X7ZA 4ZCQA 3ADCA 4F2DA 3GFRA 3FSGA 3QYPA 4JS0A 5B1YA 1MIOB 2G9UA 4L0DA 3P7MA 1K5GA 3ZCXA 4DXDA 5DNUA 2IF2A 2PM8A 4XWTA 3W8DA 1REQA 2Z3WA 4C0QC 4AI6A 2XX3A 2J5RA 3HKBB 5KMGB 3HSSA 3ZQUA 2KB0A 5LIRA 4CCSA 1T36A 1RAEA 3ROKA 2ZRAA 4D92A 2IHJA 4MV1A 2ZWIA 2V3CC 3O47A 4IMPA 1TQ2A 3UKDA 3QBVA 1RQLA 3H65A 2YICA 1EA5A 3EXAA 1VHQA 4QDXA 4MNTA 1Z62A 3RG2A 3QVUA 1GCGA 5LP6A 2VUSA 2ZSFA 3VC2A 4KN9S 1G8MA 1Y1TA 4X7RA 3WRXA 2JFHA 4FYWA 4BLWA 4CRWB 1W19A 3JQCA 4IJ5A 4CEHA 3EPKA 4BE9A 4YRPA 1PZMA 3NU1A 2PWAA 2XA2A 3O8OA 2GI4A 3VVBA 1Z7EA 4S2UA 2HK8A 3II6X 3W1VA 3KXKA 1IN8A 1EAYA 3IHLA 4HFNA 2FEOA 1USWA 5DCLA 3ORSA 1XU9A 1X1TA 2KBEA 2XKAA 3PRJA 3NT4A 1R0CA 2G72A 1ZRSA 3CB4A 3UHFA 5IJ9A 1E2KA 3OZTA 1RDFA 5CBPB 1X94A 3AVQA 3KOYA 2FLVA 3OZWA 2IHNA 4MW6A 3GQVA 1NURA 2C07A 2WM9B 4IZIA 4K05A 4XFJA 4OFBA 5HM6A 4PPFA 3UK7A 1P80A 5JC1A 3LSYA 4DDMA 2LR0A 3BN3A 4L75A 1CQPA 1D4ZA 2PR2A 3W5AA 2I1QA 1O3YA 5CDFE 3PFCA 4HH3C 4XWGA 1U2RA 2F9FA 3KDSE 3T0GA 4X64B 2ZJ7A 1JG6A 2R9VA 4MDYA 1XZMA 2QTRA 2VCHA 1KFKB 1QU3A 5EKSA 3U3XA 2YXLA 4ACBA 3EGXB 1ZHFA 3IXLA 1Z29A 4HQNA 1XDWA 1H2HA 2CXRA 3B9BA 1KO1A 5TY0A 2NVUB 4V0SA 1ZD5A 3IVRA 2VDMB 1DG9A 4MQLA 3W2IA 1ZRMA 3OIYA 4YRZA 4FWTA 5G40A 5KNCA 4IQ8A 3LUPA 4KW7A 4F2HA 2NN3C 1GNVA 3R3WA 1I2BA 2AG1A 1T2CA 3GEMA 4JASB 1C1DA 1XOIA 4NMHA 2TMYA 3RVQA 3WWPA 4F1WA 1A7UA 3CRW1 3GD7A 4HHEA 1ZM9A 2IYVA 3CZRA 4DEVA 3W79A 1AKNA 3KVYA 2DY1A 2P2NA 1YCDA 3BF7A 3PJEA 4LJ8A 2PZAA 5B4TA 4A8TA 4G26A 5DBHX 1GAEO 3KCQA 3TOXA 1NE2A 3CE9A 3ZQJA 5A5DA 1YB5A 1UBUS 4MVJI 4TLLB 2EP8A 1NP7A 3OLQA 2IYAA 4PO9A 1RM0A 2GUGA 4KG7A 4U2EA 3RWMB 5CT9A 2COEA 2BFFA 3H8WA 1C81A 2BBSA 3E8XA 1J49A 1PKXA 2XVZA 3GHHA 1VPLA 4I1SA 4IKEA 2HPVA 4OKSA 4YCBA 1HDCA 3TFWA 3ZBUA 1CSEE 2OBNA 4RFSB 2VPQA 4RGYA 1SCUA 1UDWA 2ZAOA 4P86A 5ALNA 3P5SA 1WP4A 3AESB 4OFWA 4ATNA 2HXSA 1JMVA 2OD2A 3ZWWA 5IANA 3PHGA 4JU8A 4YO8A 2EFYA 1U7HA 3RTDA 1JHOA 5FPKA 4W5TA 3TZHA 3MCWA 4NZYA 4OJQA 5EWJA 2QLTA 3VISA 3AW9A 1ZUNB 1KSFX 5ILQA 2QE7A 4OHCA 1G64A 3R2JA 4LWOA 1SC6A 2JCYA 5F12A 5GGXA 3SYNA 5JXJA 1VE6A 2ZS9A 3LCMA 5LDGA 4JH0A 1TQ6A 1GZ5A 3IC5A 3DP7A 1RRFA 3EVTA 4AIIA 3AI2A 4BNHA 1UK6A 3GLFB 2JLSA 3HVHA 2EWMA 2BZ0A 3RVSA 4B81A 2VBIA 3IEIA 5JCOA 4ETWA 4K0KB 3G8BA 1PCXA 1JVNA 3QITA 4OIFA 5A3RA 3OEHA 2XXBA 3BSYA 5AJHA 5D5QA 3RBVA 1KRHA 3DE7X 5CFQA 2ZUTA 1JECA 2GZHA 1Y7TA 2XBLA 1FFGA 2NXEA 5KDDA 1GTRA 4WTOA 2M98A 1Z06A 4PRYA 4Y2XA 2VKTA 2XF8A 1DC5A 2ZSIA 4KQCA 1HDOA 1HKHA 2C99A 4H77A 3ESZA 3HJGA 2Q0XA 4X6XA 3TLAA 1ZXXA 3UGKA 4TMYA 3KWFA 5JUWA 4Q1AA 1KOLA 4D42A 1HFWA 1O2DA 2QTFA 2XRYA 3NIWA 3TTYA 4DLUA 2IX3A 2QMUA 1SG0A 3OF5A 4RIHA 4PG8A 4DOMA 3REOA 3JCZA 4FJ1A 2DVMA 3HVKA 2WPDA 3GC6A 3HV0A 4A9AA 5AM5A 5F9FA 1NR5A 2ZJ2A 1LF5A 2FP3A 1W0KD 1TAHA 2ZJ5A 1SUAA 1M2OA 2JDID 4QTYA 4JXZA 3CF4G 4DTIA 3WX0A 3K5HA 2QRLA 2QN6A 3HXTA 1BVUA 3MJDA 1N4AA 1GKYA 1QE0A 1O5TA 1TUBB 1RYYA 1Z0AA 2QGNA 2R7NA 3AERA 1X2EA 4C4XA 3EZLA 2KWIA 4XE5A 1KIMA 2VAWA 4N7JA 3PEYA 1H9BA 3WLKX 5CU7A 1N6HA 2DUUA 3TW0A 2NZXA 3L0IB 1YE8A 1N7IA 1B43A 5T57A 2R4QA 3PQEA 1E9CA 3AM3A 2P8SA 3K6RA 4LZWA 3LMKA 3PZRA 2G7ZA 4RYDA 3UFXA 2Q28A 3MRVA 4AY2A 1G21E 4OHOA 3SE7A 2RONA 2QOEA 3AV0B 1U2DC 3G0IA 4LZLA 4Q02A 3C3YA 2WYHA 4B6PA 3IQZA 3PVSA 4TKVA 2HDHA 4Z4FA 5JYEA 4D6XA 1TU4A 3A9WA 3WSTA 1W88B 1DT5A 2A92A 4KI7A 5I01A 2JNWA 3BRQA 4QLAA 1OT3A 1TZ2A 1PJSA 3L5KA 4E03A 2VDPB 3DFZA 3IMGA 2A9VA 1EFHA 3OQ1A 2JKYA 3O3CA 3PSHA 5E8RA 2VLIA 4B2LA 4CTNA 1I1NA 1JXMA 4E22A 2QZPA 3A26A 1QO7A 4PANA 2HUNA 1F2TA 3BFVA 3DM5A 4B3HA 4LYEA 1OVGA 1JU3A 1XDZA 4NZMA 1TM1E 1FCJA 1R15A 2E5WA 1HKUA 3U3OA 4E5KA 1C7JA 4FGUA 3I5YA 3V8NA 1NM5C 2XD9A 2OAEA 2ZUFA 4L6AA 1MPXA 1RJ9B 3BJRA 2VCEA 4ALJA 4ZU6X 3FB4A 3BWBA 3E3AA 4A0GA 3M0EA 1QRRA 3JAMA 4IIYA 2Q29A 1AKQA 4RVCA 4YDQA 4QGFA 5I3CA 1JDNA 3RQSA 3ZX4A 1YJ8A 2H1OA 3X44A 2QVBA 3IOBA 4B0OA 1QOPB 3PI7A 2AEEA 1KGDA 5KDLA 1Z5VA 1T1EA 4MRSA 5CTAA 4HSEA 5EZYB 3PFWO 3I9V6 3O03A 4PHTA 3UY4A 3WLOA 4XRRA 2Q2OA 3A0RB 3VR4A 3E7WA 4NBLA 4BKQA 4LSZA 1N3YA 4ISBA 4S1TA 4G1FA 4EKEA 4YT2A 3N3BC 2ZJZA 2ASEA 2XE8A 3A10A 4M1SA 4Y1FA 1X8KA 4PYNA 1V25A 4B87A 1NI4B 3IAS1 3MTIA 1KJNA 1L5MA 3T0IA 1EG7A 1G8KA 1XZPA 2IXAA 2P3SA 2YWCA 4P36A 4PV7A 3NBYC 1KFCB 1Q7GA 1E6MA 3T9BA 2H1HA 4D6PA 1C3XA 2B30A 4MPPA 4CG1A 4EYOA 1YGYA 3CW8X 3ECSA 3GVCA 1FTSA 4QUDA 5EZ5A 5BWBA 2FF5A 4B82A 3CRVA 3UB4A 3NW9A 2WJAA 3P0RA 1YAJA 3LUHA 3OOYA 1QOQB 2I2BA 5IK2A 4RLSA 5JCZA 3CZAA 3TBHA 1G20A 3KWLA 3KETA 1WMBA 4JZKA 3VVLA 4L27A 4DIDA 1PR2A 4PC2A 4BRUA 3RAFC 3SQXA 1O6BA 1CR4A 3TB6A 1VL0A 2IITA 4OQYA 1KYIA 4B6QA 4DTCA 5F7XA 1PZXA 4F3RA 4HK4A 2KS6A 5BQ3A 1L4NA 3MAAC 2P69A 4JN6B 4Q18A 4ZYLA 3EXG1 4WNAA 3DSRA 3QNWA 4ZP1A 2HMAA 4QUEA 4Q3OA 4LBVA 4CZ2A 3VYRB 5IXJA 1PSZA 4RCVA 2EL7A 1QJCA 2O7RA 4U2BA 3I5XA 4HOYA 3KOZA 3UJCA 2Q4RA 4ZTZB 1UBSB 3BCRA 2GF9A 1DO2A 1KXJA 1U1EA 2DPLA 3GVHA 1ZHOA 1L2TA 3NC4A 1E6UA 2B1JA 5KSYA 1Y1PA 2R5WA 4DR3B 1SHKA 3NYRA 4PO8A 1SHUX 1DX9A 4QPNA 1TYDE 4Q03A 3EXIA 3MMZA 1ESMA 3R4CA 3ETLA 2P91A 4BNWA 3NDPA 4OAOA 1CQIB 1E0KA 4YT4A 1LC0A 1ENYA 3PQ2A 1AHPA 4RK5A 1TTHA 3DMYA 1T34A 4PIPA 3F5QA 5K2OA 3OX1A 2JIDA 2V0NA 4D2IA 2EGGA 1H2RS 2ORED 4IDOA 5HFAA 1XMQB 2O8DA 1KDYA 2PEYA 1KEPA 3IQDB 2NXJA 4KTVE 1QTRA 5C5EA 2HJVA 2ZULA 1XYYA 2AOTA 3I04M 1WG8A 3HKEA 1JALA 3M4JA 4YJ3F 5EKDA 4PNEA 3HABA 5CAEA 5L6MB 4HQLA 2VLBA 3PQ8A 2R1TA 1JXQA 2DF8A 2GBCA 4C1BA 1KZ1A 1DMRA 1WUYA 2QW0X 4WOCA 5DNYB 3AINA 3MQ2A 1YKFA 1DJPA 2WINI 4AN0A 5BXQC 2J0SA 3PXGA 1IEVA 3ZHQA 1T5DX 2UKDA 2ZI3A 3MSCA 5HUQA 1T8UA 1D0VA 2OILA 1ACMA 3IQGX 3SKVA 1QVWA 3OZDA 2PS3A 4BPRA 2CHGA 3JD3A 3GVPA 5DM0A 2YWXA 4DQ0A 4EO9A 5M2QA 2AFHE 3AF6A 1D07A 1RC0A 3CINA 1FSSA 1LW6E 1TMYA 4UPVA 1WXIA 2F00A 1O5IA 4PR0A 4ZI7B 3F4BA 1X1DA 1ZRHA 4ZREA 4EPXA 5I9IA 1E62A 1L8QA 2GJSA 5CT5A 4JNKA 1O94C 3NQ41 1E9DA 2A5FA 4IJKA 3QY0A 1S2IA 1T9BA 3W2TA 3EZFA 4AAYA 4JI1B 1YGPA 2YCLA 5EPUA 5EXDA 5MFZA 4J4BA 3L0YA 5HQ3B 4RD2A 3ZGZA 1R6DA 2Z3VA 3B78A 5A03A 2X5JO 5FPPA 3CSUA 3VSAA 1IVYA 1JZQA 1TB4A 4X6UA 2VZ8A 4J7XA 3JRWA 4JBLA 1C29B 1NUUA 3FPFA 1BDIA 4OQ4A 4JJAA 2P7HA 3D1JA 5FUXA 4DEYA 5KSOA 1XLWA 1TJ3A 4NEHB 2EJWA 2GJ9A 3OE7D 1YE5A 2A3RA 4V24A 1TJNA 2R7MA 3U80A 5B6JA 1E18A 2JFFA 2ORIA 4P9NA 2ECPA 2QD5A 4JOBA 4IIHA 2YIJA 3MMPA 1JEYB 4URWR 3K70C 1CF2O 3QVLA 5JG7A 4F7WA 2ALJA 4ND5A 3WNCA 2A1UA 3O8BA 3CG0A 2DEUA 1EXNA 4J6FA 4MKIA 2J4FA 3DW1X 4HNAA 1C30B 4V1CB 3X1XA 4NMWA 1ZMTA 2I5PO 1VMKA 3PG5A 4HAVA 1DBIA 1GOTA 4X97A 5CYPA 2LBPA 3CLVA 2F3RA 5JEEA 1ZX1A 2YIVX 3PC2A 1CJMA 2M6RA 1UMCA 3HC7A 4Z4CA 3TNLA 1Z8NA 4R1NA 4ZEWA 4BV9A 3L6OO 4ZGBA 5CAEB 1RKVA 3IBFA 4ZPXA 1JTVA 3ANSA 4DY6A 2GWHA 2Q0QA 2Z2YA 5ALQA 4LJSA 5EKXA 5H81A 4YRSA 1FX1A 1VYUA 3JALB 3R5HA 2W93A 5HDQA 4EARA 3TTWA 5BPHA 5A04A 5DNWA 4R8KA 1B0ZA 3VQTA 1SCKA 2WUDA 4QXPA 3VR4H 3ILVA 3H17A 3T1OA 2JCGA 3H1GA 2I3AA 3LA6A 4HBZA 3VR6H 4RABA 1FZQA 1NRJB 3PNOA 3SP1A 5EMLA 3ZTYA 5L40A 3QPVA 2FLWA 3B1FA 4NONA 4RX1A 2WJJA 1RM5A 4RJJA 4LHYA 3A9VA 5E2BA 3MUEA 1IXYA 3DT6A 5EEHA 5CNJA 3MWEB 1SQFA 2CKMA 1UPTA 1RQRA 1NX6A 4AWAA 2R6FA 5B7PA 1YXMA 1EK5A 2ZRGA 3TQFA 1Y82A 4B33A 4ZHQB 2O7NA 1FFSA 2YDXA 3FTCA 3DEHA 3PHLA 4NARA 1E3QA 4OGGA 1AE1A 3UVEA 1DBQA 1TA9A 5JZBA 4RKQA 4ZPJA 3WHLA 2X1HA 2PKCA 5AR1A 3IEXA 4GM4A 4Y6OA 1WXQA 2WVGA 2G71A 2YJGA 3LLUA 3KVVA 5FKJA 3UM9A 3D8UA 3HEBA 3JASA 4IHJA 4CF7A 1M7BA 1N92A 1WUHS 1ZK4A 3C7DB 4AU1A 1OBVA 1YS7A 4F2WA 2IGBA 5LD2C 4Q1FA 1Y7IA 4Q9JA 1L5VA 1JMKC 2FCRA 1W73A 5FLEX 1BGVA 4TSFA 1NMYA 1YS6A 1DFHA 2V6GA 2W83A 3IH5A 5LU9A 3U4HA 3PUZA 4G01B 2PR7A 4NCXA 3F8TA 4AB1A 4M9CA 3EMVA 4JJ7A 4OGFA 3T3PB 3DMPA 4E5UA 3LAWA 1EQAA 3AQIA 3ZI7A 2JARA 3GJZA 2CJYA 3ULKA 3EXHA 3VSCA 3CRNA 2ZG6A 4RF3A 1GZ6A 3ICOA 2OBFA 3NHPA 5AESA 1L8OA 1VGVA 2FEMA 3M83A 2QX9A 3OLXA 4E21A 1EUQA 5ICEA 5D3KA 3RE1A 2AD1A 2I78A 1GZHB 5DRTA 4E12A 1CX9B 1NT2A 4GXTA 4Z7QB 2I99A 5ECYA 4B7CA 3QXJA 4LCEA 2FR8C 4H3KB 2JEOA 4CNBA 4CR6A 3O2QB 3QSYA 3I2KA 4QARA 2HHHB 4HH1A 4KWTA 4RZXA 3P9CA 1HQCA 3EG9A 3NATA 1LBQA 2Q3DA 4RACA 4TMFA 5C1PA 3S55A 3PUVA 2G7MC 3LD9A 2CC2A 2FQWA 3P1JA 4U5QA 3RBAA 1GDTA 4I2VA 4MCJA 4XLLA 3ZWOA 3OJXA 2WTEA 4ZOCA 4P4TA 3S2YA 5HJ7A 3V5NA 4XQEA 4GOND 3DMRA 3HJNA 1MIOA 4A03A 3PC8A 3GR6A 1I5OA 1V3VA 5K0CA 1LQUA 1TYBE 3MRSA 2AOUB 5I7RA 3GRRA 1L1QA 3TTXA 1ZITA 3LOPA 3M6MD 3O92A 3QYJA 4GUDA 3IV7A 4WJKB 4D3XA 4MV4A 3VAYA 4WERA 1AVTA 3FKQA 3WXBA 3ZPXA 3DHYA 1JUDA 2IC5A 3C5WP 3EWNA 3OX4A 3VKFA 4UBNA 5A6SA 3ZLJA 4JFRA 3A4MA 1GSAA 1V9SA 1YQTA 1C3JA 2IEDA 1QRSA 2FMTA 4L4SA 1L8AA 3NDIA 4ZOQI 4ESHA 3EHDA 1PR4A 3UV3A 3WGIA 2X5KO 3VYSB 3DD1A 4PLHA 2RI1A 4JJEA 5IFKA 5K0TA 1DXOA 5L45A 1XUOA 4Z6KA 1EXDA 3KHUA 3TE7A 1VBMA 4DMGA 3SWWA 2JC3A 4D4JA 2VYCA 2XWSA 2NV2B 2H06A 2ZTUA 2QLBA 3SG0A 2D6FA 3S70A 1BGWA 5GMOA 2XDWA 2JRCA 1H4SA 2EFEB 2ZITA 2JK1A 3RRMA 4E6EA 3D8BA 4HQRA 3HE3A 3KAJA 3HRKA 1H2FA 1OX6A 1OMOA 1RTTA 1T35A 2HJGA 2H92A 3FH0A 3GZNB 3OOSA 2VUTA 4G56A 2YBDA 3JY6A 1EGVB 5ALMA 5ALYA 3ZGLA 5JYCA 4CXMA 2H4WA 1HZZA 3PA6A 2R6HA 4EH1A 1D9ZA 5EXSA 2XVMA 5CB4A 1TZJA 2W0SA 4G6ZA 1D1QA 1KMIY 4NE9A 2Q5JA 4GOMD 1YR2A 1SVKA 3DTNA 1Q16A 3H2KA 2JASA 5ALDA 1OI7A 1U0LA 3LDGA 3LA8A 4JXJA 5K0SA 4DMRA 1N1DA 3FUUA 5BN1A 4C5CA 3DVAA 2HCFA 3ND6A 4LOLA 3L7OA 4P22A 4TLMB 3R8CA 4AJJA 2IYTA 3NIFB 5TVKA 1X13A 5AHXA 1UADA 2VL7A 3GA0A 4BVHA 3LH5A 5ICSA 4WY8A 2WJ3A 1FXSA 2ZP1A 4KUHA 3I3OA 1NZDA 1GAWA 2GHIA 2ZQYA 1UKEA 5E6SB 1OLXA 4E4YA 2CUKA 1B76A 5ALGA 1YI1A 4AK9A 4M87A 2PUDA 5IJZA 5K0GA 4KLCA 3KXPA 1L7AA 4LN1A 3RBXA 4OSOA 2QKYA 4KH1A 4WMLA 5B55A 2HZ7A 3PUIA 1AQUA 4PR3A 1NYQA 4ZHSA 2GRAA 1UK7A 1VMIA 1BEEA 4L8WB 3BJMA 3KJXA 1IRXA 1GPDG 4AX4A 4H27A 1WKVA 3CW2A 1DKQA 1DDOA 4N0DA 1LPBB 3IAFA 3QPBA 4BBAA 4CI9A 1ISPA 4CLRA 3NASA 1LDMA 4IFBA 3ZY5A 2JAQA 3CO0S 3C3PA 1TCVA 1SY7A 4PGFA 2EJBA 3ZS9A 4CM9A 5BMVF 5EHZA 1ZUNA 2ANBA 2HQSA 2X0RA 3ENVA 1NJSA 2BKLA 2QYOA 2XMZA 3QNMA 4GL4A 5SV2A 3T3MB 5AM4A 1QH0A 4LX0A 2FUG1 4MYCA 5B5SA 5DYGA 5MHTA 5GOTA 4L9AA 4TSRA 4ADSG 1URPA 4G23A 1HNNA 3D2CA 5KHAA 5IF3A 1JHYA 4N0QA 4D9NA 4O0MA 3S6JA 4UM7A 1SJ9A 3AEQA 2PZJA 3B7PA 5BVHA 2FQYA 3RRFA 1LVGA 5FL7A 3GJ0A 4QDKA 3MHTA 1HBJA 4ZGWA 3X2SA 3S7ZA 4OQEA 2A7QA 5BQ5A 2VJYA 3SJ7A 1SPXA 5HM8A 3EIEA 2QTBA 1J2EA 2HA3A 1U2DA 4RPJA 3W4KA 1KAHA 2FH5B 2AXQA 3WK8A 4A6DA 3K2QA 1OA1A 1U6KA 4MV6A 4RLQA 4G5SA 5M04A 2ZIGA 3UJAA 1T4MA 1ECFA 2KW5A 2VJMB 5GVSA 4KKXB 4P5EA 4J16C 1O5OA 2QSUA 3ZE2B 3NTVA 5I47A 3D3JA 2XLCA 2H4FA 1IY9A 5CX4A 1ZESA 1E59A 3RS7A 2PZLA 1H2EA 2CVOA 2RCNA 3G5UA 4YCAA 5JNRA 4A23A 3KVNA 1J33A 1MABA 4S05A 4BHTA 4J07A 2Z4SA 2QS9A 5SZJA 1XTBA 3ZD9A 2H7XA 1JILA 4R2IA 3QUSA 3HN7A 4FNAA 2JI7A 1MQ8B 4OO3A 3I6ZA 1JAYA 4BIMA 4BBJA 4TUYA 3MWGA 4B8WA 4EDHA 4ZVVA 4BNTA 3A4NA 1CQIA 3A2NA 2HSZA 1MTOA 3CTMA 4RK7A 5IWCA 1KFEB 2HOQA 2ONZA 1VHTA 3PENA 4D99A 4M7RA 3KHSA 2HBYA 2HX1A 4LXGA 5JSYA 4MRRA 3WP1B 2JLBA 5LQSA 4BMNA 2VR1A 3ZS8A 3ZJTA 1X42A 4NPAA 5AUQA 2QE6A 3LC2O 1EK6A 4LMRA 3SEQA 4LE0A 5A3JA 4J29A 1XCPA 1NUAA 4FBGA 2FSFA 2LNDA 1JEJA 4LZAA 3ESXA 3H2JA 4UUMA 5J2UB 1HE2A 1V1MB 5D3ZA 5TEVA 3U49A 2Z3ZA 2HGSA 3T1HB 1V5WA 5JPDA 2IZ6A 4XVCA 2PH7A 5FX2A 4C4OA 1AZWA 3LW7A 3FYCA 3AVYA 3MJHA 3NDRA 1C1XA 3H16A 5J1SB 4I4NA 4A8JA 4UEKA 3ACCA 4E09A 4W1RA 3EIHA 4PPNA 3BXOA 1OUMA 1YNSA 4KGVA 4X1IB 4JUCA 4N7RA 3QKRB 4TN1A 4D6YA 2NMVA 1YBHA 1ZI8A 3GDFA 3L7YA 4HD8A 3SEZA 1KOFA 2FMUA 1MN6A 3MTGA 3W7AA 4D9GA 2XKJE 4L5BA 3N2LA 2OPHA 4BQOA 3CLTC 3I0MA 1IY1A 3D7SA 4MKXA 1CZLA 1FXWA 2IEAA 1Y3FE 4HDNB 2VUIB 1QNLA 4ZT3A 1J00A 3LGXA 5LSAA 5HCIA 2BGKA 4OUDA 5B58T 4YYZA 2AKEA 3FR7A 3OIWA 4LBZA 3SVZA 4CLHA 1Q7EA 1XV5A 2NZ8A 5KTTA 3PUKA 821PA 3OT1A 3SJUA 2GARA 2QTCA 2PHZA 1XVAA 3BULA 3D1VA 3L7LA 1L7MA 2XB4A 4PW0A 4DDUA 4DLPA 1JS1X 3N2EA 3QV1A 4IHQA 3ZNNA 2GD0A 1W9HA 3W3AD 2AI2A 1Q95A 1IPEA 1RAIA 2ATIA 5T64A 1M2EA 2OXEA 3TLXA 1B0AA 3Q8LA 1N4DA 2QRGA 1EINA 1IHYA 4X5OA 2EG9A 1YQUA 4FOOA 5CIQA 3A3YA 2JFNA 2XB8A 3R6LA 2HZBA 1RZ3A 2PUTA 4YQYA 5K8CA 4Q9NA 1PE0A 3C3MA 3HYNA 1UM8A 2CNWA 1JKIA 2F17A 2J9FB 4GEKA 4I3HA 2ZCVA 4HNAB 1Z4JA 3KKNA 1OD6A 3PR3A 4ZJZA 3GLUA 4EUHA 3QU2A 3PEFA 4Y6PA 2DR0A 1O0BA 1NR1A 2J6IA 3EPJA 3DXFA 3D1LA 2O8NA 3LVQE 4DA9A 3DF9A 2ONYA 3U40A 1P2TA 4EG4A 1AKMA 1N5LA 3N5KA 4JY7A 5CH8A 3DA8A 2IUYA 2GEBA 2IXBA 3DTVA 2WDZA 4PYOA 4PCVA 2WTAA 2A86A 3C5CA 1MOPA 1KH2A 4Y2UA 3TTTA 4EVIA 4WA8A 2R0QC 5CDHA 3OO1A 1V9CA 2I9KA 2ORVA 4Q6BA 1LX6A 2D1FA 3K9BA 3LBYA 4Q4DA 4DIEA 1KO8A 5BSKA 2E5LB 4DCCA 3VZQA 2Q1WA 3ZLTA 5AKEA 1ZJ6A 2C1EA 3AR3A 1MB2A 3H84A 3W05A 1KEVA 1Z2NX 3SFTA 2NSYA 2W4MA 2Q5IA 4Q7JB 1H42A 2XQVA 3LDAA 3FOZA 3ZDCA 2BISA 3O9ZA 4D8TA 4Z3OA 1GTJ1 2C5SA 1DAOA 4QPZA 3PLAE 1XJCA 4XUCA 2Z8YA 2NP7A 4ND7A 3ZHBA 4A2CA 1Z4IA 3OJOA 1P2VA 2EATA 4X62B 1MEEA 2P9EA 3IELA 3G1TA 3FNIA 4JIGA 4P38A 3UQYS 1C3VA 5DM60 4IYJA 4YROA 3K1AB 2OKGA 2UUAB 2C7PA 3W5JA 4R0NA 1R66A 1PUIA 1UBCA 5EUCA 1WIWA 3ZEIA 1FNNA 4ALMA 4UNPA 1DBRA 2Y3IA 1TZMA 3H13A 2VWPA 2JFZA 2ZWOA 3FLBA 3Q7QA 4RA6A 1YZHA 1DE0A 2HWXA 4F5YA 1GRQA 3S8YA 3IDQA 2JGDB 1EUYA 1YVRA 1VIVA 1XCMA 4LXXA 3KUXA 4LTMA 1FY2A 4JT9A 1B1AA 3O9VA 5KQSA 3E9CA 3IV6A 4HAIA 3VR6A 4KPYA 3H9GA 1HSOA 3I2FA 3LFHA 3L6BA 2A4KA 3U0VA 4LYYA 3VM6A 2PVPA 2HIGA 1NLZA 4FT2A 4Q4AB 5EIWA 3GUUA 5DGIA 1ZIPA 1DWQA 4Z2YA 5AKGA 3EZ7A 1H2WA 1E77A 5I8ZA 3CX3A 4R05A 10MHA 3DEFA 5B37A 1NKVA 1CS0A 2QZSA 3DS8A 2A33A 1ZNZA 3V42A 3DLIA 3OEED 1U2GC 1U2TA 2ODTX 2XMGA 4C7BA 1JG7A 1F4VA 1Y3CE 4JL5A 4WK0B 1UKVY 1NVVQ 1XXLA 4H4CA 5CPFA 4F84A 3VKWA 2DERA 2D1TA 3NHLA 1C8VB 3P0JA 1U8CB 4OYYA 3UCXA 5REQA 2BSXA 2N9UA 2BI7A 4UKDA 3VA7A 2W2TA 1OB2A 2XITA 2YRFA 3N87A 1ZGBA 4ND2A 4UCQA 4B34A 2H85A 1T9CA 3JYNA 4RSMA 2IK8A 3QHPA 3ZQ6A 3ZWPA 2IYQA 3IV9A 4PC7A 3RSQA 1BVRA 3OCCA 3VTZA 1G9SA 4CYMA 3EPPA 5F2EA 3UA4A 5C5IA 4PAGA 4MR8B 4XRGA 3KQNA 1CS4C 8OHMA 4OH1A 2DWQA 4PF1A 3VPSA 3GOHA 3NHMA 4FIZA 1R27A 4L0MA 4Q4HA 4F3NA 2IS1A 1AGYA 2N1BA 3P9YA 2ZREA 3I2IA 2NYUA 4ND8A 3VYVA 2P9HA 1C3LA 1EG2A 1GCAA 1JX6A 3U7RA 1B4DA 1OF1A 4J0FA 3GJ6A 3AR4A 4L85A 4O4LB 2AFIE 2QRUA 3AESA 2F1RA 2WHXA 5FEUA 1O1YA 4FEYA 4BP1A 4LE2A 4FHDA 5LDHA 1F2VA 3L8EA 1XE3A 1JIUA 2EYQA 3FPAA 3Q8MA 3TLEA 4C14A 3DL2A 1V7ZA 1W4LA 4TMTA 1R37A 1CR1A 4DG5A 4ZYXA 1EE2A 1P5RA 1FDSA 4RFSA 3RVPA 1SBZA 2NUTB 4OHUA 5A5VA 5K4GA 3JD2A 1DQRA 2ZVJA 1L5SA 1E94E 1QHIA 1NVMB 1I6LA 1Z18A 5FTJA 1EFKA 2NTJA 3W5DA 1UPXA 1VLHA 1CUEA 2XOKD 4YNBA 1MVLA 4F9TA 2XCLA 1ADGA 2HWKA 3B7GA 3B9PA 2Z2ZA 3Q5EA 4FIDA 4P1ZA 2WHPA 1XELA 2XMRA 3IQHX 4KWHA 4PNZA 3BEOA 3T52A 3EGEA 3C16C 5ISMA 1TTTA 5B3LA 5F7JA 1T36B 5KB3A 2C04A 3ZJUA 1VFPA 1Z0SA 5FL7D 1IDN1 4BN4A 4RM3A 3FN4A 3RV4A 1XPOA 2WTMA 4EPRA 5BPFA 1ZHHA 4FKZA 4LXQA 2F3QA 3DE6X 2NO4A 2RGGA 2EGHA 1LDYA 4E70A 1IBRA 4EYEA 3EFOB 3HJCA 1MNAA 1Z82A 4B4KA 3ZD7A 4AD8A 3JVDA 8MHTA 4C78A 3BE4A 1E4EA 3ZV3A 4CCYB 2XCIA 1FX0A 4MJLA 5IVPA 1CETA 2VDLB 2YJ3A 2V4MA 3GXOA 4R1QA 3K0CA 1U4NA 5KYVA 5EXTA 3ZWNA 4DABA 5IX8A 4D25A 5AD1A 3EAGA 3OZFA 1JDUA 1GYRA 6YASA 4W5QA 3KOXA 4PPQA 2OAQ1 3EIWA 3F9IA 3C3XA 3RT1A 2LRHA 1UBJS 2CYBA 1SUWA 2Y6UA 2FFQA 4UM8B 4Z51A 1U0NA 4YWHA 1HDGO 1RTKA 2B34A 2WSSD 1F1BA 2YFQA 3OQJA 1SU6A 2L2QA 2XQGA 4HH0A 3MS2A 1PZNA 5LM3A 5LQCA 5J5VA 4RTPA 3T38A 1RRGA 4EA9A 2C96A 2E4WA 2VYFA 3TW8A 2C8JA 3C1OA 4PZ0A 2FW0A 4EBBA 3DOEA 3R0XA 3C39A 2WF9A 4EF5A 5I5EA 1WPQA 4MP6A 1SKQA 2C2KA 1KOGA 3SYTA 3BJIC 1CUXA 3F9CA 4UOQA 4L6IA 1E6LA 4J1NA 1TZKA 1M2OB 1QR6A 2CUTA 1GCIA 2XUIA 3A9SA 3N58A 2C0CA 4B6SA 2YJ5A 4OMFG 4ACAA 3LWZA 2WJIA 4BAGA 3PC3A 5BV1A 2YZNA 1OYYA 2R8YA 2RGEA 3OEYA 5DEIA 1G7SA 2AZXA 1B8VA 4BNLA 3IVCA 4EY5A 3TCNA 4OX9Y 4OBWA 3WYBA 1E4VA 4I5IA 4M1ZA 2WZBA 4TZTA 1KMHB 2W6IA 4Y0NA 1AB6A 2CXOA 3MTDA 2ZRCA 3OEWA 3KKPA 1IQPA 1H6AA 3HQ4O 1KJWA 1N5JA 4KV7A 4WEOA 5DI3A 2PSFA 4BEJA 4FYKA 4N01A 1XQ6A 2UZIR 3WL8A 1NY5A 2CZQA 4A8HA 5JI3E 1FLAA 1E1QD 1G6OA 5CFPA 1X1CA 2PRIA 3W8RA 1ORWA 2B2XA 3EIFA 3O4VA 1Y4SA 4X65B 1H1LA 2HMUA 1T15A 4LCJA 2PYZA 1TW2A 1KS2A 1KQ3A 4ENRA 2RHHA 2OCIA 2P9CA 5LA6B 1RE0A 4DBVO 5CA1F 5IJXA 2O8CB 2VPPA 5E3HA 1KY4A 1WQ1R 3DEZA 3F46A 1Y8AA 2ZR8A 3SJZA 5I51A 2QR5A 4HRYA 2HMYB 1NUSA 4MRMA 2EEZA 4N47A 1VDZA 2PY6A 2DBVO 3L05A 3ASUA 2WYOA 3MELA 3LC0A 4IF6A 4IL5A 4WFJA 1MGOA 5KUTA 1MPTA 1SBCA 3BICA 4YIKA 1P8AA 3GCXA 3UEOA 4QPPA 2CVQA 2PGOA 3B8HA 1KRXA 3GRZA 1XYVA 3RRNA 5ILOA 3QMVA 5JJCA 3O91A 2REXB 4GH5A 2OZEA 3AUJB 1O6GA 3EGVA 4J0GA 3NTXA 4XX0B 1JHDA 2QJFA 3PEVA 2DWCA 4ZXFA 1NN3A 2ZTMA 3ZDAA 1RNLA 2C3MA 2OFPA 4XJVA 3PE6A 5AJYA 5DHFA 5EN4A 4E88A 2EG5A 1PGOA 3JYOA 4AP6A 1B15A 5ECWA 2I4NA 4DBLE 1AZLA 2J09A 1XD2B 3U1VA 2I4TA 4DCMA 721PA 1YZLA 2ANCA 3M5WA 2V74B 4UTVA 4CIAA 2NUPA 3UMYA 2WF8A 1OLUB 5K0FA 1Y42X 3LLCA 2D2XA 3GCZA 1F8YA 4QBFA 1PW7A 4QSHA 1XXHE 4JOCA 4OGWA 3IPYA 1JSRA 1TUIA 3U62A 1E4YA 4M37A 1AGXA 2XLBA 4U2CA 3AR2A 3VO2A 1F5SA 1EFVA 4H7JA 2JANA 2W2MA 3C6XA 1VCHA 4TMKA 2QU8A 5ESWA 1VI2A 3HSKA 5FBKA 3PFNA 1W2GA 1W4CA 4R68A 4EMSA 5FTLA 4AJOA 3KHKA 1S2MA 5MN4A 1MEOA 1QV7A 2CLIB 3W9UA 2VT7A 1Q3KA 3I2GA 4G5YA 3T9CA 1HV8A 2V9ZA 2BFCB 2Q6TA 2YRXA 3E35A 1WWKA 2HK7A 1LNSA 1UJ5A 2OO5A 1Y5LA 3ZXSA 3AZQA 4KO8A 3P2OA 4JGGA 4GPZA 3RV3A 3VPDA 2O2CA 4QOGA 2X23A 1VSTA 5CH3A 5JE8A 4INZA 2H5IA 4OHMA 2YJ4A 1K88A 1XLVA 2Y4NA 1CERA 1VB3A 2YUIA 1IUKA 4L5CA 1W36D 3OU2A 4JVMA 1H3FA 1Y6JA 1JZSA 2JS7A 4P54A 2P2DA 2PO5A 3NUZA 4EHIA 4EQ6B 4HDCA 2PUCA 1U0TA 4BXOB 3W3AH 3CTPA 2DSNA 2GCIA 4LCBA