2IDCA

Structure of the histone h3-asf1 chaperone interaction
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
174
structure length
167
Chain Sequence
ASIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNAAKEIKLARRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-SILENCING PROTEIN 1 AND HISTONE H3 CHIMERA
publication title Structure of the yeast histone H3-ASF1 interaction: implications for chaperone mechanism, species-specific interactions, and epigenetics.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication/chaperone
total genus 28
structure length 167
sequence length 174
ec nomenclature
pdb deposition date 2006-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 2idcA00
2IO5A 5BNXD 2IIJA 2YGVA 4ZBJA 2CU9A 2IDCA 2Z3FA 4EO5A 5BO0D 2I32A 1WG3A 5EIIG 4RRPM 2DZEA 2HUEA 1ROCA 3AADB 5C3IA 2Z34A 1TEYA
chains in the Genus database with same CATH superfamily
3SDCC 1TYJA 1P1VA 3QJHA 4LBEA 3CX5K 1TZIA 1RP9A 4PJAB 4E42A 2Y24A 2Q2EB 1Z66A 3TBYA 3VRJB 2Y22A 3SKOA 5PCYA 4MMZA 1I31A 3CDYA 3NJXA 1U8NA 4RFNB 4FXGC 1L3NA 2G2PA 4NBZB 1E3ZA 1VB9A 1TEFA 4NFDA 3V0FA 3MV8E 4ES8A 3QXAA 1KXHA 1YNTA 2WKLA 5JW3H 4XNZC 4X6DA 1KENH 2NY5L 4FCAA 4M3JA 4PRHA 1FORL 1HH6A 1DBAH 2BVOB 2IADA 5ITBL 3KPLB 3VYPA 4L8CB 3GSWA 2J71A 2WCGA 1IE4A 3QI9B 3BAYA 3UZQB 1BZQK 2Q9OA 2VRQA 3ZY7A 5M7QA 2ICWB 3K1DA 5D93B 4DP0X 4L4TE 2HKHL 2ZOLB 4ZW7A 3O41A 1L9PA 2BSCA 3P3YA 3CMOH 2J44A 4ZX5A 2J2ZB 4FZEL 4KY2A 5D7IA 3SBRA 3T0EB 3WEBA 1T22B 1BXXA 3SSGA 1IT9H 4G6JH 1J8HB 1OCZB 2WLNA 3FFCE 2J8HA 2VITA 4RAHA 1KYUA 4LL4A 2OMTA 5EF0A 4YQXH 5I5JA 1DBBH 3H2WA 1WC7A 3EF7A 3GB7B 5IGXH 4W4OC 3GF8A 1DN0B 5I6MA 1JF1A 3Q05A 4UT9L 3KW8A 1XD1A 2H26B 2X4RA 2G75B 1NUDA 4KKNA 4O51A 5E08H 4OCWH 2B59B 5I18H 4JRYA 4X9BA 5EOCH 3D25B 4HT1H 4MA7L 5FGBC 1YNKH 3CLWA 3U30C 1CE6B 4GBXB 4AYGA 1HCVA 4W93A 2EE2A 4G2AA 4QRRB 3DROA 3SGJA 3QZNA 3FB7A 5AAPA 5D2NB 1GZHC 4JPWH 1H6EA 2HZHA 3E6HB 1A6ZB 1HSBA 2EYSB 4JJOA 3LHAA 3N2JA 4KX9A 3FFOA 3ATBA 2D3LA 3KG5A 4LKCB 4NQQA 4APQB 1ILSA 4M7KL 1BW8A 3MRGB 2FJSA 3FRUA 3BUYB 4GMTL 2UZYB 2JJSC 3FO2B 3V6BR 5D7JA 1ZK9A 4UM9D 3HHSB 2D7NA 1FORH 3A5VA 4OUUB 4DZBA 4G83A 2E6QA 3PREA 1J5CA 2CO4A 3PFUA 4HUUB 1S7QA 2NQ3A 5J6SA 1C8QA 1QYGL 4ZUVA 1PX3A 2OLDA 1W8EA 4M8RA 4FFYL 3J8F7 1DJIA 4PY7A 3VFVB 4AUJA 4L4TD 1ID2A 2ZWLT 2K70A 3KPRD 1BOYA 2HKHH 4N0CD 4JG1H 4DP8X 1NBYA 1T1XB 2Z92A 1KN2L 1KGWA 1SM3L 3V4VA 4FZEH 1N5AA 4BHUI 3DV6A 3RJDA 3MRFA 3FFCD 4NQEB 4P5TC 4F33A 3B6SA 3PP4H 4P4KC 1BQLH 1CK0H 2F54A 1HHHB 1IJ9A 3BP5A 3CXDH 3HN3A 2E59A 4W1TA 4DW2H 2G9HB 1X5XA 3HRZB 1XSKA 2AJYL 1BBJA 5TF0A 5HYQA 4U6YA 3FOMA 3N43B 5J6HA 1X4XA 4UT9H 2YXVA 3QIBB 2Z4TA 4L4JA 3B7UX 3FOLB 4CU7A 3BYYA 1D6VL 2AAVA 2LU5A 5FO2A 2AQ2A 3UJJL 2JV6A 5I1DB 5IEHB 2C9UA 3DHUA 4MA7H 4NRXB 3MA7A 2XX0A 4KOBA 4K94H 2X6UA 5ID1A 3HCVA 2FHCA 4XBGB 1IQWL 1R1CA 3O6FC 4JE0A 4L4VB 3JV5A 1BIIB 5A16B 5M94B 3MKKA 1NFAA 1SXSA 2XWDA 2R23B 5LGJA 3IXTA 5E5MA 3HPJB 4LCYA 5C0EB 4QCIA 2YMXH 1OOAA 3V6ZB 2B5IC 3TCLB 3ULSA 1GYVA 2O1AA 5SWZE 5IW6A 3RVVD 1KN4L 4ELME 1H3XA 1ZSDA 2J6WA 3GXNA 5D1QC 4ZFOB 4M7KH 1RAMA 3EGDA 4XMKL 3QJTB 3OKKA 2Z65C 3EG9A 3K6OA 4JPSA 5TH2B 1ET5A 2NOYA 4WGWB 2DQEL 4LOVA 2K9FB 4EIBA 3R8BB 4NQVA 4QWWC 2GY5A 2DOCA 2IV9A 3UGXA 2RCSL 1ZANL 4FLQA 1QYGH 2X0UA 1ORQA 1S9YB 3IAPA 4PI2A 1BZ9A 2XKSA 1AHWC 3SGEI 3FTWA 5AVUB 3VB8A 5C0GB 3V2AR 1FV1A 3VD5A 3W11D 1T20B 1JHKL 1U30A 1N10A 2E7LC 4N2DA 3R19A 2YPVL 3DO4A 2AGJH 3P02A 1VF5C 1P2CB 1VFAB 5FC9A 3FQTB 3UIYA 2DIJA 1JWSA 1NSNL 2W95A 4IHBA 1YYCA 3GYRA 4CU6A 2X1QA 1SOXA 4KDTA 2I24N 4LHUD 1T6BX 2WMPA 4MA8L 4HAKA 4FNRA 1HHJB 2D3VA 3ZE2E 2JB5L 3AU0A 4RMBA 1A2YB 2C7FA 2JELL 4QOKB 3SDDC 2F6AA 1DQQB 3LS4L 5D1ZI 3O2VL 1GGBL 2YLHA 4JQXA 4LP8A 3ENEA 1BAWA 1XCQB 3JVGC 4L29A 3W5NA 1N12A 1XL4A 3T4AB 1GW6A 2P28B 3ZTDC 3PUUA 5TD4A 2WNKA 3OXSB 3CZSA 5T1LD 4NKQB 3RBSA 3VG0H 3Q8CA 3PLYA 1UEMA 2VAJA 3Q48A 2G4GA 1J5DA 3F7RA 3QDME 3A24A 4OT1L 4XE5B 4A7QA 3E3QE 3IPFA 2PCFA 1AS7A 5D6CA 2WNWA 4G7RB 5GGTA 3RHWK 3VWJA 4P4RA 1AG0A 5EEVA 2W0PA 3HG4A 3TEZA 2ARJB 2FT7A 4Z95L 4ZT1A 1DCLA 1RZIB 4Q9QL 1CFSB 5DMKB 5SWZD 4PG2A 1OK0A 2JLPA 5DQDL 4AV4A 1CDJA 3ETSA 1JHTA 4K5MA 2AEPL 1KN4H 5JIIA 5L8KB 2CJUL 1HHIA 2CKBB 4JVPA 3SQBA 3R7QA 2WBWB 4FKEA 4XMKH 3UGUA 2XOTA 4KZ0A 1BAGA 1OOWA 1RL1A 2HUHA 1WGVA 1J11A 3D85B 3CVIL 4HGKC 4M6NH 2FX9L 1U33A 3QZPA 4OQTL 5CU5A 5F8QC 5ITFA 2DQEH 3A6BH 1GYUA 5IQ9A 1FJ1B 3G5VA 3MGAA 4HC1A 5FB8A 3H2QA 1FZKB 1IFHH 1ZK5A 3AUVA 3RU8L 4DGYL 4N3TA 4U1LB 3FUFA 4JFQA 2BHYA 3HR6A 1J5IA 1AANA 4TQIA 3L3DA 1O9ZA 2RCSH 1YN6B 1KJ2A 4RGOL 2Z31A 5EU6D 4TUOA 3JV6A 4NI6A 4AQEB 2YAFA 3T0ED 1RY7B 1WZMA 2NNAA 2CHWA 1PZ5A 2OFQA 1U8QB 3WHXA 3X3GL 1J8HD 4RMUA 1INEL 1XR8A 3M1CA 2YPVH 3LY6A 2GUOA 2IGTA 4FQQB 2ZUUA 3C12A 4C56E 3P3UA 2XQYA 3G6JE 2P8MB 3VRLF 3A4EA 2JI3A 3MGTB 2QTEA 1YAIA 3ZT7A 5F1SA 3S4SG 2HFGL 4MD5A 4JRXE 4W70A 4MA8H 1IIIA 2OSWA 3DGGA 3NJVA 2JB5H 3VGHA 2H0EA 1OARL 2V3DA 3BH9B 1JGDB 4NJ9L 5DRNA 3X1GA 3LS4H 3O2VH 1GGBH 5FDWA 4GBXD 5TFSL 3KDMA 4PRDA 4PS4H 3LKSA 1MCWM 1XCTA 1G7JA 2WXLA 4RIRB 1KOAA 5I5RA 1A7NL 7FABH 1IEHA 4OT1H 4LEOB 4MB3A 5CILL 1X7QB 3DK2A 4MJHA 4DH2A 1YN7B 4R0LC 2QV4A 2VSDA 5LG6A 2ZUQB 3LPOA 1HXKA 4JHAH 1FZMA 2NY5C 2JB6A 2QBWA 3QO0A 2K6ZA 2RFXA 1KG0B 3R4DA 4APQD 5JW5B 3ARFA 4GKZB 4Z95H 4Q9QH 2X89D 1OV8A 5DQDH 3T3PE 4OW6A 4JFVA 5FYLL 4OZGE 5J9PA 3RLSA 2D7MA 2P5WA 3VW3L 2WXPA 1IAIH 1GGTA 2P49B 3CVIH 4OQTH 5EZJB 3FRPA 3IDGB 2AJZB 1AGEB 3UP1A 5ERWB 3CQQA 5C8JB 1KPUB 3SBPA 1ZEAL 3LXAA 4IMLA 3RU8H 4KXAA 1KLGA 4FQJL 4ZAKB 2YZ8A 4YSDA 1AYOA 4KKCD 3WN5B 5M95B 3FSWA 1EHXA 5CHNA 4RGOH 5I19H 4DP7X 3HE7D 1KB5A 4N0CC 2HJFB 1QVOB 1FYHB 5HJ3A 3BLPX 1C08A 1T21A 4Z7VE 4WGKA 4G7YL 1RV6X 4JM4L 2VYRE 3X3GH 3VU1A 4BFOA 3FUDA 4ZBJA 1INEH 1MHHB 2RJMA 2XIBA 3UAAA 5IVXE 3GC3A 4Z78A 4QTHA 2APSA 1IAOB 2RIKA 1CD0A 4HPYL 3S6CA 4JRXD 4PV9B 1A1OA 4OLYL 2HFGH 3G5XA 4DPCX 1A6VL 1KT2A 2VMJA 3FT4A 4YHIB 3N40P 3GKZA 3RVUC 4L5FE 2PPCA 5D5ME 4BRVA 5JYLA 2EYRB 1OARH 1NGZB 3IMWA 4KJYA 1A02N 5E8NB 3RNKB 5HHVH 4MZ3A 5TFSH 4LVEA 4NZRL 1AKJA 3WKYA 1ITCA 1OQXA 4YLBA 2WB7A 2EADA 1U8OA 3GZOA 4NQDE 3ARBD 5DRWB 1P5VA 1A7NH 5FYLD 4DZ8A 1I85C 3JWNH 5CILH 1C7TA 2WW8A 2OS7A 5KSBB 3LIZL 4E9QA 5BS0B 2JH2A 1ZSHA 4X7TB 1TEYA 1XQ4A 3L8QA 3L6FA 5TK4A 4NIKB 3U9PL 3GK8H 3GGWB 1S9VB 1WA0X 1BBDL 3RWFB 1HE7A 4JHZA 1IEAA 2JCWA 2C1OA 3DA0A 4MCYA 1YPZE 3IAQA 1TDQA 1AKPA 2IAMB 4JFEA 2OCFD 5EOQL 1H6FA 4NCC1 5FYLH 4M93C 3LCYA 2H0JA 1OEZW 3VW3H 1N0LA 4M5TA 5IQ7L 2ZSWB 5F7LB 4HIIA 4M48L 2CKBL 1L7TL 2QHLA 3T4YA 3TWCL 5E2WL 4FQJH 5TF1L 2VDMB 5AKVA 43C9A 3EJRA 1BZ8A 4DQAA 3NP3A 1S6NA 3NG5A 5ESAB 4OF5A 1H15B 3LZLA 4ZPTB 3W11C 4MNGB 2YO3A 4G7YH 1F97A 4WWOA 3VI4E 1PIGA 4HCFA 4PBXA 4ZOEA 3RIAF 4MAZA 1ERNA 5I1HL 3VA6A 3MRLA 2YS4A 3WO4B 5F21B 2N4IA 1DQTA 3FBQA 3KEHA 4AQOA 3D0AA 4IEFA 4HPYH 1TJIH 2G2RB 5C07E 4QO1A 4XP9L 4QOKD 2WAQA 4OLYH 2BXZA 4B9CA 4XO5A 5L88L 4NYLA 1A6VH 2XSKA 1DP0A 3SN6N 3RA7L 1YEFH 5CJ5A 3DOSA 1U8IB 1DE4B 3HMXL 4FTVA 1MW2A 2OXGA 1N5YL 3HHRB 5HHOE 2IH3B 4HHGA 2BCKB 3P4NB 3UBXG 3NIDF 2NR6A 1TG8A 2XWRA 4NZRH 3MU3A 4P57A 5C08E 5I6XC 2V2XB 4YSOA 4LPXA 2DJMA 5FFLA 4O9HL 3GJFK 1KEGH 3WTWA 4HJTA 5G2NA 1ZS8B 3KXFA 2A6DB 3DX7B 1OHQA 3IT8D 2EXSA 4XTRD 1QPPA 4XP6H 1BBDH 1N26A 3EJCA 5HHPA 4W4NA 1RSFA 4JY4A 1D3CA 2P24B 5EOQH 2DWDB 2WTPA 4HOZA 1H3PL 4Z7WA 1UA7A 1LTXA 2QVKA 3QAZC 4FOMA 5DJ6A 3SKUD 1OGAE 5IQ7H 5F3BB 4Q14A 2MTAA 3GJFA 2APXA 2ITCB 3F7QA 2CKBH 1OGTA 2CO1A 4DSYA 5KSVA 2DYRB 3TWCH 2C3HA 4D0CA 3LKOA 5E2WH 5TF1H 4D9RD 3D2UA 4KJPD 4WQOA 5I0WA 2ZXWB 2A6JB 3MZTA 5DEFB 2QMKA 1BD2A 3CHPA 3U0WL 1GC1L 1JK8A 4TSBL 3E1ZA 1QSEE 4ZTPL 3S37L 2NTFB 3LIUA 1BG9A 4O00A 2K4AA 2KS0A 3MXWH 5SV3A 2H1XA 3MRNA 2BC4A 3TIDB 2X9YA 3W0WD 3SKJH 2HPTA 3KEDA 2PPEA 2ZF8A 3GLZA 4X9IA 4X7SL 1JV5A 2BY3A 3TZVB 4XP9H 1V7ML 3GSUB 4KRLB 5MENE 2Q76B 1EHNA 2PXYD 4FKHA 5L88H 4YVNA 4PUBL 1ZHBA 2YBRA 4HZLB 1FYTA 1L0YA 1OGSA 2ITFA 3RA7H 4RMTA 2AQ3A 1EO7A 1JZGA 4KHXL 3HMXH 3O2DA 4GUPB 1HQRA 2WLLB 4WWKB 2DLEA 3FCUB 1C7SA 4OIBA 3D4YA 5D2NC 3RWHA 3SE4A 4UWQB 2EZ0D 1INQB 1CFNA 1MW1A 1R3LB 3BKJL 5JDSA 1U8LA 2CPUA 2MNJB 4UAHA 1TMQA 1B2YA 4B41A 1ZRUA 4FYRA 1YEGL 4LF3B 4APQC 3VD2A 2IMMA 4JO3L 5HGAB 4JL2A 1IBHA 1J1OL 1JPEA 4K9EC 4YHYC 5CLWA 2APTA 2B2XL 4BH8A 1IO4C 4X8JB 1HJCA 1PLGH 1E2WA 4FF9A 1KB3A 2P8PA 3TO4A 1E2VA 1H3PH 1M7DA 2H32A 3QIUB 1BLNB 4Y4HB 3BP6B 2G2NA 3NPZB 4LIQL 2FQEA 4XI5D 2VXUL 3N0AA 3OAYK 1WZKA 5AVQB 2XZCL 1LQBC 1D9KD 2PABA 5JXED 3UTTA 1H5BC 3V52L 4BZ2A 4KKCC 5G4NA 5HHQA 3GSVB 3QQ9C 4N0RA 2PUQT 5T5NG 1I3RB 2YRZA 3HE7C 4FC3E 1JS4A 4NHUB 1JNNL 3WS3A 3L3OC 3U0WH 1F5WA 2QGBA 3LPGA 1GC1H 3Q3GA 4ANXA 2L8AA 4TSBH 1IC7L 1IGTA 1HCFX 4ZTPH 3L5HA 2EIDA 2ZXAA 2WXMA 2AV1B 4FMFA 3S37H 4DKFL 2UWEE 4MZ2A 3CTTA 3F64A 2RAMA 2OJZL 1WAAF 4H88L 1LK2B 2BNRB 1DSFH 4MJ5A 1LMIA 4W9CC 1DQVA 3PHOA 1PG7L 4PJCF 3RB7A 4X7SH 1FO0A 1NLBL 35C8L 3FPYA 4G6AD 3QQ4B 3JWNC 4TPRL 4PUBH 3NRFA 4KXCA 5F7FA 1O6VA 4MNQB 4DUWA 1XF2A 4KHXH 4JDEA 4PJDF 1TYEB 3BWUC 4ZPVA 5FHBL 5BZXA 2Q3XA 3H53A 3TL5A 2CLZA 1Z3RA 3E0GA 5GXBB 3H9SE 4TRPL 3ARBC 2FB4L 5DRXA 4OVVA 3KHQA 5BS0D 1SRDA 3HG1A 2YRPA 4F1SA 1B0WA 3WJMB 3NIDB 4D8PB 2X9ZA 4X98A 4WWPA 1U8KA 4KK8D 2EXWD 1YEGH 2IAMD 2YAOA 3DPBA 2VIRB 1HH9B 3ME0B 1YNLL 3P4OA 1L0QA 4IRSA 4FI6A 1J1OH 4JKPL 1NDGA 4AKOA 4XGZB 4FQPA 3RUGE 2B2XH 2ATPA 2I5YL 1C5CL 2WZPA 3ARUA 3W81A 1TTCA 2XVGA 4L2LA 4Z7UE 3LZFL 2K78A 3HN5A 4KV5F 4LIQH 2WBJA 1JNHB 2D03H 1BG1A 4B9YA 2VXUH 1OY3B 4PJGF 3TO2B 4MCMA 5E8OB 2XZCH 5MEQA 4YHPA 3BWAA 1ZT1A 3V52H 4FQIH 4UNUA 1YLBB 2Q6WA 1CWVA 3V6FB 1EZVY 3FUNA 1MEXH 3VFOB 2O6PA 3OJDA 1KY6A 4K4KA 3NUKA 3MRHA 4TL4A 3SDAB 1F45A 5JPNA 1JNNH 4MSWB 4QXVA 5TDOB 2VN7A 3MLSL 4YN3A 1IC7H 2VDMH 2ZXGA 3GHPA 1E3XA 1ZLEA 2CSPA 4JKKA 2BSRA 4CJ0A 4XX1G 1CFQA 3GS4A 2DQFB 4AJ0A 2OJZH 4YHLL 2KZWA 2ESVA 2BVQA 4HGWA 4IKIA 5JNYA 2X4QA 2FH6A 1PG7H 1DVFB 1NLBH 1J05B 1UADC 35C8H 3NEXA 2PYEE 4Z5RB 1LO4L 1AAJA 1E9OB 1KBGL 4TPRH 4K7PX 2HG0A 5F2FA 1BJMA 1HINH 3OHXB 1XGQB 5HDQH 3VXQA 3UBFA 1ZHLB 3FB6A 3GXPA 1RZGA 5FHBH 2IH8A 4LSTH 4DO6A 1I8MA 1K4CA 3H9SD 5CZVL 1E4JA 1AQHA 4TRPH 1DJZA 4QXTA 2ZPKL 3N91A 2FB4H 4K7PY 4R8WH 2AQSA 3RBGA 1BGXL 5H2BB 1UD2A 1GS8A 1WFOA 3NTCL 1Q72L 1MREL 3X12B 2LAAA 2GYSA 1ZA3B 4ZZKA 3JV4B 4LCWB 2GQHA 4U05A 3CFDA 2WQXA 4UU9A 2YKLL 4HK3J 3UH8A 4Z0BH 1YNLH 5IW3A 4YO0A 1RZ8B 3AXLA 3S3BB 1MUJA 4XPTL 1GMIA 2HLAB 4M6MH 3LN4B 1A25A 3HC4L 4MWFB 4UT7H 1TQBC 2I5YH 1C5CH 2F8XC 4RDQG 2BX5A 3UXFA 3FH5A 5LN8A 4FNUA 3QC6X 3QO1B 1NPNA 1N7ML 2NNRA 3IMSA 3VAEA 3B2UC 1DQDL 3FT3B 3LZFH 1W15A 3CSYB 1MNNA 1KPRB 4MAYA 1CICC 2CGRL 4MXWL 4F7PA 3NZUA 2UY6B 3MRKB 3R4RA 3SCMD 4MQ7B 1O5PA 5TTRA 5JPMA 2IH1A 2PKDA 3H9HB 2P3YA 1UWEL 3DUUB 4NRYB 4YGVB 5DSCA 5K9OA 2AJVL 1BQUA 1E8XA 3KCPB 4KMTL 1E6JL 5F0JB 3O0RH 4N0UB 1CC3A 4L3EA 5DD0L 2E76C 5E1QA 1TJMA 4D7BA 1TCMA 5DI8B 3TYGL 4YHLH 2X4NA 1T6WA 4BQ8A 1IGYA 2PYED 2PXYC 3PFQA 2CD0A 4KX8A 2J43A 4UM9A 4E9LA 1LO4H 1KBGH 5EBGA 1WBZA 3CFBA 4J8RA 4R2GD 4PJCB 4PJ8C 1WUNT 4WWKD 5DDHA 5I17B 2VC2B 4LSVL 4KGLA 4AY0A 1D7BA 1OT1A 5ALCL 1CGTA 3QNXA 5G55A 5L8JB 4KPHH 3RL2B 1R5IB 3BHBB 4JGJA 4U0RC 3VTTA 1T3FB 1A7OL 5CZVH 2EZ0C 5KYXA 2VXQH 3E38A 3QJOA 4PJDB 1J9RA 2ZPKH 2OSLA 1MWOA 4AUYA 5HDOA 5TQ2L 4H44C 2DDQL 4GQ9L 5LXGL 1Q0YL 4FGMA 4NKDB 1EEYB 1QI4A 2P5EA 3EH1A 3NTCH 3HC2A 1Q72H 4L1TA 1MREH 3RX7A 3V95A 3RZCB 4EEEA 5BJTA 1EAQA 4DP6X 4HJIA 3L7EB 4JFDE 4ZUUA 1S7TA 2ATKA 3CJJA 3MCLL 1B4JL 1CFBA 2VM9A 2BJML 3ARDB 2YKLH 3IDMA 5EA0L 3O3BB 3QIUD 2XBTA 4XPTH 3G9VA 4FYSA 4Y4KA 4HUVB 3HC4H 1UKQA 4QLRA 2Q1EA 4LVOC 5D7LE 1XIWB 3QJFB 1GC1C 3ILQD 1N7MH 3VXPA 4AQAA 3K46A 4LEXL 2PNDA 5GRZA 4LLAA 3CPLB 3WN5C 2VAAB 3IS0X 1PDKB 2JK5B 1D9KC 3OJ2C 4PJHF 4A7GF 2B77A 1Z5YD 5EU3B 4OVUA 5JXEC 1NC2A 1SEBB 1KTCA 4RNRA 1SHSA 2L7EA 2VDRB 2CGRH 1T6VN 2XT1B 3NJKA 3POCA 4MXWH 2JIXA 3TONA 1BVLA 2VR9A 4PJGB 4DQOH 2V9QA 4H0GA 1SVCP 1CVRA 1UWEH 2X4SB 5CKGA 3STZA 2AJVH 2GJJA 3QUZB 4KMTH 4KVNH 4QYOB 3GLEA 2DV6A 5B1JC 2O4EA 1BM7A 2IBBA 4J1UB 3P0VL 2ENSA 4R83A 1G4MA 4V1DA 2QR0A 1FL3B 1S3RA 8FABA 1NFDA 2AZUA 3TYGH 1H3WM 5DQJA 2NY0D 5F7BA 2QHRL 3S35L 2GY7B 1S2EA 4JFZL 2AMGA 3C5JB 2V17L 4G6AC 2ETWA 5FO8A 4NXKA 4BDVB 4W6XB 1EHAA 1SLXA 4HIXH 2HYMA 4MNQD 2R29A 1MIMH 3FQWA 4HMEA 1UACL 3V0EA 5AKTA 5BW7A 1FGVL 3VXSE 4JN2A 4OCSL 5KG9B 5CEZE 3KWVA 5ALCH 4F27A 4EKXA 2IDCA 4QAMB 1IGCH 1MZYA 4P2RA 3C60A 4G72B 1PSKL 4MB1A 4RRPM 1ITBB 4P3DA 5HP5A 5I8CA 3EH4B 1Z5LB 5TQ2H 1AIFA 2DDQH 4GQ9H 2ENQA 3LPWA 1Q0YH 1M4KA 3NH7L 4K2UL 4KK8C 4MCZA 1R9FA 4OZIE 3RVXD 2IAMC 5ABAA 4B5EA 2NXYD 1ZV9A 2DLFH 3SPJA 2YPKB 3MJ8A 3V0AC 1B4JH 2F53A 2F74B 2CBPA 2K3HA 2BJMH 3GMPA 4L8SA 1BX2B 1OB1B 2FJFB 4ODTH 4YHKL 4D8OA 5T3XL 4X5RA 1YEHL 2H8PA 4DN3H 5EA0H 1QEXA 3NESA 2ZOKB 4P04A 2SODB 5J4MA 1WT5C 2XWXA 4P06A 3UTZB 3ZMEA 1I7ZB 1SJHA 1YECH 2CBTA 3QCVL 3O4LE 4NZJA 1D2PA 3MOAL 4LPWA 5KBMA 3B2DC 4X0KA 5IB1A 3KPNA 3V0VB 4PREA 5DHYB 4AGNA 3KZ8A 5DURD 4PGEA 3OZLA 1CT8A 1WDAA 2DWSA 4JFFA 4PJAA 3S36L 3LNFA 4MXVF 3TESA 4LDEB 1AY1H 4GW5A 2X4PA 3VRJA 2YGQA 4G8GB 4GAYB 4F93B 3WO4C 5CF3A 3RIFF 5CBEA 4IBQA 1ID5I 1GYCA 1G5AA 3E1F1 1AR1D 2LFEA 3LRHA 4Y5YC 1P6WA 5ANMB 3QXVA 3SJVD 2XPGB 4AT6B 2DM4A 3OKDB 4UIKL 5G5DB 2YPLE 1KCUH 4UDTB 3RPKA 3UPAA 4E36A 4ERSL 5IOPB 5CN2A 2TRYA 2EO7A 4WU5B 4HWBL 3S35H 1K3IA 4ZO8A 1FVDA 5I1AB 2GJZB 2V33A 2V17H 2BVOA 3PGDB 1PEWA 4IRJD 3HPLA 5FGSA 2YIHA 1KIQB 1EMTL 3QI9A 3BVDB 2X12A 3D4ZA 3R0MA 1AXIB 1NGYA 3HZVB 4LP4A 1FGVH 4ODVL 3PG2A 4BSVB 1HEZB 4OCSH 4XNYH 4MB5A 4PGCA 4CMMB 1YMMA 25C8H 1COBA 4G8IB 4E9XA 3D3VB 5LDSA 5T3XD 1PSKH 2VC2L 2AERT 4FI7A 2J2ZA 3T0EA 1WIOA 2LT9A 2XG4B 4LCWD 1T22A 2ZSVA 3VSTA 5I0YA 3TWYA 2DQUH 4WDIB 4WSKA 3T2QA 4U7KA 3NH7H 1T7ZA 4K2UH 4RQQA 4R96B 2XN2A 5C0BA 3T0WA 4NUJA 3VXUE 7CGTA 4BKLA 5I1JH 3AS0A 3GB7A 4C4BA 3NEOA 4ZQTA 1S5IL 1QR4A 4YHKH 5T3XH 1YEHH 3GMNB 2G75A 1PIFA 2Q0ZX 4HS6B 2PETA 3N40F 4KTGA 4FRWA 4HPOL 4L0ZA 1EEZA 2B59A 2BSBA 1VACB 4NNXB 4ACPA 3D25A 1DANU 3QCVH 4LO9A 4NN5B 3BQUB 4G9DB 3ELQA 3HI5L 5A2JH 4FYTA 4QRRA 1SXZA 2ED7A 1XB6A 2B15A 4TLKA 3SCMC 2F7RA 1A6ZA 2EYSA 4PJHB 1UOLA 2KH2B 3LKQA 1P4UA 4I88A 2Z9TA 1XV8A 3P30L 5DC0A 4HIEB 4XXWC 3RKDD 3S36H 5EIIG 3VWKB 3KS0J 4LKCA 2VDRL 2XVLA 4OQTA 5FF6B 4GG6F 1JD9A 2B1AL 4JM2C 3MRGA 2R7EA 3QORA 1A6AB 3BUYA 2AEOA 5CJXC 3GT6A 4UIKH 3NSXA 3EIFA 3QWOB 1JXFA 4X7CC 4MRBA 3JWDL 3SBWC 3HHSA 4ERSH 1CXHA 4XP5L 4HWBH 3ZDYF 1BP3B 1RK1A 3ZYOA 4OUUA 4KTEH 1A3QA 1EMTH 2EIZA 2X6MA 4R2GC 1BMZA 2GTWB 4HUUA 1EA9C 4WO0A 1E43A 3MRCA 5F3HA 2J1KA 4PJ5A 2WLHA 1D5ZA 4W9IC 4ODVH 4HU2A 3VFVA 4LE8A 2DQJL 3G6JF 1BECA 2BNQA 1ZGLM 1DVSA 1LEKB 1QAWA 3MRDB 4MD0B 4ORGB 4FMKA 5AW7B 4EDWH 1BZOA 2ZCZA 2XJLA 1T1XA 3QARA 1Z9SA 2VC2H 2DEYX 5K1VA 3PGCA 4Q2ZB 4P2OB 2YD2A 2WKOF 4NQEA 1CR9L 3ARDD 1F11A 2GBUA 5B4MD 2K7PA 4F7EB 2FIRT 1X5JA 5C0AA 1M05B 3HRZA 3QEQE 1QATA 5AWNL 3F7KA 4TOYL 4KO5A 3MPCA 3KGRA 1KFAH 3UAJA 1S5IH 1FFQA 1TCRA 1T0NB 3QIBA 3KYMB 3HIZA 3UEZA 1ZOXA 3H42L 4WLCA 4WTZG 3FOLA 3WTXA 3ILQC 1E5ZA 2P80D 1CUOA 4HPOH 4XP1L 5CZRA 4WZ9A 3FYEB 3AITA 3SE6A 1RUPL 5I1DA 4NRXA 5FO9B 1QSFD 4GRWE 1U2YA 3DARA 2WZ5A 5L0QC 1TLMA 2EUXA 1QO3A 3HI5H 4XBGA 5DJ8B 2P43B 3TEXA 4QDGA 2FWOB 4L4VA 1UOWA 4B0MB 3QUZD 4OZGF 2FX8H 1BM3H 3OG4B 4FABL 3I2CL 1TTAA 2GSMB 3HPJA 3LNHA 4EE2A 3SYOA 2K9UA 3V6ZA 5C09E 3TCLA 2AI0L 1XO8A 4QT5B 3ULUF 5D9SB 2DQGL 2VDRH 4MLSA 5FWQA 4CSPA 4Y9EA 2DRUA 4LGRB 3BLBA 4ZFOA 2B1AH 4RH4A 4Y1AE 1OAQH 3WNOA 2F7QA 2PCYA 3OLEA 2YC1B 3PXJA 4HZAA 2VRAA 1V27A 1C1EL 5BUGA 2NY0C 3BDBA 2MNWA 4XR8C 4BUHA 3RGVC 1PL3A 3L4CA 1ZVHA 3FNKA 2WQUA 3MCKA 4XP5H 2A83B 1FH2A 5F9WB 2W60A 3LKPB 3LH9A 4GQZA 3FT9A 2F19H 1S46A 1F3RB 2F68X 1MSPA 4NDMB 1ZS2A 2X1WL 4K3JH 3E2HB 1T5WA 2IBGA 4AYEC 3K2KA 4ZUTA 4ZNCD 1XAUA 1I53A 1XF3A 2VLJB 5C0GA 4WTQA 1R6VA 4E41B 1T20A 1OD7A 4IBTA 5IIEB 3MJ9H 3MV7E 4TQPA 1P2CA 1VFAA 3FQTA 1G5GA 1RMFL 1CO1A 5EV7A 2MIZA 3RVXC 2NXYC 2QKIC 4H8VA 4A38A 1ROWA 3QEQD 1T1ZB 3IGLA 4TLUA 1JNJA 4QHMB 4TOYH 3NFNB 2X28A 4DP4X 3B9DA 3G9AB 1DQQA 3Q6GL 3HI1B 4GSUA 1ND0B 3K71B 1XCQA 3H42H 3VI3F 4WFFD 4X6CF 2CKNA 2IVFC 3Q9PA 4TYUA 1OW0C 1XF5B 4XP1H 1VLXA 4U1IA 4K3DL 4FQHA 1DVUA 3SOBL 1RUPH 3QH3B 1UZ6E 1LLAA 3WY3A 2VSCA 4XN7A 5T3ZL 2OYKA 2WWNA 5FHAL 2V3FA 5B38B 1JRHH 4K7FB 5GPRA 4G8GD 1AZVA 2CRIA 2P46B 1CG9B 4WI4A 2C4XA 3I2CH 3S5LB 1RZIA 4DVBA 5DMKA 3BIKB 1WP6A 3HN8A 1HXYA 2AI0H 4RFEB 5KVGE 2DQGH 2FT8A 3H55A 4PJXF 1P1ZA 1QZNA 5DCCA 1AR1C 2VZSA 3FH7A 4B9PA 1MCHA 4AH2B 5DUBB 2H5UA 5C7ZA 4EI5C 3CFJB 3D85A 4GG6B 3K5SA 1NANI 4BH7A 2L4OA 4RETB 1FJ1A 4IRJC 5DYOB 1NIFA 3ATAA 3OHXC 2MCG1 1FZKA 3MCG1 5ICYB 2QLVB 3BFQG 3QULA 4U1LA 4V33A 1P9MA 3ZDYB 3I9AA 5EHFA 5GRWA 4I0PD 2FQGA 1QBLL 4OLUL 4UQDA 5GS3A 1HKLH 1BQHB 3D5OF 4AQEA 5EO9A 1EWHA 4Z7QE 5KSAB 3VVVA 5AUMA 3KAAA 2ZONA 4P2AA 3MV7D 3G6JB 4G8AC 4EF3A 2ZKWA 3MCYA 1GW0A 5I66B 1G1OA 4B9KC 2JJTA 1RMFH 3BKYL 2P8MA 4Y7OC 3SY0B 1AZBA 2DZEA 3GBNL 4JDZB 4KO7A 1MI5B 3DIFB 4BGLA 5AB0A 1NEZG 1YQVL 2HWZL 3F7VB 5T3ZD 4EN3B 1UQSB 2FO8A 3P40A 2HJLB 2G60L 3VXRB 1UJTA 3QR2A 1Q1PA 5INDB 3OKLA 3Q6GH 2HX9A 5IBLD 2B1HL 3EHBB 1HL8A 2FNWA 4GH7B 1T1YB 1J9QA 4LFHD 4RIRA 2Q3ZA 2XIIA 2V9TA 3L5JA 2OR8A 2EXTA 4LEOA 4ZSOE 3GRWA 5T3ZH 4WEEA 1DQJB 1LXMA 4HBCL 4OD3L 4GXUN 5EF1A 4Z7IA 2F7PA 3QZWG 3RFZB 5FHAH 4JY6B 4LDCA 1KXTB 1H0DA 3BP4B 3UTPE 1SDAB 2ZG3A 2BZ7A 4LRIC 3RKDC 3DUSB 2RALA 4YXHL 5CD3B 4GKZA 1SEQL 1OP9A 4OZGB 3AS2A 1JZDC 1KGCD 4HUKB 1IGIL 3AQXA 4F8LA 3FQYA 2R15A 2E27L 1HSAA 3P9MB 5BXFB 2HJKB 1R47A 5DJAB 1S9WA 4JCLA 3LKRB 2WVVA 2W9EL 4F2ME 5EZJA 4MBRA 2AJZA 1AGEA 3HG3A 4TQEL 1GJWA 2GB2A 5C6WH 1KPUA 1AMYA 3B1UA 1OTTD 3IYLW 5IB4B 3WDHA 1A65A 3N9GL 1MZZA 4H2CA 4JM0A 4ZAKA 1SYSB 2WN2A 3NRQA 4BEIA 1FP5A 3VH8B 5KYNA 4X99B 1F41A 3HG0A 4XNXL 1DDHB 1QBLH 4CVUA 1CMOA 5JOPE 2HJFA 4CNIB 1QVOA 1HX0A 1JV2B 1K2DB 2K1MA 3NQKA 1RCYA 4PJBA 2Y2YA 1MHHA 3ESVF 1KTDB 2XACC 5FS5A 1XXDC 1F6FB 2OI9B 5AALA 1DQIA 5I6KA 3ARDC 2AJ3B 1BOGA 3EF4A 5B4MC 1XVSA 2JQMA 3BKYH 4QMEA 4WO4B 3IJ7A 1CGSL 1JF5A 4PV9A 2ZX8A 3AREB 1YQVH 4KXDA 2HWZH 3H3PL 4YHIA 5L2JB 2N0MA 5DK2B 1B0RB 2G60H 4MB4A 1D7FA 2EYRA 1JGEB 1TF4A 3Q8AA 1KXVA 4HETA 3VFRB 2YHGA 4PJIF 3RNKA 2MTPA 4Y19A 3Q8BA 2VUKA 4Y5VB 3WTSA 1S7UB 2JF1A 3ML8A 3VI3B 4DPRA 4X6CB 2BY1A 2BW5A 3HBGA 4HBCH 1JNLL 2I07A 3P0YL 3QUZC 4OD3H 5KSBA 3BKCL 1UD4A 4AM0Q 1EZUA 3DHJA 2E8YA 2MOGA 3JWDC 4ZOBA 4I1NB 1KGJA 4U0QB 3PNRB 3W56A 2Y07L 2ZWYA 4KWUA 4YXHH 3RWFA 2RACA 4LASL 5DVOA 1SEQH 4Z3HA 2VR8A 2VABB 3FQ2A 2O5NA 3B83A 2EEDA 4FTDA 2Z7WA 5EN3A 4J2XA 1FNFA 1E67A 1EDQA 1IGIH 1TMCB 1MCDA 4TM9A 1TVDA 4P59L 5GZNA 4ZD3H 5J13C 3QEGL 1CFTB 3ELAT 2E27H 3RTLA 2ZQKA 3HLKA 3CCHB 3NABL 3AT0A 1NIDA 5IMLB 2YN5A 4PJXB 5HYSB 2ZSWA 2G0LA 3M88A 3D51A 3L2NA 1Q9LB 3D0VB 1GZPB 1RK0B 3O9WB 1AGDB 3UTOA 1MCKA 4U2ZA 3N9GH 3SDXF 2EC9T 4G43A 2JMRA 2VLJD 1I1RA 5IHLB 4E41D 4HGMA 4WI7A 5LGHH 4XNXH 5JOPD 1NBVH 3I6LE 1H15A 4ZPTA 3TN0D 5E6ID 1UHVA 1J88A 4MNGA 3MAWA 4NENB 4NM8L 5EO1B 4L8DB 4LPCA 1ETB1 5I82A 3PGFL 2GCYA 3VGAB 3G5YB 4S0TD 1KTLA 1MIEH 3D39B 1PD0A 4NP9A 4ZMZA 1I9IL 1R5WA 1B2WH 2G2RA 2EVJA 4XRCB 1CGSH 2Z35B 3M1BB 3QUYB 3QRFM 3H3PH 5SWSB 1E40A 5ICXB 5HHXL 2PW1B 4Z3IA 5EO0B 4YFLI 5CEYB 1JP5A 1XHHA 3GEWB 1U8IA 2E3VA 1DE4A 3WLBA 1CBVL 3JTSB 5HVGB 5L2KB 2FQDA 4MDJB 3A67L 2VR5A 3LRKA 4IMKC 3P4NA 4PY8J 2YD7A 1IM9B 2NY6B 3MRQA 1M57B 2F1AA 4K8RC 1AR2A 4JLRB 1I4FA 3U82B 4R7LA 1JNLH 3P0YH 1MQ8A 3BKCH 1SN2A 1ZS8A 1AQDB 4Q58C 5SX5H 3RWEB 2B3RA 3ECBA 3OM3B 2AXGB 2Y07H 3O81A 4PHZA 3NJGA 3ZIMA 4YJZL 4HWZB 5IKCA 4JO4L 3HLAA 4M56A 2B0SL 3B43A 2W9DL 3D0LB 1UM6H 3KR3L 4PREB 3MV9A 4P59H 1OWWA 3ESNA 3QEGH 4ZXBB 2ZWKA 2EACA 2WTRB 3NABH 3X3FH 3FU6A 1RUML 2C4FU 2ZUYA 5GGVY 3WEOA 1KZYA 5J56B 4FHJA 3K4DA 3ZKMD 3JT2A 3VJ6B 4XZUB 2X1XR 5K9KB 3OGOE 4I0PC 1B4TA 2DMKA 4F57L 4QJ4B 2ITEA 1ADQA 3BGMB 2JI1A 5DEFA 4YK4B 4HCRH 2BFGA 2OULB 3RDTB 1EEUA 4JGMA 5ACZA 1AP2B 4OI7A 3HAEB 1UGKA 3KPSE 1V7NL 1V10A 2E7BA 2E86A 5JIMA 2NTFA 3F62A 4NM8H 1GVIA 4X5LA 1RZKH 2GIMA 5E00A 3PGFH 1MI5D 2F5BL 4PN6A 4WEMB 1KZQA 1ZTMA 2I26N 2DF3A 4BZ1L 1R3IL 4EN3D 1CLYL 2ZOUA 1SXAA 3S8GB 1I9IH 2ZX7A 3QAQA 3REVB 3VXRD 3NCXA 3TZVA 3UPRA 1JL8A 3BRDA 1PKQB 5JLZB 3GSUA 2Y7OA 3IDUA 2Q76A 4IBLT 3EHBD 3C5ZA 2VL4A 4RAVB 4HZLA 1MFEL 4Q8BA 2VXQA 5HHXH 5IBLC 2DQCL 2FYYA 4POYA 5EF2A 1CBVH 4GUPA 2IOOA 2WLLA 3I6GB 4LHUG 3A67H 4DK6A 4NC1C 4AIEA 2H4EA 3QUXD 4PJIB 5HGBB 1R3LA 2PPAA 3GI9H 4IKLA 4XHQA 4Z7OE 3MTXA 4ZYKA 5SX4I 4OCXL 2OJEB 4UTBL 3GXUB 3C9NB 4WU7B 3HZMB 3KH3A 1U41A 5AOLA 5C0IA 5I76B 2HTKD 5AVXB 1MCEA 2CZNA 2VN5A 4TVPL 4AQ8A 4KI5E 5HGAA 2M8XA 3X14B 4AMXA 4YGAB 1HC1A 4JO4H 4PVNA 4JREB 2B0SH 3C6LB 1J0ZA 2W9DH 5BRZE 3ZTJH 2XBZA 4PSRA 1XTMA 2A4EA 2Y06L 3QIUA 4Y4HA 5J8OA 5HVFB 1PQZA 2AF2A 3FQRA 2AQ1A 1NJ9B 3SPVB 1RUMH 4JRFA 4KQ4H 1OTTC 1Z3GL 3BSZL 4MJIE 4K3EL 2FSDA 1NAKL 2Z4QB 3ULUH 3IVKB 2H2SC 1QWUA 4OY9A 3UEQA 4PWJA 4H8WH 1CJYA 1LYQA 4P5KB 1GKEA 3LV3B 4CMHB 1OSEA 3SDXB 4PRNB 1ZXQA 1I1YA 1OSYA 5KJRL 3KPSD 4WUUB 4NN6B 1JPFA 4XH2B 3DRTB 3FMGL 3QB7C 3LZRA 3HE6D 1CFMA 2XTJE 2CNYA 3NIFF 5CP7B 3EDDA 4O4YH 1DUZB 2F5BH 1UWGL 2BNRA 3L95B 3W5MA 1DYZA 3LN5B 4R5TA 1R3IH 3ROLB 1CLYH 3UYPB 2YOCA 3HKFA 1N8ZB 1ZJBA 1FI8C 3H6JA 3QQ4A 1MFCL 5SWQB 2BSSA 4UNVA 1NIBA 1ACXA 3KLSA 4HYTB 2NY3C 5E6RB 3U36B 1MFEH 2W9LA 5HHMB 3DJ9A 1ETJA 5LCVL 2DQCH 3RQ3A 4LU5H 1E5UI 2WVSA 4TVPD 4NUPA 1W80A 4OM1L 4L0YA 4ZX6A 1ZLSL 4S2SB 4TL5A 3Q6FB 3QGVA 4QR7A 2X53A 3WJMA 1T5XA 3CAFA 4OCXH 2LOEA 4UTBH 2I32A 1KGYE 3BESR 4NNPL 3CFKB 3IPBA 3US0A 4OJFL 2VLRB 1Q90A 5B7EA 3I85A 1LVEA 2OYMA 3ME0A 4TQHA 3V6OA 4XGZA 5DZPA 4K71C 2F7OA 5D1XB 5AW8B 3BJ91 5BRZD 1Z0NA 4FL4B 5IJKC 2NX5B 3V10A 5E8PA 2A2QT 4F7MA 4OZHE 3T6ZA 3O9WD 2Y06H 5DJDB 4I5BA 3LD8B 3MUJA 3F5WA 3DI2B 4MJID 5BO0D 5I5IA 1Z3GH 4KO9A 4PEEA 3BSZH 5D96B 2SEBB 1A5FL 2W1NA 3PL6A 3SGEH 1ZJAA 5E8OA 3TO2A 4PFEA 4K3EH 3UMTA 3DVIA 3V0IA 2R8SL 1U42A 4MMXB 1NAKH 4LCUB 2D7PA 1HT6A 5DZOA 3MI6A 1VDGA 2ILLA 3TN0C 1UXWA 1WZ1H 5E6IC 3SDAA 5JHDB 4WI8A 1FFNB 1M56B 1ML0A 1Q4NX 5LN4A 2FQFA 4EN2A 4UOZA 3RVWD 2APFA 1RLWA 2XTJD 3FMGH 1JG9A 4PIBA 5ETUB 2CR0A 3Q9QA 3C87A 5AVRB 4IK6A 1WS7A 3QUYD 1UWGH 2O5XL 5SWSD 1NA8A 1QRNB 1ORSB 3AW5A 3C2SA 1DVFA 1OAJA 1J05A 1FVCA 3H1ZA 1NCDL 2GT9A 1MFCH 1KY7A 2W0FB 3UYRL 3BPOB 4JKMA 1VCAA 4F8QA 3W37A 5EZIL 4DEWA 4JN1L 4Z76A 1XGQA 5LCVH 3L4XA 2EE3A 1MELA 4J3TA 3MLTB 5BVJA 4OM1H 3TBCA 5HYJB 4Y9BA 4JFOB 3KNBB 3TIEA 4BWTA 1MCSA 5IBTL 4BSWB 1ZLSH 3JWNG 4N2HA 4N5ED 1IU1A 1JZ8A 3ZDZF 3F12B 3AFLA 2RB8A 4P5TA 1S8DA 3LDBB 1JF6A 3FQNA 4HLJA 3X12A 3VXMA 4C83B 5FGCE 4NNPH 2W59A 1ES0B 3JV4A 5C97A 1B4RA 1M3IA 4X6DF 5B1BB 4BV1A 3ARGB 4OJFH 1U3JA 2O6FA 2Y2TA 1YEIL 4LLDA 1FZOB 5D8JL 1RZ8A 3N41F 4FNLL 4ZXBD 2HLAA 3EYVA 3M8OH 3T65B 4G71B 4MWFA 1ZWIA 3GIVA 4P9MH 2AMUA 4G80B 3MRRA 2PR9A 5FYKE 2IF7A 4GT7A 4E9YA 4F20A 1IAII 1LP9E 1NBZB 1Q94A 3U6XS 4AV0A 3VFNB 3FT3A 3KYOA 5AOIA 3VM7A 1OPOA 3P3TA 3PWPA 3ZKMC 1DJWA 1A5FH 3WUWG 3TS8A 2NMSA 4WI9A 2WBKA 4Y1TA 2R8SH 1H3GA 3NYKA 2AEWA 5IBUG 2UY6A 4F7KA 3MRKA 3NCWA 2B9AA 3RDTD 1ET8A 3GRBA 3ULVF 3O6ML 3LPPA 2UVEA 2HVJB 1EQWA 2MPVA 4ODSL 2R0LH 1SLVA 2YN3A 3KCPA 4MHHI 1PTZA 3FTSA 5EU7E 3HB3D 2WXOA 4KHTL 3BI9X 4N0UA 5GRJH 2JJWA 1F4AA 1D6EB 1NFIB 5L9DL 1KTRL 1DJHA 3C5XA 1X9LA 4EN3C 1QP1A 3VD1A 2XQBL 2VO8A 5HDRA 1NL0L 4ZW8A 4G42A 2BRRL 2O5XH 3UTQA 3VRIB 4WK0B 4D3CL 2A0LD 3HAEH 1TZAA 5ABDE 4H1LG 3NIFB 4EVNB 3P1VA 1X9RA 3GBDA 3S0PA 5GGSA 3EHBC 1LWJA 3UYRH 3PXHA 3WD5H 4S10A 3BMWA 1PS3A 2OR9L 1KCSH 4PJCA 5EZIH 5HVHB 5I17A 5KBNC 2HRGA 2VSMB 4JN1H 1AO7B 4A7TA 1R5IA 1QNZL 3BHBA 5F9JB 3QUXC 1T3FA 4Y2DB 4CVXB 3N1GC 2FZ3B 2A77L 5IJCC 5LNEA 4F92B 1EHKB 3DK0A 4JZOB 5IBTH 2ADGB 2X09A 5DJZA 3EBIA 1I8UA 3F2LA 2GSIA 3PABB 2MQGA 2HTKC 3RZCA 1JZIA 3FU8A 2ZF9A 4IOSA 3L7EA 3VD4A 1LWHA 3BSHA 3KGTA 3C6LD 1OTUD 2X0WA 4MQXD 1LO5A 1E2ZA 1YEIH 5D8JH 4TNVK 4ZOCA 3AXHA 3O3BA 4FNLH 4NO3A 3SKMA 4HUVA 3T6VA 2OMWA 2DWYA 2WNGA 2O6DA 1ZVNA 2MWCA 1XIWA 3QJFA 5E9DE 1C16B 1FNAA 2E4FA 3CU7A 5GIRB 3X17A 4KUCF 1EAPB 3CPLA 4JDTH 2VAAA 3C09B 1R3HB 4TNEA 5I1GL 1DLFL 1PDKA 3EYQD 3DV4A 3AQZA 1L9SA 1SEBA 3NGBB 4FFZL 2D2OA 4WK2B 1JERA 3EXJA 2HX7A 4PG9B 3IKCB 4Q52A 5E94A 4OI8A 4Q9RL 1UENA 1TPXC 1G6RA 4IJ3C 4WKZA 1F3DJ 1PY0A 3L16A 3O3EA 4WUUD 4PJGA 2OL3B 5DRZB 3ZZQA 2O61B 3O6MH 3GFUA 1G84A 2OI9C 2X4SA 2VR6A 3QDGB 4ODSH 4R5XA 4WEBL 2LQRA 5AFAA 4QYOA 3S8FB 2EYTA 1BVKB 1FZJA 2YEZB 3HE6C 5FX3A 1HQ4A 4J1UA 5IM7B 2NSXA 1E4KA 5L9DH 4PSPA 1FL3A 1FVEB 5AZEH 2XQBH 1NL0H 4UQAA 5B8CA 3FCTA 3VYNA 4I2XB 3C5JA 3VG9C 5HHMD 1USQA 2LGNA 3APFA 4BDVA 2AITA 1XGTB 5F89B 4G9FA 1WRFA 3WKML 2ZG2A 3A4AA 4XODA 3T9WA 1MVYA 2QMJA 4QD2E 4WW1B 3MJ9A 4Y5VC 5DU7A 5F44A 4C57C 5KG9A 4XBMA 4AYBA 5DEJA 1QNZH 5IF0A 1AZNA 2WNXA 4RWHA 5AG8A 2A77H 3QJHB 4O58H 2UZIL 5CIPB 5KUMA 4NJAL 4FHKA 5H37G 1TTRA 2EILB 1FFPB 3TJHD 1F86A 2HRHA 4LOUD 4RMQA 3ZDZB 3ROOA 1THCA 2P47B 5D1XD 4JMNA 1U8NB 1LO0L 2YPKA 3DIVA 3KWXA 1N6VA 4FA6A 5F1KC 1BX2A 1OB1A 2FJFA 4P07A 2JFCA 4X6DB 2J3SA 2YD9A 2X44D 2B4CL 4PRHB 2EKJA 1OALA 2ZOKA 2KZKA 3FT2B 4PY8I 5GGUA 4S1QL 3GSWB 3LNDA 2EC8A 1IILE 1KCRL 4IYKA 1U2CA 2J5LC 4TLTA 1GOFA 2Z8WC 3AT9A 4DEPC 3CFIC 5J6GA 4JJ5A 2BS71 1QI3A 4FZ8L 5I1GH 4CC4C 3F65A 1K4DA 1KTJA 4YOKA 5ISZE 4CSTA 4KFZC 4FFZH 3V0VA 5DHYA 3L5WA 4DP5X 4UILL 1Z32X 1F3JA 2H45A 2QPDB 3IDIA 4Q9RH 3GM0A 5D1ZC 3DSFL 2D7OA 3VGAC 5JIDA 2Q2LA 2X42A 4XO4A 4BGDA 4WEBH 1UA3A 4GAYA 3A23A 3RVWC 5JMRA 2OMTB 2XTJC 3MV8A 3DGDA 4AC4A 2ED8A 3VD9A 4IBVA 1WC7B 2XLLA 4J3OD 5ANMA 2VL5A 2XPGA 3VFUB 3WN6A 1JF1B 1SN5A 2LU7A 2H3KA 5IOPA 2O5ZL 4GT0A 4RGNE 1SJEA 3TA4D 3PGDA 4O51B 4WI2A 1KIQA 4ZDHA 2V5MA 3SB3A 2AABH 5FO7B 1MPAH 4GAGL 3DWTA 4AIZB 4JRYB 5ADPL 5HYJD 5EMYA 3WKMH 2BW4A 3CK0L 4N8VA 3HZVA 5DR5H 1ZVSB 2NY2D 2ICCA 1HEZA 1JTOA 2Y7SA 3I9PA 2VQ1A 3B1TA 3DROB 2AXFA 4CDGC 3FB7B 4IKKA 6CGTA 4B9ZA 3W38A 4G8IA 4N5EC 4IW4C 3D3VA 1HSBB 3KGUA 4DOHE 2XZZA 3APNA 5EWIL 5INCB 1NQBA 4PBWD 4WDIA 4X8XA 4K5LA 3ZE0E 2BVYA 4KK6D 4BWUA 1H8NA 2XN9E 2MEJB 3B7SA 2YFNA 4LPUA 4UQ9A 1T4WA 3BSGA 5D7JB 2AZAA 2XA8L 3QFJE 3D9AL 2ICEB 4Y5XC 2CA4A 3RHWF 3T04D 5GS2H 3DUHA 3GMNA 5LVEA 2R0ZH 4YSRA 2TAAA 2B4CH 4HEPA 4HS6A 2JQAA 1L3WA 3AM8C 1V3LA 2J8UE 4DZBB 1CTOA 4S1QH 2BNUB 2X88A 43CAA 5I6LA 1JWUA 3B56A 4KX7A 1VACA 1KACB 4NNXA 4U1GB 2ZOOA 5DO2D 3BQUA 5TE7L 4HFWB 4PY7B 5AOJA 1MLBA 4Q6IB 5D4HA 5ISZD 4OSUL 3B2VH 1GKOA 4UANA 3F6IA 5T5FA 1KCVH 3RDTC 4EUPB 2WQWA 1TOXA 4UILH 2V8MA 3AY4C 3G7TA 4A7GA 4YDJA 3ZE1E 1I8AA 1N5AB 1ZE3C 3DV6B 3HB3C 4HIEA 2ZKYA 5KAQF 3VWKA 2OW6A 4F33B 3CX2A 3UZEC 3ZQXA 3GSXB 5FF6A 4HCGA 4J4PD 3FQ1A 1TEGA 2EAEA 3BP5B 3PCYA 3O3UN 4EXKA 2OL3L 3SPIA 4ZMAT 1W6WA 3WHE0 1BBJB 5HYQB 2A0LC 3QWOA 3O45A 2WQRA 1QRKA 1RUKL 2V8LA 4RGND 1WAPA 2O5ZH 3SYCA 2ZTBA 1X6NA 2WD0A 5TGBA 4XPAL 4M62L 5ADPH 2NDFA 2GTWA 3JTBA 5AW9B 3QA3A 4Y2DD 5FR3A 2YJQA 3DX0A 5ID1B 1UJ3C 1OZUA 1LEKA 4MD0A 4TSCL 2X4TB 4B9JA 3EJUA 1BLIA 4OGZA 5LGJB 4XVOA 3IXTB 5E5MB 1CIUA 4Q2ZA 4QCIB 5EWIH 4URKA 4P2OA 1NIEA 3OQRA 4RFOH 3GMQA 5C0FA 2BY2A 3SGKC 2HTLD 2L0DA 5IW6B 2AQNA 4JREC 3TX4A 1ZSDB 2HAZA 4YDIL 1G43A 4F7EA 1OTUC 4EAEA 2BIIA 3OKKB 5C7XL 3MGOB 4X8CA 2K4WA 4X4KA 1OAYH 3EG9B 3MLZL 2J5WA 1X5KA 2ISDA 4A2DA 2ENPA 3D9AH 3L2LA 3T5WA 4JR9L 1UB6A 3IBEA 2E7DA 4IJTA 5C1MB 2PO6D 4OIFA 3O2WL 5KANG 1S7VB 5DJCB 2IWFA 5E5LA 4WHCA 2KQNA 1ORQB 5FO9A 5CMAA 3RIFK 4I9WD 5TE7H 3EYQC 3OLDA 1QFWM 4W68A 2OMZB 1XEDA 3B7YA 1RZFH 3IDYC 3H9YA 5FM4A 3T6XA 3WSQL 4NM4H 1U58B 4OSUH 2FWOA 5D7IE 2XIDA 5DFVD 3AACA 1NGQH 2ZOWA 5C09B 2WM0A 5EU7C 3EKCA 3FUJA 1E27A 2ARJQ 3WTVA 1JWSB 4QT5A 5D9SA 3TPUB 3O11A 2J21A 1B9ZA 2BP8B 3MBEB 2OL3H 3B9VA 3EFDL 3EO9L 2RTTA 2YC1A 3E6FB 1P5UB 3ZR6A 2WY3B 3IJHA 4GKNA 1BF2A 2DWXA 4GW4A 4XB3A 5HJDA 1RUKH 3ULVL 12E8L 1NCAH 2VMEA 3QXUA 2GJ6E 3D12B 2A83A 1ZY9A 3LVEA 1AC6A 1PY4A 1LEGA 1F90L 3LKPA 5IP4A 3IKKA 1UH2A 4M62H 2E7MA 2VGLM 1T89A 4DEUA 3V0GA 5B39B 5KBDA 4LVNB 4G82A 4OFYA 1UH3A 2VUYA 5B3SB 2IWGA 4Q4IA 3VD7A 4XP4L 1HZHH 1MRFH 4TSCH 8CGTA 5LUMA 2EDHA 5I8EB 4P4RB 5AVVB 4LVHC 1D7DA 3VFSB 4DERA 5K9JH 2X6BA 4DP2X 3TJHC 4X7FC 2ZYHA 2N1KA 3T08A 1NCCL 1CLCA 2QADD 1ZTXE 2YXFA 4LOUC 3Q1SL 5FM8A 3DTXA 2VN4A 4OCLC 5D1XC 3V5DA 4M02A 4YDIH 4N0FB 4FL4C 3ILDA 3SQBB 5I73B 5CIPH 1T1ZA 3LMJL 4LLWA 4PRHD 3GSOA 3FO1A 4QHMA 1BVZA 4XC1L 4AC2A 3ZLQC 5ITFB 4AW4A 4YSTA 4NLHA 1EVTC 2KUTA 3OV6A 4JR9H 5I71B 5IQ9B 5B1CA 2R0WL 3IJEB 4BK5A 5BNXD 4JQIH 1ZMYA 4YHML 1ND0A 3K71A 3QS2A 3O2WH 5D96C 3MNMA 1I3UA 4G11A 4XAKE 1XF5A 3QDMA 4FXKA 4MMXC 4U1SA 2J4WL 3F6LA 4C59B 4DCQB 1PW3A 1RIHH 1SJVA 4UZSA 2Z31B 2XKNB 2X2YA 3T0VA 3EW3B 4Y2OA 4HJ0D 3WSQH 2AJSH 4OKVB 1PZ5B 4DAGL 4PJ9B 3LNGA 3WHXB 2CA3A 2ORBL 3IJ8A 5B38A 4K7FA 5KVDL 1UXSA 3PDOA 3ULVD 2GUOB 3QDJE 1L9QA 4UQIM 3W9DB 1DO5A 3W9EA 1WCBA 1Y6KR 3H4HA 2AJUH 3S5LA 3UG4A 4Q9CA 4ZFGL 3H56A 3V9FA 3DHMA 1U6AL 3RDJA 3ESUF 5EBLA 3ARQA 4F9LA 1MWAB 4J3OC 5AOMA 3BUIA 4A7VA 2YUZA 4MD5B 1JYXA 4AH2A 5DUBA 3EFDH 2H6OA 1WLHA 1XGYH 2LABA 3EO9H 1N67A 2OK0H 5J5EA 2B1OA 3BPOC 2A9DA 5DRNB 4GKLA 4JFYB 4JRYD 4KH9A 3ULVH 5DYOA 3ZN6A 12E8H 1Y1UA 3EZ8A 4HCRA 1LD9B 5FKAA 1F90H 3WKNA 4M6OL 3KPQB 2IO5A 1G7JB 1ACCA 1FLTX 2NY2C 1JGLL 4S1RH 1GOGA 4MDRA 5DC9B 1BQHA 3L3OA 2YXWA 4PU2A 5ENWA 4AJYV 2IANE 4XP4H 5KSAA 4ZMXA 5DD3L 2CDEB 1F6LL 1A1NB 3WDIA 1FZMB 1R34A 4C56A 2VT0A 2B4CC 2RFXB 3G6JA 1F2XK 2YD6A 4BCXA 3T0XA 3NDYE 3DI3B 3ARFB 5I16B 1NKOA 4KK6C 4M8QA 5C86A 1NCCH 3NACH 4J2QA 2JE8A 2IJ0C 3Q1SH 4Z7WF 5D7JD 4JDZA 3BIBX 4WI6A 4HOWA 1AXTL 4WV1C 2P5WB 1EHLL 5ID0A 4XC1H 4XO3A 5IHUL 3EJZC 4J6RH 3WE6A 3FRPB 5INDA 1AC0A 4XOAA 2R0WH 4PCYA 4QRTA 4JFWA 3DECA 3MMEA 4YHMH 1RFDL 3NOIA 4IMLB 3TFKD 1M1SA 3MV11 5DO2C 3WFBL 1KLGB 1FAKT 3A0OA 4KUCD 2ENJA 4GAAA 5CLYA 3WIHA 2XZQL 3EH3B 1C08B 1T21B 4DAGH 4JY6A 5DVNA 2ORBH 1KXTA 1OTSD 2N3JA 5KVDH 2F54D 1OCRB 1QR1A 3DUSA 4BM7A 1XBRA 4Z78B 5B1AB 4ZFGH 4J4PC 1W6LA 3QEHA 4OZGA 2WYIA 4N6RA 4HKJA 4DGVL 3CD4A 4EUPH 3B3BA 3L81A 3RZWA 1A1OB 2IOMA 2JTYA 2MHAB 3P9MA 3G5XB 5BXFA 4B50A 2WXNA 3UDWA 1KT2B 2FSEB 3FT4B 3HKZA 5DJAA 5C0JB 1IGJA 1XCXA 4RGNC 3B7TA 3LKRA 3LRGA 4TUJA 3D4GA 2QKSA 5K93A 1AIZA 1SPDA 2C34A 4ZW5A 3U0TA 4C4KT 4AOFA 4EIZC 3EUDA 2YLKA 4CJ1A 4Z8FL 1AKJB 4M6OH 4Y2DC 1SYSA 1AD9A 5HJBA 3MXVL 5KUKA 2R1XA 1JGLH 3ES6A 4X99A 2MQ3A 4I18C 1DDHA 5FKPB 4DZ8B 2HB0A 4CNIA 5BOZG 1JV2A 1K2DA 2ZYIA 5DD3H 5F8RC 5D70L 4K5OA 1YHPA 1KTDA 1T0MB 4GXFA 2C26A 1OF2B 2XI9A 1JFHA 1DVZA 1QTSA 2DYPA 5CGYD 4Q97A 1IEAB 1QNIA 2AJ3A 2HTLC 2C1OB 4MCYB 4WHTA 4KVPA 1FGNL 4WO4A 4XXCA 4FXLA 4JFEB 5GGTL 4DKEL 4GRLA 3AREA 2A1WH 4AZUA 5L2JA 2NZIA 5JIQA 5MEOB 1EHLH 1N0LB 5DK2A 1TNNA 3LH2H 2WXRA 5IHUH 3MLUH 3VE0B 4HULB 1JGEA 2PO6C 3C09C 1O7DE 4J3UA 4DFIA 3IPEA 3BCFA 4HJJL 4HLEA 3DMMB 2DTML 2G9KA 3NGBC 1RFDH 2XTLA 3OKNA 4NQDA 1XMWA 2XVKA 2XWBB 3WFBH 4KI5F 3L4ZA 4ZOAA 5LAXB 5L6YH 5CZXD 1S7UA 4HC1L 4X6CA 3IJYA 9CGTA 3M1OA 2Y72A 3MTRA 4GRWH 1BEXA 4H8PA 3CMGA 2CR6A 3KLKA 2PTVA 4L48A 3IJSA 1CL7I 1XXFC 1F4YL 2WXJA 4OF3A 3CHQA 4ORZC 1MG2C 4MQSB 1T2JA 4DGVH 4IEFB 1KGXA 3BSZA 4QO1B 1CFTA 4XMZA 4YX2H 1WZAA 3MZGB 4LEBA 5HYSA 5JIHA 5DQ9A 4YDKH 2OJ1A 3FUHA 3H54A 1MWAL 3DOSB 1Q9LA 4GMSL 3D0VA 4F15C 1RK0A 1CICA 3O9WA 1AGDA 2NUPA 2OXGB 3G6DL 1IVTA 4MJJA 4Z8FH 4YAQA 1WHOA 4FAAB 3MYJA 4CVWA 3LH8A 2D4DA 1A7QH 3VWJD 1P6AB 4HF5L 4YMPA 5C9JB 4U3XA 3VI4A 4RZCB 1RUQL 1EX0A 1PLAA 4RISL 1BMWA 3KXFB 1MFVA 4OAWA 4L8DA 5D70H 2R4SL 4MMZC 3NT0A 2D0HA 4L1HA 3G5YA 2ERJC 2QADC 4KQ3L 3D39A 4R84A 4X9GA 5E70A 5C07A 5JHLL 1QSVA 1X9UA 3ESMA 3L48A 5GSVA 2XUWA 3UJIL 3ZJAA 4EXPX 1FGNH 4UQBA 2P42B 2MOVA 4ZS7L 5GGTH 1QHPA 2Q7NA 3VMNA 4ADIA 4XRCA 4PJEF 5GRVK 4DKEH 3QWNA 4QRAA 4Z7WB 3CHXA 4GXVL 5F6HJ 5JQ6L 3ARXA 5EO0A 3DLQR 5KOVC 5HHOA 3OSVA 5GGSY 3BAXA 3GJFB 4NAJA 1IBFA 5D7EA 1QHOA 3JTSA 2J1ZA 1UWXK 4LLMA 4HJJH 1OGTB 3FUMA 5C08A 4MDJA 2DTMH 2Z31D 5KSVB 5L2KA 1N6UA 4NN7B 3ZKXB 1IM9A 4HIJA 4OLXL 3LKOB 4XN9A 5K1NA 2HSIA 1NMBL 4HIQA 4RZKA 2FJGA 4HJSA 4KKZA 2ZXCA 4HJ0C 4KRPB 5FUOL 1JK8B 5I6PA 4XE0A 4BFEA 1H9DA 2OBGA 1KBKA 5CN3A 1AQDA 3RWEA 4QRSB 4ETYA 2EEAA 4LAQL 1OCWL 4JPVL 1F4YH 1KB5L 1KDJA 2IPUG 3B8SA 4R7NA 3MRNB 4HWZA 5FM5M 2GUYA 2FBOJ 3LZPA 2KPNA 5BZZA 1CGXA 1OGAA 4M1DL 1R24A 2XG5B 1GIGH 1BQRA 3BAEL 4N1EA 2WTRA 3SBQA 1ZHBB 2YBRB 3VUAA 3GIZH 3FSZA 2RHEA 3Q5YA 4HK3N 1IVLA 3G5WA 3UX9B 4RMRA 1MWAH 1CD8A 4GMSH 4A7SA 1BVOA 3K2IA 3QEUB 2Z93B 4N2GA 5J57B 3SGJC 4HAGA 3VJ6A 2VLKE 4XZUA 4C4KO 4IOFD 5K9KA 3FB5B 2AK4E 1YYMH 3K8MA 1T04B 4BE6A 2X2JA 4YFLF 2VDPB 3MO1A 4JFSA 1QSEA 4Y8DC 1U8LB 3VNYA 4RBPK 1YA5A 4OB5L 3O3AB 3ARFD 4F2EA 1B0GB 3HAEA 1MJUL 5B1KA 4GKOA 3U4BL 4N22A 1WUZA 2R4SH 2ZICA 3KMDA 1MFNA 1CF8L 3ZK0A 2WWOA 4KQ3H 5EG6C 3Q06A 2LVEA 5D7JC 2P5WD 4CILA 2CNZA 5JHLH 1WCQA 5MENA 3UJIH 5E2JA 4F7CB 1X5LA 2P5PA 3REVA 1TSRA 2HRLA 3P73A 3CH8A 4ZS7H 1BWMA 4YDZA 1RZJL 2P8PB 4LMQI 1PKQA 1M7DB 4O2CB 4OGQC 5JLZA 4AI7A 5FEBA 3MACL 4GXVH 3JYBA 5JQ6H 2NDGA 4ODWB 4K55A 5JO5B 3G08A 1EJOL 1P69B 4DPBX 5BZDA 2EUVA 3I6GA 4G8FA 3ETBJ 3Q0HA 1IMHC 1DJYA 3S3SA 5HHQB 2VCOA 2C3VB 2XWCA 4HP5A 1SXBA 5HGBA 1NMBH 4XCEB 1GL4B 4N8PA 3T3MF 3OKYA 2QEJA 2OJEA 5FA4B 2Z3FA 1PZDA 3C9NA 2G3ZA 3MRIB 5AQ0A 1OTSC 2E8ZA 5IVZB 4NBYB 4MX7A 5GGRA 3PP3H 4PRIE 3ZMNA 2GK2A 3X14A 1L9NA 1OCWH 1IC5L 3QS3A 4JPVH 3D6GA 5F9OH 5F96L 4E9VA 2HT2D 4MJ5B 4NWUH 4YH6A 3H3KA 4PLKD 3K0YA 2EXYD 5KYUA 2VSKB 3IDXL 2M2DA 4M1DH 3T1WA 4Z7AA 4LSRL 4FTVE 1KBVA 3O3DA 1NJ9A 3BWSA 1XB3A 2I25N 1AKJD 3SPVA 4HA1A 3IRPX 3BKML 5TK2A 3KL0A 4JDEB 4PD4J 1JDAA 2V5RA 1TVHB 3QRGL 3ZL2A 2WCPA 1UURA 5I15L 2GW5A 1WO2A 4TTDD 4YIQA 1VADA 1Z2KA 3HZYB 3QHZH 1PFCA 4P3WA 1BQ5A 3NK3A 3LV3A 3QNZB 4DKAA 4X98B 3SDXA 1A4JB 4OB5H 2UWEA 3KYKL 2J55A 3QZLA 5MERB 1MJUH 3WMQA 1FFOA 5K59E 4JFED 4QPEA 5CGYC 3P4OB 1CF8H 1DUZA 4IRSB 4PW3A 1KBBA 4RMSA 1HL9A 1IL1A 1NDGB 1EAJA 3AU1B 3LN5A 3ROLA 5DMYA 1WEJL 3AS1A 3UYPA 1Z6JT 5CNHA 4XNQB 2X2HA 4LPYA 1XSIA 3DXAB 4UTAH 1RZJH 3NIGF 5IB5A 4LCIL 5K9QI 5E9AA 4DK5A 3GLDA 3MACH 5F7WC 4Z3FA 1JCKA 4PJEB 5E8DH 4L3CA 4KNQA 1EJOH 5IMOB 1FNLA 4WW2F 1IBZA 2OV0A 3BWAB 1ZT1B 4YHPB 1URLA 1BD2E 1ILUA 5CZXC 4U6HA 4YR6A 4JFPB 3MRHB 4ODUB 5JPNB 1YEWA 4ENZA 1JRHI 1NFDF 2ZKHL 2CXKA 3CFKA 1HNGA 3HVNA 3D08A 3KL3A 5EIVA 3MNDA 2VLRA 1J10A 1SDDB 3L1GA 4KDTC 3MLRL 4DESA 4D0DB 1CFQB 4G7VL 3NAAL 4LAJH 1IC5H 4QHLB 3DDGA 5F96H 3VFPA 4R7DA 4DVRL 2BVQB 2FHFA 1HYRC 5JNYB 2CWRA 2X4QB 4Z7UA 1MVUA 2JKNA 1ZDSA 2NX5A 1FYTE 1MHCA 1F8TL 2KPWA 4JQXC 1LDPH 3IDXH 2VLME 4FTVD 3STLA 4A37A 1L5GA 2C1PA 3L9BA 3PY9A 5DJDA 3P2DA 3MHZA 4XCYB 1FSKC 4CGUB 1GS7A 3UO8B 2NR6D 4Y88A 4FLHA 1FDLL 3VXQB 5CEXB 5JR1L 2SEBA 3BKMH 3FB6B 3MJ6A 4IU2A 1S9XB 1MJ7L 1XT5A 3QRGH 1R0AL 3KPMB 4LKXA 5BV7L 3DYMA 2JLLA 3FF7A 5FWRA 1QABA 5I15H 3IMVA 1QA9A 3GD1C 4LCUA 3VWJC 3S5ZA 6PCYA 3KXFD 5F9DC 2L7UA 5JHDA 1FFNA 3QFGA 4L9LB 1IZKA 4ABUA 4PG2C 3KYKH 2NLJA 4JM2A 2AQTA 5TE4L 1BEYL 4AQ1B 5FW8A 2BS9A 2Z0UA 4D2NA 4K9JA 1WV7T 1Z9OA 4IIQC 1ZD6A 4UU9B 1JHLL 4YO0B 3VM5A 1BAFL 3AXLB 1M6OA 4OZFG 1QRNA 1AFVL 1ORSA 4JX0A 2C9AA 5I71C 1SBBA 2CHXA 3WTYA 5KTEL 3CFTA 4JPIA 5IROA 3OPZL 3L3KB 2W0FA 3R06A 4YSQA 4NKOA 5IK3B 3BPNB 4LCIH 3QDHA 2G3NA 3NSDA 5GISL 1O7DC 2EIEA 3UTTE 3RYMA 1SZNA 4W9JC 2VO5A 2ZP9A 2Z31C 1FLRL 3BP7B 3THMH 1BYNA 3D2UD 4JO5A 4U31A 4JFOA 1YZZA 1BD2D 3T8XB 1W8NA 1KSRA 4PLJD 4BSWA 2XWZA 3ZQ9A 5EF3A 5JPMB 2IH1B 4PRPE 5CSGA 3GJFH 3F12A 5JUEL 2RH0A 3PQYB 1ONQB 2VRKA 4HIPA 4ABVA 3WEXB 3AG1B 4OF6A 1OAKL 4BZ2L 3NSCA 2A3TA 5D7HA 1ES0A 1KJVA 1U36A 3GBEA 5LNGA 2ZKHH 3OAZK 5BZWA 3T3MB 4L3EB 3ARGA 3MLRH 4ZJ9A 1YUHA 4G7VH 1FZOA 2VMFA 3NAAH 3P77A 2KL6A 3A3YB 4L1LA 1JBJA 1E30A 3IGUA 3N42F 4CGTA 5A40E 4G80A 1IGYB 4I3GA 4L1DA 3IFNL 3K4AA 5E6ZA 2DQHH 2Y36L 1J0KA 5AAMA 3B9KA 5D2LF 3CFBB 4J8RB 2BWIA 2X10A 1TQCB 4ABQA 2QVMA 1A9BA 1NGPL 1FO0L 3SZKC 1FDLH 5MHSD 5JR1H 2G5BB 3CSBA 4ODHL 4OI9A 3S4SB 4IOFC 4UT6L 3NSJA 5BV7H 1E8WA 4O2FB 3ZHNA 4M7JL 3S2CA 5E6YA 4FA8A 4RSYA 5AAWA 2DIEA 3WIFA 1MRCL 2OSLB 5IT2L 2GAZB 3OMAB 3H7BA 3KWTA 5AKRA 3K72B 3KPPB 4LLVA 2J1XA 2LLNA 2YQGA 2WINA 3G5ZB 4ZUWB 1DBJL 1NFIA 1BEYH 4MS6A 5IVOA 2ATKB 1HDMA 2VDPH 5TE4H 5FLUA 3RFRA 4BXSV 3CC1A 3ZMRA 3IDMB 1JHLH 3VRIA 3ARTA 1BAFH 1WBYB 3RGVA 1PAMA 5JOEA 4Y4KB 1PZCA 4DN4L 2YD8A 4EVNA 1AFVH 4OH2A 3CVDA 5A6LA 1DLHB 1W8OA 5KTEH 3TVMB 3OPZH 5F7UA 3UTTD 3QUKB 3FN9A 1T7XA 2V0AA 1VESA 3WIIL 3NIGB 1AO7A 1FLRH 1G9NH 4KROB 1UA6H 4L37A 3ZXAC 3X13B 2HCZX 5BQDA 1XTLA 2VN3A 3U2IA 2JIXB 3VACA 5A3ID 4NUGL 2ADGA 2CM6A 4WW2B 4IDJL 3KE0A 3WI9A 1ZDQA 3STZB 4BZ2H 2PP7A 1IC0A 1EJ6A 3ORJA 2VXTH 2XV3A 3S9DB 2ESVE 1KBWA 2HT2C 1T0OA 1J1XL 4KK9D 2QR0B 1U92B 1PCSA 5JW3L 8FABB 1NFDB 5CGMA 1G94A 1QD0A 5D7LA 2YWZA 4PLKC 5E9DB 5JHMA 3CVHB 3PAVA 4FERA 1IX2A 4KY1L 5FO8B 1OW0A 3IFNH 4AMWA 2IH9A 2Y36H 3TNNA 1YO4A 2QTVA 3EOAB 3FQWB 1C16A 1QBML 5ICUA 3ABGA 3S88H 3ZE1F 1EAPA 3U46B 2VDQB 1R3HA 1U3NA 1NGPH 2AJXL 2LU3A 3MUHL 4RCAA 5HDBE 3BGFB 3BFWA 2XHNA 3HG1D 3IFOB 4ODHH 4TTDC 3IKCA 4UT6H 5GRUL 3EO1A 1TU2B 4P2RB 1KXQA 4KNTA 5DVPA 4LCCA 5DRZA 2O61A 1KYAA 4BKSC 1NDMA 4P3DB 4YSSA 3QDGA 1AIFB 1IJNA 1HK6A 2BHZA 4IRSD 3BCDA 3U4EA 2YEZA 1BVKA 5EU4B 3EUUA 2LLGA 4XNBA 1DBJH 3D2TA 1OGPA 5IM7A 4EI5A 2WZPD 2F53B 4L8SB 3GHEL 2HLEB 1F6AA 1FVEA 2GI0A 2V5YA 2X87A 4TVSa 1X5IA 4LNVA 4ZMLA 4Z7NE 1HZLA 1QACA 1XGTA 2WBJD 1FE8L 3VXSA 3MOBL 1I7RB 5C0RH 1YNKL 3EYFA 5DVKA 3WIIH 3QK0A 3AG4B 4X0KB 5IB1B 3KLQA 2ZCLL 3KPNB 3V5KA 4JPWL 1AJ7L 4FG6D 3A47A 4JG9A 4PGEB 5LG1A 5I9QB 3NCMA 1ZLUH 1CT8B 1JOIA 4EKJA 1FAIH 4JFFB 4NUGH 4QRQA 5CIPA 2IQAA 4IDJH 3IWVA 1FFPA 1ZCRA 4OZIA 5TDPA 4GW5B 3CSTA 4F8PA 2X4PB 2Z7YA 5J7CC 2OCJA 4WJ5A 5KVFL 1NC4B 1IBYA 5CBEB 5FECA 4JQIA 2ESVD 1N6QL 4MBOA 1SY6H 3ZDXE 4HJGB 4BYHA 4EOWL 1KLUA 4BFNA 2A9BA 1AD0A 1GY1A 4KZCA 3CDGA 4BWWA 4DFHA 1BZEA 1J1XH 4LT7A 1R75A 1BXAA 1XF1A 3K74B 5CBAA 3NJNA 1FVDB 1EUTA 2R56H 3FT2A 4KY1H 3UO1L 3HPLB 3O4LA 3QVAA 5C0CB 4ZG1A 1XH2A 3N42B 1F1GA 2NR6C 4X6FB 2Y5QA 1QBMH 5IB2A 1NGYB 2IPTL 2C9XA 5AL8A 4RRPG 5FXCH 2AJXH 3NCYP 4PGCB 5CINL 5D2LB 1YMMB 2D3NA 1CFVH 2XFXA 2VUOA 4OLEA 3KPRE 5FPIA 2W0LA 4AL8H 5IUSA 1ANUA 4JG1L 5GRUH 2E74C 5EBMA 2P5EE 1OAZL 2OMVA 3TF4A 2ZSVB 4XWOD 3OXRA 1FWXA 4N1CA 1CGVA 2J25A 3PP4L 1BQLL 1XSJA 1CK0L 1QFUH 4LCVA 1IAKB 2NSMA 3CXDL 4KKQA 4RQQB 3UBXB 1PD6A 4DTGL 5C0BB 5A2LH 4NUJB 2YPLA 3FT1A 4DW2L 4BKLB 2R2HB 3VFUA 1OK8A 3GHEH 1OD9A 3CVCA 1JDDA 4G6FB 2H6UA 1KIPB 1CQYA 3KL5A 5C0ND 1EEZB 3QJXA 5FM5O 5FO7A 4AIZA 1FE8H 4NN7C 1JI2A 4MAYD 4PVLA 4PCSA 1S5HA 3MOBH 3MLVL 1ZVSA 3CUPB 4K94L 2Q7YA 3V9EA 1WBXA 4GLRI 1CD1A 4R97C 4XMXA 5E03A 5FFOA 5JORA 1CLVA 2ZCLH 3PQYD 4DOHB 4PLJC 5FW7A 3M45A 1AJ7H 3K3QA 4F80A 1URZA 3LKQB 2VQUA 1B4LA 1LO2H 4YC2B 2YMXL 5INCA 4L3ED 4OD1H 5E5RB 1QW8A 3U79A 3WHE1 1XDTT 3VXUA 2DQIH 4P3CH 4YBQD 5KVFH 2PWFA 4WEUD 2R7EB 3GBLA 3QORB 1N6QH 1IARB 4XNMA 2QPSA 4EOWH 1Q9KB 1TIUA 4HH9B 2F61A 2ICEA 3ALPA 5DLML 5DO8A 5KVMC 1RK1B 5DVMA 3PHAA 1TQTA 3CBRA 4XCCL 4R9HA 3UO1H 3WNLA 4HISA 1G7MB 2BNUA 3B3IB 2EIZB 3EJYC 2B08A 4AEIL 2J1YA 3MRCB 2Z1PA 3SE4C 5F3HB 4PJ5B 2CCLA 4HFWA 1D5ZB 2IPTH 3K80A 3KS0H 4FJZA 4Q6IA 5CZKA 2BNQB 3N85H 5CINH 2R29L 4NKMB 3ZE1B 3H8NA 4ZS6C 4EUPA 3T0DA 2P5ED 4G3YH 1RZPA 2AGJL 1U3HB 2VDQL 4PRBA 1Z9SB 4J28A 4F3FB 1OLLA 3KH4A 1OAZH 3QIWB 3PGCB 1OB0A 3AABA 3AAZA 4QRPB 3OLGA 4FYQA 1F11B 3GSXA 4X9HA 4P23B 1UC6A 4DTGH 1E5BA 5C0AB 4Y4KD 4P2QB 2XCMC 4GQPH 2P1YA 1E42A 4XMPL 2WIIB 3TO4C 1RP8A 4U4IA 4HS3A 3RL1A 3SE9L 4QNPE 1BV8A 4LQFL 5DT1L 5F7DA 1BQKA 3O0LA 2XWJB 5KOMC 1TCRB 1VCBC 2VDKH 1M71A 2A4CA 1QLFB 5FK9A 1JZHA 1MCPL 1GZQB 3CIAA 4TS6A 4KROD 4RDQF 5GJSL 1NC2D 1HEHC 3VG0L 2QQQA 2JXMB 5HI5D 4HXBL 3E9UA 3MLVH 4FFWD 1OP3K 2JIXD 1AXSA 4WIQA 1QO3B 1CS6A 5SX4H 5GGVH 2PTUA 1EZLA 4NO5A 4PJAE 5A3IC 2X4TA 2GEEA 3FSOA 4JGUA 5CUSH 2WGNB 1SLUA 4G1MB 5TE6L 2BIOA 3GDCA 2IFFL 4HLZG 5DVLA 2CBMA 3TJEL 5CKAA 1FNEA 2QV2A 3G6AB 3VTMA 3GTNA 3VFMA 2YWYA 5J1AB 4V1DD 3BC9A 1GCFA 4M4RA 5FOJA 5EOTB 4P48A 4KK9C 2BIQA 1MXDA 1MHPL 2WSKA 3MGOA 4S0SD 3W1ZA 3BZ5A 3NJJA 4M6NL 4E2OA 4XXDB 3A6BL 2EIMB 1G0DA 5DLMH 3MCKB 1IFHL 2Y23A 4PJFE 3EFOA 4XCCH 3ARZA 2W60B 1S7VA 2C3GA 2V2WB 1IIKA 4HS8H 5DJCA 2AP2A 3DNKA 3ZZSA 4AEIH 4S0HA 2AHIA 2H9GA 1RD6A 1T5WB 1T7VA 1O6TA 2DWTA 4PJBF 4P2RD 1F56A 3C60D 4ZUTB 2OMZA 3CVHH 4I1PA 2HPOA 2EE6A 4P46A 4ZX3A 5EU6E 5JYMA 3BUBA 1HIMH 1U58A 1XF3B 1U8MB 3T0EE 1RH8A 2YD4A 4OF8A 2R29H 1YMHA 3BIAX 5KBLA 3UGEA 3IN0A 1J8HE 1GPOL 5C09A 2VDQH 3B2XA 2EH8L 4IRSC 4Y1AA 2F53D 2H2PD 3TPUA 1FUNA 4QAWA 1I1AC 4NOBA 5CAYB 3S37X 4DHLA 2BP8A 1IKFL 3MBEA 1ZV5A 4XMPH 5I28A 3E6FA 3QCTL 1P5UA 4H20L 4ACTA 3TBSB 3SE9H 4S1DD 3TT1L 2CLVA 4LQFH 5DT1H 3SE3A 1S7WB 2R4RL 2WBJC 4MTMA 4U3HA 4PS4L 2YD0A 1AGBA 1MCPH 4GS7C 4P9HH 4BK4A 4XC3L 4MD4B 4U1IB 5GJSH 4FQHB 4QRRE 3ZTNL 4AW7A 5B39A 4O2EB 5D2NE 1MDAA 4MA3A 1EZSA 1HESA 4HJEA 4HD9A 4JFFD 4FG6C 5JPNC 4LLQB 3BQVA 4JHAL 4CBPA 5I8EA 3V9CA 3VFSA 5TE6H 2CDFB 2IFFH 3WNJA 4DVBB 3TJEH 1FBIH 4ANVA 1HXYB 3I75A 4NERA 2YXMA 3GXTA 1P1ZB 2AQRA 3HBZA 3N04A 4ALAL 4N0FA 5KVEL 1WICA 4B9FA 4FQXB 1IAIL 1MHPH 3HMWH 1THAA 1MLCB 3QI9D 4BH7B 3LYRA 3IJEA 1AOHA 4PLNC 1K5NB 4KOCA 5F71A 3QULB 4CAGA 3ERXA 1XR9B 4DCQA 4E0RA 1YMMD 1PAZA 3AWFA 1KCLA 2WK2A 5I19L