2IDCA

Structure of the histone h3-asf1 chaperone interaction
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
174
structure length
167
Chain Sequence
ASIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNAAKEIKLARRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast histone H3-ASF1 interaction: implications for chaperone mechanism, species-specific interactions, and epigenetics.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication/chaperone
molecule keywords ANTI-SILENCING PROTEIN 1 AND HISTONE H3 CHIMERA
total genus 28
structure length 167
sequence length 174
ec nomenclature
pdb deposition date 2006-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 2idcA00
2DZEA 4ZBJA 5BO0D 5EIIG 5C3IA 2YGVA 2HUEA 2IIJA 2IO5A 3AADB 2I32A 1WG3A 4EO5A 2Z3FA 1TEYA 5BNXD 2CU9A 2Z34A 1ROCA 4RRPM 2IDCA
chains in the Genus database with same CATH superfamily
2VZVA 3IU4H 4K5MA 2FNBA 3L4UA 1N2RA 3MLWH 4DO4A 1HZLA 5TPWH 2HVKB 3OAYK 3UPRB 1N64L 3JWDH 5T1LD 2AEQH 4PV1C 3NPSB 3QDGB 2HFGL 4MCYA 1L6ZA 4MVBC 4NQCA 4AYFB 4BH8B 5E1AB 2CDGB 3GK8H 1PX3A 5T3XH 3UROR 4GAJH 4HBCH 4WFEE 3ARXA 5AOLA 5E1GA 4O2CA 1PZUB 1RH8A 3SE8L 1G9MC 3FB6A 3GSNB 1Q0EA 2XTJB 2YAPA 3VRLF 2AERT 5HDQL 2FEEI 3B7YA 3EFOA 3ZYOA 4AG4L 4ZPVB 4P2QD 4KZDH 4MMZA 2Y4SA 5E2TL 5D2NA 4Q9CA 3LPWA 5I1LA 2ZKHL 4NAMA 1K3IA 2NRDA 1AS8A 1RD6A 5T5FL 3AG4B 5C2UB 1QFWH 1I8MA 4WNSA 4DOHE 2I27N 1AE6H 2AEWA 1DVYA 4P48A 3WO3B 1WD8A 3VVVA 3N3EA 4MGXA 4HV8B 3DURA 5TGBA 3VWJC 3ZE0B 2AJVL 1WZMA 2X6CA 1FG2A 4IBLT 4ODTL 1WAAF 4P4RB 2ITDB 2FSEA 4XCCH 1R3LB 2BSBA 4N3UA 1JIBA 3EYSL 1FWXA 4M7JL 3ZOAA 1N26A 4PJFA 1QBML 3F5WA 4AZ8A 4OFKA 1Q0YL 4HIEA 2Z8SA 3ARUA 3NSYA 2VR6A 1FO0B 3PWNA 4PLOB 1D6VH 3KYMA 4MA1B 3LMJH 3RIFK 4FQPA 5JQ6H 2D31A 4YDVA 2P5ED 4JO5A 3QUZA 4QRPB 3RWHA 1WBZA 2YC1A 2AMGA 5BOZG 2PCPA 3BP7A 3GF8A 2FYYA 3NIFF 3VTAA 4Z3JA 1CXLA 1PZDA 4U0RC 5GGTA 4EOWH 1MRFL 3DOSB 3P9MB 4JFYA 1Q72H 2CH8A 1GS6X 2AVGA 4HJ0D 2H1PL 4J4PD 5BUAA 1N67A 4U6YB 4F80A 4KJWC 5I1CH 3QZMA 2C9SA 5IK3B 5D7SL 4KK5C 4P2OC 5KSBA 2Q7AA 3NJVA 2DQUL 3SJVA 3OKKB 1ED3A 2P24B 2YD8A 2Z31C 1ZE3H 4WV1B 4NLHA 5IKCA 4LSSL 2DD8L 3K4ZA 2EIZB 2OTWA 4D8PB 3UFIA 3QIUB 3VA6A 4UILL 4XZ4A 1WBZB 2YC1B 3F7YB 1VPOH 4M8QB 2P48B 4PU2A 1Z6JT 3QCUL 3DMMA 3VH8G 4XN4A 3KPSD 5HGBB 4AM0B 3CFBA 3GSUA 4HOZA 1I1YA 5H4YA 2YGPA 3MLXL 1QPXA 5AYUH 4AJVA 2J6EL 4I77H 3BJ91 4ISVB 2WUBL 1OAQH 5B39G 1ACXA 2QL1A 1MELA 1P5UB 1T83A 3BESR 1F3JB 1F97A 4ZO7A 3EJUA 1BQHB 4KROB 2BOLA 4J6RL 4KO5A 2CLZB 2J8UA 2PYEB 3QPXH 2VDNH 2ZYRA 3EYFB 1FSKC 4KROD 5D7LD 3C87A 2PP9A 2XV3A 3GSRA 1NC2B 2GPZA 5C09B 4M1GL 3EYFA 4Q9BA 3MZTA 3ISRA 3R0MA 1KTRL 1CXHA 4N22A 2MOGA 1XEDA 2CHXA 1FVCB 1WIPA 1M4KA 4HJJL 1IM9A 4P57A 4N2HA 3VFNA 4X83A 2M2DA 1EZLA 3IYLW 3T65B 2VMFA 5IHWA 1IBGH 3NJHA 3EFFB 4ONHA 3WIFB 4YEEA 4BSVB 5IHBA 4IBVA 3I3DA 4IMKC 3K6FA 2A74A 4LSTL 4M4RB 4NN6C 1T1YA 3ARGD 3IU3A 2QTEA 3T65A 2XV2A 3CBKB 4N3TA 4S0SD 1CQYA 2A0LC 3MBEA 5DRZB 3WS3B 5KS9F 5GJTL 5J12B 1QNZH 2W60B 1P4UA 2YAHA 1F18A 2KZKA 3UGUA 2Y36H 5C0BE 4PD4K 1ETB1 5ANME 1U8NA 4WWKD 4ZAKB 1ESOA 2J6EA 4IU2B 1ICTA 1VFAB 1JZ7A 1NBYB 5DURB 1HKFA 5GGUB 2R0WH 1NC2A 4ZQKA 5IROD 1X7TA 2JCCA 3MYJA 5EBMA 1RAMA 1YPZA 5IVXE 1S9YB 3LRGA 4FE9A 3IFNL 2OMNA 1MCQA 3BHBB 1BVKA 5ISZD 1MRCL 2BMKB 2RD0A 4HGWB 5CJXA 1LDSA 3KG5A 1ET7A 2CALA 1T20A 1INDH 2BS9A 3WEXB 4PR5B 4JN1L 4YGAB 3VQ2C 3AC0A 4DPRA 3DX9A 1M3JA 2R9HC 3C9NA 3JZYA 4N28A 4JFDA 2X89D 5KS9B 5KYYB 5LDSA 5FM8A 2E6QA 3GQFA 4PRIE 4FF9A 1KB5H 3WIIL 3GJFA 4R26L 1B0IA 1XF5A 4UWQB 1U8NB 4ZAKA 4LGSB 4WI3A 1XCTA 1ACYL 5JXAH 4M7KH 3NIGB 5DT1H 4KO6A 3FU9A 5IHUH 4GG6F 1WS8A 1S9XA 5E99L 2X4RA 3FMGH 4NB7A 1DN0B 1WA2X 3BVTA 4JPWH 4U1KA 2BJMH 5D96C 3WHE1 1L9RA 1AMYA 3WXVH 5BZXA 2Z0BA 1UA3A 1VZGA 4MXVE 4FTVD 5DVPA 5DEGB 4Y4FB 3T0EE 5G2NA 3N43B 4K94C 3TZVB 2GJZB 2DN7A 1HAWA 2B15A 2GTZB 1H5BB 2G5UA 2MRYA 5K9KA 2BDNH 1T5XB 4P4KC 4A37A 1X5GA 4PQXA 4CU6A 2XN0A 3FL7A 3JUYA 2GW5A 1K4CA 1YC7A 4HZLA 2VDPL 3QPQD 4GRMA 2J8UB 3SZKC 1DQLL 3WHXB 3UTZA 1M7IB 2VE6A 4P06A 2OR9L 4PJHE 4ICXA 1ZV2A 4QLRA 5IWLC 3L45A 4ZW7A 5C0GB 5EMYA 4DNLA 1H3PL 3PFUA 1MJ8H 2VLRA 4M93B 5H2BB 3ARDA 5E8NA 1FVDB 1C16B 1NIAA 3W9EB 1HKLL 3N43F 3SKMA 1G7LA 4LDLB 5E6UB 5DFWH 4ZUWA 5JUEH 4NKIH 1SDAB 4N87A 4X6BA 3D9AL 2FSEB 2HP4A 1MOEA 4GAGH 3HZVB 3D4ZA 3AQDA 4RFOH 2IMMA 4HH9A 4IRJB 5J4MA 4P23C 1RZ7L 2X40A 3SDYL 3Q2LA 4HCIA 1PX8A 1CLYH 4JFEE 2YUWA 4EN3D 2X2UA 4NX0A 4PI2A 1CDBA 5GJTH 5M95B 5LO7A 1RIUH 1M1XB 5FB8A 3C8HA 1RV6X 4JZOB 3ABKB 3DYOA 5I0XA 3A5VA 3BEVA 4L9LA 3S37H 1IC5L 3P0YL 2PW1B 3D4CA 2D4DA 4LLDB 4TSAL 5EIIG 1BGXH 1LO5B 3AQXA 5I19L 4JO4L 2DOCA 5MI0B 3OB0H 2C1OA 2HFEB 3HB3B 3TBVA 3GS7A 5TE4L 2XXGA 4NT6B 1Q9KA 3FUFA 4W9DC 1MNNA 3EOAB 5AWNL 2R8SL 4YDIH 2I25N 1X5XA 3S35H 1OCWL 3DOSA 1NIFA 3QDME 3CDZA 4TNWK 4NUMA 3LKOB 4BHUA 4XX1E 1H9VA 2P5WD 3CLFH 2CHNA 4MCMA 5K69A 1T7XA 1GYWA 3BUYA 4F57L 1USZA 3HNVL 1IBBA 1QA9A 3CFEB 4XVTL 4ONOA 3ATFA 4IM8A 5CZVH 1FZOB 5AYUL 3V0AC 1E7VA 3VRIA 4AM0Q 4XPBL 1KEML 5KANI 4RMQA 5DJ8A 3TBYA 3CDYA 5L88L 3SD5A 3QXAB 3APNA 4KHTL 4JFXA 1UQSA 3II3A 4WFED 3TXAA 2VR4A 3ZQWA 1KBKA 3HS8A 3Q2WA 2WXFA 3MUUA 3GB7B 4PGCB 4YHOH 3H7BB 5DMGC 3D25A 3RRQA 4G6ML 3WFDH 5IOPA 4LSUL 4NNXB 1JXJA 3MUZ1 2HJLA 2Z93A 3TCLA 5LXGL 1KLFA 3LN5B 3VI3B 2GKIA 2EC9T 1V05A 1A21A 4MJIB 5I1EH 1QFOA 4KXCA 3V4PB 2YD2A 2GTQA 2AV1A 3MUHL 2X7LA 5I1DA 2ZG3A 1JYWA 1NH6A 3FUJA 4G8EA 1BAFL 4ODHH 3TBWB 1SXAA 1VENA 5I1DB 1RSYA 4ZFOL 1RHHB 4KI5F 1OF0A 2WXLA 2BFVL 1PCSA 4QJ3B 4GO9A 3RFZC 3EYVA 4OFDA 1PLCA 1MXGA 3KLKA 4CILA 4NDMB 3VQLA 3A6CH 5I28A 5ECGA 3FCBA 2MFNA 4GRLC 4DN4L 2EVFA 5C07B 4BFJA 2VDLH 3ABGA 4ZOCA 1NBVH 1IGIH 2VR7A 4LXFA 2Q7YA 5JPMC 2XG5B 5CINL 3V4VB 4UINL 1XWVA 4XXWC 3O6LH 3T5WA 3QG6B 5C2BL 1R34A 3PYCA 2VKXA 4KXBA 4GKNB 4APQA 1BZOA 2IH8A 3WOVA 5AKRA 4D3CL 4F2EA 4XBEH 5DR5L 1U91B 2OR8A 4MA7H 4ESKA 4B9GA 5C0JB 1JRHI 3U7WL 2F8IA 2JELH 1UXWB 1FI8C 3SQRA 4PJEB 4PJBE 5DMIH 4OCSL 2CRMA 2CUMA 4GRLA 3O4LE 3QIBC 1P9MA 4C8XA 2XVBA 2VZSA 5C97A 3D2UA 1QI4A 4PJEA 2AV7B 3L3HB 3UIZA 4HETA 2NPLX 1MFNA 3FRPG 1KCKA 4RGOH 3CPUA 3SGDI 1DQKA 5I73C 3FB5B 2MQCA 2HFFA 1JN6A 3UC2A 4OCYH 1FE8L 4UM9B 4WGWB 4JRLA 4AIZA 3PREA 4B27A 3BVVA 2ENQA 3VXTB 5ID0B 4XCNA 4XPHL 4PS8A 2EVHA 1RVFL 1OAKH 4KC3B 1WT5A 3CZGA 2EIKB 5F7LB 2A9NL 1X5HA 2ZYSA 3D33A 1HHGB 5AVYB 4Z7UF 5IOPB 4YHZL 1G84A 3AXLB 5BZDA 5JIKA 1SVZA 2NNAA 3NAAL 1LP9A 5FYLL 4H7VA 4W93A 4YQXH 4J2XA 2OPCA 1NGQL 4E42A 3ZTJH 1JWMA 3BD5A 5DRXB 2NT0A 2CK0L 4UV7H 5B1JA 2BH0A 2UY7A 1IMHC 2YBGA 1UGNA 1KJ2B 4N2LA 2AKRA 1ZEAL 4NENB 1VFUA 4PWKA 1UA6H 4NN5C 4AQ8C 1B0RA 4G5AA 3WYRA 4H0HB 1CD1A 4H20L 1PCXA 2XWJA 5KVGH 2WAQA 1JZHA 2NCMA 3MRMA 4HS3B 5DUBB 1A9VA 5B8CC 5BVPH 5F7NC 5HYFA 3HVNA 3GTTA 3HE7C 2ICEC 4JZJB 3X3FL 4GP5B 1FL5B 3SEPA 4DVBB 1QD0A 3D2TA 4K15A 4DGYL 1QSFA 2IDSA 2VDPH 2GAZA 2WZPD 1GKEA 2V5TA 2Z31B 4OJDH 4YGVB 4WV1C 1RJLB 3WJJC 2NTFA 4P23D 2EDTA 3C6LB 3QFGA 2Q1EA 5SX5K 5A3IC 5AENA 4G59C 2WYZA 4AQ8A 2IXQA 4G6AD 4M62L 4UNUA 1R3IH 1M9SA 2AP2A 1QFHA 5JW3L 1BAGA 2WUCL 1QA9B 1TT6A 2FEDC 2GK2A 2GSMB 3BWZA 3CFEA 3BMVA 3MKKA 2GCYA 5B39A 3LKSA 4YWGH 3VFTA 3EDDA 4GW1A 1I1AC 1O7DE 3CX5K 2WVTA 4ENEC 1BD2E 1TJHH 3GXFA 4GNKB 4P3DA 4PV9B 4RETB 3BIKA 3BUIA 1MLBA 3MV9A 5DHVB 1F58L 5CD5D 4S1SL 5FAAA 3IFOB 2IANE 1Y18B 3FT1A 1KB9J 3BQUD 4Z95H 1FNEB 2YGNA 3N50A 3QHTC 3BVUA 3VAEA 5HI5C 1KMGA 3VSUA 2WBJD 4AUJA 2DF3A 2OYMA 3MBXH 4IBUA 4UTAA 3BPCA 1E9PA 1ZTXL 1X9LA 3KPNB 4G71B 1A9BB 1KTLA 4Y5XC 1A7RH 4GKSA 1X5KA 3UPAA 4XP1H 2FE0A 2CIKA 1M42A 1GYVA 5TFSL 3TNMB 3FQYA 4OKVB 4I8DA 5J13C 4UQIM 1WBYA 3NN8B 4XNUL 5SWZB 1EQWA 3RFZB 3QPKA 4H0IA 3CK0H 2C9PA 1I9IL 1XH3A 3BP4B 5DLML 1QSVA 1E2WA 4DEPB 2BP5M 5SWZD 3HG1B 2FQFA 1BX2B 1NAMA 1NOAA 1KT2B 4ZFQA 5I74B 3WNOA 2AS5M 1NGZB 3PABA 4HKBA 3QR2A 4NQCD 4K3GA 4W6YB 2X6UA 5FO8A 3KYOB 2MNJB 4I88A 3CHOA 4LK4A 5ILTH 2CUHA 1FVEB 3A21A 3QQ3B 1T3FB 4J3OH 1EEZB 4LBEA 1AKJB 4K5OA 3VI3E 4AQOA 4PWFA 1HH6A 4F24A 5BQDA 3ESMA 3VWKA 4YZFF 5E00A 1J8HD 3SKUD 2LTQC 4X7CC 4XXDA 4AYEC 4PB9L 1X7SA 5DEFA 1FL3A 2WK2A 1FFNA 1Z1WA 4LDOB 1RCYA 5FYLD 4HAFA 4L8CB 3S3DB 5JLZA 1FNSH 2IALB 3LS5H 5IK3A 5CSGA 5ETUB 3K1DA 2PYFB 1S7QA 3PJLA 1RULL 3HAEA 5C0CE 1YO4A 4HUUB 1NM4A 3V4PH 2DWXA 1MI5E 2HJFB 1J5HA 3FOMA 3ESNA 4ZQKB 3GBNL 5IW6B 4R7XA 4GSRA 2CJTA 2NT1A 3BISA 4OF5A 2OYPA 2WO4A 3O3EB 1NCCH 2NUTA 2EO9A 1BVNT 1SOSA 1CT8A 2E9IA 3BAEH 4UDTB 2W0FB 2Z3FA 1I3VA 3TBSB 1KPRA 4LKCB 1AP2A 3QUXC 3TJHC 1M6UA 3P9LB 4WY7L 4KKBD 2D31B 3AQZA 4YDVB 3MR9A 3IU3B 4TOYH 2XWTA 3PQYD 5EWIH 2HVJA 3RY6C 3MA7A 2H3XC 4GAFB 4K23L 3DX9B 3QJRB 5GIRB 1MCFA 2VLKD 1INEL 3F7QA 1CLCA 3QZWA 4MNGE 4BCYA 2ZWKA 2VDOH 3IFLL 3ZYIA 2IALA 1XGYL 1KEGH 8FABA 1C5BH 2DWSA 5LGJA 5T1DH 5EBWA 4PJFB 4UTBL 2C4FU 2IAMB 4L1DA 3WFHA 3M17B 1DVUA 2WLYA 4WQOA 3GMQB 5FW6A 5I8EA 3L9RB 2VM4A 5D1QC 3O0RL 1BEYH 5CU9A 1MHHB 3GO1H 3X1EA 3UAFA 2F54B 4ACPA 5E1HB 2DS4A 2IBZX 3KPRA 4G6FB 2QJDA 4NNPL 2QEJA 1S7WB 4X5RA 2GSGB 4HJJH 3UMTA 2A6IA 3VX1A 4OI7A 5DVKA 3H4FA 3RUGE 2WQWA 2P47B 2N0KA 1DJZA 1I7RA 1U3YA 2NY1C 2A74B 4KUCF 3CGTA 1HVXA 1NMAL 1ZJAA 3ABLB 3ML9A 5AG9A 3UZQB 1P7BA 3OJDA 1WBYB 1NMCB 3NN8A 1MIMH 5AUMB 1QFPA 4CMHB 5I6XB 5D2LF 3N0AA 2FO4B 4J5VA 4QNPE 1XX9C 3CVHH 3HBZA 1J8HA 3PP4H 4XOEA 2A6DA 1E6JH 2EEBA 4KUZH 1AG6A 5AW2B 3VRJA 4ES8A 3BPCB 3OKDB 1V3KA 3BC9A 3EHBC 5HI4D 2GBVA 4WY7H 4DO5A 2AQRA 3VFUB 1CXEA 4HCRH 4AJWA 1SYVB 4XCEB 4HJSA 3IGAA 1FCGA 4ODVL 2JB5L 5EEYA 2BOBA 2V9RA 5CGTA 1JZDC 3FUNA 3VXUD 4N2NA 4OR1A 2XZZA 5E0QA 3P4NB 4O5LL 2CKBB 4PJGF 4W4OC 1WFTA 1T2XA 2ZP0T 5DD1H 4QAMB 3I85A 1MEXH 4LEXL 4DKFL 1DSFL 4K71C 5KYUA 3C75A 1HYSD 3HI1B 4GQ9H 3WMSA 2BM3A 4OZ4A 2GEEA 4JRFA 2X9YA 1W72L 1PG7H 4HX1A 2O5ZH 2XN1A 3SE9H 1LE9A 2VLRD 3JT0A 2HJKB 3ETBJ 5AW4B 5DZAA 5C0DA 2GUYA 4D8PA 1SJEB 4UOZA 5K1VA 3EZ8A 2CDEA 2ZT9C 2JIXA 5B1CA 4JQXC 1VEMA 3GRWA 3C6LA 3BT2H 3NZ8B 4PEEA 2NTSP 3DWTA 3S96A 1IGCH 4LVHC 1PG7W 5CEYB 4C4KT 4NZUL 5DXWA 2EIMB 4JRYE 5F0PB 4OM0L 5IREA 1A6AB 4ODSH 1ANUA 5KYWB 3S35X 2DI9A 2CWRA 1KB5B 1S7RA 4MVBD 1XZ0A 4UOJA 5I1GH 1NCHA 4UU9B 1FC2D 5C08E 1LEIB 1S9VA 2APBA 4M6ML 2FJGA 1CG9B 5HYSB 3C5SB 2KZ1B 4R96B 3O4LD 3R18A 2WMPB 4PJGE 3WGUB 4FP8H 1F58H 9CGTA 3A6BH 1URZA 3DV4B 1MWAL 3C6LC 2ZX5A 4G8IB 4PGCA 2ZUTA 4OF7A 3ZUNC 5K1JA 4TRPH 3GHEL 3QWQB 3K6SB 3BPNB 1BF5A 1VADB 2OMUA 1HZKA 3R1GL 2Q3AA 2VDKB 3IS0X 4I9WD 1YYML 1A47A 3AMKA 2ALAA 2XSKA 4UDUA 3L3OC 4J7RA 3AREA 1MJ8L 4LPUA 4JR9H 1I3GL 2I60L 4WCYL 1H6UA 2VN7A 1QWUA 3FT4B 4OKDA 2KZBA 1ZHKB 3EYOB 2BY2A 3LKRB 3LKOA 4GXVH 4L1SA 5TQ0H 3KJ4B 2L8AA 4UOW1 3N42B 5LAXB 4DGWC 2DBLL 1UWYA 2ZSWA 4ZMTA 4XCNB 4PP1C 2P8PA 2H3KA 3NCFB 2DV6A 1EDHA 2IO5A 2P42B 3GDBA 1RU9L 1ZA3A 3LQAH 4BZ2H 3QORA 1HJCA 1X5ZA 3IDGB 2HFTA 4CW1A 3RVUD 4FFZL 3ZE2E 2AZAA 4JFFE 3IU4L 1H3XA 1LWHA 2I5YH 1LQSR 2RFXB 3ARGA 1E4JA 3KYKL 4AIXA 1LDPL 4KK9C 3GZKA 2HRPH 2ITCB 1KIRA 3C6EA 3EBHA 3FF7A 3D4YA 4XB8A 3HFFA 2TRHA 5AZEL 3RWEB 1WLHA 4JVPA 3O2DL 4RZCB 4Q6YA 2PTTB 3DKHA 2Q3ZA 4NI3A 1UWEH 3FT4A 3I2CL 1UZ8B 3K74B 1PQZB 1DBML 3FSOA 4HKJB 1TVHB 5C0CB 5DHEA 5FFOA 2AEOA 5I0VA 1A1OA 2VW6A 1CFQA 1IZJA 1S78C 2VLJA 3FF8A 3CVDA 3BFOA 4NWUH 1S6NA 1OGPA 2DLTA 2WCPA 3UTZB 4PY7B 1BOGA 3MQIA 3I50H 2W5PA 3M8OL 3QC5X 3K5RA 4RBPK 3SGJA 4MNQD 3WXWL 3GUTB 5I8KL 3MFFB 2PTVA 3UDWC 3EO9L 4PRAB 5ENWA 5FYKD 3C5SA 1LO2L 4F9LC 1K9TA 3S36H 5FA4B 4E41B 1I8KA 3CFIC 1JHLL 3N9GH 2GTZA 4FI6A 1P5UC 1UM5L 3CN1A 2FHCA 4WWKC 1YUHA 2A1WH 2HMID 3RZCC 2FBOJ 3FU6A 3DTXB 1T0MA 1IAIM 3BAYA 1U8CB 2J1ZA 4YAQB 1DE4A 5F96H 2WZAA 3CN3A 3LHPH 4PJ5D 4BQ8A 5SV3A 2LVEA 1SBSL 4XMTA 5I26A 4U1KB 1ZCRA 1MIML 5ISZB 4AIOA 2JIXB 4OV5A 4JFED 4BWTA 1BWWA 4TSCL 5C0FB 4NNXA 2CK0H 4JHZA 2YMOA 3RY4A 3QUYA 4RSVA 1EEYB 4GG8B 4P9HH 2IOOA 1FFPA 3AWEA 3PWUB 4G7VL 5CJBA 4TVPE 5GS1C 3IJSA 3ORJA 3HZ3A 1CLOH 3JWNH 4K71B 1NBVL 2H0FA 3J07A 1LEGB 4N8VB 1AI1L 4NUGL 5EH1A 2V4LA 4YO0A 1UH3A 4HLZH 3CIAA 1USQA 1F3DH 2BSTA 2Z92B 3D18B 1VRSA 2IG2L 3L4YA 1I1FB 5C8JB 4S1DC 3IRZA 1A8ZA 1XSOA 4XCCL 3N85H 3BUYB 4N9GB 3U1PA 3LKQB 2UZXA 4LP5A 5DR5H 1XH0A 3DO7B 5AAPA 1AHMA 3FSAA 2CDEB 5AB0A 1WAAA 1GGCH 4NFDA 4JO3H 4JREB 5I6PA 2F7QA 4AVKA 4I3RH 4C47A 1OB0A 3SBWC 2FNWA 2CJUL 3MLSH 4MA1C 1HCVA 2GTWB 3V55A 4BFIB 1L6PA 1GAFH 2WYHA 4OJAA 4Q74A 2Q8BH 4KX8A 4XP4H 2EC9U 5HHXH 4FERA 4XI5D 3QUMH 2BRRH 1JHTB 2X9WA 4BA8A 3FUKA 5CEXB 5A2FA 4ODWB 5JOFA 5EEVA 5DEJA 5FS5A 3GWJA 2EH8L 2C1PA 2KI6A 1UOLA 5LCVL 2OZNA 3V5DB 5ERWB 3LH9A 1NL0L 3L08A 3WENA 2PO6A 3LHPL 3U4EB 4HIHA 4DN3H 1TDQA 2AEQL 3VH8B 2GJ6E 3DX6B 1RZIA 3RGVB 5EHFA 5AVUB 2IANB 4POUB 2JTYA 4CGTA 3RHWF 5A6LA 4FFYA 2ZD0A 1DYZA 2ZSVB 3DJSA 4XNAA 5E7FA 1K2DB 2KKQA 1TJIL 3QJUB 4YFLF 4PLNC 1DN2A 1VGEL 5TF1H 5IHZA 1U41A 3C09B 2WWNA 2VJ8A 3MREB 1NEPA 1DBAH 4JPIB 2AFNA 3C60C 4WUUA 5D2LB 2R1YB 4YVUA 4WU7A 4JAMB 4UNIA 3BZEB 2LU4A 1DFBL 3EJYC 1U8JB 2AK1H 3E2HB 1IAII 2A4EA 3ELAT 3SIKA 1FL6B 4KAQH 1UB5B 2ATKB 2K78A 2KC0A 2QADC 4O9HL 2DIAA 3ZT7A 1IGYB 4LPVA 1XH3B 3BP4A 4BZ1L 4GG6B 2EEFA 3TBTB 1EAPB 2C5DC 1I1AB 1JYNA 1YQVH 3HG1E 2WSPA 1NFDA 4OFPA 3DX6A 4L2LA 1FHGA 3DHUA 1NOFA 1TQUA 2YPVL 3WDIA 4LFHG 3BX7C 2P8LB 4CSPA 4CNIA 4TF4A 4KMTL 4OJFL 2NY6B 3NJJA 4ZTOH 4C4KO 1CMOA 3L4CA 4LVHB 1NLBH 4OCWL 4ADGA 1F56A 3NPZB 4WF7A 1Z9MA 2NTFB 5FYJU 3UACA 4DTGH 1RQ5A 3DX2A 4KKLC 1R46A 4WW1A 3RNKB 3QNFA 1MWAB 4O51B 4EVNA 4Z3FA 1ZLEA 2ILLA 1XF4A 4ZMNA 4DH2A 1AOHA 4J2QA 4E9TA 2CO7A 1R3IL 5JW3H 1T7WA 1PZ2A 2NXYD 2MCPL 1JPTH 1HJBC 3FO0L 1RIUL 4GKLA 4GG6A 2N1KA 1P84K 2R0KL 2QV2A 3TN0A 5J13B 4RWYL 1ZDSA 1UWEL 5JHDE 1I8LA 2DQGH 4BM7A 3LKQA 2XX0A 3JWNG 4KTGA 3S36X 2DEYX 5J3HD 4TSCH 3IKKA 4PJ8D 1RURH 3KYMB 4XAWH 2JKRM 2GSIA 1SOQA 2YD3A 3BKYL 3IE9A 3QUMB 1EO7A 4NEHB 4PRPE 3WTYA 1OP9A 4JFFB 3CNKA 4X9FA 1BG9A 2DJUA 4Z18A 4U1IA 5EO0A 4FFZH 5T1KD 1L3NA 1TNMA 2UYLB 1QATA 3ARBD 2FGZA 3TASA 1SM3L 4H26B 4M7ZB 2ZPKH 4L8CA 2WY3B 3BYTA 3MX0B 1DLHB 2A83A 4OLZL 4XBGB 2VJ0A 4AMKL 1S5IL 4LF3A 2O30A 5CZVL 2BVQB 4Y2DA 1ZEAH 4PP1D 1IGYA 1NAML 1XTMA 2HT3C 4OTXL 5E00B 1FV1B 3FQXA 1LO2H 5DVMA 1V3LA 4Z7WB 1G7MA 5FYKH 3FCGA 5CLXA 5I1KH 5ERWA 4MKMA 3MRMB 4R90L 3DPBB 2ZUUA 2JKWA 4Z0XB 2F74A 2QSQA 1A7QH 3V10A 2YPLB 3PIQB 4EE2A 1TTGA 5IVXA 4QY8B 5GPRA 2NYYD 3K2UL 4TL4A 3TV8A 1NGZA 2J57A 5I73B 1OQOA 3QYNA 5IMMA 1M7DA 1JTOA 2XI9A 2BNRE 3PL6D 5DUPL 3JWOL 2G2PA 1A7NH 5GRXG 2FB4L 2DW5A 3EXJA 3D69B 5F8RC 4NGHH 4NP4L 3GXMA 4F2MA 1WBXA 4KKCC 3QXUA 3ARVA 3SDCC 3SKNB 3BIKB 1NCAH 3MV9B 4LFHD 4ELMF 4X7TA 3U36B 1RSFA 4MWFA 4Z7QB 1OARL 2BVYA 1EDYA 2W59A 1PX4A 2HTLC 2MPAL 5ALBH 2WQVA 1GGYA 3O2WL 2BCMA 2E86A 1N6VA 2EE6A 2YPKB 4NQQA 3K6OA 3KXFD 5CBEB 1BFOB 4PRBB 3D0VB 1JOIA 1PSKL 4UV4L 3RWIB 5KN5B 2CUAA 1SEQH 4U6TA 4Y16A 4M6NH 4NQEB 5FF6B 2QLVB 4ALAC 3US0A 5CIPB 3V5KA 4O02H 3QIWC 4BFEA 1UYWH 1RJLA 2DEXX 3FZUC 1KGIA 3AGWA 4K94H 4M7LT 3I74A 3F7YA 2XHNA 2XWZA 3NCEB 1XR8B 2CG9X 3T4AA 1DBJH 5HHPB 2Y7QB 3L3GB 4HALA 4KXZI 5E9DD 3U30C 1EBAA 1A6WL 1HDMA 1CXFA 4ABWA 1ZXQA 5KBLA 4AYGA 1NDGA 4IOSD 4HIQA 2R29H 5F1IB 3C8KB 3V0IA 1YEDB 1LMKA 3V5HA 3T8MA 3OKLB 3VFTB 1RHFA 2GCYB 4XX5A 4U3SB 1U95A 1OTSD 1DVFB 1WZLA 2Z7UA 3AS3A 5KSBB 1A02N 3RGVC 1TTUA 5ES4B 3X3GH 3FU8A 2RHEA 3D18A 4NPYA 4KI5C 3UTPE 4AENA 2PCFB 3LN4B 5D1XB 2VH5H 3FNKA 5DQ9B 4G9FD 4WK0B 5F3HB 3F62A 4S0TD 5LGHL 1ORSA 4R2GC 1AGFA 3BP5B 3B9EA 4CNIB 3W81A 3BH8A 3IXTA 2OCFD 2W8CA 5J06A 4Y2DD 2JB5H 5G4NA 3TESA 4ICWA 2K6WA 3SDAA 4GO8A 3H9HB 5HYJB 5AVXB 2C3WA 2Z6FA 3DV6B 1AGCB 4DWHA 2JCWA 5D7EA 4P5KA 2ZCKL 3QQ9C 2FT8A 4AVHA 1KDIA 3KH4A 4IKLA 1ZS8B 4F3FB 3NJKA 4HHGA 1EXUB 5MP6L 1A9EB 4X0KA 5GGTL 1UCBH 3REVB 4E9LA 1HZHL 5DWUL 2JB6B 5CJXC 3RVWC 3TX4A 4CN1A 5DD5L 3NCJH 3WGVB 4HIIB 2XU9A 2FH6A 2NR6D 3FN0L 2PXYB 4UAOB 2UXTA 1JNJA 1E2ZA 4GIPD 4RZCA 4PI0A 2DIEA 1MKFA 2XG4B 4K7FB 1RJZB 2IOMA 3BWUC 2VN6A 1IC5H 3JWDC 3P0YH 3FRUA 4Y5XB 1PD6A 3X11B 5CLWA 2IPUK 3RU8H 1VIWA 4LSRL 2P46B 3QR1A 1CBVH 1XIWB 2RQEA 2K8QA 4JFOB 4XVSH 3T2NH 1DTUA 3NFNB 3R4DA 1TQBB 4NN5B 1BECA 3IDYC 4FNUA 1MHEA 1HILB 3B6SB 4AKOA 4FXTA 4HHWA 1OP5K 4ZNEA 5J1SC 5ICXA 1FBIH 1HEZB 5DK2B 3VDAA 1DZBA 3U0PB 3L3IA 3OX8B 4JHUA 3BQUB 1MUJA 2CUIA 3DBXB 3KNBB 4HF5L 4Q0XH 3UBGA 43CAA 3GXPA 1I3UA 2KDYA 5CP7B 2X4SB 3FTYA 3BO8B 2VDOL 3SYOA 4YHNA 2WLLB 1IQDB 5FA4A 4E41A 1G7PA 1EFXA 5J8OA 2O5NA 4JG0H 5AL0A 3CCHB 1RU9H 2H45A 6PCYA 4PJIA 5IB5A 1N2RB 1WQVT 4N6QA 5J89A 2JI3A 2ICWI 3JWNC 4Y4KC 4HMCA 2XFXB 3K8KA 2EXSA 5I17A 1KGJA 4JQVC 1P5VA 2OMTA 1TZHA 2EE9A 4NZJA 4XT1C 1IGTA 4GO6B 5DF0A 5FA3B 3ARGB 2G0KA 4RDBA 1AGDA 2YK1L 2VDRL 2AJVH 2NY7H 3CFNA 3H9ZA 4L3AA 4DKAA 4GXVL 5CJOH 1JDAA 2OMTB 2XC8A 3FZUD 1ZWIB 4JY4B 4L4TD 4AIEA 4HUVA 4QHMB 2HT3D 5EU6E 4A7GA 1J11A 5IOKA 4M3JA 1OLZA 1LE5A 1CPUA 3JV6A 4WO4B 1PNDA 1YYLL 1RZJH 3OB0K 2EZ0C 2DYRB 3QPQC 4Y5VB 1UZ8A 2AABL 4CMMA 1JE6A 5L7XL 5F9AC 2X6BA 3ZHNA 2OL3H 2Z8VC 3BO8A 2X4SA 3LKRA 4KFMA 2ZICA 5LHDA 3CG8A 4TSBL 1ZSDB 2I9LA 5B1KA 3D39E 4YR6A 2NNRA 4ZS6C 4F15B 4L3CB 5C3IA 3TH3T 3EGXA 3HNVH 1PD1A 3EJQA 2H1XA 3GZOA 3VJ6B 4G42B 1KBGH 5DGRA 2BNRA 3DIFB 3QRLA 5HVGB 4JFXB 4EZKA 4JM4L 5CFHA 3MV7E 3BGAA 3RVUC 1X6NA 4RMBA 4K7PH 4N0UB 2B0SL 1MFVA 4ZD3L 5MEPB 1YEFH 5DUPH 4Y0GA 4F7CA 1JI1A 4JKPL 1RZFL 4PGEB 4RAVB 1M7UA 2X3BA 3ATEA 4MAUL 1UUNA 4QNPF 4QRQB 2X2IA 5MHSD 1HCYA 4WHCA 1HSAB 1KPUB 3BVWA 1EJOL 4W6XB 4BQCA 4CMMB 3GMQA 5I8EB 1LNUB 4PJBA 5LGYA 1A6AA 1EANA 3P1VA 1ID5I 4MNQA 4AE0A 3F04A 1OT2A 4M7KL 4PY7A 3T2OA 2VDKL 6PAZA 4O4YH 4BV1A 4G6KL 3ZTJG 4NXKA 4RISH 2J88L 4EI6A 2DQFA 2Z7YA 5HHOA 4Z78B 2GC7C 1B4RA 3LMJL 3AXIA 3CHXA 1AGCA 5H94A 1IJ9A 2CM6A 5LNDA 5F6HJ 5EEXA 3Q6FA 3V4VL 4R97B 3S6CA 1EWHA 4WI9A 1KZYA 1D5MA 5I8CA 3E9UA 2E27H 3L5IA 5F44A 2WLLA 3EYQC 4NZUH 5B3SB 2R27A 2ZCHL 3VE0B 2AXGA 4CMHC 5I6MA 2FO4A 2PTUA 5EIQA 1TEYA 3RQ3A 2IJ0C 3EOAA 1QUNB 4QXGH 2WLIA 4KDWA 4OZ4B 2YBRA 5JXAL 3KVPA 3O45A 3ZE0F 1LXMA 2BIMA 3POHA 5F1NB 1ZD6A 4JUTA 3VFUA 2MTPA 3PUCA 4FGMA 3B9DA 1GHFL 1F4XL 5FB8B 1SMAA 3MBXL 1T89C 3NZ8A 1FVCA 1YMME 4MHHG 4U0QB 2DJMA 2FLRT 5EOTB 2OI9C 4K8RC 4DP9X 3KPRB 2OYKA 1BJ1H 3GHEH 3PHQB 1KIQA 5ESVB 4QT5A 2C3VA 1KC5L 5JO5A 5D4HA 1M2VB 3HMWL 3NABL 2NY7L 2VO8A 4R4BA 5D72L 2K4WA 1T5XA 4OCXL 2B1AL 3QIBD 1OSYA 5E2JA 1Y1UA 4LNVA 2W38A 3VMNA 1JYVA 2WXOA 3V4UH 1OM3L 1HIML 1T5WA 2DWDB 5CBAB 2WCSA 1E5YA 1YNTA 3WTVA 1NEZG 2CLRA 2NLJB 4J6IA 4YWGL 1XF1A 2X4TB 1QI5A 3IE4A 3A22A 1NIBA 3BGMA 3GTVA 2AF2A 5JIQA 4PY8I 4HFWA 2E9WA 1T89A 1XH1A 2DMBA 2EZ0D 5KJ4A 3VFPB 5LG6A 4GQRA 4GMTH 2VL5B 2P4AB 1FJ1A 3QFJD 5JHAA 2EYSA 2P5WB 1SUJA 4BD4A 1B0GB 3KM2A 5HGDB 5DK0B 1C5CL 1I9RH 1UZGA 4QHUB 4X9IA 3TFKC 4KJPD 3TBBA 2AK1L 4PRHD 4BWWA 1BD2A 3WKMH 1JS4A 1OE2A 1SOXA 3MU3A 4TKWA 3A47A 4QHNA 3T0AA 2F68X 3RDTD 4YDJA 1ZIAA 3AY2A 4R7DB 3FOLB 4G43B 4MCNA 5ESAB 1CVRA 1X9UA 1EJOH 2VYRE 2P43B 3QRBA 1UA6L 2QDVA 3G6JA 3FN3A 5JDJA 5LBGA 3BAIA 3BHBA 4F5CA 4ZO8A 3GS4A 3UP1A 25C8H 2ZWSA 3ES6B 4MNHA 5JORB 3RAJL 3MBWA 2H4EA 4OLUH 4PS4H 2QTVA 5E0FA 5EC2A 2WXQA 3V0WL 5IB2B 1AIFB 2EDNA 4ZPTB 3CAFA 1P6WA 5MENB 4YH6A 1WA0X 4F7PA 4XHQA 2Z64C 4HDIA 4IGBA 4PJ5A 5IT2L 1JTTA 1PU0A 1TTRA 4V1DD 2F0CA 5EU6A 4M7JH 3GSWB 5BVJB 4N0FB 3EIFA 2YEZB 5IUCA 1BZ9B 3CZSA 5KVFE 4WTXA 3PGDB 2XN9D 4ANVA 2Z31D 1JPSH 3HPLB 4YBQD 5C70A 5HI4C 1JDCA 2D7PA 2KERA 3ZHLA 2N4IA 3D0AA 4RDQG 2KPWA 1E3ZA 5BZWB 3VXRE 1CICB 3KLLA 1OPGL 4GW5A 5A2IH 4DPCX 1SRDA 3QIBA 4PRPB 4O51A 3S5LG 1N0XH 1OXYA 2H1PH 3L48A 5FO9A 4NO0B 2J20A 4DOHB 4FTVE 3UMNA 2LLLA 3N06B 2A9CA 5EV7A 3F6IA 1PZ5B 4H25B 1KUMA 3GD1C 2I7OA 4ZW6A 1P7HL 5EUOE 3HC0A 5BUGA 1TVBA 5AAWC 5ICZB 2ZF8A 1FV1A 3HZKB 3GI8H 4LNRB 4EBQL 4ODUA 4B9FA 3D50A 4XNZC 3V52L 1AXIB 4WI7A 4MAYD 2VXQL 3BI9X 5I66B 1U8HB 2FJHA 5FYKU 4FKKA 3RNQA 3T2QA 4X98A 1PLBA 1F41A 2EKSB 1TZOA 3VG0L 2RB8A 3FBQA 1FGNH 3SBRA 1Y6MR 5FECB 1YY8B 4P2CG 1GIGL 1LGVA 1PG7X 5DLMH 5BRZA 3FRPA 1JSYA 1EO8L 3Q8EA 4IRZH 3VFMA 3SODB 4WUUB 1OCWH 4HHAB 3KYOA 3BAEL 3LQZA 1PL3A 3PRZA 4NO0A 3F7RA 4N6RA 3M86A 5FO9B 5LVEA 4EI5C 2EABA 1XFPA 4FQLH 4KWUA 2A6KA 1AQDA 2V8MA 32C2B 3NG5A 2VC2L 4I2XE 1J18A 4WJ5B 4JZJA 3NIDF 3TEZA 2KHAA 5JQIB 1VZHA 2A9ML 5LJYH 1BAFH 1O9WA 5ACLA 4IIQB 2NY4C 5TH2B 4PJAF 4FULA 5DUBA 3HFML 1TG8A 1DVTA 1PAMA 2W0KA 1YEIL 4D0DB 2PO6B 1RZ7H 3SDYH 2MCMA 2V33A 4Z7UB 1O9ZA 3BQVA 5D1QD 1M57B 1WP6A 2J44A 1LK2B 4QRPA 3RWHB 3S3CB 5I1IH 3CLEH 2OAAA 4N24A 5J1TC 1EAJA 4X6DB 4HIEB 1QTYT 2CO3A 2DQIL 3ILDA 3EHBB 1GHFH 4S10A 3OMAB 4FG0A 5GZOC 2Y23A 2WWMD 3LH8A 3HG0A 5KW9L 4R4NC 1YN6B 2DM2A 4Y5YA 4XNXL 1I1AA 3WFEL 1NGPL 2WXIA 4HS3A 2XWJB 5HJDA 1B4LA 3VGDA 4FQXD 2B1AH 1FL6A 3MACL 4DESA 4OGAC 2XV6B 4HIXL 2DKSA 2EADA 4MJ4A 5F72S 3A0OA 2HH0H 5CM1A 1ZS2A 2F18A 1ZVSB 4UTCA 2W07A 4M00A 1H0DA 1D9KA 2YUZA 4C83B 4ZMYA 2IADB 2XXCB 1TU2B 3ECBB 4QHPA 3KD4A 3UP6A 5DHYB 1SUHA 4ODBD 4V2BA 1NAMB 4WKZB 4XMPL 2AV7A 1MIEL 1ZXKA 4X6FA 3DRQA 4W9JC 1Z3GH 3ROOA 4DERA 2F1EA 1E4KC 3M45A 2HG5B 3STZB 2QQNL 5GZND 1TTCA 3I75A 2WQ8A 5DJ0A 4JHBA 2NNCA 5JHBA 2PCXA 3O9WC 1Z7JA 3P30H 1A4KA 2FEEL 1I3RA 4CUCA 3H85A 3F85A 1DBBL 4E9RA 1TZGH 2HWZL 2KL6A 1U93A 4TLSA 4MZIA 2EDDA 1SJVA 4B9PA 1R75A 3C09C 3L3HA 4H8WC 3OZLA 2FX9H 4HK3N 5IHZB 1W0YT 4M56A 2OJEA 2YARA 1IM3D 1UXLA 2OV0A 3APMA 3GIZH 2E8ZA 3LH2L 3LPFA 1C9SA 5GJSH 4OAWA 4J3OF 2XFXA 3QQNA 4JX0A 2CCVA 4GLRI 4YBLB 3L1FA 3NZHH 2ZUXA 4E5XB 4QTHA 1F6LL 3QEHA 4KDTA 4PWHA 5CFAA 3II2A 4ZYKA 4MCYB 1T1XB 5TE7L 3O6LL 3SDDC 1XTLA 3SQOH 1FN4B 2ZCZA 4OFQA 2PMZA 3CE1A 3OGOE 5IBLD 5FUZH 3IJ7A 3SY0A 4JR9L 4JG5A 5CP3H 43CAB 1R5VA 1AO7D 4BYHA 1ZV9A 5BVPL 3H1ZA 4FQXC 4OM1L 2VR8A 1LEKA 3IWUA 3QQ4B 4HUWA 1J1XH 1JK9A 1L0XA 3F05A 1EIBA 4OFIA 5T1LB 3N04A 4PRIB 2ZAHA 3FTUA 1RUMH 4PJCA 2HX7A 1JWSA 3FQUB 1BPLB 1HL9A 2CHZA 3SPHA 3DGGA 5IHUL 2AK4A 1TQCB 2AQ1A 1KF9B 1KDJA 2JKJA 4JDEA 3NDZE 1HXYB 1TCRB 2Q6WA 4RQQA 3QDMD 1PY9A 7CGTA 4WHTB 4F9PC 4JN1H 4RMTA 1QHQA 2VZUA 1TQCC 1EHNA 2VDQH 2WTRA 5FK9A 1FYHB 2FLMA 2H5UA 1KACB 2VKWA 4PTTA 5EO9A 3VXNB 1OSZB 1QFWM 3P11H 5MEOB 4N0CD 5C0IA 2G2RA 1F6AB 3CC5A 2R2HB 3ZKMC 1DQQA 3VXNA 5LG1A 3D39B 4P5TC 4LLAA 3VXRB 4WTQA 2FDBP 5I1JL 3MBED 3KVQA 4R96A 2KLRA 5D8JL 4AQEA 3CN4A 4XO8A 4P46B 4AYSA 3VG9C 4KK8C 3ULVC 2YAMA 1A1MB 4JY5L 1S7VA 2BP3A 3CLEL 1P4IH 4YSTA 3MRLA 1IGMH 2AMUA 3H9HA 3LAFA 2ZXQA 2XZCH 1U8QA 1L4IA 2R0WL 1E67A 5HGGS 4FXKB 3T3MB 4ZI8A 2CRZA 4XMZA 5MEPA 1CI5A 2PW1A 3BKMH 5FM5M 3PXLA 5JPNC 2I32A 2I9TA 2YQGA 1HNYA 4PSPA 4Q9QH 1AD0A 1DN0A 4XHJC 3IM1A 2J73A 5JPNB 1INDL 3CN0A 3GTNA 2EEAA 3QDHA 3TO4D 4CVXB 3TU6A 1G5GA 3K80A 3IMVA 2FJGB 5IQ9A 5HYSA 4W9HC 3IMWA 1U3HC 4I77L 3QUZD 1M71B 3OMIB 4ZODA 1PD0A 2J3SA 2C4FT 4ODXA 1A0QL 2D73A 1G94A 4BFRA 4HWEH 3T71A 3FQ4A 3ARZA 2AQNA 2PLTA 2YQ3A 4IKNA 3RU8L 5GGRB 2AK4B 3MSPA 1H3WM 4HCGA 1DVQA 2V2TB 2C9UA 1MREH 3EOTH 3FSWA 3GMNB 3X2QB 1XD1A 4CVWA 1YN6A 1F4WL 1MLCB 4F7KA 1INEH 2BMKA 4HGWA 1HX0A 2AQ2A 4RGMC 5TTRA 1BVZA 4PGBA 2VE6B 4FHBD 1WK0A 1M05B 4I3SL 4LOVA 4P99A 4WUKH 1BXVA 3S35L 4XCEA 1LEKB 4KOCA 1GS7A 2BFGA 2NQCA 3AWGA 2XZAL 4NQEA 1Y6KR 1KNOA 4DO6A 3S8FB 5FHAL 7PCYA 1OWWA 3UZEC 3AREC 1HEJC 1EFXB 1OK0A 1PZCA 2YUXA 3LB6C 1H8SA 3LS5L 3V2AR 2CDFB 5JOPD 4LPWA 1NIDA 3CUPA 3GUFA 2EYTB 3E6FB 4IRSB 1P4IL 4Y4HA 3WS3A 2QGDA 3EGDA 2JJTA 3ULSA 1MFUA 4LASL 5E2UL 4XO3A 3KPSA 4GB9A 4JQIA 4PWEA 2ADIA 2WXGA 3H42H 4NC1E 1V8HA 1MVUB 3HE6C 3Q5YA 4WFGE 2VXQA 3IGAB 1PZBA 3ARYA 3ASNB 2EKJA 5KYNA 1NBQA 2YQBA 3IT8D 2YXFA 4OQTH 2E4TA 1XIWA 3D87B 4JFOA 2ZXWB 2ZNXA 4MS6A 3WSQL 4GFTB 5F3FA 4JHAL 4WI0B 2WZ6A 4LCVA 3KCPA 5CILL 5AOJA 3WFBH 1IX2A 3U1SL 2G5BB 2R2BA 5HJ3B 3V4PA 1HN1A 4GUOA 5DJ2A 4Z5RB 2WZPA 2A9AA 1GW6A 4QOKB 4KNUA 5CR1A 12E8H 1S7RB 2ERJC 2DQHH 4H1LH 1FNAA 2PXYA 4RRPG 2GYSA 3C9NB 2J1XA 4JDZB 1PAZA 4GSDH 1IO4C 2E59A 2IAMA 3WFHB 5F6IC 4HIPA 1YYCA 4PJDA 3GB7A 2BNUA 2A3TA 3AUVA 3MLZL 5KVGE 4ZO6A 4XNQA 4CJ1A 2H6OA 4MZRA 5D93B 3IWVA 3DJ9A 1REIA 2CGYA 1L9MA 3OAUH 1EMTH 5D1QE 1VAHA 2XWTB 4FQHB 2X4RB 1BGXL 2CSPA 1ZLVK 5KYXA 1YCSA 1G1OA 4ODSL 4WWOA 3P4OB 2D7MA 1CGTA 3MTRA 1XGQB 4G9FB 5K39B 1N7MH 4LPTA 5ESQB 1IE5A 4OI8A 2G75B 5EF0A 1UACH 4CL7A 2P28B 4OJEH 3HBGA 3DSNB 2D7TL 4DW2H 1LEIA 2W60A 2Z7WA 4A67A 3SE4C 2EH7L 1MFBH 2VZ3A 3ZKSD 2BSED 2P49B 3WELA 1H15B 4Z7WE 1EH9A 3CFDA 4TVSa 3VQMA 3LV3A 1CFNA 1CIUA 5ETUA 2VLMD 1L3WA 4LOUC 2N3JA 2BDNL 3WIIH 1PBYA 2H2PD 3GSOB 3NJXA 4WHYG 2VR5A 4LHUG 3RL1A 3V4PL 3W82A 3WAKA 5PCYA 3NK4A 5D4IA 3MA7B 3PNWB 2Y2WA 5K59E 4OSUH 3RDTA 4PHZA 3SE6A 1YYMH 4TTDD 3W39B 4BDVA 4JFYB 5IB3A 3BWSA 3AGVA 4IGBB 2PW2A 3SDXB 4UDTA 2BERA 3KH3A 2YN5A 1UD4A 1W9XA 4UB0H 1JGDB 3AB0B 4MDJA 4Y4HD 5LN8A 5CSZB 1XGRB 3RTQD 5F7FA 4MLSA 4A2LA 5KWYC 3OJDB 1EVUA 2OZ4L 1G7LB 5EUOF 1NFDE 1KCUH 5EBLA 3SGDH 3X3FH 3TS8A 1BQHA 2Y1VA 4XVTH 1SLVA 4Q7DA 2LVCA 4I18C 5L2KD 1R6VA 4N1EA 5DHDA 2APVA 5GRZA 1ROCA 3RGHA 2C9AA 1T21A 4NO3A 1JNNL 1ZGLA 3MGOB 5C0AB 3MA9H 2BNQD 1KTDA 1CYGA 4HPYH 4MZ3A 3U9WA 5DC2A 4YSAA 3UTPD 5A40E 4PG2C 5J57B 2WWMC 3DUSA 4XMWA 1Q9OB 5L4IA 5T8IA 1A3QA 4I3GA 5B4MC 1EHXA 2BHZA 2BS8A 2H2SC 3FQTB 2JH2A 3GMRB 1M2VA 3LRHA 4ENZA 4E68A 4QT5B 3RJOA 2QQKL 3W0WA 3MCKA 1TYRA 4PRNA 3SDXA 3BUPA 4AT6B 2YRPA 2PWFA 5AYTA 1VA9A 2OMVB 3TCXA 4FCAA 3Q3GA 2X87A 1H6EA 5DRZA 4D0CB 5JIIA 2PYEA 3NIDE 5EORL 3L7FA 1JPFB 1PG7L 2H32B 3FFCD 3OKOA 4GQPH 4NC0B 5KVGL 4S1QL 3ISWA 1CGYA 2ZOLA 4HBQA 1CFNB 3FCTA 3MODH 2OJZL 4BUHA 2ICCA 3HMXL 3VG0H 2YBRB 4KXDA 1EV2E 1A64A 35C8H 2AEPH 2A7BA 4LARL 1MLBB 2DD8H 2QADD 2AXFB 2LE9A 3PWVB 3EG9A 2CBPA 3F3HA 5E4OA 5GGSA 4UYQA 5KSUA 3RA7L 3U83A 3FHEA 4I5BB 1DJSA 2VRKA 2G75A 1CDGA 3SGEH 2W81C 5ICUA 4PJFF 4ZPTA 1MPAL 3AT0A 3U2IA 3U48A 3QEQE 1D6EA 1OB1B 2WV3A 1P84J 3O8XA 2Z0UA 4MAZA 4OB5H 4ZNCD 2IXQB 4MQ7B 3POCA 4OCYL 5MEND 3DARA 4MSWA 1UACL 4OQTA 4M6AA 3EJZC 1SBBA 3HG4A 4MA7L 2BSTB 4FFVD 1WJ3A 4LSSH 4AQZA 4KQ0A 4PV9A 5LGHH 1MWOA 1OVZA 3HAEH 3MKGA 4BZ2A 3CBRA 5HYQA 5H35A 4XVJL 2ITFA 3UG5A 2OSLA 1RERA 5B38B 1U6AL 3MXVH 3VXSA 5E6SB 4ELDA 1X5FA 4PWGA 5FO2A 3C5ZC 4Z3EA 7FABL 4DGIH 2ZXAA 2I7SA 1E30A 4WU5A 5DDHB 5KSVB 4UNVA 1TOXA 3ILPB 5GRYA 4YHYB 2W92A 4LCWE 2EYSB 2P5WA 2DMHA 5AVWB 4L18A 5CUSH 2WOBA 3DPDA 5DI8A 4PGZA 4AQ1A 2KZWA 4Y19B 5DJYB 4E9QA 1IEHA 3FSZA 4QKXB 2OL3L 4PRPD 1VGKB 2UV3A 1U8CA 1IVLA 2B9AA 4HK0A 1Q9LA 5K9QI 2CGZA 3S7GA 1OTUD 4ZSOB 4YDJB 3CFDB 2JKLA 4JKLA 2BNUB 1VEOA 3OKNB 4JO3L 4KX9A 5IJVA 3PF2A 3ZL4L 3ARBB 3FQNA 2BSDA 4LHUA 5D6CA 3ZGHA 1VACB 1MI5A 1BXXA 4B0MM 3TN0C 3JV0A 1U8MB 3HC3L 3N5AA 2HVBA 5F7UA 1L5GA 1CBVL 3FFCA 1LVEA 2KQMA 5CJQH 3VXTA 2DQCH 3APFA 4BWUA 5CSBA 4D7BA 3I9AA 5DZOA 4YDLB 5HHMD 4K5PA 2GBTA 4JVWA 4W1TA 3RGVD 4QUOA 3N85L 5L0QB 4ELMA 4CSZA 3IF1B 1A7NL 1CVSC 3PV6A 1PFCA 4HKZB 4GAYA 5EZIH 4B9IA 2ZOKB 1TCRA 3TPKA 1IKOP 1LD9B 3OSKA 3MRIA 1Y7VA 2QMJA 1BV8A 3UCQA 3T04D 1KY7A 3BVXA 3S2AA 1MG2C 4JVUA 2CJUH 4LCCC 3B2MA 3W9DA 3QA3B 3FTZA 4JO2L 5F96L 2Q86A 3ARFD 4I9WE 1KIRB 1WUNT 1N70A 4PRIA 4JGNA 1FAIL 2ARJB 3O41B 4JL2A 3NIFE 3K72A 4WFFD 3WLWC 3ISYA 5A7BA 4M48L 3VACA 1KCRH 1ID2A 1T4KB 2W95A 2D3LA 4FG6C 2ZE0A 1SHMA 4OUUB 4KKQA 3CU7A 1W0VA 4NI6A 4YXLH 4P9HL 1KIPB 3IK2A 3QE5A 1ZTXH 2WUCH 3LXAA 2YXVA 4X7SH 3IDYB 5J3HC 4PV8B 3FQ2A 4APXB 5GZNC 1XCXA 4H2CA 2BVEA 3QFJB 1KXVA 1WFJA 3BIBX 1QKZL 2VLLB 4AYFA 2NY5L 4CVZB 3CX2A 4TSAH 3BSGA 1V7MH 2V7NB 3RGBA 5IESH 2XKNA 5CWSA 3V7AG 3G5ZA 4P5TB 3HBQA 4QXTB 4EUPG 5F7HA 3DETC 1AXTH 2PP8A 4V1DA 2V7HA 4KJPC 5IB1A 4BKLA 4WFHD 4E42B 4PP2A 4B60A 1HI6B 2FUQA 3CTTA 1H3PH 3ABMB 3DVNA 2R69L 3KPMB 3GNML 5EZJB 4YGVA 3NCBB 5AW1B 2Z31A 1OE3A 3SDXE 5C07A 2VIRA 5I8KH 3VD4A 5G4MA 3OPZH 5JUEL 2BIOA 3GMOB 3TA3A 4Y2DC 2HKAA 3H53A 4IOIA 3VRLE 2HG5A 1TITA 3RUGB 3STZA 4P5MA 2ROYA 3BFWA 2XUWA 3IDIA 1EFQA 3ULVH 4XX1G 1N19A 5INCA 3DMMC 2EIJB 2YD4A 1HINH 3PAVA 3RBSA 4DSYA 4UZUA 3CFKB 2RCSH 1MDTA 3LZPA 2WINB 3P30L 3O2VH 4NKQB 5DQ9A 1Q90A 1L9QA 3VXUE 2HRHA 5DCCA 1D9KB 4G83A 1NCUA 1R5VB 4DP1X 2JWYA 1NLDH 2ATAA 2EAEA 4FMKA 3VW3L 3L4TA 3F58L 2AEIT 3S37L 5DRXA 4K3EL 1ZHNA 3N44B 4QF1B 5GS2H 4JFHE 1U92B 1OGAD 2FX9L 4FN0A 5JXED 2AXJA 2VM3A 3BN9C 3RTLA 1F1GA 3O6MH 3WAJA 1AQKH 1B2WL 2NZ9D 3ZR5A 4NWTL 3BZDA 4H2AA 3GHBL 4U33A 2AJXL 2HRGA 2PWDA 5E1AA 3CH1A 1XR8A 3KLQA 5I15L 4I0PD 2B0SH 4NHUB 3R7RA 2OMWA 5SV4A 3SQBA 4M9PA 4PB0H 1ZT1B 3GRGA 1PKQA 3GSXA 3D51A 4L48A 3CFCL 4MQXD 3D39A 4R90H 1A1OB 4NJ9L 1KLUA 3PL6B 1NM9A 4Z7WF 5F9JB 3H2WA 1U8OA 3T2LA 1CDJA 1FH5H 2Y5EA 2R56L 1JK9B 3QIWA 5CBEA 3MLPA 4YUEH 1QP1A 3L16A 4NO0D 4P04A 5K9QG 3ULUL 1RUML 3GBDA 2PCFA 3MV7A 3OF6A 4LCUB 2F19L 1OD7A 4NUPA 1PY4A 1Z2KA 4FHKA 2R4SH 4BFGA 1DJHA 4ZW8A 5HDBB 2RJMA 3MUGB 1JZJA 1YQ2A 1A8JH 2P5WE 3F7KA 4QTHB 4RVBA 1QRNE 3K6NA 4X6FB 4JRYB 4XMKH 2DYPA 1TTAA 2NX5D 2YRLA 4ANWA 3BKJL 3OWRA 1V54B 3VB9A 2HAZA 3EDJA 1XCQA 2Y1YA 2VDRH 1U93B 3LEXB 4HS8L 4GQ9L 5KVEE 2WQUA 1TR7A 3BQUA 3QVAA 3UO8B 4OD2B 5T1LA 3FHQA 1UJTA 3DMMD 2V5MA 3PFQA 3GK8L 3PIQA 4G5ZH 4HUWB 4KJQD 4KKNA 1JPTL 2GIXA 4Y9CA 5C08B 5TDPA 1U8OB 4FYQA 1H19A 5E6IC 5F9JA 4S1DD 2Q86B 1JXDA 2Y2YA 3PAYA 2F8VA 3KM1A 2BK8A 4M6OL 1G7IB 2YFNA 5L7XH 2DIJA 3BW9A 4MD0B 2B8OT 5EZLA 4WO4D 4X8JA 5IW1A 1AG0A 3MRLB 3B8YA 2UXFA 1YEGH 3WY1A 1RURL 4Y5YB 5IG7B 4X7TB 3KZ8A 3DRQB 4ZMOA 1RUPL 3QZWG 4FNQA 4OAWB 4LSTH 2DIBA 5T3ZD 1IGIL 4RRPA 2EICA 3VFGH 1G7JB 5IFAH 1J0ZA 2V2XB 4R4FH 1KGWA 1FPTH 3IVKB 3CC5B 1K4DB 2CGRH 5INDA 3PWJA 3NA9H 2BZDA 1M6OA 4FLHA 4TULL 5E6IA 1IKFL 4JCWA 4O5LH 2VNCA 5EF2A 3EOBB 4XP5L 2H32H 2CBOA 5D71H 2QSCH 2RALA 1RI8A 3JXAA 4PUBL 3OJVC 2NMSA 3HBPA 4P2YA 1GCFA 2WBKA 3U7YH 4RBPH 5B7MA 3C08L 2R2EA 4FYSA 3WJLA 3FFDA 3IFPB 1NGXA 2WVVB 2WKGA 3R8BB 1CWVA 4NFCA 3B7SA 3TP4A 3VWKD 4XNMA 1Q38A 2F5BH 5BV7L 2B4CH 3AACA 2NUTB 4GKZB 5CEZD 1R4XA 2VIRB 1F4WH 3BZFA 1AJ7L 1TPXC 2P5EA 4G6FD 3ARFC 2PXYD 1DQTA 1TTBA 4YX2H 3B3IA 4RMRA 1ZHBB 2P80D 3QJFB 1HXMB 2BIPA 3NRPA 4MMXA 4QRBA 5DJXB 5IHLB 1DQDH 2GABA 1W6LA 4TOYL 2AANA 4FS0A 3H3PL 3SY0B 5E5RB 3L1OL 3GYRA 3ARDC 2J56A 4QCIA 2L0DA 4HUMB 3ESOA 2FT6A 3B5TA 5FEBA 4XTRD 3QB7C 2W65B 4JFDB 5KS9A 4RAUA 5EDXA 2NY2D 4KRMB 4DCQA 1LILA 4XB3A 1FGNL 1PS3A 4L3EA 1AYRA 1BZDA 1U0QA 4MD4A 4XNDA 2YPVA 3FCTB 4JAMA 3EYUH 4OJCA 1YMHB 1SQ2N 1XF3B 2HKHL 4PJAB 1GCYA 2BNQE 2ENPA 3NCJL 2PCYA 5F8QC 4F8TA 3QCUH 4JY6A 1BFSA 1JDDA 5E9AA 2WAHA 5AEAA 2YPLA 3VTTA 1AGBB 4W9FC 1S5HB 2UXVA 3LTVA 3IBOA 4DKEH 1FNLA 4BQ6A 5L8LB 2CK2A 2CO4A 2JK5A 4P4KA 1A6PA 5H4ZA 5F9DC 3FQXB 3H9SE 3QEUA 3KJ4C 4Y1TA 5AUMA 3CJJA 4HG4J 3JTBA 5ABAA 1RFDH 4XRCA 2DBLH 3D09A 1S7XA 3BT0A 1G7QA 3QG7H 4UMSA 2B4CL 2ZP9A 5E1IA 5JW4R 3SO3B 4HEME 4OF8A 3X17A 3QQDB 3BKCL 1AR1B 3OQRA 5IMMB 3I6GA 2NZ9C 3D08A 5AAMC 3DDFA 2L7QA 3ESUF 4HAGA 4OH2A 5E1QA 5FKAA 4A2EA 3GSUB 4PJAA 4IYKA 1NCDL 1WFNA 5B3NA 1ZV5A 4L8DB 1NSNH 1NL0H 3T6XA 3NH7L 1G4RA 3GXDA 4AQAA 4R4BB 4DP6X 3J27A 3O6KH 5I1AA 5KYYA 1JAEA 4FFWC 4NKOB 4R84A 1BXUA 1NCTA 4H1LB 3PHSA 2KDGA 2WXHA 5K9KB 3VM5A 1T03H 4P2QA 1Y0LB 5IKCB 2ZP8A 2EDKA 2W65A 4R2GB 5C6TL 2Y06L 3ARQA 2ATPB 1EERB 3FT0A 1OCZB 1NKRA 3L3KA 2OZ4A 4NQSA 2JCCF 4RMSA 4BA0A 1WWBX 2K45A 3VDBA 4HSCX 4U1IB 5EO0B 4M6MH 5DYFA 5AD0B 4NM4H 5EOCL 4C59B 5G4OA 1P4BH 4TNEA 4YHIB 3QAZC 1X5AA 5B1BB 4K07A 3ATBA 2BXYA 3V79C 3LQMA 2HYMA 4ABQA 3H9SD 4AK1A 4YHYC 2YS4A 4N1HB 3VSQA 2WBJC 3JYCA 4RLDA 1S8DA 3MRGB 1EZVX 1MRCH 5DYOB 1N5YL 4B3EA 4XPBH 2ZIDA 3VYOA 3MBEB 4RFNC 3UAEA 1EA9C 4FRWA 4A38A 4X6DF 4S2SB 2FQGA 1PJWA 5AQ0A 3HTLX 1A3LL 4RCAA 5AALA 4IMLA 1B0WA 2H32A 4ZTOL 2EXYD 3FULA 3GDCA 3ILQC 4NJAL 4P8QA 4APQC 2YGVA 1FLRL 2CO2A 1YNTB 1JNLL 1I1FA 4HQQH 1YEIH 2EDFA 2P5PA 1E5BA 2VLKE 4JHWL 4OUOA 4EO5A 3VFMB 3REWB 1HHHA 1S9YA 2ICWB 3MOAH 4GUPB 3TT1H 4Z3HA 2GITA 4P4KD 4JO1L 5FGCE 4X4YB 2BJML 1XB6A 3LQAL 1HTYA 3HC4H 3P40A 3GJFH 3PWUA 5IVNA 3HN3A 4FQLL 4CC4C 4YXHH 4KNTA 2DLFL 2F54D 2HUHA 3AU0A 1JWUA 1HQRB 4Y1AB 3U4EA 4ZOBA 1QSED 2HUEA 1AHKA 2VL5A 3BDXA 4JG0L 4TLUA 4U1GB 3OGCB 4LLVA 2FJFA 3O2DH 4GG6E 3O45B 5KBDA 3FC8A 5HVWA 1CYXA 2ZOLB 4PJDB 2C4XA 1AZVA 3BZ4A 3SE3A 3EGXB 2J4WL 4LRIA 1L7TH 3BVNB 1VKXA 2JKNA 5AZ2H 1I75A 3DX8A 4RMWA 3AS2A 1PIGA 4PRPA 4KK9D 3NEXA 1AQ8A 1OD9A 5IB3B 4Q6IC 1DFBH 4XVSL 2HCZX 1E6OL 3MAWA 4H40A 3JV6B 1EJFA 5H94B 3GUTA 2NZIA 4HW6A 4WNQB 1E4XH 2N56A 5BQ7B 1RZKL 3WTWA 4IKKA 2B39A 3WDJA 2B9BA 4TQEH 1E8XA 1NFKA 3PP4L 1NANH 5E4EC 1AS7A 3UG4A 3V5DA 2DWEA 3NCWA 4DEWA 2KPNA 1H15A 3W0WD 4GSUA 3CZLA 4QHKI 4GKNA 2ZOOA 3QORD 4K3DL 4PRHE 4APQB 4DCQB 4G82A 5AAWA 4MMYA 2C34A 2BOCB 3O6FD 4KRPD 1QRND 2A9MH 1SQMA 1F90L 3ESVF 4KMTH 4APQD 1B90A 1BF2A 4Q4EA 5E8OA 3T6ZA 3IJSB 2H9GB 4FNLH 1ZPUA 3QUXB 4D9LH 5DS8A 2C3VB 5JO5B 2ICEA 3N2JA 1VFBA 3OHXC 2PW2B 2WM0A 1OK8A 1N4XH 3GXUB 4KQ3L 5DD3H 5LBSL 4CKQA 5AFAA 2OLDA 2BSEA 4MX7A 4LLYA 3TT3H 4DF9A 2A9NH 1OHZA 5E8PB 1BQSA 2Y72A 4MZ2A 2X4OB 2R59A 3GBML 1D7CA 1K5NB 2N01B 1KGUA 4AC4A 4JM2A 1RZJC 2KH2B 3JBG7 3WMQA 1FF5A 2R9HD 2ZQKA 4BXVA 5D7IB 1MW0A 1K8DA 3B34A 2X7LB 4GXUM 3CXFA 4UIMA 1S7SA 4QO1A 5LAXA 2UVEA 1A3LH 3PDGA 5I0WA 4WEEA 3P4MB 3ZZ1A 5IF0A 2UY6B 2F7RA 3PDDA 2V6HA 1JBJA 1QASA 1O6SB 2P1YA 2MKLC 2VDLL 3H0TB 3MFFA 4KKBC 4ORZC 3WN5B 3HC3H 2VABA 2IDCA 1KCVH 4DKDC 1BA9A 1F00I 4LSPL 4ODTH 2D2CC 3FTGA 4N0UA 1JWMB 1J7VR 3MLSL 4HUKB 4P23B 2AITA 1IRAY 2E9GA 2MNWA 2XY2A 1FZOA 1JV5A 3QUML 1VJSA 1HH9A 1R3JA 1JK8A 3OD3A 4XP9L 2VERN 5TF0A 1LNUA 4FQCL 2FIKA 2UWEB 3AG3B 1YPZF 4UM8A 3Q44A 1OT1A 4JKNA 4IGBD 3L4WA 4UT9H 3L9YA 1KELL 1UH2A 2ZKMX 2DZEA 3QCTH 1GZQA 3QUKB 1Q9KB 4P5SA 5K33A 3TA3D 3DI2B 5CJ5A 3BAKA 4K3JL 3NJGA 5FO7B 2RFXA 5GS2D 3RX5A 1QLFB 3L5XH 3L2NA 3PWLA 4EI5A 1SXZA 3IBEA 5I6KA 5I1EL 4FXKC 3S4SG 5L2KB 1C5CH 1GJUA 1X3DA 3D2UB 2XZAH 4XXCA 1B3IA 3Q13A 5C0NC 3C8KA 5T5FH 5GRJH 4E5XA 1DLFL 4AC2A 2ZUQB 3H3BC 2DLGA 3R4RA 5KSBE 3DX0A 2ZUVA 4ORGA 2OQJB 1GGIH 1R3HB 2CA3A 1AIZA 2J1WA 1AHWA 1TETH 2CA4A 3ENEA 4UQ2B 2EDLA 2VXTH 3T0ED 3O9WA 5FYKL 1YEKH 3LZFL 3N0PB 2KS0A 4FQJH 5IB4B 1X5LA 1QHOA 3U0TA 2Y07H 3SDDD 3U6XS 5J9PB 4X5WB 4PJHF 2BOCA 4PJGA 2ZCLL 1IEAA 1URLA 1F3RB 2BHUA 4WWID 1UATA 4XP1L 1MAKA 1BSIA 3K6SA 4KHTH 3HG2A 3V0WH 1QLFA 4GRLD 4GI9A 2OR7A 4H13C 2X53A 4DKTA 2OMWB 3DOIA 2NY6C 2WP3O 3X11A 3PXJA 1NQBA 1WCQA 4JPVH 3WD5L 3BDYH 3WFDL 2PO6D 2J55A 1FNFA 4BFFA 4PRID 3QIWD 3SKNA 4Q9QL 3CFJB 4MA8L 1WC7A 5DJCB 3VYPA 5EIIB 1JZ5A 3OF6D 3Q5OA 3AT9A 2QZ5A 2W91A 1JNNH 1MJUL 3CZFA 5IHHA 3IDMB 5DQDH 4KKRA 1PIFA 4YDKH 3P2TA 5LLIC 2OMXA 5IJVB 5AZUA 3O2WH 3L4XA 3M8OH 2CR0A 4R8WH 1AKPA 3FUHA 3PL6C 4QY8A 4IJ3B 5KAQF 3FT3B 4N2BA 4BZ2L 2X42A 3DV6A 4M62H 4JPKH 1VEPA 1HS6A 4JDEB 1KENL 4O00A 1AXSA 2R0ZH 1LDPH 3QDJB 2W9LA 4U31A 4DTGL 1IC4L 1ZANH 2ZAGA 4CN6A 1T04A 3QDJD 2DLEA 4ZJ9A 4FI8A 1J05A 1SN2A 2Z65C 4LAQL 4P2OD 2X05A 3SKJL 4NFBA 4AXWB 2D0FA 5D7IA 1G0XA 2G3NA 4ZUVA 2EVIA 4WO4A 1GPOH 4GXFA 2F8XC 1PKOA 2J8UE 1TQWA 1TXKA 2JCCE 4OY9A 2LOEA 5HDLA 1NDMB 1AZNA 5C0AE 2XNAA 4LLQA 5HGAB 4KK6D 4Z7UA 1MIEH 3F12B 1E42A 2DRUA 3LS4H 4FLQA 1MZYA 2HVJB 2YUVA 3DNKA 5ITBL 5KVDL 4LSQH 1WIOA 4UQBA 5B21A 2F53B 3R1GH 5KSAD 3KBHE 1J9CT 3RY6A 1OCRB 3SDDA 4PTUA 1TF4A 3RVTD 1UWGH 4FFYL 2XN9E 2MCAA 4WDIA 1LO3H 1IM9D 3T77A 1IBFA 1YUKB 3DYPA 5D4JA 3ULUE 3BIAX 4XCFH 4G7QB 1BX2A 2W9EL 3GSNH 3LCYA 2V5SA 2EUWA 1S7QB 3DPBA 1BMGA 1MHCB 5C0BA 2DQEH 1QVOB 1IL1A 4XCYB 1KIUA 1JZ4A 3PQYE 4OGZA 5FECA 4BK4A 4PRBA 3PU7A 3RWIA 4FOMA 5KN5A 2J5LC 3BLKA 1GZHA 5SWQB 3OKDA 5EOQH 3QBTB 2CIKB 3GS0A 2GG1A 1I53A 2GB2A 3IMRA 5BW7A 2ADJB 2A6JA 1IE4A 3EFDH 1AZBA 5FUOL 1NMAH 5DHYA 4N0UE 2H2PC 1IFHH 3B4NA 2BY0A 1YVLA 1IBGL 3QQ3A 3GHBH 1ZIBA 5E7BA 4GRWF 3IFNH 5KG9A 2CQVA 2PUQT 3DSFH 2YA1A 5TFSH 3KBFA 1AACA 2HT2D 2JB6A 2XTJC 2LT9A 3ARFB 4F1ZA 3PABB 4BGDA 2VM9A 4U05A 1I7RB 3L95B 1H6TA 3COOA 1E6JL 1EBPA 3D0VA 3UABA 1F0LA 3U1SH 3TN0B 4IS6A 3UZEA 1J1PL 4XRCB 2XDHA 1MFCH 5FCSH 3BJLA 5DO8A 3NZUA 2VB5A 1XB8A 2W0FA 4N8CL 1KB5L 3QIUC 4Y2DB 1JGUL 2VW7A 1XBRA 3VI4F 1XF2A 1QO3B 1MWAA 1N68A 3RVXC 1A22B 5GSVB 1KTLB 4EJ1C 1MEXL 5HYJD 3Q7JA 2QQQA 3ARRA 2UYLA 3WS6A 1KENH 4LDCA 3TFBA 2YOCA 4DP7X 4X5LA 3IJHA 8FABB 4Z23A 3HS9A 5E9DB 1IBZA 4NPYB 1TZ8A 5TQ2H 1UZ6E 4B0MB 3ZYZA 1RZJL 2GQHA 5JLZB 2EACA 1X5MA 1G7MB 4N8PA 3QEQD 5IBTL 4PMFA 4U6XA 4M1CC 3B9AA 5F7AA 3IN0A 2X2JA 4WI5A 1JGEA 3PPEA 1OF2A 1MCIA 5DRWB 5D5MA 1WWCA 1XBDA 1KELH 3P69A 3S5LA 5D1XD 4HG4K 5E8DH 4Y88A 4N2EA 15C8H 4H4NA 5CHNB 2IPKA 1CUOA 3PWJB 4YE4L 3SY6A 2FJSA 3ULAB 2MCPH 1L0QA 3VD0A 5D7IF 5E8EB 5L2KE 2N7AA 2RH0A 2MOVA 1CB4A 2DQTH 4P49A 4DZBB 3F01A 3MYJB 2G4GA 4AW7A 3CHSA 4DEPC 3TF4A 5I1JH 1UVQB 2ENYA 4FQQB 2IFFH 3WNPA 1CE1L 1JXGA 3AAZA 3D1MC 1KEMH 1FL5A 4TULH 4H1LA 4PJ9C 5J12C 3VNYA 3IEAA 4NKOA 1EDQA 4N68A 4YOKA 2XIDA 1I31A 1OTSC 3RWGA 1A4CA 1P2CA 3ZR6A 1QVOA 3EGSA 3VFSB 4JGUA 3G5YB 1HE8A 1E9QB 2NX5A 3NIFB 3TBCA 1ZT7A 1A65A 1YNLL 1XCQB 2VR9A 2XQYK 43C9A 5DWPA 1MY5A 4EDWL 5I75B 4Z77B 4EN3B 2V2XA 2UWEF 1N59A 4UQ9A 4N26A 1QYGL 3NJLA 5J7CC 3WY3A 3DIDA 5E6YA 4ZK8A 3SGJC 2BP0B 5AOIA 1U3HB 4ZUUA 5DHVA 1PF3A 3PHQA 3WJMA 2JLLA 4AV0A 3N41F 3ZXAC 3IMSA 4ODHL 3R19A 4PCYA 5LNEA 1VSCA 2CDFA 3AAZB 1S7UB 4OIBA 3F83A 3MLUL 3S0PA 3HPLA 1AGBA 1P5UA 1DBBH 4NPJA 2VLJB 4NO3B 3FO9A 4BRVA 5BS0D 4L4VA 1BJ8A 4IU3B 1WCBB 1PFOA 1KN4L 4JPSA 1AQHA 3RPIB 4ETQA 1VDGA 2ENSA 4Y89A 3TF7C 3HNTL 2A2QT 4YPJA 1BBJB 1V7NH 2YAQA 4U1SA 4K5LA 3LIUA 4PG2A 2DQJH 1IIKA 5KOMC 5DA0B 2JKIS 1ZE3C 4G6JL 1UA7A 2RGSA 3S88H 3VE0A 2DQCL 2WJ5A 4TQEL 1HOCB 2H26B 3DSFL 2GJJA 2CHWA 1QEWA 4M43L 3HRZA 1IQWL 1WWAX 3BSZL 3GMPA 2MKWA 4NSKA 2NSXA 1YECL 3FFDB 3IFPA 3G6JB 2R2EB 4N0YH 2LV4A 4N86A 5FUZL 3UO1L 5F7EL 5HYEA 3ZKNC 3K4DA 2GFBB 4RDQF 5HHOB 5FKPB 2YGQA 3CDFA 2ZOUA 1MFCL 4A2GA 2FWSA 3TWCL 3MV8D 1EAQA 2YJLA 2EVJA 3Q0HA 3K2UH 3U4BH 1D2OA 1QHPA 2FBJL 2QFRA 3PJNA 5GS0L 5BRZE 3DX1A 4U1MA 3L3DA 4OW6A 1QW9A 5GSVA 1FFPB 3T1FA 4PJ5B 2I5YL 4UM8B 3ECVA 5T5NF 3UDWA 1FNGB 1P4LA 2LTQB 1AFVL 4HPOL 4L8SA 5HGDA 4FA8A 4BFIA 5GHWL 1G9NL 2PCPB 2CNZA 3BP7B 4YDMA 5K39A 1GOHA 1XGQA 2IAMD 1JPGA 4PFEA 1ZLWK 4K3DH 1NICA 3V6ZB 4I2XA 4OZFA 3UADA 1HK6A 1HIMH 3OR6A 2DLFH 2FWUA 1A7QL 4PB0L 1RUQL 2V17L 3TLRA 5E2VL 3QJOA 3EOBA 2J2ZB 1W72A 1W72H 2DQMA 1D7FA 3QJSB 2WWOA 3D85A 1TQTA 3MRJB 4G42A 4H5SB 5F7WC 2QGCA 5FW7A 5D96B 1D5XB 1ZA6B 4GMTL 1AYOA 2IWGA 4IBQA 4IEFA 4NWUL 2ESVE 1RL1A 3MNZA 2IBZY 1Z5HA 2ZSVA 2CO1A 3EKCA 2A6JB 2Q76B 4WW2B 4TRPL 4W9CC 1HYSC 2MTAA 1SDYA 5AW5B 3B2VH 1XGPA 4GS7C 3HNSH 3MLRH 4FKEA 3D25B 4L4VD 4OU3A 5FCUH 1NANI 1OO2A 1ZWIA 2WXNA 3T3PB 5B3JF 2QHRL 2WWKO 5IJKA 3QI9B 3V0VB 2IWFA 4FQ1L 1J87A 5I30L 3DXAD 2XWCA 3QULA 4ZDHB 2OW7A 2Y9RT 5FYLH 1T0MB 3HPJA 3QI9C 2CLRB 2DTMH 2E0PA 2NLJA 3QAQA 2D0HA 3VGGA 4GQQA 3PGCB 1OW0A 1MRDH 4P3CL 3F2LA 3OTTA 5IB4A 4HX1B 2FR4A 2BCKA 4UTAL 1JPEA 3ECWA 2FQDA 2JF1A 3RTQA 3UEZA 2QVMA 5EN2A 4W9GC 4IKIA 4CGUB 1T1WB 2OZ4H 4R9HA 5L2KA 4QHMA 1MUJB 1UUSA 4LEOB 2PABA 4RFOL 4BK8A 4NZDA 5JHLA 1NGWB 5JW5B 5KTEH 3K1KC 1RUQH 2JLPA 1JV2B 5IVZB 1JNHA 3WKNA 3L7EA 1HL8A 3ULUF 3FUIA 1SY6L 1JRHL 2J25A 2WSDA 3K46A 4RA0C 1N6UA 1DQJB 1XGUA 4U1NA 5E08H 2P8PB 3BUBA 4ONGH 3O9WB 4OVVA 4BCXA 1J05B 1MCKA 3P4MA 2O4EA 2XG4A 3W9DB 5KSAC 5E2WL 1EEYA 1M9WA 1UCTA 3A6BL 1E65A 4JZNB 1YJDH 1MQKH 4AL8H 3B9KA 3ECUA 1IC0A 5ID1B 4Y5VC 3TGXA 2XQBH 3QCVL 2J2ZA 2ZKXA 3PE9A 3JV4B 4MMZC 5DI8B 3HUJE 3L1EA 3RDJA 3PWLB 2X6MA 5LCVH 2AI0L 2NSMA 5CILH 1IQWH 3BSZH 3WFBL 3N55A 4JDVA 3QYMA 1MDAA 1UT1A 1XCTB 2NY3C 1ZSDA 2I9LB 1ITCA 4HH8A 5KAQG 2VC2H 3GI8L 4QRFA 4EUPH 2EIEA 2BHFA 3AU1A 4LEEA 5ITFB 5D7SH 3O3DB 4R7LA 2ALWA 2UWEA 1BXAA 2FIKB 4HXAH 2GITB 4OT1L 2WLNA 2HJLB 2Z93B 2CMRH 4NZ8A 4MMYB 3QHFH 4HUXA 2LHAA 5CKAA 4E9YA 3MGTA 1R33A 3TZVA 3MRCB 2Q8BL 4PJIE 4TUJB 1IILE 3MRFB 3NSCA 5GGRY 3LNIA 3DVNB 4ZXBA 1FCCA 2OMUB 4FC3E 1ADQL 3HE6D 2APFA 3OLGA 3FAWA 4X6DA 4AE1A 4PJ8B 5BQ7A 4EDWH 4Y19A 2F08A 3GC3A 1PQZA 1OAYL 2ARWA 3CC1A 3VXSD 1AI1H 3SPVA 3OZKA 4PVNA 3VI4A 3Q43A 4RMUA 4DKEL 2WQAA 4RNRA 3SDCA 3G5WA 3T0VA 4D0DA 4NBXB 1A6VL 1I85A 3C5ZB 4M43H 1KPVB 1QG3A 4ZMLA 3EUUA 2ODIA 5GSRA 5DVOA 3P3SA 1GC1L 3HPJB 5HI3D 4XO4A 1GXEA 4AWJC 5E8NB 2VZOA 3V5KB 1EGJL 3B2UC 4I0PB 2AGJH 2UXGA 4MXQC 1AH1A 2Q8AL 4CW1B 4HA1A 5C0RH 1E3XA 2V3FA 4J28A 4MA3B 2VISB 1RJCA 3ZJAA 2JI2A 5IVZA 4P2OA 1LK3L 2ZG2A 2C3XA 2HZHA 4IMKA 3A4FA 1WDAA 2E75C 5HDRA 4LLYB 1CF8H 5JHDD 2H6PB 5K5YA 4O58H 3F7PC 4OFVA 3MBEC 4RFNB 4UQDA 4MQ7A 3ULUC 3UC0L 3CVBA 1CGSH 3ZDYB 1RP8A 4K9EC 1FBIL 1Z9OA 3VWJA 1FPTL 2O5XL 1JVLA 1U8PA 4DGVH 1N9PA 4BH7B 1PDKA 1RULH 4I4WB 2YLKA 4DP0X 1LJMA 4OGQC 1G9MH 3ARBA 3FQNB 4LHUB 5D6CB 1ZA6A 2PPAA 1A1NB 2VDML 1R3JB 1LTXA 5D1XC 3PWVA 3VXQA 4TUOA 3KXFB 1U8LB 2XIIA 4KX7A 5E95B 4DEUA 3LNFA 3O0RH 2F74B 3W2DL 1DHKA 3IJEA 2C9QA 2GSGA 1KTKE 2HLFD 2VABB 3GI9L 3KGRA 2GUOA 4XN7A 4FA7B 4QAWA 1L6XA 3RIFF 4PBXA 1A6TB 4G8FB 2X4NA 3D69A 4ZRGA 5FOJA 5C0BD 3ZTEA 4TUKH 4EZMA 1G1CA 5JW4N 3UTSD 5CN2A 3S3BB 3CSYB 2EYRA 5M7QA 5KS9E 3OR7B 4XZUB 4YE0A 3SJVB 3PY9A 4MB4A 4ADIA 4HKXA 2VN3A 1CYWA 4I0KA 4R4FL 3Q2CA 1J1PH 4FQXB 5EOQL 4HIIA 3RWDB 2DLHA 4LLUA 4HSQA 3HUJF 3ZDXB 5FDWA 5DMYA 5IP4A 5EBWB 4I0PC 2IMNA 4NRXB 5EO1B 1HEHC 2BZCA 2RMNA 1BFTA 3OC5A 4LZKA 2KT6A 4BJLA 3DO3A 4XOBA 2D7QA 1NDGB 4PJXB 2VLKB 5C0EB 4MBRA 2IC2A 4LP8A 1QFWL 4HLZG 4JFWA 4H0GA 4HDIB 3CFBB 1J5DA 5D55A 2B1HH 4BUGA 4YXKH 2A83B 5EEZA 5DFVC 1PNCA 3IS1X 5DHMC 4XPAL 3WKQA 3MLTB 5KJ7E 2GI0A 3T3PE 1LMIA 1SNRA 2A77H 2UZPA 4HJUA 3T1WA 4X5QA 1ZJBA 1GC1C 1OWRM 4KKCD 5E9DA