2IDJA

Crystal structure of rat glycine n-methyltransferase apoprotein, monoclinic form
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
291
structure length
277
Chain Sequence
DSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSKDITTSVLTVNNKAHMVTLDYTVQFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 5-methyltetrahydrofolate is bound in intersubunit areas of rat liver folate-binding protein glycine N-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Glycine N-methyltransferase
total genus 78
structure length 277
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 2idjA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2idjA02
2Q41A 4IWNA 4YV1A 3S68A 1ZGAA 2IDJA 1F3LA 3HA5A 3I9FA 2C7PA 2ONZA 3EVDA 3P71T 2PX8A 5LQAA 4DA4A 4PGHA 1VLMA 5E2AA 5GM2A 3PS9A 4HSGA 3BWYA 3DLIA 3UZUA 5LQJA 5K0BA 5GM1A 3DP7A 3T7SA 4HGYA 5K0LA 4KRGA 4A6EA 3FYCA 5HIJA 2AOUB 3OE5A 3ER8A 4RVFA 1HMYA 2AOXA 1G60A 3DOUA 3MERA 2H1RA 3WSTA 1NW5A 3GNLA 2NXNA 2JH9A 4YUXA 1JSXA 3KQVA 4PIMA 3X0DA 2ZFUA 3ID6C 5JR3A 5KVAA 3KPJA 2OY0A 2PXAA 3C0KA 5DLYA 3THRA 2PX2A 4PYOA 5EHGA 2G71A 1OR8A 4E2XA 1VIDA 3DXYA 3GCZA 4PYKA 3FPEA 2EFJA 4MHTA 1RJFA 1KHHA 1JG1A 2KW5A 3TPZA 4ER0A 3D2LA 1BOOA 4E32A 4E70A 3JWHA 3QOWA 1KYWA 1VP3A 3LCVB 3L8DA 5CCXA 3NWBA 2B2CA 5E1BA 2PSSA 4X60A 5E8JA 5K0JA 3R6TA 1O9HA 4R6WA 2QM3A 3BGIA 4GOOD 4P7JA 3GRVA 2IBTA 3P2KA 5BW5A 4OX9Y 2PWPA 1KPHA 2CKDA 5EZQA 4P7GA 1QAOA 4FZVA 4ZTBA 3TRKA 2C7QA 3BGDA 3CJRA 2ESRA 4K6MA 3T0IA 1D2HA 2FCAA 3UJBA 4FS8A 5KYGA 1VPTA 3TKAA 4CKBA 5DPMA 5E8RA 4RTLA 2P8JA 2BR4A 3IHTA 1F38A 1M0EA 2O0LA 3I58A 1IM8A 5T67A 2P3QA 4RTQA 1JQDA 3EVEA 4MIKA 3KPYA 3UJ6A 5FWAA 4DCGA 5IKMA 4U7TB 2AVNA 2AN3A 7MHTA 4L7VA 2PXCA 2CWWA 3M4XA 1X19A 3LKDA 4RTSA 2O57A 2HWKA 3LBYA 3LDFA 2BR5A 5K0NA 2GA9A 5C0OE 4PONA 2OXTA 2YXLA 4BLWA 2UYQA 2NP7A 1XDUA 4EVIA 1EQAA 1XCLA 3QOXA 4OA8A 4PGGA 4YUYA 4PYQA 4PNEA 3KU1A 1P91A 3RIEA 1NKVA 1WZNA 3B3JA 3ORHA 2WK1A 5DX0A 1X1CA 1EJ6A 1O9GA 3CBGA 3KR2A 4ER7A 1X1AA 1M6YA 3EGEA 3HCCA 5E9QA 4DKJA 2OO3A 1EG2A 2AOWA 3KQWA 3PTAA 5HFJA 4LECA 2ZIEA 5DWQA 5LSAA 2GB4A 1FJXA 2EX4A 3NDJA 5FA5A 3QV2A 3NVMB 5BW4A 2QRVA 3SVZA 2OB2A 2IH4A 1KPGA 3A25A 5ICGA 4KDCA 2R3SA 2IPXA 4C04A 1ZKDA 2O05A 2PLWA 4HTFB 4C07A 5EMKA 5K01A 3FRIA 3OZSA 2P35A 5DM0A 3AWIA 1JQEA 2JHAA 3HVHA 4GOMD 3AXTA 5LQRA 1RI2A 4DM3A 2BZGA 1RI5A 4P7KA 3GWZA 4RV9A 1P39A 2ZZKA 1G8SA 3PVCA 4HTFA 1UWVA 1G6Q1 3FTCA 3OU6A 5FTWA 1N7JA 2B78A 4EMSA 3HM2A 3EEOA 3A4TA 3DR5A 2AS0A 2JJQA 1G55A 2IH2A 3C3YA 4GOLD 3EVFA 2H00A 3GIWA 3KR9A 3LKZA 3O31A 3P9NA 4OQDA 5H02A 2VZ9A 3IYLW 4DMGA 3DUWA 3BUSA 3SM3A 1JR4A 2ZBPA 3ANXA 3BKXA 5F2OA 1BC5A 3B7PA 3FUWA 2PWYA 1NV9A 1YUBA 4X41A 5LQNA 5ICEA 4HGZA 3KR0A 4CTKA 2Z6AA 3KPWA 5E1DA 3LCCA 1SG9A 3VC2A 3LHDA 1JQ3A 4R8SA 4C06A 2ORED 3HA7A 1X1BA 3EGIA 3R3HA 3G88A 5FULA 4C03A 4YUWA 1M6EX 3MCZA 1XCJA 3KQTA 3THSA 2YX1A 2FK8A 4ATNA 3G8AA 3TFWA 2HMYB 3CJQA 4GC9A 5FHRA 4V0RA 5EKXA 4MQ4A 2Y1WA 4FSXA 1FP1D 4GBED 3OFJA 4ER6A 5GIPE 5K0CA 4PCAA 3CC8A 3PFHA 1KR5A 3G89A 2QRVB 2ZWVA 3OCJA 1RJGA 2DULA 3BWMA 4FGZA 3UJDA 4AZVA 2UYHA 2UZ4A 2DPMA 1R6AA 3GXOA 4X1OA 1V39A 1NV8A 2WA2A 3MHTA 2IP2A 3R24A 2NXJA 2OYRA 3HCAA 5DX1A 4LG1A 4R6XA 2I9KA 4QTUB 5EMMA 1XJ5A 5C1IA 2A14A 3I53A 3M6UA 2OB1A 3C3PA 3OFKA 5P8WA 5LQKA 5DM4A 1L9KA 4PYMA 1ZQ9A 2PX4A 4BY9E 5T64A 4F86A 3NTVA 1QAQA 3OU7A 4GEKA 1Q0TA 4X61A 2AOUA 5DTQA 4X63A 1SKMA 1XDZA 2ZIGA 1BHJA 5FCDA 2AVDA 2YQZA 3H2BA 1JSZA 3KQSA 5DM2A 2AN5A 4UOEA 3P97A 4E33A 5GP1A 1I4WA 2AOTB 4CKEA 3NMUF 3IEIA 3TM4A 4CTJA 3M6VA 9MHTA 4OBWA 3GRZA 3E7PA 2JHCA 3DH0A 5G02A 4AZTA 2ERCA 2PT9A 2EJTA 3ELYA 4OA5A 1KYZA 3GJYA 5E9JA 2XVAA 1SVUA 3HCFA 3HEMA 1RJDA 3K6RA 3P8ZA 5DM1A 3O4FA 3P9CA 2C7RA 4FP9A 3DMFA 4BP3A 4F84A 3G5LA 3TLJA 1AQIA 3AJDA 3FUTA 1JG2A 4GC5A 2P7HA 3AY0A 3IV6A 2YXDA 3LCUA 1L3CA 1FPQA 3B5IA 3K0BA 3DMHA 3PX2A 4HH4A 5FQOA 4DQ0A 1WG8A 3DTNA 5F2KA 4QPNA 3BT7A 3NVKI 3LDUA 5LQCA 1SUIA 3DXZA 3ER9A 1PRYA 2ZW9A 1P1CA 1JTEA 1VQ1A 2P40A 3OPNA 3REOA 3A27A 3C6KA 1NBHA 1QANA 5DSTA 4EQZA 3KQPA 2IH5A 1RI3A 1WS6A 3CGGA 3TM5A 2ZLBA 2XVMA 4GUAA 1U2ZA 1L1EA 5DRTA 3MB5A 3UJAA 1KIAA 2B25A 2PXXA 3BZBA 5CVVA 3FTFA 2FYTA 1JTFA 3SMQA 2OKCA 2GAFA 3EVGA 3CVOA 3NDIA 3EVBA 3E23A 3RW9A 2UYCA 3G2OA 5HIMA 2FPOA 2YR0A 3FZGA 1SQFA 3JWGA 5KQSA 4LWPA 4BLVA 5ERGB 4M37A 5M5BA 2PKWA 3EMDA 3VSEA 1WY7A 3TR6A 3B3GA 5FADA 3PLAE 2GLUA 3P9KA 2ZIFA 1EIZA 1UIRA 4KIGA 1PJZA 3HCBA 5EKUA 1DCTA 2NP6A 3G7UA 3B89A 4YMGA 4RYLA 3PB3A 5BXYA 1R8XA 2FHPA 2YXEA 2IFTA 3UJ9A 5E9WA 1T43A 3DXXA 3SSOA 5D1HA 1QYRA 1L3IA 5KS2A 2GS9A 3OZRA 2F8LA 2N47A 4PWYA 1ORHA 2PT6A 4JXJA 4POOA 5U4XA 5K0GA 3FYDA 4RVDA 2FK7A 1WXXA 1VBFA 2BM9A 3V8VA 1XVAA 1X1DA 4QVKA 3V97A 3FUXA 5CM2Z 4E2WA 5K09A 3T7TA 5K05A 5K03A 5EG5A 2PJDA 4HG2A 3NW9A 2LD4A 4CXMA 1SQGA 3FPFA 4YV0A 5CCBA 2Z6UA 5F2NA 1QAMA 10MHA 3MGGA 3I64A 1QZZA 2HTEA 1G8AA 1FP2A 3R0QA 2AZTA 4RSRA 2B9EA 2E5WA 2NNWB 3BGVA 4E2ZA 4U7PB 4M7RA 3MTEA 2ZULA 3SGLA 2ZBRA 3A7DA 1HNNA 2NXEA 3LBFA 1NW6A 3GGDA 2VDWA 4B17A 1NW3A 2AOVA 3BWBA 4DZRA 1R00A 4RTJA 1Y8CA 2H11A 4RTRA 3F4KA 4O29A 3EGVA 3HVIA 4R05A 2HV9A 5FQNA 5HOQA 3ELWA 3FPHA 4ER5A 1R18A 4BLUA 3A7EA 1D2CA 4XUEA 5DT2A 4M38A 2PBFA 2I6GA 4C4AA 4OBXA 4RTKA 2YVLA 1Q0SA 2XYVA 1EJ0A 3CCFA 3JWIA 3NJRA 4GF5A 4OQEA 4E2YA 4C05A 1R8YA 1AV6A 2G8NA 1ZHFA 5EEHA 3KPUA 1YZ3A 4AX8A 3OE4A 5FA8A 5EIFA 5ICCA 4QPPA 3UJ7A 3CJTA 4YMHA 5DTRA 1UFKA 3GRRA 3M6XA 2PY6A 2QE6A 3A26A 4QDKA 3SSNA 5EEGA 4ER3A 1RI1A 5FWDA 3TKYA 4ISCA 2V7EA 3SX0A 3BKWA 5FHQA 1ORIA 3E8SA 3PX3A 2AR0A 1MJFA 3KR1A 4EK9A 1AF7A 4PCLA 2QYOA 3B3FA 4Z2YA 4RVHA 3KKZA 4QTTB 5DRYA 1B42A 3M6WA 3FPJA 5E1MA 5K8VA 3FRHA 1YZHA 5EHIA 4RTPA 4MWZA 3HCEA 4FT4A 2OBFA 3G5TA 3GU3A 5EQJB 4CKCA 4FSDA 1YFJA 3UJCA 1VE3A 3FTDA 5CVUA 2ZTHA 3KPVA 1N2XA 3SSMA 2ZCJA 4GOND 2P3LA 3Q7EA 2V74B 4WVLA 2Z6QA 5LQUA 2P41A 3ERCA 2XYQA 4EKGA 5T6BA 3BWCA 4KVZA 1ZGJA 2K4MA 4F85A 8MHTA 5DX8A 4FT2A 5K0FA 4QVGA 3HTXA 4G56A 3ELDA 3UFBA 4E31A 4XCXA 5K0EA 5MHTA 2CL5A 3M70A 3M33A 2XBMA 5GIOE 2EG5A 4Y30A 4PYLA 3TMAA 1G38A 4AUKA 4XUCA 4GQBA 4V0QA 5ICFA 5EOVA 5HZMA 2NYUA 3MTIA 1DL5A 3HVJA 1Z3CA 2O07A 2OPBA 3LDGA 1NW8A 4HC4A 4R8RA 5EVJA 1INLA 5HEKA 1NBIA 1KPIA 3UA3A 2CMGA 1O54A 2OZVA 4QQKA 3G8BA 2NXCA 1WXWA 5CUQA 3ELUA 1DUSA 3ME5A 5LR6A 5CVDA 5DXAA 1RJEA 1VL5A 2P3OA 5HIIA 2PX5A 3JWJA 1R74A 3HP7A 2WA1A 5EPEA 3R9XB 3VYWA 1JG3A 2PGXA 2IBSA 2AOTA 2ZBQA 4DCMA 2IIPA 2VP3A 2AN4A 2FRXA 2ZVJA 3I5UA 3SR4A 2ZZMA 2G72A 1XTPA 3LX6A 4IV8A 1IY9A 3LPMA 3RODA 5DXJA 2GPYA 2ZSUA 3Q87B 2IGTA 3DLCA 4KW7A 4AZWA 3KHKA 4PYIA 1I9GA 3G2MA 2VDVE 5HIKA 3UWPA 1KP9A 4YV2A 4C08A 1YFLA 4CWAA 5E2BA 1EAMA 3LL7A 4PYJA 1D2GA 2ZWAA 3FPGA 4P58A 3KQYA 3EVAA 3C6MA 3EVZA 4E30A 4A6DA 4RWZA 3TOSA 5CVEA 1XDSA 4QDJA 4IV0A 3P2IA 3EEYA 3FUUA 2YTZA 5DSXA 4KIFA 3SXJA 4WXHA 1XXLA 4BP1A 4EKIA 1AQJA 2VS1A 1P1BA 1TW2A 3DULA 2EJUA 3LSTA 3P2EA 4LWOA 2R6ZA 2CMHA 3GO4A 3MAGA 4HRAA 2B3TA 2HNKA 3PFGA 4M36A 4QQNA 2QY6A 3EPPA 4PIPA 4YUVA 4P7FA 5JUWA 4PYNA 2GH1A 3AXSA 4FR0A 1YB2A 5D1NA 1H1DA 2XYRA 3UJ8A 2G1PA 1NW7A 5C9ZA 4KDRA 4MTLA 5GWXA 3GDHA 1RI4A 4NECA 2P7IA 2PV0A 3UBTA 1MHTA 4RTNA 5KQRA 1TW3A 1YF3A 3KQMA 1ZG3A 5EMJA 2HR1A 5BP7A 1SUSA 2ADMA 2I7CA 3CKKA 1BKYA 3O7WA 4IKPA 2JG3A 1N7IA 2ONYA 4RTOA 5EIWA 5CVJA 1IXKA 2I62A 3G2QA 3KQOA 3HVKA 5EMLA 4YUZA 3BXOA 3P9IA 5IH3A 3VC1A 1NE2A 2PVCA 3GRUA 3PT9A 3HA3A 3KQQA 3NWEA 5FUBA 3MCTA 3T7RA 4AZSA 1KXZA 2JHPA 3FTEA 4KWCA 1L3BA 3G2PA 3OZTA 5E1OA 3TQSA 4RTMA 1TPYA 3OU2A 3LGAA 4PINA 3UA4A 5GOZA 3FUVA 5DTMA 4H0NA 5GINE 1I1NA 1VP9A 2JH8A 2C7OA 1NT2A 2BH2A 2IDKA 2ZZNA 5EZSA 5EGSA 2Y1XA 4RX1A 5EC8A 4RVGA 2BM8A 5B1SA 2G70A 3LECA 3EMBA 3E05A 3MQ2A 4Y2HA 1JG4A 2BR3A 3HNRA 4DF3A 2P1DA 3EVCA 3GRYA 2UYOA 3U81A 3HCDA 2O06A 2VDUE 4XUDA 5CIYA 5CD1A 1FBNA 3DMGA 2YUIA 5HILA
chains in the Genus database with same CATH superfamily
1JE1A 5C3UA 3G2IA 3BILA 3WRVA 4UQLA 2WY2D 5FNZA 1HT0A 4ZQCB 1QPGA 1CY1A 1N6RA 1NY6A 5F7XA 4JDUA 5SYMA 1QFXA 3IQIX 2XJ4A 4IWXA 1Z6XA 1BDJA 1SURA 2IYPA 3UTDA 4CMIA 1BH6A 2E1PA 3DP7A 4EPVA 5SV2A 4EH1A 1U3UA 4OP1A 5JV5A 4IJUA 1Y48E 3VMMA 3A37A 3MN1A 3UO8B 1JA1A 3AR3A 1FYVA 3SR0A 1V47A 2AW5A 3L77A 4C7VA 2XRMA 3PL1A 2BJWA 4M8NE 3GJ5A 1E6UA 4AKEA 4KR6A 5JR3A 3JAWB 3KPJA 3LUAA 3L8FA 4F3RA 5DLYA 3THRA 1K68A 2AN9A 1LBEA 2G71A 1SD1A 3QF4A 1ZZGA 3KXIA 3DXYA 3TFQA 1XJWA 2QTCA 4OM8A 2EFJA 3T4PA 3DJYA 2EKDA 1IY1A 1MC8A 2EKBA 3W6ZA 4Y6SA 3SM9A 1TUEA 5ECYA 3DAFA 3RT9A 4YCDA 4ASUA 4QLOA 1HOXA 2R79A 3W2IA 3S1LA 3W1VA 1CEEA 3K0AB 5TF0A 4YCCA 4BQRA 2XVZA 2PWZA 1H3NA 1M66A 2KMLA 4ND6A 3GRVA 1IONA 5GV7A 2ZJOA 4IYRA 1PFKA 1XLWA 4F3NA 4J6EA 1GGMA 3B12A 4ZK6A 4EJ2A 4BWVA 3NDRA 4E46A 2FSGA 3CMCO 3WMXA 2FEXA 4RQUA 2H1OA 1IAQA 3AR2A 3W4KA 1Y0BA 4RHYA 1KSFX 4YRSA 4J0IA 2ECKA 4KO2S 3O82A 4ZVPA 2HT6A 1U4NA 2QMHA 2I9PA 4D9JA 3IBGA 4WNIA 3DEZA 3E9MA 3RYIA 4FJ0A 4ZGBA 3GN2A 1ZRHA 2FZWA 4GI1A 3ZDYB 3IT3A 4V38A 1C7IA 2M1XA 5JANA 3STUA 3RVSA 1C9NA 1GG9A 1XPJA 1YHNA 4M1EA 4A27A 1G9SA 2NSYA 3MJSA 4Q9DA 3GRFA 4HXFB 5B3KA 3AL2A 4W5TA 3VXKA 3OECA 3QUTA 4DLAA 3OLYA 1DS6A 3ZY4A 5I45A 1TGYA 3MWGA 1GUZA 2FSIA 2O14A 1QF6A 3U2QA 1VSVA 3NBQA 1DG9A 5DWQA 1WHSA 2CFRA 1RIIA 3QV2A 5BW4A 2Q0SA 3H11B 2OB2A 2YHIB 4M9XA 1IBRA 1WDMA 3TEJA 4DA6A 4MRMB 1EFCA 4BNHA 2XYGA 4N5HX 2P35A 2IHUA 3JU3A 4GOMD 1S89A 1IDN1 1GT91 3DEIA 3Q1KA 1E1KA 1FX0B 3RT1A 3NYQA 2JH3A 4OHXA 3A4VA 4NAUA 5HF9A 4NWIA 4DDTA 1QHHA 1OI7A 2V97A 3NM5A 1K9VF 1EUCA 4TZKA 2GEKA 2QGZA 3GA7A 3KEGA 3N0VA 3VZDA 1Y3CE 3MJDA 5KNCD 3ZDEA 5HF5A 4P3OA 3TD9A 3VKVA 3QPVA 1CDEA 2GCEA 3R1IA 3ZHCA 2VF5X 2QNBA 1HXHA 1X7ZA 3CW8X 4IRMA 4CU2A 1XXHE 3TLCA 1QHXA 1J6UA 1H9CA 1XTVA 3HWX1 4DEYA 4E6PA 2XA9A 3KB8A 4JWKA 4MIOA 5GJCA 3HPRA 4RCZA 2IEZA 3PGKA 1JR4A 1EUDB 3IMFA 1QP0A 2JFNA 2YQ4A 3V4OA 1HV8A 3QXXA 1C7JA 1GUBA 3FFAA 3PC8C 1XCGB 3H2ZA 1WLYA 4HGZA 5ALSA 3OUZA 2QAGA 4ZO8A 2XMQA 4AECA 5LIPA 1RKXA 4LDNA 4DARA 2JVJA 4OUKX 3I9NA 4ZA2A 3L0SA 4JUCA 1XKQA 4F4UA 5K8LA 4PFJA 4YAOA 3QVXA 2PSJA 1XCJA 4YPOA 3NRCA 4UE2A 4E2FA 1Z68A 2GSDA 3Q2KA 1AMNA 2ZRMA 2BRUC 2IEGA 4G01B 5AXDA 3VYVA 2XTJA 3IAFA 4K9OA 2ID4A 4LHEA 1N6OA 2C5SA 3I39X 3ITNA 1YI8A 3LW7A 5FWXB 1E6MA 3PFHA 4RM3A 4TYNA 1OXTA 1PFGA 4MZXA 3O1LA 3G2JA 4IILA 4TWRA 2SBTA 4PXSA 2R8PA 5JEDA 1JHRA 1ZM4A 2NO9A 3AY3A 3H6KA 4HEJA 3NHRA 3A05A 3B51X 3NTRA 5DXFA 3R9IA 4WK2B 1GYQA 1TK3A 2JVIA 1MPTA 4CG0A 1CD5A 4ZP1A 5DX1A 1G20B 4H7DA 2QI9C 3W5CA 1WSAA 2QD2A 2R84A 5EMNA 4AX4A 4JLKA 1PBTA 2W6OA 3OFKA 4CGYA 4DTCA 3C3PA 3UK0A 1SQ6A 5LQKA 4CPDA 3G13A 5EKDA 2VYQA 2UXCB 4K40A 2XTMA 2EQBA 3U1VA 1OXVA 2BUBA 2V5UA 2H1IA 3E7DA 3RWOA 2VHVA 1OWOA 4D74A 4LJKA 4J7UA 5AKIA 4FXOA 3DWFA 1VRVA 3H75A 1W5BA 3NO4A 4TT8A 1NMYA 2PH1A 2NO6A 2Y3IA 2X3UA 4XDYA 1ENZA 1U2TA 2JFVA 2YHIA 5CPFA 3AEQA 2XLBA 3Q85A 5F3DA 2AJBA 1Y1QA 2DBVO 3PC6A 3K20A 4IV5A 1ZINA 1XEWY 4US0R 1U3DA 3E7PA 2EWMA 3IPLA 1EGAA 2R6DA 4B3TB 4D4GA 1XC7A 2IZZA 3U13A 3GJYA 2RHTA 1NF8A 2BGNA 3GY0A 1PJAA 4Y9SA 4M1OA 4UBKA 3FKSA 3P32A 5E6UB 3VU8A 3U6BA 1KGDA 1U02A 2BGWA 3AHHA 1SXGA 3GRCA 3OCUA 2ZJYA 4LSWA 1FXSA 3IVXA 5DZSA 3G79A 3OM8A 4JA0A 3Q0TA 1J8VA 3IDSA 3GFGA 5G4KB 1JUDA 4MWDA 1B8NA 3FGZA 4IIGA 2ZRGA 1G21B 4IDAA 1N5KA 3DVQX 3WNBA 1W34A 2NYRA 4HH4A 2CHQA 1E2QA 2VQEB 4MQEA 5D85A 2W0SA 2H7CA 2W2QA 4DLZA 2TMDA 5EJ9A 3QTLA 1SIBE 4YQZA 2A9OA 3AM5A 4IQ0A 4HR7A 3ER9A 3VDNB 3S0JA 5IAOA 3KQPA 3C4QA 5I7AA 4RA9B 3HO8A 1T2AA 4KBYA 2DUWA 2ET6A 3QWBA 3VBCA 4F9FA 3ENQA 1VCMA 1A1SA 4G25A 2QJRA 3FTFA 3N2GA 2P9ZA 4ZVUA 3IMCA 3V7UA 4DHEA 5IKPA 1XTQA 2DEUA 3H99A 3HXLA 4MMZB 2K2WA 1QWOA 3EMDA 4RY2A 1V45E 2XMBA 1RC1A 1R88A 4JI2B 4ZK2A 1FMJA 1EM6A 2XDWA 3MJVA 4CLOA 2ECFA 1J9EA 2FPUA 1PKEA 3A1TA 3ANYB 5FD8A 3I2KA 1NMEA 2NTVA 5BUCA 5JNTA 3RYTC 2HCRA 4PYRA 3SLKA 3VR2D 3PB3A 4NG4A 1UBLS 3ZHTA 4CW7A 4XIGS 4EYEA 2ZB4A 3IS3A 5EWMB 5KVCA 1ZOIA 4XWYA 1J5XA 1WKBA 4LDQA 3O4IA 1PNRA 4QEDA 1NBEA 4H7EA 4IY1A 1W5FA 2PQ2A 1YB5A 1UJNA 2F8LA 4OJQA 2JBAA 5IULC 2DP4E 1SBYA 2G9ZA 2JA2A 4ND7A 3L0PA 3RUAA 4IEFB 3HRHA 5U4XA 5JS6A 3B48A 4M55A 4RHEA 3GLQA 4KWEA 1PJLA 2QUKA 3OCCA 1NVDA 1PZHA 4P2GA 4QVKA 2QN9A 3V8VA 3G9ZA 3GNQA 3T5PA 3OPMA 4MJXA 3DV2A 3HYRA 2ORVA 3P20A 1VL8A 4H18A 2IBMA 2XE8A 2YIJA 5AKYA 2HRBA 5IW8A 5KYTA 4DMUB 4BFTA 3R0QA 2HLHA 4YT2A 4DV2B 2W2KB 4RSRA 4F2PA 3LP8A 5CDTA 3HPQA 3ND5A 3PUXA 5ABPA 2BGUA 2JI9A 1XHLA 4MW2A 3A7DA 4F4HA 3LBFA 1A4RA 4JP8A 3I4CA 3GGDA 2YW9A 3LO5A 3KBBA 5C52B 1V8BA 2N46A 4MR9B 2C2ZA 3IOMA 1RDFA 1YE3A 4UBLA 1DJMA 2DQKA 1R18A 4CEJA 1A9ZA 1FDOA 2CNWD 3SEFA 3RVNA 2HWXA 2QORA 3IMKA 4C4AA 4D6YA 4DR5B 5HKOA 3RG8A 3HDHA 5AI0A 2VWHA 2W5UA 2FXVA 4OQEA 5ITZA 3NIGB 4U2FA 1ZUIA 2PLAA 1CUYA 4MV6A 5CRIA 5J5VA 4HEQA 4PNPA 2F3TA 5CJ2A 2C88A 2YYZA 5FA8A 1BGVA 1JHZA 3MS4A 2IEDA 4QREA 4BO3A 4P3YA 4EX7A 3CRZA 4Z4QA 5IKEA 4RDXA 1O4VA 4HB3A 3V2GA 4RGQA 5A4FS 1JPNA 2JPDA 2J9XB 3M6XA 3OBBA 4HAXA 4JC0A 1XJCA 2ZDGA 5IVPA 2V4UA 4L08A 2IS2A 2DPLA 3DKPA 4C6HA 5CMLA 3QNMA 1QBKC 3L05A 4WHMA 2Q6IA 1E3DA 1NVBA 3IAM6 3AETA 4O59O 4K9DA 1UM9A 4EGSA 3C74A 1GPNA 2XYHA 1J8DA 2A9VA 2E1RA 3TMKA 1EDEA 2QYOA 4CM3A 4K9RA 2YYSA 1CUWA 2F59A 2PZ8A 1HYBA 1X2BA 3ET4A 4UMDA 4AG6A 5K8TA 5L4LA 3PDIB 4NV1A 3TW6A 3E5NA 4CMEA 3IIJA 4G1VA 4FT4A 4DC0A 2EFHB 2JJ1D 1GCAA 4K05A 2X76A 3TAHA 3X2SA 1BU5A 2PGDA 4FM9A 4EYOA 4F1KA 4B1FA 4Z3DA 4C0SA 4O2AB 1DOAA 1YRAA 2H17A 3B78A 4UNRA 4EBBA 3G23A 4PEVA 3S4YA 1Q22A 1AGPA 3TI9A 1IIBA 3F47A 1T3SA 2XZTA 3KJEA 4KQJA 8MHTA 3EFEA 4EATA 2YV5A 1JEOA 1BFUA 3N7TA 1ABBA 3BA1A 3VR4H 4DDMA 3W3ZB 3WZMA 1RPNA 3ZQ4A 1SHUX 3DHYA 3M33A 4OOEA 4N65A 4G4SO 4PYLA 5ALNA 5C3MA 4QFMA 2AD5A 3ZDZB 4AUKA 3QOFA 4AVYA 2FAXA 4E3ZA 5HRUA 1RCUA 2Q99A 5GVSA 1VCOA 2ZIZA 1QCCA 3HUDA 3P0IA 4HK4A 5BN5B 5J2TF 3SNKA 1FP6A 3UATA 3MFYA 4HNTA 3DDWA 2AR7A 3K1YA 4INZA 2FMKA 3JRNA 5B7QA 2A9KA 2HNBA 2IF0A 3DAPA 4FFNA 4EG0A 3R8FA 1QVWA 1Z5PA 3O8QA 1J56A 3GQBB 4JJFA 3A4NA 3G8BA 3QWIA 4HL6A 4M9CA 4FE3A 4ZAGA 3RKSA 1KARA 1VL5A 2XNJA 4MQ5A 4E03A 4EUHA 2VP5A 2OQ2A 4IVRA 4MWTA 2PRKA 1L5KA 3VYWA 2O8EA 4W5NA 3RTEA 3BQ9A 3TNLA 1F8YA 1P2TA 1T9GS 2FRXA 2Z95A 4H6WA 1CRZA 4K9QA 4BC1A 1JDZA 1DP4A 2G72A 1NR5A 4IXMA 5BSWA 3L43A 2BZ0A 1RBMA 1V7CA 3CKMA 5ENDA 3ZCSA 5FWYB 2HDOA 1QQBA 3GFPA 2CC2A 4TMVA 1TMKA 2VPIA 3FH0A 1EA5A 1XELA 5HIKA 2GAJA 3NYWA 1HWYA 4IH4A 4YV2A 2P2NA 3T3PB 2YYAA 1JV2B 1M2WA 2JJ2D 2H57A 3C5VA 3HNPA 3Q2IA 4IP0A 4B7XA 1DDGA 1OIXA 1IWBB 2CB9A 2QAIA 4P58A 5EJ8A 1DNPA 4DAEA 2NZJA 3FPSA 1P29A 4H3SA 3CZQA 1RJ9B 4S1PA 2XXAA 1X3LA 2QM8A 3IDZA 3OTIA 3QE3A 1GV0A 1A98A 3CX6A 1NT4A 4KDFA 1OFTA 2PR2A 2ANBA 3EIQA 3KDPA 5FOWA 5J5CA 2WFZA 3IUJA 3FW1A 4FC6A 2W6NA 4A0FA 4WXEA 1NW9B 2VT2A 2EXXA 1JNYA 5EWMA 3ROPA 3MIIA 4AI6A 4EEZA 1H4QA 3PFGA 4FN4A 4RH1A 3QJ5A 4PIPA 1AO3A 3ZU5A 2O2SA 2XMDA 1ZZEA 2W6JA 2XYRA 2X5OA 3BRSA 3ZWCA 1TIBA 1D4ZA 4CF7A 2G1PA 1AY0A 2VJBA 3FYSA 3DAGA 3FCAA 3UBTA 3ZJYA 1MHTA 1NMXA 4XWTA 4IIDA 4QFDA 2I7CA 3TZEA 3FKSD 3O7WA 5IT4A 3NHWA 4GVLA 1DAKA 2I62A 4UARA 3ZWAA 1NQTA 1C3OA 2JIZD 3BXOA 4UCXA 1DGQA 5CX4A 4D9FA 1G5HA 4IHAA 3W9UA 4CKZA 1QYVA 1R4ZA 3JVUA 4OK3A 2D5IA 1F5NA 5AICA 1XVLA 2JLBA 2XWBF 2Z58A 2CLHB 1JVSA 3CZRA 4JKOA 3H4MA 3V4SA 1ID8A 1U4SA 2HZ7A 2X42A 4S24A 3D7SA 2C7OA 5BWBA 2HQSA 2DWOA 1GQQA 1XU9A 4JFRA 3UXEA 4TLCA 4CQMD 1LLDA 1ZAKA 3CT6A 3MTBA 3CB2A 1CJSA 2AYZA 4V24A 2B82A 3RSQA 3TTYA 1UP6A 4Q82A 1H2BA 2QWXA 2QN3A 2UYOA 2P0EA 4FQ5A 2O06A 2PCJA 3LHSA 1C81A 4UAUA 4XUDA 1FBNA 1DELA 4M9RA 5B1HA 4ZGWA 4KFTA 4HADA 2WG0A 2XQGA 4MW5A 5HM6A 3MELA 4LGYA 3H3JA 4Q3CA 1Q57A 2WUVA 3QVLA 3R3UA 4F56A 4BEWA 3GQVA 4FOLA 1BXGA 3TNJA 3UBMA 2P9BA 3WIVA 1XZKA 1R9JA 2AG8A 3G0GA 5FOTA 3GJ4A 2XF8A 1QDEA 4M21A 4CQLA 1ZL2A 2WG1A 3UMCA 2IS6A 2C5LA 2D8MA 4HGYA 1WCIA 2BP7A 3E9DA 3FN4A 3A9WA 3IKJA 3DEKA 2YVQA 4PFKA 4UHKA 5ENVA 4B47A 4F5WA 3DOUA 4F96A 3WB1A 3FOZA 2NXNA 3KKPA 3IEVA 1HDEA 1YR1A 1KXJA 2OZLA 5ALRA 3UHAA 3WYAA 4LOLA 1JDBB 4KN6A 5HKBA 2G5PA 3U6KA 4J43A 1U2QA 4X1IB 3RK0A 5CB4F 1C8BA 3VNAA 3B13B 4RPJA 4B5LA 1W0KA 1MAAA 4JT8A 2EHDA 5E7MA 1JBKA 3THYA 2A7XA 1HRDA 3GGGA 3WADA 1KY4A 1ZVJA 4WKGA 1A96A 2GBFA 3R5TA 1QU3A 2H9AA 1B00A 3IJEB 4OH1A 3NUGA 2QM3A 3MT7A 4P9NA 4B85A 5A5EA 3NHUA 1AKEA 4Q48A 2I6QA 3RQIA 2WKPA 1Q84A 5EWLA 3SR3A 3ZCVA 5LYJF 1P5HA 2P9CA 2H92A 1OLOA 4TTIA 5FOVA 1EFRD 1FS5A 1V3TA 3HBMA 1JHXA 1Z6PA 2D06A 1XD8A 3T7IA 2Z08A 5CLLA 4IL5A 5BT9A 3L1KA 2X7HA 3EDYA 3RLIA 4J90A 3OOJA 4AY6A 2MSEB 2OORC 1Z2CA 4BJ3A 5KTSA 2W8BA 1LSSA 1TUBA 4IXTA 4ZVRA 3A9RA 1I4DD 3DGEC 3AK4A 1R0CA 2DHDA 2IOFK 2V6BA 2VAVA 3ZKWA 4KRYA 2YXNA 3DE1X 3QMWA 1E2NA 4RXUA 1FB5A 2QX7A 2WLTA 3GPLA 3R3VA 2ZAIA 2ZB8A 3EVTA 3LBYA 4R68A 4BLWA 1IZ7A 2D5CA 1RHUA 5T7BA 2F4VB 2CD9A 3OIGA 3U5TA 1N2CE 2OEPA 2QMQA 2WV9A 1QGED 3E03A 3EDOA 3KZCA 5TGTA 3SDBA 3WA6A 1XEFA 1RW4A 5EXTA 1T8YA 3LO8A 1HDIA 1Z34A 2HF8A 3C15C 5H70A 3A2KA 3CVUA 3WGKA 2D1YA 1RHRA 3CT4A 1QVRA 2Q07A 2X2EA 2WF6A 3IEUA 3MAJA 3Q5DA 4NPHA 2V98A 2GRJA 4BN0A 2UYGA 4QBHA 2HV8A 4UZSA 2WTXA 3V32A 1WMEA 1KFEB 3V2HA 4LY6A 3A25A 1COWD 3IULA 4RK5A 4D26A 3VR4D 1J97A 2CZCA 4J9VA 1C5KA 1SCBA 4RH3A 3OJWA 2XUZA 1NPYA 2BZGA 1RI5A 4WTOA 1VIVA 1T6ZA 1RTKA 2JIRA 2ZRNA 4KLZA 1SQSA 2FOIA 1Q0LA 1XRMA 3AUTA 2G88A 1N5MA 2X6TA 4MVJM 2PZGA 4P3PA 1FSFA 4KJZA 2XD4A 4ZOLB 5DEIA 3A4TA 4IBOA 3SQXA 4FCCA 3WNQA 2A3RA 5H4HA 4D8WA 2PAFA 2O8BA 3QITA 1T5OA 2PU7A 3K73O 4UM7A 1OX4B 3B6EA 2DR2A 3FPCA 1Y7PA 1TF7A 4BO7A 2KX7A 1ZJ4A 4XX0B 1PYGA 1VBMA 5HUHA 1FLNA 5FRDA 3P9ZA 2QDKA 1VPDA 4MP3A 1D03A 4MUIA 1M1YE 1FVOA 5DYYA 5T4FA 3U3ZA 3BM5A 1UP4A 2P9GA 3AYXB 1OBCA 5EUCA 1HDGO 4CQMA 3A4YA 2GHRA 1YBAA 5LLTA 3D7KA 1XZNA 2VP2A 3NYRA 2K5UA 1H2HA 4ARUA 2V9CA 4ND8A 5CB6A 1DRJA 3KM0A 3C85A 2FQQA 4FGLA 1JDNA 3BHNA 1GGNA 4YAIA 5J2UA 4W9MC 4ZZ3A 3THSA 4WN9B 1ZQ1A 4HXEB 1NVFA 1RSZA 2IYUA 3CUSA 1GPKA 4XGIA 1SOVA 3IP9A 4LNHA 4QBKA 5D87A 1Y7LA 3V8QA 4B44A 4YAEA 1E5QA 2Q5IA 3E5RA 3AB7A 4ER6A 2C9BA 4DT1B 5GZ1A 4GGPA 1KNQA 1YVUA 4M53A 3RC8A 5JU6A 1F0KA 1H2AS 1U7WA 1LQUA 3KHUA 5ELLA 2FZVA 3HJUA 3TE7A 1A4UA 4FFWA 1SUWA 3HCAA 1BGWA 3C8DA 2NVOA 5DH9A 2BFMA 2AFIA 2Q21A 3UT6A 3RSOA 1XJ5A 1YCHA 3I53A 5KVVA 4KV9A 4L0DA 3N2ZB 5EP3A 3KXDA 4EX6A 4JI7B 2PX4A 3QHPA 1WXFA 3CR3C 1E2DA 5KB3A 3FBWA 1QKIA 2VWQA 2AFRA 4OOFA 3GZTB 4X61A 2R7LA 5TY0A 1M2VB 2J1LA 4G1FA 4RZXA 3TOVA 1CB0A 4OCZA 2YJ4A 2XADA 3IIKA 3P27A 4Q19A 5K3BA 4BMPB 1EB9A 3T8YA 5CB8A 5HPYB 4ENPA 1OFUX 3A1FA 3FG9A 3KQKA 2XAUA 2EARA 1QFJA 2Z2XA 1I4WA 3GARA 4WZAE 3VH1A 4A15A 3PXEA 2X2FA 4RD6A 4YVFA 1YR6A 1Z25A 3I2HA 1RXEA 3OWOA 4PSVA 2WUFA 3GN1A 4OQZA 2ENWA 3WOHA 3PEWA 2Q5HA 3KKEA 4ITUA 1NZFA 4GFDA 1I3CA 4TS1A 4LFCB 5C34B 3GVXA 4DGSA 4HJRA 1Y5IA 1KU6A 1A2BA 2IX9A 2PG3A 2OFWA 4MP6A 4U1RA 1CR2A 3IODA 3EQ8A 1CETA 1IG0A 1VJRA 3D2BA 4FP9A 4IOJA 1NP7A 1EM8A 2O0MA 3K9NA 3HRKA 1U3VA 4N54A 5B2FA 3ENZA 1BMQA 1YIDA 3WLPA 1Z06A 1ZC3A 3CURA 3ZJUA 4J75A 3OQBA 2YBDA 4DBVO 2BWJA 2J8ZA 5KX5F 2H1LA 1KQ3A 4DV5B 2GBLC 3RABA 1N2IA 1X7YA 4NMWA 3QLJA 3S8EA 1TJYA 5KU1A 3OC6A 5LQCA 4IG9A 4EY8A 2G67A 3IPRA 3U7QA 1JTEA 2Y4NA 4H9GA 4KIUA 3REOA 1QVZA 3A27A 1YK1A 2POCA 3C6KA 2ZIAA 2C2XA 5EXSA 3T0FA 2BDEA 2JLAA 2RB5A 2O9JA 1EVZA 2SCUB 2VPYA 3LUHA 1SVNA 5IH7A 2QVZX 3T3DA 2HBYA 3QY9A 5JC1A 3LYAA 4M0CA 4LMPA 5BW8A 2XZDA 3ILVA 1EBBA 1KI6B 2JIMA 2VDKB 2VQ3A 2YIMA 3JZMA 2O2GA 3PK0A 4N5DA 5KOYA 3EIUA 5L95A 2NZ8A 1ECCA 1XJQA 1HC7A 2C0QA 1ML3A 2LCFA 3B70A 3JWGA 4UHDA 5IF9A 1ESDA 4LWPA 5M5BA 1WTCA 4RE5A 3YASA 1XZHA 3PUZA 3SX4A 1TNDA 4OBEA 5H82A 4DCVA 2C5HA 4XJXA 2D59A 3A04A 3K72B 1DC7A 2IYWA 3AHIA 1IATA 4JC5A 4Y2PA 2GVDC 1KORA 3WYFA 1Y82A 1BHO1 4XEHA 5KOIA 2IP1A 2JGDA 3V4VB 1X87A 3Q0IA 3W04A 4EVRA 4IIVA 1P72A 4X1YB 5BURA 3NS7A 4I5EA 5K8JB 3KEMA 2KBEA 4RS4A 1MOSA 2UUPA 2D8AA 3ASZA 2J6CA 3NWPA 3IIMA 2Y05A 2O2JA 4MS3B 1T1JA 4XX1A 5J1TB 4B7CA 3O3MB 2XGGA 3D6VA 3RFXA 4UM9B 1EVKA 2ZIVB 1NYRA 1U2EA 2WJGA 2P5SA 3OD5A 1ORHA 2CEKA 1ZD1A 4U6NA 5FI5A 1R5OA 2HF2A 1JBEA 1XKTA 5GAJA 3AEKB 1QO7A 4DABA 4U5QA 2HPAA 3TLMA 4PC2A 3H2JA 3EWNA 5CM2Z 3BMCB 2I7TA 3AVXA 3DOEA 2Z04A 3W4IA 3NW9A 4F6CA 3N7AA 1QRDA 5KCZA 3RRYA 1QAMA 1FUYB 4K28A 2IPNA 4YACA 3ZW7A 2H1HA 4IUCS 5AKKA 4URFA 4Y6PA 4D92A 4EJ0A 1NF3A 1LBQA 2WU0A 2ATEA 5EP1A 5C2JB 1HE1C 2MSNA 3LWDA 1O0BA 1WUYA 3EMVA 1TEHA 1FUIA 2BMDA 1PL8A 2Q3LA 4DCPA 1T24A 2H11A 4MR7A 3TEFA 5BNTA 1RQXA 3LNCA 5EXDA 4M9QA 5HJ2A 4ER5A 1K9SA 3PCXA 4BVAA 3A7EA 5AW6A 2ZT5A 3BJEA 3NV9A 2I6GA 1OYOA 2VYVA 3AKCA 1VECA 4KOAA 4GHWA 4TV8F 4XB1A 5JXJA 2JRLA 2JL1A 1Z5UA 4MVJP 3UJHA 3ZBTA 1U1EA 3SEQA 3FGPA 4G0XA 1ZUWA 3GOHA 3N2EA 2DY1A 3QUBA 4LY0A 4YREA 3RTDA 1YVRA 3AO0B 3UQYS 1UC8A 2I03A 3DV0A 1WMFA 3KKQA 4LXIA 5LP6C 3D3QA 1H1TA 3ZCXA 1RT9A 4M0KA 1K8RA 5DYNA 5G0SA 1OFHA 2YNMD 1C8LA 2ETXA 1O5IA 2H4YA 3BRWA 2FLKA 1WEKA 2JCBA 3LVQE 3GFOA 2VEDA 3CO0S 2RJ3A 4MCHA 3DEJA 4OHKA 1N2ZA 4TZ6A 4OB8A 2XNKA 4C6TA 1S6YA 4G0YA 3TJRA 4FN5A 4GKAA 3WRWA 1UZAA 4AMZA 3SX0A 1O77A 1ISJA 1E1MA 2YN0A 1B2LA 5I7EA 3ZGVA 1MMFB 2AZXA 2H4XA 3DZHA 4PQGA 3LRXA 1ZW1A 1ZI8A 1PFWA 4N0EA 5D6OA 4S3MA 4M98A 3TI7A 4DIKA 2FKNA 3SQNA 3V8BA 4HLNA 4QTTB 2OD7A 1XDGA 2Q62A 1DBQA 2R7KA 4XDZA 4FFMA 5K8VA 3HB7A 4XPIB 2GOYA 3WHIA 3HCEA 5CA1B 4ASUD 4GSKA 3SIWA 3IB3A 1Y6RA 2BKXA 1KDTA 3AIKA 2CW5A 3KT0A 3I45A 1TAQA 5G53C 1TQ4A 4D4JA 5L4NA 2A2ZA 1ANKA 3NX4A 3VTAA 3HZRA 4E88A 2PU5A 2AMLA 2QMUA 3BH6A 1F4PA 4NEQA 4RGVA 1QIIA 4D8XA 1LTQA 5J5AA 5CLGA 2WPDD 3ZE0B 4F85A 4ZZ2A 4LMAA 4TLLB 1PZMA 1QZ3A 2DECA 4K9MA 4RJ2A 3GGPA 5JASA 1D2MA 2A1UB 2Z2YA 1I6WA 2IZ5A 2ZKLA 4HQ6A 1US8B 2JB9A 2LNDA 4IIUA 3R77A 3ZNNA 4G4IA 1YJBA 1NSTA 4PC3A 4X7BA 2MYNA 1DXYA 3GUYA 3RKUA 2GN4A 1A9SA 4YHBA 1SHTX 5KYYA 1PG5A 2GCOA 3KLMX 4N5NA 3U1BA 5SZJA 1BDBA 2HL6A 4LXHA 4YQFA 5B2EA 5IVHA 4Q4AB 1CRPA 4L0QA 2VT3A 1AM4D 2XGSA 4BKQA 2CLFB 4DA9A 2PD6A 1OWPA 2QAGB 4ZC1A 5CDHA 3IE1A 3KTAA 2W8BB 4KXUA 2F64A 4WL0A 4B7ZA 4P4LA 3EGOA 4OGLA 3UOWA 4DLWA 2C7VA 2Q1SA 2R6GA 1PR1A 2GTIA 2PGXA 2PWAA 2MR5A 4FFLA 2DHCA 1NSFA 4AZ3A 4E5YA 1PNVA 2ZZMA 4CE6A 1G2QA 1J2JA 3ROGA 2VRWA 1DQZA 1U0OC 2A9PA 3OQHA 4NYIQ 4FHGA 3T1VA 3HYTA 4EUNA 6REQB 4CKEB 2ZSUA 2CL0X 1SBIA 2VJNA 4M99A 2ZG6A 3WWPA 2F1HA 4KX5A 1NM5C 2NO7A 2P9HA 3IP1A 4J29A 5BOSA 5BY2A 3U44A 4B84A 4C08A 4UDXX 2FRDA 2C5FA 5DNVA 2W2LD 3CNHA 4FHDA 5ANRB 2BZ1A 3EXHB 3C7KA 3SC2B 1LDNA 5EZYF 3AR5A 1KJ9A 2HMAA 4CM7A 3DA8A 4EFMA 3DDHA 4TKLA 4LX0A 4TWIA 1NXSA 2JAHA 3CLRC 2PT5A 1U11A 3ICQB 4TRRA 4ARAA 5G0WA 1KJWA 2QTHA 2FSUA 1FFEA 4W1PA 2X4LA 4QQNA 2JIOA 3G68A 2ZYRA 5KTMA 1WETA 4EIWA 1Z0UA 3NT4A 1QHHB 4RM2A 4YAJA 2BKLA 3EA0A 4PTLA 5BNFA 1JHUA 3MLBA 2C98A 1A71A 1SHKA 5KYVA 4CTMA 1A9XB 4OMUA 1YONA 1NW7A 3KYCB 4BWFB 4RD3A 4K1LA 2J0UB 4MTLA 3MOIA 1T4MA 2PUVA 5GWXA 1KS2A 2AB0A 4OFZA 5KAMA 3S44A 4KB5A 4QRHA 3OQNA 4URHA 2HR1A 3PVSA 2LIPA 4PBRA 2O8FB 2RD2A 4MRMA 4BZPA 2IZ1A 5JI2E 5L4SA 1IH8A 4IKPA 3LGSA 3ODGA 1VSBA 5G2OA 3MUNA 1A97A 4D8YA 4ZYYA 5C1OA 1MCZA 2EBFX 5FUBA 3S1SA 2HWUA 2BBSA 2JGNA 3OZTA 1VLQA 5FTMA 3J81k 2NU8B 1WP9A 2QUBA 3HB0A 3FJYA 3N59A 1TUBB 3ZPXA 1T2VA 2AMVA 1PWXA 1PWZA 1YRLA 4B4WA 3MS7A 2WWGA 2COKA 1NBME 4P53A 3STTA 3NI2A 2PL3A 1KJIA 1L5OA 4LK3A 4O5AA 3UUEA 3WK5A 2ZTVA 4EPTA 4GWGA 2I78A 4LBVA 4KNWA 2GD1O 3PC7A 2D1FA 3AFMA 3MJTA 4M0EA 3T38A 3V6LA 4BMVA 2WD9A 1VL2A 4ALLA 2YJGA 3KAQA 2C2KA 2OKGA 2B1RA 3Q1LA 5JCOA 4EY3A 4DREA 2G17A 1Z0ZA 3GJRA 3RFCA 2C9CA 2YJNA 3CLUC 1DJPA 3GJ3A 1B6GA 1Z36A 2A86A 3OA0A 1T6NA 3SHQA 3REGA 1T5DX 2H2HA 3T1QA 2RKBA 3FVTA 2RGEA 2D7CA 2CFSA 4YR9A 5GM2A 4L9WA 3PZBA 1F5SA 1L8XA 4RZSA 1DKRA 4H1UA 2GN1A 1EDBA 2J87A 2QBYB 3OSUA 4KV7A 3UB2A 1F06A 1JAZA 4J0QA 4U4AA 2WBLC 3E22B 1PLJA 3VR3A 4L02A 2ZUUA 2QTVB 3VTZA 2PYZA 2AEJA 4YUXA 1W93A 3HE3A 1I3OA 3ZLJA 3MMNA 3FIJA 4DM4A 4PO8A 1Y1RA 5KNBD 2R11A 3ID6C 5CFMA 1AMUA 2X0JA 4BJ6A 2QPLA 5T3YA 1YXMA 3LDAA 4WKOA 3PXDA 2Q3BA 3MRTA 3O6VA 4G97A 3OT5A 3AI2A 1TMYA 1K6IA 1L5HA 4QPDA 4U2GA 1FL9A 2C4MA 2HA6A 4JR2A 3VSCA 3VJLA 1UK7A 2XB2A 4PLYA 2I1VB 3AIMA 4B3IA 1BOOA 5EE0A 4BQEA 2QGNA 4EA9A 3CH6A 4H6PA 4AMYA 1HYQA 1PHPA 3JAWA 2J3MA 2XOEA 4NICA 3ROXA 1L7XA 5H8WA 1OTXA 1Z5VA 3W7BA 4BBPA 3DE7X 2BFWA 2DTXA 3A36A 4LYEA 2V96A 3AC0A 5IDYA 1G6OA 3C8UA 1KPHA 4YALA 1F2VA 4IOMA 2Q2QA 1QGZA 2FPPB 3UV7A 3BSSA 3MWYW 4FS8A 2W00A 3U80A 1Z73A 4AAYA 3IV9A 2C03A 4R1UA 5B4VA 5JI3E 1U0TA 2G9UA 3DVRX 4ZVNA 4REMA 2FETA 1DWUA 4U39A 2IEBA 1XNRB 2R66A 4K5QA 3REQB 4LTDA 1VZ2A 2JK1A 4LZAA 3FXAA 5DASA 5U1PA 1PQUA 3GAMA 4L7VA 3K53A 1I94B 1MO3A 2P5UA 2PGJA 3W5HA 3M4XA 1TXGA 3ACDA 3W2FA 3FETA 4QUDA 4AJJA 3G7NA 3KELA 1C9MA 4CIYA 3DZ8A 2UYQA 1T1EA 1XDUA 4B3HA 2WWVD 3MCWA 1JJAA 2DBQA 2OM6A 2P5YA 2R47A 2PDAA 3O94A 1CQIB 4RDHA 5AWFC 2VQ6A 2WJHA 4XR4A 1FRNA 2YHAA 1FNSA 1WZNA 5AUPB 3ORHA 3WMWA 1OXMA 1M2OB 2ZUSA 2QZ9A 4HYEA 2B99A 3C3AA 2OQIA 3EGEA 3EXIB 3R6GA 4D7AA 4ZTUB 4YP0A 4RK4A 5C32A 4LECA 4JBIA 4OQMA 3U4DA 3ZZTA 2INGX 4YMTA 3KZMA 3EHEA 3B7WA 5JZVA 2AQKA 5DGIA 4QJ5A 5A6VA 3ZJ4A 1QQTA 4LYJA 3I32A 2A0YA 1GTL1 4C04A 2VHYA 2HIMA 2QI9F 5EMKA 2R751 2FLVA 3OZSA 3AKYA 3GH1A 4MCIA 1JQEA 5JAQA 4HDKA 2PGIA 3V6MA 3AVPA 4XQEA 3MZ0A 5F1OA 2GZHA 3GGSA 3WKDA 4PANA 5FLXA 3R3WA 4EF6A 3S55A 2P90A 5CNKA 2GVNA 3X3HA 3FTCA 2O23A 1IQ0A 1Q83A 1QIEA 2FSSA 1U31A 2MJLA 1EJ2A 3C6YA 3DZFA 3LQFA 3QE2A 4WH0A 3DDNA 3TCNA 3GF4A 3TZLA 3E53A 5AVKA 5CA0B 3LA6A 5LQMA 5JXHA 2ZWMA 2O2IA 2P3SA 1M2VA 2VDJA 2WB4A 1VDMA 5H02A 3GD7A 3VGJA 5LDHA 4OFXA 2J46A 3HB4X 1G21A 3EZXA 4UHJA 2AV6A 3GT4A 4Y2UA 3OIDA 1LBIA 3EARA 1OYYA 3AILA 1NV9A 1HMPA 1WPGA 1KO8A 2IP4A 3PNVA 2PUEA 5IT0A 4DIBA 3H7IA 5ALHA 1AQNA 3DF7A 4GPZA 1RKVA 1BQ3A 2OGTA 2OGZA 5A05A 2DWQA 5HFNA 5HJEA 1KMMA 1JMVA 1WVMA 1T36A 4XQGA 3KQTA 3L0DA 2TECE 3A2MA 1HLGA 3K05A 5JWHA 3JARB 2HMYB 5IBRA 1W0JA 3GEEA 3WGNA 4QBFA 3HH8A 4A2PA 1DJNA 2J3DA 1NLYA 4PCAA 3LPLA 4Z9FA 2NU9B 3VNBA 4ACBA 3ZDCA 2A1TR 3BWMA 1JIQA 5F5XA 5BOVA 2RK3A 2F3RA 4AJ4A 3NHBA 4BZXA 4M0PA 4QELA 1B76A 1MNQA 4B4VA 2ZUFA 4MO2A 2HNAA 1JFFA 1P5ZB 2XVYA 1U9IA 4FILA 5DHTA 4BUJA 2CGEA 3BIJA 4BX9A 4O4IF 3JQAB 3I2IA 1DEKA 1RYYA 3GUUA 1L9KA 4XDGA 5ALMA 2Z1MA 3ZE8A 2IIVA 3OF2A 4I2VA 1WIWA 2ZK7A 2A33A 2FUG6 1YACA 3B36A 2JGJA 3S5UA 2AOUA 2OC4A 1IB0A 3DBRA 1L5RA 4RF2A 3A1DA 5A7FA 1B8PA 1V95A 1UFRA 4TMZA 4WUVA 1ULSA 3RBAA 4XJVA 1FXWA 5SZKB 3E15A 1ADBA 2X2OA 1SIOA 5DM2A 1X38A 2PL9A 2VVTA 2AN5A 3NWOA 3SJUA 4UOEA 3DNFA 4MDFA 3PJFA 4IG4A 2O8BB 3GFRA 1CS4C 1UDXA 1Z82A 4S35A 2GTHA 1ZA1A 2QL7A 1RXWA 1ONPA 2QTVA 1HE5A 2X4IA 1JVBA 4TLDA 5I7UA 1KEUA 3MNFA 4G5XA 4P5EA 4PC7A 5AVJA 4KE8A 3ZTWA 2XRZA 4WPGA 3OLWA 4EKYA 2VDQB 3QXSA 1E1DA 5DN6A 4Z0PA 2XT0A 4A0SA 4LXGA 1RJDA 1JQJC 5HYVA 2VPTA 3JQGA 4WZAB 3P9CA 3VZRA 5C5DA 5CG2A 1RM4A 2HIGA 1SQ0A 1HLFA 1DOHA 2Q6VA 4GPTA 5D3ZA 3LTNC 1Z0KA 3CNEA 1NYTA 4I1IA 3P4UA 1FJGB 5FL7A 5K45A 2R87A 4I2NA 1NUPA 2I3ZA 3A2LA 4P84A 1T8UA 2PX0A 1BX3A 3DONA 4FLEA 4MUBA 5K3CA 3BT7A 4QPNA 3TRIA 4LHYA 3ICVA 2RCNA 4HAUA 1G18A 4KIJA 3RGGA 1L1FA 4TXMA 3AP2A 2F8SA 2H48A 1NXQA 5KX5A 2ES4A 4RQAA 3JAKA 2R1VA 3AU8A 1NPDA 5TNXA 5KYUB 2E3JA 1JXQA 4GUAA 2PZMA 1PR9A 3K5IA 3ONNA 2IX3A 4MV4A 3G1UA 2ZETA 3JYNA 4HYTA 4EEXA 3OIYA 3ZV7A 4CM4A 4BGIA 4EL5A 2NT4A 2V6FA 3WTBA 3OLVA 5C31A 3IURA 4KQEA 1QNFA 2B0JA 1WO8A 1D4AA 2AKAB 3NALA 3IT1A 4LIPD 5DGXA 1X8JA 3O0DA 3N74A 5A3RA 2I71A 3I1JA 4HBGA 1FXUA 2H6EA 4YWHA 3WV4A 4EY5A 5JIBA 1T9BA 1IY0A 4BYGA 2F2TA 1UIRA 2CF6A 4WNCA 2PUJA 1EX6A 2K6GA 2V58A 4L50A 2H31A 2WFAA 5CU7A 1TJ5A 3N0XA 3M4ZA 1C9JA 5DNWA 2RHHA 5JTTA 3ZD9A 3WLAA 2ZXUA 3DFIA 3QVGB 1T43A 2ZR9A 5F1YA 5L3SA 5ALEA 3L3BA 4PXAA 2ODBA 1U63A 4CLOB 1GG8A 2D5LA 3QE0A 3GFFA 1NG1A 1UWLA 2QP3A 2ZRAA 5JCOC 3CE6A 1NWHA 1WMAA 3CUYA 3G2NA 4RUKA 1FNMA 3IALA 5J4YA 2KJQA 4ITRC 4FFDA 2TYSB 1IOLA 1TIKA 1OT3A 3V97A 1S8AA 2I67A 2PJDA 3ORFA 2LD4A 5F4BA 1VKJA 4FBGA 2H2WA 1WCIB 2A5YB 1YB4A 3UCXA 1R4MB 3BDIA 3K2IA 2QYHA 2FPGB 2PT7A 4WBSA 4YJGB 1MV8A 1ES9A 4OSPA 5AH0A 4LSMA 2PFGA 3QLVA 5IG2A 2J33A 4ZMSA 3D7LA 1VB3A 4RFSA 1BWPA 5C80A 2KHZA 7ABPA 2NXEA 3HKDA 3IIEA 2SHKA 3CPJB 4FI3C 4K8OA 1DEAA 5H7XA 5TS2A 2AOVA 2PE5A 4GOJA 3DJFA 1CLUA 1JEEA 1ZX1A 4GM1A 4I9FA 4QX6A 2E4ZA 4PG6A 4H77A 4X93A 4DW8A 3IP5A 4IGKA 2RI0A 1WHTA 3A6ZA 5K3AA 2WTAA 4BGUA 5G0UA 1C9YA 5HOQA 2Y9MB 4WN3A 1D2CA 2YCBA 4UXHA 4JI6B 3WGVA 3BVPA 3ZWWA 2CXSA 2R68A 2ZE7A 2F1RA 3ASUA 3O7MA 3PDHA 1R8YA 5JCPA 5FDFA 5DK6A 2G8NA 3P0JA 3ZU3A 3I0ZA 4AX8A 1D07A 4HI0E 2GFHA 5TE9A 1R8QA 3KQUA 2JFGA 1HBJA 4QGGA 1I13A 3VZPA 3IQFA 1AK2A 2P9EA 2XMCA 1ZO8A 3NXKA 3EF1A 4AJ9A 4U9HS 4UHBA 1KJJA 5FEMA 2GPJA 5JYEA 4ZICA 1MQSA 1RMQA 5EERA 5IP5A 1OVGA 4D4KA 1JE0A 2XPCA 4UQOA 2GEJA 2RHJA 3BKWA 5EZ6B 4DCCA 5HUQA 2DM6A 3U4HA 1R15A 3ZK7A 2YBEA 2W2PA 4I4TA 2HKIA 2UZ1A 2FFBA 3KCQA 1Y4AE 4IRXA 5KQLA 3D31A 2IS1A 5EXXA 1P7YA 3IUPA 1K6MA 2RARA 3Q3HA 2OSBA 1P1IA 3LC0A 5DRYA 3FLBA 3M4JA 1OCEA 5EHIA 5AK0A 5KJFA 5KIAA 2QQEA 2Y0BA 5AKZA 1DRUA 2DR0A 2OBFA 4G26A 2GAAA 1NY5A 4CKCA 4DMCA 1AKVA 3O75A 3DF9A 4YP6A 3EIFA 1S9HA 3QI7A 4A82A 2ZCJA 2V74B 4WVLA 2Z6QA 4Y2RA 4HQRA 3T54A 2O5CA 5AK6A 2I34A 4J0JA 3PXXA 4ZT2A 3ENWA 4NX2A 2YOFA 2E6UX 1DT3A 1ATZA 1RJ9A 4Y0AA 4HWRA 5ERYA 2XCQA 4MCAA 3PR1A 3P5SA 4IM7A 4OI2A 1VBNA 4ZDWA 3WWCA 1ONSA 3JQ6A 4IUBS 1T3ZA 1LLFA 5EGNA 2ZB2A 5BSEA 1YDGA 5TT1A 4KQGA 3KETA 4W82A 3LK7A 4Z7OB 4FEEA 1SVOA 1DZ3A 5FUQA 2AH5A 4LZWA 5LQDA 1ZONA 2DAPA 1XCOA 1HYEA 3KYDA 5FOSA 2HPHA 4E94A 3HZOA 3HHEA 5I51A 3H8VA 2F62A 3VGPA 2ZSBA 3HP7A 3OMXA 4MB0A 1N2CB 1Z8FA 5TMPA 3DO5A 2VP3A 3LXRA 1PR6A 2BE9A 3QQPA 3FHJA 1KMHB 3GCXA 3PLNA 1PWHA 2TRSB 3G8YA 1PTKA 2VQDA 3HFJA 2IHTA 2W71A 4MPPA 3DCNA 5PNTA 2LR0A 4HNAA 3B1KA 4GPEA 1ODKA 4Z1OA 3DQPA 5CAEA 5CB4B 3NVAA 3JASB 5A2GA 4B4UA 4MB6A 13PKA 4B31A 4WBNF 1CUFA 3L0BA 1GTVA 3N8GA 1KS9A 1W19A 2QQ5A 3CSDA 2R6CA 3G2KA 1Z3IX 4QDJA 1ZCBA 2JAXA 1TVCA 4I1VA 2V7GA 1RYHA 2W6IA 3GDOA 1ZPDA 3CQ9A 5DNAA 1GNLA 2MMCA 1ZIPA 3PFIA 3JYOA 5LD2B 5I4KA 3SDSA 4N41A 5BRJA 3P94A 3K3PA 2XT9A 1QO0D 4G0PA 4L28A 1E2GA 3MAGA 3GO4A 3U31A 2B3TA 3PHLA 5COBA 3V2UA 4LGMA 5ER9A 1QE0A 3SF0A 2HO5A 3ZUPA 1USWA 1XZQA 2DT5A 3NOOA 3LOPA 2FG5A 5AKEA 1DEOA 4TUYF 3UAGA 2BMVA 4UHHA 4BLOA 3AHJA 2CMDA 1RI4A 2GN9A 1Z0JA 1MVOA 2OHFA 3OAAA 1PEAA 4LYGA 3CN9A 1P0PA 3DPUA 2XUQA 5TLSA 3ZWPA 2QV7A 2VKQA 4N5IX 3G9QA 3PHIA 2A4MA 4RLHA 4MAAA 3BXHA 4NBUA 4ZVOA 2NOAA 2ONYA 2WOOA 3RV4A 2OD2A 4ETMA 3SWWA 3ANNA 4FYWA 3VC1A 3JD4A 3KQQA 1MX1A 3NWEA 1HL7A 3KXLA 1HEYA 5JDIC 5J2TB 4JV5B 2FPSA 3FTEA 2Z4SA 3Q72A 4PINA 3KVOA 2IDMA 3PTZA 1W36D 3EDRA 4IDFA 3C14C 2PAAA 3FSGD 4L4YA 4C0QC 2GLXA 4HNVA 5T41A 1I7DA 4QATA 1I1NA 3MMSA 3NU1A 5SZIA 4JB3A 1IXZA 3ZWVA 4OQ4A 4D3YA 3RROA 4AF8A 1LF5A 2UKDA 4RPGA 4EYSA 2W6PA 2Y1XA 1M0WA 3EIWA 3D6AA 4KYIB 3UK2A 3SQWA 2DFPA 4WESB 4EG1A 1CUZA 2WU8A 2JJYA 3AEUA 3WGLA 4DG9A 3MQ2A 2WU1A 2ZT6A 3P4XA 1N33B 1QLHA 5BYBA 4BO1A 3U81A 3ET5A 4JZKA 2EJBA 5CD1A 2X0EA 2YUIA 4KFRA 1XZPA 3CH4B 5IYZB 4IWNA 2C8JA 2HOQA 2VJKA 3UT5B 4GM0A 4D4MA 4EG8A 2O59A 3OCYA 3AEKA 4A3SA 1G3MA 1Z47A 3P71T 1E1CA 4KQWA 3S99A 3T95A 2FX5A 1DRWA 1N2BA 2XUDA 5DOZA 5LB2A 3PS9A 1QHFA 4L4ZA 2H9YA 2VUHB 2FFJA 3HDQA 2BMJA 3TUZC 3BF8A 3IUNA 1P3DA 2B21A 2XB4A 4KRGA 5HIJA 4RVFA 1KEZA 4L1KA 3MERA 2H1RA 3QF4B 1NW5A 3KVNA 1IK4A 3SD7A 4DIOA 5KJ1A 1QOQB 2J7KA 2R1ZA 3GL9A 1VDZA 4FKBA 3R2JA 3X0DA 4H60A 4P22A 4L75A 5LPNA 2BFCB 1P77A 2VI5A 3OKCA 1JU4A 3DMTA 4ZRDA 3MT8A 2IYYA 3L4JA 2HUNA 3C8HA 3TPZA 1W4CA 3D02A 1T9KA 1L5VA 3BCHA 4A8JB 2EIHA 5ES3A 4X65B 1VJCA 2D6FA 1GZ3A 2VUIB 2WP8J 2BOVA 1SCIA 4X71A 5F77A 5JATA 2SKEA 5TJ9A 1RXSA 3I5AA 3VRHA 2FMHA 2QT9A 4WOPA 4CFZA 1O9HA 3GLIA 1Q1QA 3GUCA 3LLVA 1LVGA 4OSEA 4NBRA 3NNNA 2ORIA 2RBEA 4C2BA 3MG9A 4JB0A 3BJRA 4BHTA 4G09A 5HKAA 2VF2A 3LQ1A 4YP1A 3F1LA 4UUBA 3KSAC 1U9JA 3IUYA 4I8IA 5JQWA 1TKRA 1K8ZB 4KLAA 3ZWQA 2RFLA 2RHWA 3MMPA 3NHAA 1V8FA 3QELB 1LS6A 4LXXA 4IR7A 3KQLA 3ZG6A 2VTEA 3CNLA 4ZQIA 1IM8A 3A1UA 1SM4A 3OHMA 3EVEA 2E0IA 2I4MA 2JIBA 1OVMA 3H65A 1EK2A 5CGQB 4QXMA 5TF4A 1QYWA 3RH0A 3ZYZA 4JL5A 4L7QA 3MTJA 3WGOA 2PXCA 2H4ZA 1FDVA 1YD7A 2QL5A 4ROTA 2PD3A 1VL0A 4TTQA 4I66A 4W9NA 5IPFA 5LFAA 1XMQB 4PO9A 3LDFA 2WWHA 2FW7A 4FMCB 1OF1A 5AJXA 3C1AA 3UW1A 1Y8QB 2AA3A 4B2YA 2BFOA 4PN7A 3O8OB 3R5JA 3R7WA 1GILA 4ZVTA 4ZCRA 5C1BA 1I5OA 1QS0A 5DX0A 2VH2A 2WICA 3R7BA 4UNPA 1CS0A 3V80A 1O96A 1XCBA 1Q2XA 2Q9BA 4PHGA 3ZE1B 5JAPA 2QLNA 5JZBA 2GCGA 2EFYA 1EG2A 4KQ9A 1OH7A 1N6IA 4AXXA 2XE7A 3L04A 3UIEA 3IEXA 3QLEA 5L3SB 1YASA 1U28C 3BD6A 3F6CA 4FW8A 4JY7A 1DIAA 3B8EA 4Z6KA 1XAGA 3SHTA 1ZKDA 2CLLB 1TO6A 2PLWA 2V7UA 2WZCA 3COZA 3NH9A 3WDLA 3DKKA 2GYYA 1M1ZA 3AF6A 5FO0A 4OXYA 5BRNA 4AZ0A 2XCRB 3H97A 5KPDA 2CD7A 4HDQB 3U60B 1GY8A 1Z9BA 5FT9A 1JILA 1ULUA 2QTGA 3NHSA 3LWZA 2ILVA 4G8BA 3G85A 4IRUB 4RV9A 3PVCA 1YU9A 2G4VA 3QMPA 4O3MA 1KZ7B 1R0LA 4AG5A 5IHPA 2HTFA 1FVHA 1UC5B 3FSJX 4DDWA 3HM2A 4WSOA 2WC1A 3X1ZA 3RSZA 4JLMA 1HT1E 1XA0A 2B92A 3KR9A 4DNPA 1A9RA 1E94E 1CUXA 1PGNA 1Y8RA 2J6HA 2WAAA 2YICA 3DFMA 3RB8A 4PX3A 4DIFA 1KKLA 3AIIA 3BKXA 4UAGA 2X19A 3NZEA 2FSVC 2CL6X 2Z3ZA 2I8CA 1JGTA 3H05A 3C3XA 1C3OB 3BFKA 4EENA 3W2EA 1DUIA 1C7QA 1G1AA 3MK31 4GZ5A 2G5CA 4F8EA 3SEAA 4V2IA 4YN3A 3WY9A 4LKOA 3TL6A 2PKRA 3UB3A 4DB2A 4FHCA 3EGIA 1FP4B 2NIPA 2NO5A 2R62A 3TX6A 4UJ3A 5CA1A 3R09A 3CEJA 1KI4A 5FWXA 2OCAA 1B23P 4UTPA 1T0JB 3CZ5A 2VFAA 4M8LA 4CRWB 4Q4HB 4J2TA 4J3FA 4LVUA 2I2FA 2AMJA 3CZCA 1TO1E 1ZC4A 3UKJA 5E3IA 4GBED 2GF0A 4RWEA 3I0NA 2VYCA 2DULA 5AJUA 2UYHA 4Q1FA 3W3AA 2PA3A 3UMGA 3K4HA 3QFSA 3DBRB 3GLHB 4WI1A 2VK8A 3WFZA 3IJ5A 4UTXA 1ZS9A 3NP9A 4IINA 2HEIA 4D46A 5DFAA 1B73A 2GPTA 3LKBA 4BXOB 3F5FA 2ZJ4A 2YHUA 1M7HA 3BEDA 4CG2A 4M1YA 5T64A 3USES 2XRFA 4M89A 5B36A 3L7LA 3B6MA 3FLAA 4F2WA 3GJ0A 2J0QA 4LE0A 3BD7A 2J5RA 1KI9A 5JSYA 4QEKA 2XTZA 4Z4GA 4NBTA 3KU4A 2QZPA 3S28A 2QB5A 2YQZA 4HDNB 4K6HA 3U39A 5C8ZA 4LXUA 1Y37A 4FNAA 3FE2A 4NYMQ 3WYBA 4DBLE 4RIHA 1NI4B 1SVWA 1A04A 3A1SA 4YJKA 4R4JA 3KUKA 4KPUA 2FUNB 1Y5NA 1Z88A 5EE5B 1JPVA 3V8PA 4RCVA 2HHAA 4FZ3A 4MDHA 4CTJA 9MHTA 2VZLA 1YHYA 4CFYA 4M1QA 4OA5A 1N2SA 2WIKA 2ZTLA 3OQVA 1ZNWA 1AURA 1V1MA 2Z8XA 3QFCA 1YRHA 4WV3A 3RRZA 1N57A 1X8LA 4IZ6A 4U7JA 5LOVA 1ZIXA 4GSLA 3JRWA 2WFLA 5A9SB 3D5QA 1S8OA 4BO8A 5CNJA 4BX3A 3NNDA 2GBGA 3UMVA 3V42A 1RZ3A 4MQBA 3UXMA 1TM3E 3OJCA 2P7HA 2CVHA 4QEZA 3RS4A 1Y6QA 4MGKR 2GUWA 5AVYA 5FOXA 3MW8A 2WYOA 3OVMA 4BB9A 2QTBA 1G20E 1VQ1A 3NUQA 3EZ2A 3VZQA 7AT1A 2VBCA 4B3GA 4R9UC 1E6KA 1QANA 3UMMA 1K1EA 4MICA 1XPUA 4R9VA 1EVYA 4LJYA 4BJ1A 2XVMA 3GZNB 1Q7GA 1WPXA 2PUTA 4JBXA 2HQOA 1M54A 3EE6A 5C7OO 4HGOA 2P75A 3B6IA 4N18A 2BTEA 2GJSA 1NXVA 4HSEA 3E23A 5KEIA 2UYCA 4E4TA 2NNLD 2M6RA 4L5JA 1TLFA 2H2DA 1VPEA 4M37A 4TXLA 4HT3B 3RSFA 4L2IA 4UCFA 1FQOA 1NAIA 1W87A 1PGQA 3W8NA 4MGEA 4WBNA 3L82B 4DUGD 1NVVR 2CJYA 2VWGA 1KO5A 1N2OA 1NVGA 3HJGA 1Z5OA 3OPYB 2PJZA 3ROKA 4CM6A 4N3NA 3PLAE 1KI6A 4RS3A 4PX2A 1NHGA 2ZWPA 1OH6A 4BE9A 2KBFA 2DUMA 1FTWA 4CLEA 1H4TA 1SXJB 3CUKA 3L7MA 4O63O 2P9FA 5HF6A 3AONB 1XMIA 1VSQA 4RY0A 2E85A 1FDIA 2X6QA 3K4PA 4WOKA 5TQ2A 1AZWA 3AZQA 3TTSA 3W6NA 4YMWA 5L7YA 1FFYA 3WJ2A 3ZHOA 1PE0A 1CUJA 4AMUA 2B7BA 4PQYA 1LSJA 1XWIA 4ONEA 1DC6A 1Q3TA 1TF5A 1W2HA 3N0TA 4PWYA 4UM8B 5DTJA 2IY7A 3ZE6A 2A30A 2YRWA 4OUDB 5ALPA 5HW0A 1YQWA 2AG0A 1JB9A 3U4CA 1QJCA 1E3WA 1IPHA 1X9GA 2VDMB 2WWRA 3KWJA 4C89A 4CN8A 4DJAA 4F6RA 3CH7A 1UXKA 2WVGA 1K27A 4UNIA 1RXIA 3QHAA 4A5OA 1Q2UA 4RGBA 1J06A 5F2NA 1EXMA 4QOSA 1GU7A 4IO1A 4XUGB 5K3DA 4CV2A 4HGRA 4CKYA 1JR3A 2CLKB 2P2CA 2J59A 3P0FA 1VKRA 1KEEB 4PPQA 3SJAA 2JAPA 3G0BA 4E2ZA 3BMNA 1C1YA 4YLYA 3EOAI 3TCXB 3BE5A 3LQQA 2D54A 2PZLA 3GRPA 1EHYA 3SXUB 2AXNA 1TU0A 2RHDA 1R00A 3K9GA 1LLUA 1GUAA 3U3OA 4DZRA 4PBTA 4F2HA 1UWCA 3DDZX 1PUJA 3LM8A 4WK6A 2HY7A 3GWGA 3GEDA 1Z2DA 4JIGA 4BNDB 1E2UA 1GFSA 4G0WA 3EN0A 1N9KA 2PBFA 1SULA 1G6HA 3C6XA 3FYUB 3K9WA 4D97A 5EJGA 2IODA 4B48A 4NYJQ 4FE4A 4A4DA 1S9DA 1I10A 1ZCFA 1C7ZA 1R8SA 1G6KA 1P6UA 1MV5A 1YC5A 1YE5A 2AE2A 3D4LA 3HLKA 4JVNA 1XTJA 3I6ZA 4BP8A 5AW7A 2ROQA 3EQZA 1AV6A 3KPUA 1NDUA 1YS2X 1VL1A 3EQ2A 2QLMA 3DLPX 2C78A 2GPAA 5F7JA 2XB8A 4YRCA 5FR1A 1F14A 1MX3A 5AHRA 3CXUA 3CLRD 3GAAA 3JQ9A 4WOBA 3UK1A 2E9SA 4JJKA 5KHLB 1UFKA 1W5SA 3H3FA 5G0VA 4QDKA 1M0TA 2BGGA 2LV8A 2XTNA 3TKYA 4UM9D 3PI6A 1E60A 1EGQA 2R8RA 3NKVA 3PWSA 1F20A 4DLUA 4HMPA 1ORIA 1YL6A 2CZGA 1T5HX 4K6OA 4C4ZA 1XEWX 3KR1A 2EW1A 2WJIA 1Y3DE 2FRVA 2B36A 3KZNA 3TQRA 1N5IA 3QXCA 2I87A 1UEIA 3QPAA 5E1MA 3PFKA 5AK4A 3TG8A 3EEBA 5HOEA 4GE0A 3O47A 4L6AA 1FMLA 3AFNA 1JQBA 1S8NA 4K88A 1XLVA 1NVEA 1L8QA 1YDHA 1XYGA 2J31A 2JBHA 1UMCA 2VHUA 4K2AA 4M0FA 121PA 5IBPA 3RANA 5JCXA 3QVWA 4EKGA 1XZGA 4B6GA 1MAUA 1OXXK 5DX8A 2GJ4A 3WIUA 1TADA 4ARSA 3L41A 4E31A 1U7UA 2ZGVA 2NU8A 3L0CA 4ZYLA 2M6LA 4FDMA 5KNLA 3VNRA 3TMAA 1Z6ZA 1ZRSA 1LPMA 1XJ0A 3I1FA 3AU9A 3L40A 2QK4A 4Z2AA 5DULA 2F1IA 3P9XA 1BA3A 2B3DA 5H81A 4LPSA 3WLNA 2Z1DA 2NUPB 2EZ4A 3PTLA 3LFTA 3GRKA 1HTBA 5EVJA 1JPJA 4C4SA 1NBIA 2FZKA 5BPFA 1EUYA 1H85A 2X0NA 5IVDA 1M8GA 4MWSA 4LOJA 3ZJ5A 2RKOA 5DXAA 2XWQA 1RJEA 3DHVA 3TAXA 1OILA 1GPYA 3DQQA 1B41A 4F4JA 3RUEA 5IWCA 1I0IA 3A32A 3Q41A 3MSXA 4G6ZA 3TVTA 3UWDA 1IMOA 5K0ZA 1YR7A 1BYUA 4N40A 1PAUA 2BHTA 3ZDFA 2YY5A 4FIZA 3ZV6A 4IV8A 4JYBA 1VZ3A 1Y7IA 3CNBA 3QBTA 2YJZA 4HB4A 1KRWA 2GF2A 1ST2A 4RZ2A 4Q3KA 2ONJA 3B6ZA 4UOQA 4ZI7A 1P2FA 4BE4A 1A4XA 3ONWA 1BHSA 4W8OA 4WLEA 3FI9A 2IL1A 1GR1A 3PCTA 3UVEA 5B3JA 2V54A 4N7BA 3RK4A 1KBQA 4UUPA 5J58A 3AVVA 1LC0A 5EIAA 3FRJA 3TW8A 4W99A 2WOJA 4TKZA 3GLIE 2I99A 3O5AA 3WIEA 4A6DA 2JFZA 3L1HA 5G1NA 3KS9A 1IY8A 3MPOA 5BPHA 2BGIA 4FB5A 3K0HA 1NFQA 3GJ7A 3DP9A 5AM4A 1J00A 1X3SA 1IHUA 1C9EA 2XKBA 4RANA 1T9ZA 4X8LA 2W98A 4JMPA 4L57A 5A7HA 1P61B 2XUHA 2R2AA 1I33A 4GEGA 4HGQA 3MM4A 1DU4A 4EHLA 3BBPA 1Q0QA 3T7KA 3B1VA 3I9JA 1WQ4A 1HH4A 1P33A 4HCJA 2NQ8A 3HADA 4ND3A 4MQ6A 3GXBA 1OKKD 4PRZA 5D1NA 1H1DA 3RVLA 5FTLA 3ADKA 1R3UA 4AS3A 1AVTA 1DBSA 3BWVA 3TRDA 2O8DB 4MW7A 1VMIA 4PV7A 4XB6B 2BE7A 3UN1A 3FY4A 5KQRA 1ECJA 3Q3EA 1G5QA 1A7JA 2OAP1 3RBXA 3WIBA 4HQKA 3A3YA 1U5BA 4H16A 2BMEA 4RTOA 4BLRA 1JIVA 1YRBA 2HA0A 4BPBA 5WRFA 3I0MA 2FFHA 1UKEA 2F48A 2RG7A 5CT9A 4ZT3A 5I7HA 3A6FA 2JLZA 5M29A 4DN6A 4O4JA 3OQIA 2P2SA 4PSKA 1PQPA 1SU7A 3OLZA 3WL4A 1H93A 1CNMA 3M82A 2C99A 2GGSA 1DAMA 2NUTB 3QSYA 4COOA 3B53X 1W4LA 1E3EA 1K88A 3DKRA 1Z8DA 4C7OA 4YP9A 1RWNA 1COZA 3QUCA 3WK7A 2WSYB 1M1YA 4ZEOA 3DG9A 2FWIA 1F2TA 2ZS7A 4JXKA 5EC8A 1JHAA 1AHIA 3NEAA 4Z9YA 2E4YA 3C7CB 4AP9A 5FKJA 3PSAA 3VC7A 1KI1A 3HNRA 1KSHA 1I1HA 4PZCA 2IHVA 5DN9A 1A8SA 1KZ6A 2QLFA 3ZGNA 5DI9A 1Y8RB 1QIFA 1H69A 3TXXA 5ALGA 4ANFA 1T34A 1DQYA 3QBJA 4MW4A 4W6QA 3S68A 3OT1B 4EI8A 2GXAA 4OJKA 1E3QA 1QFSA 3A11A 3EVDA 4V1CA 1G3RA 3B20A 3AR4A 2QAJA 5E2AA 2Q9AA 1SMKA 2ZYSA 1XD2A 1J9GA 1U0EA 3KYBA 1Z8NA 2O4UX 3MQFA 4E1AA 5CBPB 5KQPA 5MGNA 1OZAA 2JATA 3N6XA 4UC0A 1KDOA 3PYMA 4MROA 4ZVSA 2C97A 2CFOA 2BFBA 3NUZA 3K09C 4K6GA 2XCTB 2YVUA 3GV0A 1RCTE 1NLMA 5ALIA 4WNAA 1LB1B 2QG4A 4NZMA 3R7AA 2J4FA 1I3LA 1QYIA 4E2XA 5IHXA 4MPTA 2OQVA 1PYOA 4PYKA 3WV5A 1T6BY 3T5BA 3E2IA 5I5EA 4S2UA 4C0JA 5JLAA 1H2RS 1LS1A 4KGZA 1OLXA 1CLEA 4L85A 4D3SA 4KR2A 1VP3A 5EJ7A 5KSYA 4DG5A 1E69A 4BV9A 4GZ3A 1QQ6A 2H8KA 5HRAA 5I3ZA 4BMZA 3R5SA 4DOMA 3UGJA 2UZAA 3SK0A 1Z7YA 5EIBD 4CTNA 5JRDS 3AP3A 5JVDA 2PRJA 4F3TA 3EDQA 3HXMA 4ZTBA 4BO0A 5A1TA 1LBSA 1NN5A 5CLFA 4E12A 3I37X 4J0FA 3RYFA 2H4FA 1V3VA 1GDHA 4LW8A 4GZLA 4P32A 5E8RA 1HZJA 2NPIA 4II3A 5ED0A 1Q77A 3VTKA 4DAOA 4ENRA 5T67A 3IAEA 1FU8A 1XLTC 1XTZA 1XL1A 4B9AA 4H27A 4DYVA 4CKWA 3U16A 5D7BA 2ISSD 4J76A 4BC0A 4KSYA 3ZS8A 1YU6A 4U7TB 1M1XB 4ACAA 1YCFA 4P80A 2HK6A 4CKBB 4NK4A 4S0XA 3VX3A 2HWYA 1ZM2A 1BKSB 2KI5A 2GSWA 3E3OA 3CG4A 1NIPA 1TPZA 5J63A 5A4MS 1ND6A 5HR5A 5FBLB 4Z5XA 5HZGA 4ZALA 1NBWB 1P91A 3MF4A 1JSCA 5KNBH 1P19A 3EGCA 5L7WA 4G81A 5L3RA 1ODLA 3I2YX 2X77A 3KYCA 2H5IA 1JW9B 1ZY2A 2AOWA 3OH8A 1WNTA 2NU6A 3MWDA 4F4CA 1NXXA 1QSGA 2ZJ3A 4UEJA 4XVQA 3ILYA 1BAPA 1FSGA 5AVSA 1BG6A 1O58A 2DFVA 2HRDA 3SVZA 2X7JA 2RH8A 3BMQB 1XZJA 2FRDC 4EHIA 4JVLA 1ZM3A 2O05A 2WUGA 2A58A 4ZQEA 4B33A 4E5PA 4O4HA 1IULA 2I2BA 1RAFA 5CG1A 2AGVA 1BCSB 3AXTA 3Q4GA 4QHSA 1J5PA 2H4JA 3ZWYA 5JC8A 3CGWA 1LSOA 2YRFA 3FPLA 4BQIA 5FJIA 4H1WA 4G0MA 1XN4A 4Z51A 4ILKA 4MJ3A 2ZUWA 1PYDA 3RR2A 3D3EA 3M4YA 4AUEA 1N7JA 4A9AA 4LWZA 4RV4A 3P7MA 4YJ3F 2DTDA 1CUSA 4YCAA 5T8KC 2ZUCA 2VHWA 3DR5A 4BNZA 4BMCA 2QTMA 3RIXA 3QQ5A 4GOLD 4CKEA 3NMUF 2Z2IA 1QTIA 4J9UE 1CRLA 3HACA 5HMLA 3UAYA 1NVKA 5BN3A 3PEEA 1WW2A 2ZBPA 1WUJS 5DIZA 1N5RA 3S27A 4AJKA 3KD3A 3B7PA 4DY6A 4UHEA 2BD0A 2L17A 2WEKA 3MFQA 2BT4A 2DKOA 2O0JA 2GAOA 3U7RA 2PA0A 2X9QA 4XWGA 4PN3A 4YRDA 3VHXA 4LF5B 3QKSA 1JFFB 1RACA 3BB4A 1JQ3A 1I2CA 2M6SA 3FAKA 2X9GA 1PK7A 3A3OA 5TS3A 4CIVA 3AJAA 2OK8A 3VNSA 2PH3A 4YUWA 4LQDA 3WI7A 2WMNB 2IPAB 1KH1A 2QRNA 4YK7A 1GJRA 5C8VA 1ODCA 1FRFS 5F12A 1FLDA 1G5TA 4FYJA 4FSXA 1DJOA 3RC2A 4NARA 1B6SA 4N8EA 4DKXA 5BR7A 2QVXX 4F5YA 5F73A 4UD2A 3H17A 3BWXA 5AQEA 5BR4A 2H1VA 3HGQA 4YMUA 3D3WB 3NT2A 4G63A 2CYAA 2NXJA 4BKRA 2GN0A 5FXMA 4DVJA 2ZJAA 1VE7A 2ASVA 4R3WA 1P75A 4BMOB 4R6XA 1ILEA 2I9KA 5TQ0B 4QTUB 1WQ1R 1V4NA 4R2HA 5JAUA 1PEKE 2PMEA 4ZN6A 2C84A 1KQGA 2YJ5A 2OMEA 5ECDA 1ZUD1 3BL8A 3NTVA 3GBSA