2IDKA

Crystal structure of rat glycine n-methyltransferase complexed with folate
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
291
structure length
277
Chain Sequence
DSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSKDITTSVLTVNNKAHMVTLDYTVQFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine N-methyltransferase
publication title 5-methyltetrahydrofolate is bound in intersubunit areas of rat liver folate-binding protein glycine N-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 71
structure length 277
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 2idkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2idkA02
3UWPA 3ME5A 5C0OE 3VC2A 3FUWA 4GOOD 3CBGA 1P39A 3DXZA 3MGGA 5MHTA 3GGDA 3JWHA 5FWDA 2HTEA 2AN4A 3A4TA 3KPYA 2AOWA 3R0QA 2PXCA 1V39A 4OQDA 5K0JA 3HVHA 2H00A 5HFJA 4QVGA 1DCTA 3OE4A 4DF3A 3FRHA 4GC5A 3TPZA 3OZSA 4IWNA 3VSEA 4YUZA 1NT2A 5CVVA 1Q0SA 2BR3A 3DOUA 4GQBA 3TKAA 2JHAA 2KW5A 4AZSA 4EKIA 1N7IA 4EKGA 4F85A 2DULA 1DL5A 3UJBA 3OZTA 2FK8A 2G8NA 3DULA 4GEKA 5E8JA 5F2KA 2Z6AA 4DA4A 3QV2A 1JQ3A 1G8AA 1M0EA 1JQDA 1O9HA 2XYVA 4KDCA 1XDSA 4O29A 4HTFA 3PFHA 3GWZA 2JG3A 3Q7EA 4R6WA 1L3CA 2FYTA 5EMJA 3GIWA 4PONA 3AWIA 1F3LA 5EMLA 1JTFA 3LHDA 2PV0A 4X61A 1NW5A 1JR4A 2ZWVA 2FCAA 1L3BA 3G5TA 5DPMA 1R18A 4MIKA 4PINA 5E1DA 2PX2A 3NVMB 5E1OA 5CUQA 3HCBA 1X19A 3UBTA 5DTQA 3HNRA 4FSDA 1QZZA 2GB4A 5CVEA 2PX5A 2P41A 4IV8A 4E33A 1XDZA 4HGYA 4RTJA 5GP1A 4QVKA 2AOUA 5G02A 4P7GA 5E9WA 1RJGA 3EVAA 5FQOA 1L9KA 4A6DA 4RTNA 1SQFA 2BM8A 5EKUA 3G8AA 1WG8A 2BM9A 1JTEA 3FRIA 3M6XA 5KQRA 4KWCA 2B78A 1TW2A 3TM5A 3SSMA 3FPJA 4DMGA 3GU3A 3IEIA 1JSXA 3LBFA 1QAOA 3KQTA 3O31A 5GINE 1R74A 4KW7A 3PS9A 4C03A 4LG1A 4OBXA 1XJ5A 4PYKA 4RV9A 1O9GA 3AXSA 4HRAA 5T6BA 1Y8CA 10MHA 4E32A 5E1BA 4YUXA 2PVCA 5GIPE 3FTFA 4WXHA 2PWYA 3PB3A 2JH8A 3OFJA 1SVUA 4E2XA 3G7UA 3C6MA 5EMKA 3OFKA 5EPEA 3TQSA 5DXJA 1G8SA 3B89A 3OU7A 5DWQA 4RTPA 1YB2A 3C3PA 4MTLA 3Q87B 5DT2A 3K0BA 3BGDA 3IHTA 3G89A 4R6XA 1MJFA 2ZCJA 4P7JA 3TRKA 4L7VA 5DTMA 1XXLA 4PWYA 1RJDA 3P71T 1KPHA 1SUIA 3LSTA 5C1IA 4HGZA 2YX1A 4PCLA 5BW4A 4RTOA 3EPPA 3P9KA 4OQEA 4M38A 1NW8A 1KXZA 2JJQA 3EGEA 3MCZA 5CVUA 3UJ8A 2P1DA 5DSTA 5LSAA 4XUEA 1TPYA 3A27A 4BLVA 3MCTA 3M6UA 1X1BA 1VP9A 3U81A 3LKZA 4RTLA 2O07A 1AQJA 3P2EA 1JSZA 2V74B 2R3SA 4F86A 2IH4A 3DTNA 1TW3A 1X1CA 3UJDA 3NMUF 2G70A 4V0RA 2O57A 3FUVA 5KVAA 3UA3A 2XVMA 3KQVA 3CKKA 4MHTA 3A26A 1P91A 2UYQA 2WK1A 5ERGB 2YXEA 5HEKA 1R8XA 2C7RA 1WY7A 3CJTA 2FK7A 5LQAA 3FTCA 5DM0A 2OPBA 4QTTB 2ZSUA 4C04A 1WXXA 1EQAA 2YXLA 3G5LA 4LWPA 3OPNA 2LD4A 3KPVA 2OB1A 2P8JA 3FPFA 4P7FA 2NXNA 2NXEA 2PLWA 3BWYA 5DRTA 3I5UA 4K6MA 3DXYA 1NKVA 2GLUA 5ICCA 2FPOA 2OXTA 1O54A 3B3FA 1KR5A 2NP7A 2AOTA 4EMSA 3G88A 3FZGA 3G2PA 3R6TA 5ICGA 2IDKA 1BKYA 3EVZA 2ZBQA 1HNNA 4RYLA 4A6EA 1YF3A 3DLIA 2EJUA 1ORIA 3P8ZA 4QQKA 2PT6A 2P3LA 3KHKA 2P40A 2IH2A 2YQZA 1FJXA 3C0KA 2NP6A 4YV1A 4WVLA 1ZG3A 3F4KA 1RI5A 1Q0TA 1YZHA 5IH3A 3FPGA 1NW7A 1G55A 1F38A 1RI2A 1VP3A 1NV9A 2JHPA 5E2AA 3EVEA 2I7CA 2OKCA 2AOVA 2QRVA 3LCUA 1AQIA 1L3IA 5HILA 2DPMA 4LWOA 3SR4A 3GRUA 1YFLA 2XYRA 4FR0A 3M6VA 3BUSA 2A14A 4RVDA 4PYJA 5IKMA 4GOND 3NWEA 3JWJA 2IP2A 2CWWA 3CVOA 3NDIA 3GRRA 3HEMA 3KR1A 4JXJA 5HZMA 5K03A 1WS6A 2G1PA 4V0QA 2P7HA 4RVHA 1IY9A 2AOUB 3BKXA 2EG5A 2B2CA 5BW5A 4DCMA 3B3JA 5DLYA 2ONYA 1JQEA 5JR3A 4XUDA 3BWMA 4DCGA 4P7KA 2PX4A 3P2IA 3ER9A 4M36A 2ZBRA 4AZVA 2EJTA 3MQ2A 3HA7A 2P3OA 2O05A 3LDGA 5F2NA 4U7TB 4RTSA 3SSNA 1VBFA 4CXMA 4QDKA 2JHCA 1PJZA 2AVDA 4FSXA 5C9ZA 3PX2A 5K0FA 3GO4A 3JWIA 3HCDA 5DM1A 2P7IA 4BLWA 3O4FA 5FADA 4Z2YA 2C7QA 3DMFA 4R05A 2AOXA 3OCJA 3EEOA 5FHQA 5CIYA 1T43A 4CTKA 3SGLA 4UOEA 1XVAA 1U2ZA 4AZWA 3CCFA 1D2CA 3BWBA 3KQMA 1QANA 1X1AA 5F2OA 5HIMA 4BY9E 5LR6A 1X1DA 3AJDA 2F8LA 5K8VA 3KR9A 2FHPA 3PTAA 1XTPA 2JH9A 4BP1A 2HV9A 1KYZA 2K4MA 1XCLA 2GAFA 4XUCA 5T67A 3BWCA 3ID6C 2CL5A 4E30A 3B3GA 3DMGA 4HH4A 4LECA 3REOA 4EK9A 4ER5A 4B17A 1D2HA 4GOMD 4YMHA 3JWGA 2BR4A 5B1SA 3BT7A 1AF7A 4YV0A 3RIEA 1WXWA 3KQYA 1VE3A 2OO3A 2WA2A 5K0GA 2PSSA 3FPEA 2ZIFA 3OE5A 3A25A 2PXXA 3FPHA 3GNLA 3UJCA 3LCVB 3V8VA 3H2BA 1NW3A 3TLJA 2Z6QA 2IGTA 4RTRA 4X63A 2PXAA 4R8RA 4E31A 4GOLD 2VS1A 3P9IA 5K0EA 3NJRA 4KDRA 3BGIA 2OZVA 8MHTA 2ONZA 4YMGA 2CMHA 1FP2A 5HIKA 4CKCA 5K0BA 2ZULA 2GPYA 5FHRA 3R3HA 5E9JA 2AZTA 3G2QA 2VP3A 4QDJA 3DXXA 3TKYA 3DMHA 2ZZNA 2OBFA 3HM2A 3P9CA 2IBSA 2ZZKA 1KPIA 2AOTB 3THRA 4PYLA 5EOVA 1L1EA 1VPTA 3DLCA 1UFKA 1RI4A 2ESRA 4MWZA 5HIIA 4ER3A 3EVCA 1HMYA 1NV8A 4DQ0A 3TM4A 3ORHA 5EEGA 2ORED 4AX8A 1NBIA 3EMBA 3ELYA 3LX6A 5EIWA 4CTJA 4E70A 4IV0A 5D1HA 3E8SA 2QM3A 2IBTA 3LGAA 1N2XA 4PIPA 3TR6A 5EQJB 4C06A 1ZHFA 4CWAA 4E2WA 5LQKA 2UYCA 3HVJA 1SQGA 1IXKA 1P1CA 3A7DA 5E8RA 4PYNA 1ZKDA 2WA1A 3PFGA 1M6EX 3A7EA 3G2OA 1G60A 2V7EA 3HP7A 3P2KA 2Z6UA 1I9GA 1ZGJA 1KHHA 2QY6A 2ZWAA 3M33A 3QOXA 4YUVA 4OBWA 1ZQ9A 3BGVA 3KQSA 1H1DA 4YUYA 3PX3A 4ER0A 1ORHA 3CJRA 3VC1A 2OB2A 2XYQA 5DSXA 1JG3A 2G72A 3E05A 2G71A 5DM4A 3GDHA 5EKXA 3PT9A 4HSGA 1NBHA 1EJ0A 2I6GA 3EGVA 4MQ4A 4BP3A 3S68A 3E7PA 2OY0A 3NTVA 4HTFB 4DM3A 4PYQA 5DRYA 2R6ZA 3R24A 1I1NA 5GM2A 3GJYA 5KS2A 2I9KA 3GRVA 4GBED 2AN5A 4E2YA 3EMDA 3NW9A 3B5IA 2OYRA 3HA5A 5EHGA 5LQCA 2AVNA 2ADMA 4CKBA 5D1NA 4C4AA 2QE6A 3HCCA 3KR2A 4Y30A 3UFBA 2ZZMA 4ZTBA 3P97A 5M5BA 1YFJA 3DR5A 4AUKA 4RWZA 2IDJA 5EVJA 1KYWA 3G8BA 3HVKA 4KIGA 1VLMA 2YTZA 3LBYA 4PYMA 1RI1A 5K0LA 4QPNA 5LQNA 1XDUA 3L8DA 3TFWA 5CCXA 2ERCA 3PVCA 3T7SA 5JUWA 1KIAA 2Y1WA 3IYLW 4ATNA 4QPPA 3PLAE 3D2LA 4M37A 1VIDA 4Y2HA 5EG5A 2PKWA 2PJDA 2IIPA 1RJEA 2PX8A 4KIFA 5LQRA 3THSA 1FBNA 3ELDA 3R9XB 2YVLA 3ELUA 1EAMA 4OA8A 4H0NA 2BR5A 4DKJA 1G6Q1 5EMMA 3IV6A 5DM2A 3EVBA 1M6YA 5DTRA 4X1OA 5CM2Z 3LECA 4U7PB 4RVFA 5LQJA 3G2MA 4KRGA 3KPJA 2GH1A 3UZUA 3FUTA 1QAMA 1QAQA 2ZBPA 3GRZA 5BP7A 2XBMA 2PT9A 1BOOA 2GS9A 3UJ6A 4C05A 4POOA 5E2BA 2AR0A 3T7RA 1FP1D 5E9QA 3BZBA 3KU1A 2VDWA 1RJFA 4PNEA 3LCCA 3HCAA 2CMGA 2PGXA 2EX4A 2GA9A 5GWXA 4PCAA 2ZTHA 3UA4A 3M6WA 3OU6A 2HWKA 3FTDA 4PIMA 4PGHA 2N47A 3M4XA 1UIRA 3SX0A 3KKZA 5EZQA 2C7OA 4M7RA 3ERCA 3CJQA 1NW6A 1KPGA 3KQOA 1XCJA 3EGIA 3MAGA 4RSRA 3DUWA 4HC4A 3BXOA 4FP9A 3CGGA 4PGGA 2H1RA 1OR8A 3WSTA 1RI3A 1AV6A 2P35A 4QTUB 3FTEA 5FQNA 3B7PA 3HA3A 2O06A 3V97A 3MTEA 2IFTA 3UJAA 1JG4A 2VDUE 3NDJA 4RVGA 5FA8A 2UYOA 1EJ6A 3RODA 3P9NA 2ZW9A 1INLA 2VZ9A 4NECA 5EZSA 3I9FA 5DX0A 5CD1A 2YXDA 4R8SA 5K0NA 4QQNA 3EVGA 4CKEA 3HCEA 5KYGA 3FUUA 1I4WA 3E23A 4YUWA 3AXTA 4X60A 5FTWA 3KR0A 2ZFUA 1R00A 4FGZA 5EC8A 3C6KA 5EHIA 2UYHA 3KPWA 2EFJA 4GUAA 4KVZA 3T7TA 1KP9A 5GM1A 3X0DA 3MB5A 3EEYA 5K01A 3NVKI 3HCFA 2ZLBA 3NWBA 1SG9A 4PYIA 4RTMA 4FT4A 5T64A 2Y1XA 3ER8A 4C08A 2HMYB 3LL7A 5LQUA 4OA5A 5DX8A 3OU2A 5GIOE 1G38A 1BHJA 1YUBA 1EIZA 2NXJA 4ISCA 3I58A 3BKWA 3DP7A 1UWVA 3GXOA 1R8YA 1NE2A 3LDUA 2BH2A 1D2GA 2QYOA 5P8WA 4ER7A 1PRYA 1B42A 4F84A 5FUBA 3LKDA 2H11A 2NYUA 5H02A 3HTXA 2ZIGA 2IH5A 2HNKA 3MERA 2IPXA 2P3QA 3T0IA 4XCXA 4RTQA 2HR1A 5ICEA 1JG1A 1VL5A 4X41A 4E2ZA 3EVDA 5K09A 3O7WA 4BLUA 1R6AA 3I64A 1DUSA 2AS0A 3LDFA 3SXJA 2B3TA 4AZTA 3KQQA 4FT2A 1IM8A 1FPQA 5U4XA 1ZGAA 3CC8A 1WZNA 3FYDA 2QRVB 5HOQA 3MHTA 3TMAA 3M70A 4GC9A 2NNWB 2B25A 2UZ4A 5ICFA 3EVFA 5DX1A 1MHTA 2XVAA 2YR0A 4GF5A 3DH0A 5EGSA 3VYWA 1JG2A 2VDVE 4P58A 2O0LA 3RW9A 3ELWA 9MHTA 2YUIA 3OZRA 2I62A 3KQPA 2CKDA 5CCBA 5E1MA 1EG2A 2ZIEA 2FRXA 4RTKA 4EQZA 5CVJA 3K6RA 2NXCA 5FWAA 4RX1A 3I53A 2PY6A 5KQSA 2B9EA 5CVDA 5K05A 2PBFA 3LPMA 4EVIA 5K0CA 3QOWA 7MHTA 4OX9Y 3MTIA 3SMQA 4ER6A 5EEHA 1BC5A 4YV2A 3AY0A 3SSOA 5BXYA 3KPUA 2ZVJA 4FZVA 1VQ1A 3ANXA 3UJ7A 4PYOA 1P1BA 1Z3CA 4HG2A 2BZGA 5FULA 1SUSA 5GOZA 3HVIA 5DXAA 5HIJA 1N7JA 4IKPA 3TOSA 3UJ9A 5FA5A 4DZRA 3SVZA 4C07A 5FCDA 1QYRA 2E5WA 3FYCA 5EIFA 3GRYA 3SM3A 1SKMA 2Q41A 4FS8A 3KQWA 3GCZA 1YZ3A 3C3YA 4G56A 2PWPA 2C7PA 2AN3A 3FUXA
chains in the Genus database with same CATH superfamily
4MI9A 3MSXA 5C0OE 1U9IC 4HJRA 4PAOA 1M34E 4QYWA 3I5AA 1MQAA 2SNIE 1U8XX 1VKRA 3A4TA 3ZE8A 1GAQA 3MWJA 3R0QA 3TTTA 2A0UA 2BMFA 2HN9A 3C5WP 3H5LA 3TEFA 4BBAA 3U44B 2BGUA 4UMDA 3C7AA 3K32A 1G17A 2AA3A 2V96A 3CM0A 4GC5A 4XJSA 3E9MA 4O02B 2VZEA 2ABWA 2NO6A 2D2XA 3UK1A 3WWEA 4V1CA 5IZ4A 2VZ8A 1QF7A 4X71A 3KB8A 1Z2PX 1QYXA 2BYTA 4O0MA 4ETWA 5ARDA 2CUTA 4QECA 3QLVA 1DWUA 4EGQA 1G8AA 3CPSA 4R84A 3LW8A 3LFUA 4L4ZA 5AIBA 1NXWA 2EXXA 4K03A 5G1PA 2JAHA 1V47A 3U4QB 4ZAXA 1KJNA 1Z5WA 4OI0A 1MZPA 1K8QA 5JS1A 4TLBA 1TNDA 4P22A 1A7KA 5CJ2A 4AM8A 3UW3A 2D2VA 5JPIA 1KU0A 1ST3A 2JKYA 2Q3JA 4BMYA 2J0SA 2DHDA 1JQKA 1DG9A 2AG1A 4YCAA 3BRWA 4BNUA 1YZGA 1V11B 4MIKA 1U9IA 1Q50A 4KO8A 3ADBA 4C29A 5H3CA 4PN3A 1TKRA 3ROZA 5JZMA 3JTEA 2PMBA 4NK4A 5KTOA 5M34A 1DIAA 1LPMA 2XSZD 1IY8A 4A26A 4C22A 4HNTA 4MYSA 4PSCA 4JQSA 1IBRA 2YJ3A 2WYWA 4MGKR 2HRDA 3NETA 1T3LA 2A1UB 2E2WA 2VT3A 5A6SB 2P78A 3E3MA 4P7GA 2NSDA 2FQQA 4FFLA 1ZK0A 3GVIA 5HSGA 4KDFA 4B74A 3DJFA 1HMPA 1CLUA 1G6HA 1H2WA 2WILA 2O59A 1IK4A 3F7NA 3CF2A 1U1FA 1ZNYA 2SHKA 1DO8A 1NQVA 1OIXA 1OUMA 2QX9A 3G59A 5D2CA 3TM5A 5LP6F 3HHPA 4YJ2A 3U7QB 3E7DA 2B6HA 4OBXA 4URHA 3P96A 1XQVA 2DSTA 3V9PA 1G21A 2R97A 1M1UA 4BBPA 5J47A 1CFJA 4INOA 3ZG6A 1FJGB 5E1BA 3FTNA 2X8BA 4R69A 3WG9A 5GIPE 3FTFA 2PL1A 1DQSA 3NC1C 2JH8A 2J4FA 2E4UA 4YGXB 1CFZA 3FOFC 2Y8EA 3G7UA 4QHYA 1U0BB 1M8KA 4L0QA 3GT4A 2HJWA 3C3PA 2J9YB 3H4TA 3Q87B 3VDRA 4B2PA 3K0BA 2CZQA 1YHYA 1ZSVA 2FW8A 3BGDA 4M8NE 1VRCA 2ODPA 4LS3A 3PFKA 1ZMOA 1X86B 5F1PA 4R9NA 3RVJA 8LDHA 2JJ2A 3LQ2A 4RULA 3FBWA 3LGSA 2NPFA 5KTRA 1R8SA 3TYXA 3E6AA 5FI0B 1DBRA 1RQ7A 4N1AA 5DF1A 1KXZA 5FLKA 2RC6A 3K92A 2A78A 1RS0A 4R54A 2GZHA 3FPSA 2W83A 6PFKA 3CUSA 5GZ1A 1YGPA 3EUAA 4UCXA 1SUPA 3S1AB 3KT0A 1SBNE 2J9FB 2BP7A 1NQ5A 3VNRA 5B2FA 1RP7A 2ZWMA 1IEWA 3DKPA 5F7OA 2B4TO 2J3EA 1E2PA 4R83A 5MFZA 2OBLA 3EMKA 4PC2A 3GDWA 1UANA 5JJKA 4QUIA 3RRBA 3EPJA 1XD2A 2V97A 3D6JA 3JVVA 3PC8C 5F2EA 2WK1A 1SK9A 1I4EB 2PBRA 4OFXA 4Z0NA 2QTGA 2VHZA 2IUFA 3IEKA 3Q5EA 1YHNA 4YTEA 521PA 4AX4A 1IPFA 2QXUA 3MHPA 4J4BA 3ZK7A 2JLAA 2ZSUA 3OQVA 4Y9RA 1YQDA 1KBOA 5AIAA 4RH1A 1XAHA 3PHIA 4IO1A 2OV8A 1RYYA 3O4HA 1T8YA 1E2KA 5TQVA 3WLPA 1JHDA 4KSBA 5HCIA 5TMEA 3X1WA 2XNCA 4K7JA 5IEBA 4XWWA 1WBDA 3RYFB 4G23A 2BKVA 1QOQB 4IMJB 5JFGA 5ICGA 3KQLA 1XMQB 4F3CA 4RYLA 4E51A 4A6EA 4B3XA 3OO1A 5C35A 1TM3E 5JRZA 2DX7A 3LC0A 1WBBA 5AW4A 1Z07A 1I10A 2MR5A 2O7SA 2YQZA 3PQFA 1XTTA 4YY3B 2WC1A 3S2YA 3MT9A 3K70B 3T94A 2C78A 3C6YA 4MQLA 4L4RA 1AF4A 4QTZA 1NF9A 1W5BA 4KFRA 4DCJA 5AVSA 2W6ID 1EVEA 2J33A 4KAJA 1XE3A 3W90A 5IBQA 1T1SA 3VU1A 2YN2A 2IITA 2W6OA 1CQJA 1KMMA 3GPIA 4WBSA 3U17A 4BP9A 3GA0A 3CURA 1CRQA 3F3YA 5ALDA 2C2MA 5I9MA 2NO4A 1PO7A 4WHMA 2YWCA 3F67A 3KOWA 1N0UA 3BA1A 3KU4A 4K8RB 4TX1A 2XNJA 1PX0A 2XMBA 1JF8A 3AJEA 4RQBA 4AUMA 4LKOA 3D43A 5GINE 1E2QA 4I3GA 4IFTA 2D8MA 3OCVA 3HBLA 4BLQA 3F6SA 1XRLA 3NEJA 1ZKMA 3RYCA 5EJMA 3OIWA 5HZGA 3DEZA 3ECCA 1HRKA 3ICVA 2ONYA 2H4WA 1JQEA 3KEOA 4MKRA 2WU0A 3BWMA 4L51A 2PX4A 4I4TA 2ZSKA 3DEHA 4HP8A 3GMTA 2O05A 4YDQA 3VR3D 2F67A 1VBFA 5LQMA 5D85A 1E7YA 1V5FA 3IL2A 1QJ4A 3FE2A 4LTNA 1COZA 1O7JA 1YR7A 3HJRA 4IRXA 3GBPA 3OFVA 3GARA 4ONEA 4HVLA 3QU9A 2P7IA 4UBOA 4X3CA 4CR8A 2WB2A 5JCXA 1NUSA 1YE5A 4UAUA 3EEOA 2FMUA 3PQ7A 3BCHA 2C4NA 2LPMA 1Y8QB 1SCUA 4K8OA 2FUNB 3EN0A 3KSAC 4HLCA 1HDXA 1XVAA 3Q15C 3AV0B 3OF2A 5F5NA 4FJ2A 2YJ6A 5BSTA 3RFTA 2UXCB 5F2OA 1MEJA 2R44A 5LR6A 1OT3A 1Z6ZA 2O0MA 2WSYB 5CB4B 2FHPA 2XYPA 3E53A 1RKQA 4UQOA 5FPPA 4CM6A 2VP9A 4S1WA 4KQIA 5EA2A 4I36A 1KYZA 2I34A 2WJJA 5AM5A 4ETNA 4HV4A 3IOEA 4CIAA 4P1ZA 4AP6A 3GJTA 1LUAA 2FFAA 3GLHB 1P44A 4INAA 3ZCRA 3UVEA 2VDQB 2B7CA 5HUJA 4RAQA 1CETA 1KAMA 3R7DA 3MT8A 4MS1A 2GHTA 2AQIA 2WA2A 4OH1A 1P5HA 2PSSA 4PZ0A 1VPVA 5F73A 4E09A 1QH1B 5H16A 1GQOA 4C4RA 3Q7IA 3VC7A 3W4KA 1E4OA 2UU9B 2ZJ8A 1VLLA 2FGKA 3EOAI 3GRPA 4DQVA 2VSQA 4K9LA 4BVGA 4JP8A 4EEZA 1OREA 2GYUA 3DZHA 4AWAA 4HQOA 3DLAA 3FH0A 4PLWA 1H4TA 3R9IA 4GKJB 3B5EA 1GTL1 1G3RA 1F2DA 1T9KA 2JCYA 3T61A 4AJOA 4BNTA 2VWGA 4CV0A 5B6IA 4DRZA 3AFIA 3QWIA 1ODIA 3O4RA 3R41A 4H3VA 1JAXA 1UK8A 2Q29A 3GEBA 1UEXC 3K8YA 3FPBA 1E99A 4L1KA 3K0FB 4PC6A 1EUCA 4WZBB 3I3OA 1L1EA 3EASA 4INPA 3SYLA 1ILWA 1E2EA 3N7AA 1T4CB 3DKIA 4EYOA 4AJHA 1NV8A 1RWQA 2BGJA 4XVCA 4OIFA 2CL6X 2WMYA 3DPSA 3MOIA 4ACAA 4PTYA 3LY9A 1FFHA 1C41A 1F48A 2HGSA 4JLKA 4KQCA 4Z7NB 3TZKA 1Z7BA 1D2MA 1DWPA 1K8XB 3H1TA 3HYRA 3GFFA 4JQOA 4CWAA 2ZYVX 2DSNA 2Q6LA 4G09A 1A4RA 3AZPA 3KRTA 1JJIA 1P1CA 4H7PA 3GFVA 3PUJA 3RS9A 2LKCA 3AR2A 4C01A 4IKEA 4ZPJA 1AKVA 1LX6A 1UDAA 2V4ZA 3DVAA 4OO3A 5KPJA 2Z6UA 3QI7A 3ZQKA 3ZY3A 3QOXA 4C5AA 1ZD8A 3ORQA 3KQSA 1H1DA 1KSGA 3DFIA 3IC5A 4IHJA 5K2OA 5DSXA 2AEFA 3K0SA 3V4OA 5IPFA 1SXHA 4Q3EA 3C1UA 1Y4UA 3PT9A 4RVUA 1IJFA 1CZHA 1SZPA 1U7XA 4IVRA 4CN8A 5CFQA 1QYCA 3OUTA 4NCKA 3S68A 5K4AA 2BKXA 3DZIA 3KJFA 1UXJA 3SS7X 3DD5A 3ESZA 3DHEA 3IDOA 5EN4A 2WT8A 4KQ2A 2V6MA 2F1RA 1V2HE 1YQUA 2ZBEA 4JB2A 1OWOA 4OQXA 5JSZB 3THXB 3FCSB 3SZOA 1M83A 4EAAA 3MT7A 2GDZA 4MV9A 5TGTA 3FLBA 4FHEA 1Z6TA 3ULKA 4L72A 3LTNC 3TB4A 2Z4SA 4FR2A 4MLPA 3HBAA 4BUJA 3HGMA 5AJXA 4H1HA 3QYJA 1JWLA 1P0FA 3TZQA 4AN1A 1LLUA 1NJ8A 2FZ4A 1SK8A 2ACVA 3W6OA 4KQJA 3BRWD 2HMVA 1XB2A 3LMKA 2YTZA 1YE8A 4PYMA 4ZQBA 1H5UA 5HZKA 3ZVMA 5TARA 3EE6A 4OYRA 4CDMA 4A6PA 3EULA 4QPPA 3OZVA 3D6FA 3WKEA 3HKEB 1ZNWA 1ORVA 5HUQA 1JB1A 2EWMA 4JJ4A 4DIOA 1RJEA 2RI1A 3DEKA 2VP6A 2IXDA 3I37X 3JATA 3R3ZA 1KZ1A 1NRWA 1YR8A 1CJUC 3R77A 4G8BA 1C3OB 1FNMA 5DHPA 2O0KA 1RWPA 3L4EA 3QSGA 2PRSA 1J90A 3N75A 2BCGY 4G5OA 1VSQA 2H5LA 1SQ6A 3FSEA 5DYWA 3D0QA 2B5OA 4GR9A 4ENSA 2JFPA 1GPLA 1LTHR 1TZMA 1U4NA 3GLRA 2WKWA 1K5PA 1PR9A 1UKBA 2F8MA 4KMMA 1G9TA 4Q4HB 4QBGB 3RBAA 3UZUA 4A4DA 4P84A 4CMCA 1MT3A 1C7EA 1E7WA 4OAOA 3VPBA 5ED0A 1NLFA 2WWYA 4ALMA 3R3WA 2Y68A 4C5BA 2BCEA 3M6WA 4LJYA 3AJ8A 2ST1A 6NULA 5KDOA 4C30A 3BFXA 4FD3A 3PE3A 1T3SA 2ZUSA 2GJ9A 2XHEA 2X0KA 1NWHA 2X5NA 1LPBB 3Q6IA 3T1OA 3ASVA 4FP9A 4IGEA 4M0LA 1OR8A 1NHWA 2X6RA 4KUHA 4Q18A 2ZRFA 2IQ5A 3JYHA 1C7IA 1USGA 3TH5A 2JJ2D 3JCZA 4K05A 4KH1A 2FDRA 1E5LA 1K4KA 2UYOA 3FLAA 3IQXA 4QARA 3TVDA 3VHRA 1U6IA 3DL0A 2CK3A 3DDOA 3GGSA 3LWBA 4Y98A 5EJ6A 1AN9A 4NECA 5JVDF 3OHPA 3QX8A 1OLUA 3LX4A 2JFYA 4J4TA 1RM5A 2ZI9A 1NY6A 4GIBA 1JKFA 3NYIA 1FS4A 2GHRA 4M0PA 2ZFUA 5H9VA 1JZSA 3A6KA 2UYHA 1E1MA 3OZBA 3S99A 2EFJA 1DHRA 4DSUA 2WZQA 4NENA 4WA8A 4PFJA 1NUUA 3X0DA 3EEYA 1LBHA 2CDCA 3KOUA 3S2GA 3PDJA 3E1SA 3G02A 3STHA 4DLKA 5KB3A 3ZVKA 4LOJA 2FW1A 4BLPA 1KRWA 1VL2A 5DX8A 3S29A 3DMDA 3P94A 1EIZA 4R8VA 4H35A 3JQQA 1FFXA 4R1LA 1QFMA 3MRVA 4LE1A 3Q1LA 2H7CA 1NLUA 3R5TA 4MVYA 3OIVA 3RUCA 3VNQA 1E3LA 2VH1A 5LP6A 1QK4A 1NN1A 2EJVA 4IJQA 3HDGA 2HAEA 1Q7TA 3THWB 1NURA 1X42A 1DSSG 1T1EA 3G0DA 4RFVA 1YZTA 5BXQC 2I2BA 1Y1LA 4YRIA 4RF2A 1GU1A 5CIQA 3HQ4O 2JIDA 3L8EA 5BNFA 2D5IA 3NWJA 4JR1A 2ZBVA 1MA0A 3RYHA 1QRTA 4CEIB 2ERYA 1YR2A 5KTKA 3MXTA 2D3WA 5B5SA 4MKXA 4W8OA 4B6OA 3UOAB 1JEYB 1FVXA 1O6CA 5KOIA 2PPVA 3CRZA 3IPAA 5B7QA 3RFXA 2WD7A 3DONA 2MMCA 4JOSA 3H4MA 1NLZA 1ZVKA 1C7QA 1ZLXA 2KBEA 2BEVA 2QTAA 2HHHB 3T5DA 1N2BA 5E38A 1PTJC 1DDIA 1MAVA 2QMOA 2QQ5A 2NZXA 5AD1A 1IHOA 1PS0A 1SOWA 4U8HA 3MPUA 2B37A 1GEEA 1FMFA 2W2PA 4OSEA 3NGLA 4YA6A 4A8HA 2PY6A 1MX5A 4KN6A 1ZS9A 4I8XA 1F20A 1GSHA 1OI2A 3P9QA 1IHYA 5HWSA 5K0CA 3CNBA 2VXOA 4PQFA 4BFTA 2RBEA 3K3PA 2GCOB 1SZCA 4NVRA 5IBCA 3PEEA 4XVQA 4OFWA 5AWFC 4XR9A 1SBCA 1GXSB 2ORVA 4RCVA 4ALIA 5JBIA 3LK7A 1EG7A 4OHKA 5DHQA 1FJHA 5DXAA 3CCCA 4B3SB 4G56A 3B8EA 2E85A 3D59A 1I2MA 3FGNA 4PX3A 1UDBA 2W22A 4BNHA 4BRUA 4Z0TA 2E5WA 2PKCA 2E4XA 1SKMA 4CF6A 3L46A 3IV9A 2FHSA 1MIOA 2HD4A 1JS1X 3OTWA 4MNTA 1U80A 3WO0A 1JHMA 4NXNB 2Q7XA 3BGSA 2ONCA 3DV0A 1KC1A 5EXPA 3U3XA 3VC2A 4BO1A 1Y6GA 1BE0A 4KEAA 4QFDA 4MWDA 3L1VA 3PNMA 1HGXA 3J81A 2WJWA 4WLUA 4GVPA 3HCRA 3OZXA 1GGJA 3WI7A 1HXHA 4OQDA 1GZ4A 1PTJA 2F1KA 1WB4A 1DJLA 1NNUA 2JVKA 3DT6A 1IAVA 3L8MA 1DVRA 1DXYA 2HJSA 3QM1A 1WOMA 1WXGA 4HRVA 1ZVQA 1I2DA 3P32A 4EKGA 4Z9FA 5LA6B 4JUAA 1K3TA 4P4NA 4ZEOA 2IYPA 2OTCA 4FNOA 2VEOA 3E2PA 4Q4JB 3A4YA 4E4TA 3KZXA 3PSHA 1DOHA 2P69A 2ZJYA 4AY2A 2XBLA 4WFQA 3VFDA 2HF7A 1PEKE 3BHIA 4J0JA 3TJRA 3GIWA 5EMLA 4YHHB 4YO8A 4H18A 1EUDA 5H81A 3R6WA 4TTQA 3U7IA 4B2IA 2O2CA 1NJ1A 1EFPA 3FCCA 1ANKA 3V4FA 3D2BA 1TX4B 2WSMA 4KWEA 5DPMA 5L4SA 3U16A 4KNYA 1S01A 4F91B 4BJ6A 1L8OA 3VH3A 2HIHA 5IC5A 2D1FA 3PNVA 1ADFA 2H54A 4FR5A 2VCHA 4CF5A 1FC0A 1K2VN 3GFOA 5IKXA 2Z8ZA 4UHEA 2P41A 1T8SA 5E4FA 4E33A 2VDOB 1ES9A 3KJQA 3HMQA 4J03A 3OOSA 4EFKA 4Z1OA 2XQFA 4B47A 1XYGA 4UVHA 3UXEA 4NJEA 1L8QA 1A8IA 1UC4B 1YVDA 4OATA 1KJ8A 1MENA 4O5OA 4HUJA 4P2BA 1P0CA 2F43A 2G08A 3M6XA 5AVTA 1ZEMA 3MS4A 4KWCA 2HWUA 3MT0A 5LJIA 2Q6KA 3SSMA 4XLLA 4QYMA 4HMQA 3ZJ4A 1JSXA 1QRDA 3UQZA 4HNSA 3TQTA 2JFZA 4BIMA 1YFKA 4E3ZA 3P27A 2O52A 2I6UA 3B1KA 5L40A 3GLIB 2IYVA 1JKJA 3STVA 1L4UA 3QFHA 2PNFA 2QAIA 3GZNA 4URFA 1VG0B 2Y1CA 1O1YA 2JCGA 1E1KA 1WHSB 3AB7A 4FQ7A 2IOQA 1FBTA 4MV4A 5EMKA 4YRKA 4H7IA 2B8TA 1QVWA 4H08A 3FHLA 1EM8B 1ECJA 1UUFA 3I4FA 3JRNA 4IFEA 4CT0A 3AVVA 3KUDA 1VHQA 1MJFA 2EJWA 3G9QA 1UJ2A 4KYTA 5DTMA 3OD5A 1O57A 4DV3B 2QRUA 1V7PC 1QR2A 4F9FA 2H9IA 2I7DA 3LUDA 3EPPA 3P9KA 2MSEB 1XQ1A 4ID9A 5HKBA 3O1JC 4E5DA 3EGEA 2JJMA 2NZUG 2P1DA 2WNHA 2YWJA 1QYWA 4DNPA 5TVKA 2QTHA 1EJ2A 3QKTA 1OCEA 1SELA 4FHGA 3RYTC 3ZJUA 1Q7EA 2OZEA 3LX8A 4EVSA 5BV8A 5KWSA 2PZKA 4IJVA 2B8JA 3OWXA 2FP4A 3U3OA 4EEKA 2LDBA 4L5CA 4YQFA 4YLYA 1MMFB 5ALXA 1G4AE 2YQ4A 2ACEA 1A76A 4HDRB 1UJ5A 3TMKA 3VSBA 2VF8A 3E82A 2JLRA 3GH3A 2UXBB 4JH0A 4JR0A 4MKGA 3IIEA 2JI4A 2VNAA 3Q9UA 4ZO9A 4O4JB 3CJTA 1T26A 1LK5A 3E58A 1OFIA 1Y5IA 5DM0A 4D82A 5FWXB 3HL0A 2NTNA 3F5SA 1JSRA 3V4VB 5AKGA 2OA0A 2X15A 3CR7A 3G0BA 3WWZA 2DJ5A 2P91A 1G16A 4CLHA 1XK6A 1NKVA 1QZ3A 5ICCA 2YFKA 4ROSA 1XVLA 2OXTA 3LBHA 2JIOA 3ZDFA 3WA6A 2RK6A 4M1SA 1G98A 5DIZA 5JQGA 1ZN7A 2H92A 1KS2A 1VIYA 4ZT4A 5B58C 1M34A 5BV7A 2WZDA 3AUSA 5JD6A 2EKQA 3OKCA 4Q02A 4RE6A 3DKRA 3W3ZB 2IH2A 3QKRA 3D6MA 4BMXA 4DR7B 5A0VA 1P4JA 2VF2A 3WLJA 3X1ZA 4BNMA 3DDHA 1E7MA 3B1YA 4TSKA 2RD2A 2DQSA 1JG7A 3AYZB 5JE8A 1QGOA 1JU9A 5ARCA 2JLCA 2PGLA 3O3NB 5KNCA 3AI7A 4BFYA 2CXOA 1R9NA 3Q88A 4O4HB 1RXYA 4QTYA 5ICSA 3W7BA 1RQLA 2CB0A 2OORA 3UHOA 4J0QA 3B53X 1PJQA 1G5FA 4R9SA 3DBRB 3U37A 3UWMA 2WIKA 4G4GA 1LGYA 3DNMA 2O2HA 1GPBA 5FFFA 3JWJA 3LDAA 1KDZA 3QHQA 2ZIWB 1N5LA 2GSDA 3NDIA 4B8ZA 5L6MB 4KPYA 1KOJA 4QXPA 1JEQB 1ONPA 1SO8A 1Z4KA 5B1DA 1Q3HA 3AHCA 1GCUA 3PFFA 3KETA 2GXAA 3N07A 1FFWA 1YRAA 4TL8A 4HBZA 2CK3D 6YASA 1GP2A 2BFMA 3AKDA 2PLFA 3GUYA 2BELA 3GT0A 3I1FA 3P9YA 5AW1A 1TCVA 4L50A 5A4FS 2XA1A 3G3EA 4WESA 4XWTA 9ABPA 4BASA 4CVNA 3RUFA 1K6IA 4EG5A 2WAMA 4PCVA 5I01A 1CV2A 3K1AA 3PZBA 3LOPA 4YONB 4XDZA 1GFZA 3L6OO 4JEHA 2IY7A 3JWIA 4WBNB 3QYAA 4RJ2A 4RHCA 4FHDA 4H16A 4TLLB 1GQQA 3IPCA 4Y2PA 5KYTA 2C7QA 3PX7A 4U6QA 1D4FA 4UJ5A 3EXEB 3L41A 2DAPA 3OBBA 4H1UA 3HO6A 1LLCA 1SC1A 2M6LA 5HKKA 4HQLA 1NNI1 3UGTA 2FN9A 3GUUA 3LGXA 1Y3FE 2ZI7A 5CW1A 1IVYA 1OSNA 1FJ2A 2LUOA 3DHYA 4BP1A 5ALGA 2A86A 3ZUGA 1PR0A 1C2TA 1EQ2A 1N75A 3KTDA 3F4BA 3PUYA 2QJTA 4JUIA 2VYFA 1YH3A 1HC7A 2HU2A 4LJ9A 3RS7A 1EUZA 1FIUA 2VWHA 3BB1A 3JQ8A 4X7PA 1EEHA 3PCRB 1XN1A 1ID1A 2VLIA 4RGBA 4YJFA 1HL3A 1J7JA 4WKGA 3QZUA 3RIEA 4RVSA 3MLBA 1OWNA 2B99A 2J4CA 2YZNA 4X20A 1KK2A 2FFBA 2OWEA 3N5CA 4LBZA 3HO1A 1QHGA 4IL5A 1CF9A 2PQ0A 2BHSA 1BGVA 3V48A 4EOGA 4KITB 3ZBPA 4RHTA 1QHFA 3D8HA 3EQ7A 4NOLA 3IUJA 3HV2A 4YRAA 4RFLA 1M6VB 2PXAA 2HPZA 3MMSA 4A10A 1AY0A 3WA7A 2NQTA 1FFSA 3WGUA 3JQ7A 1O77A 3NIDB 3CXUA 1NE7A 4GPEA 1JI0A 1THZA 3ZKWA 5F23A 3HGQA 3GYBA 2GZDA 1L7DA 4LC9A 4A16A 4YRMA 5JY6A 1QFYA 2B83A 1AJEA 4L73A 4YMVA 2QRMA 1LBEA 2AYXA 3DBLA 4MK4A 4L2IA 5IDQA 3TN7A 3O9ZA 3DYIA 4FZRA 2BONA 2X6TA 4PHCA 1XD9A 3HM2A 4M7PA 3S70A 4I19A 3H05A 3L1IA 3OM1A 3BDIA 5D8DA 4Y2QA 2BM0A 4ZOLB 5EOVA 3RYIB 4RHEA 4KAXA 4Q9NA 1SGWA 1U90A 2LDXA 1JNXX 3HFGA 3N2YA 4UHKA 3S8EA 1C7ZA 2W70A 1S3IA 2QZ9A 1R4MA 4ZGWA 5SY6A 2PSEA 4DDMA 1DJMA 1T91A 3E8SA 3EZXA 3LGAA 1UBEA 3WMGA 5JYDA 3GYGA 1TADA 2EQ5A 3ABQB 3K7EA 1QPZA 2PQ2A 1PR6A 2VJOA 2WA1A 2JGRA 3A7EA 1TKBA 1IOVA 4N0MA 3IERA 1NOKA 4P4TA 2VNJA 2DECA 3IUBA 4EG6A 1K3FA 1IZZA 5L95A 4U0KA 6Q21A 3VC1A 1PJBA 3OJXA 2QN9A 1PSDA 4J3NA 3PUHA 1GA1A 1J22A 4YRJA 1WUTA 1TT5B 1EJ0A 1KEEB 2IYAA 4LOIA 4LYGA 3T3DA 4B5KA 4GECA 3H1EA 4YLGA 1G2IA 1YQXA 4CCYB 4F1KA 3O95A 4ZI3A 3LXUX 1UCFA 4FDVA 4TV8F 3CIOA 2BSAA 2NUBA 4NCJA 1QGED 3GJYA 2PH1A 2W2MA 3U5ZB 1CEQA 1SIUA 1R9MA 2QJOA 4JODA 1N5DA 1UKZA 3PYXA 1H1LA 4AT1A 4DC1A 2RKBA 1O6GA 1D8AA 4JN6B 5L8VA 1YKGA 4ZTBA 2YV1A 4LXTA 3TDNA 1A3CA 4X1YA 4JI8B 3T1VA 5CURA 1R4AA 1KYWA 1AMUA 1Y82A 3Q2OA 2XCTB 3GRCA 1KVTA 1CS0A 1NG9A 3K20A 4XVHA 4R2WA 1FXSA 3ZD8A 2OHGA 1KFEB 3U0BA 3B82A 1NF8A 3P9ZA 2XNKA 1WMFA 4PQYA 1XEWX 1VZ3A 3OQBA 5CX4A 1B15A 5E6UA 3V7FA 2Y0EA 1KFKB 3ED5A 1QUEA 2VXCA 2HH9A 1EQUA 5PGMA 5LMUB 1W8DA 3IPXA 4GLBA 4MKHA 4CKWB 2YYYA 1DAIA 4YRNA 5MN5A 3HS3A 3OKFA 1IJBA 4Z4FA 4ZA2A 3I04A 4OSOA 2XTJA 4PG8A 1GUZA 2F55A 1S3SA 3UMMA 2XOXA 3HXKA 2REQB 4DOMA 1YRWA 2RAPA 4EELA 5ITSA 3WMRA 3HNOA 3LOQA 1JAHA 1U7HA 1KKMA 3BBPA 4C2AA 1Q92A 2IDMA 1FSZA 2OQIA 4HSEA 3AR5A 3IIMA 2QM8A 3REQA 1HNWB 4UE3S 1XCGB 4ZZ3A 5ERYA 3EGXB 1UXHA 3H9BA 4YECA 5FJIA 1M2FA 3HR7A 4XZ3A 4N03A 2NT4A 4CDNA 3H9QA 2ZRAA 3H2ZA 1HR0B 3UXMA 3C48A 4AKTA 3O03A 5DLYA 1DBQA 3KQOA 2PS0A 4HKTA 4DCMA 1RZRA 2H1RA 4XVRA 1W47A 3IRUA 4HFMA 5LU9A 2MYPA 4WWHA 5T4BA 5BV2P 3N3AC 5FBZA 1HURA 3PC2A 4F2PA 2NVWA 4YP6A 1WM1A 5K3AA 3LPDA 4AKSA 1MB0A 3ANTA 4QBIA 5A3VA 4BX9A 3NIWA 1SA0A 4JI6B 2DUJA 2EP8A 3A3NA 3WL8A 2OLKA 1TT7A 1V96A 4Z4IA 3F1KA 4Y67A 1L4LA 4YRDA 3RVLA 4LF9B 2AV6A 3ICEA 4LJ7A 2DHEA 1T5BA 3GBVA 3FNQA 3T7AA 1RQNA 1WHTB 3DVQX 3ZJYA 4IXMA 1AK2A 4IKOA 3QJYA 3AXTA 5FTWA 2XUQA 1C1XA 1R00A 2BFDB 4RF3A 3IEXA 1M72A 2ZRJA 2ODWA 3L7MA 3VX3A 1XTQA 9LDTA 2FPMA 1VMAA 5D6OA 3SXPA 5CCXA 3NVKI 3I0NA 5A7FA 5DE3A 1E58A 2MDTA 1DEHA 1E69A 3H2KA 3LM8A 1SG9A 5GTDA 4J7CA 1N5KA 2XE6A 1KJQA 4GI1A 3JU3A 5LWQA 2G5TA 5I7FA 4ISCA 1UKEA 1YUBA 1DEOA 3AHFA 3U9LA 4Z8XA 2XEXA 1WXQA 3ZHZA 4D42A 3PRJA 2Z5VA 3QKSB 4MDFA 3K1ZA 4IH9A 3C3WA 4FFBA 3VPGA 3DE5X 2UYGA 1XMIA 3RNOA 2C98A 4AG5A 4MB2A 4UTPA 1RPNA 3W3AA 3DDZX 2CXTA 4GYWA 5TY0A 3K4QA 3U9SA 2IPXA 2O7NA 3RIMA 2RB5A 4DHWA 2W58A 2FZWA 1Z36A 3H5VA 4Q03A 2IZ1A 3BX1A 2I6TA 3SC4A 4ZVTA 4RDHA 4UDNA 1C0PA 4HGQA 3C6XA 1RMTA 2Q3HA 3JQ6A 3I76A 3NBKA 1NP6A 3HR8A 5HS6A 1DUSA 2FW7A 4EY5A 3D3JA 2A30A 4MUKA 4BNLA 3GGOA 1ZH6A 4RC9A 2PZ8A 1I7PA 3DO8A 3SCZA 4D0LB 1R0YA 4DCNA 3ZDCA 4GPIB 3A58B 3ETHA 1KI4A 2AFHA 3JYPA 1RAEA 1LXCA 1OMOA 2VNKA 3EXFB 4QHTA 4XYGA 4E5NA 2H4YA 3JPYA 3QOFA 2OOSA 5KNCD 1TGYA 2D5CA 3DM9B 4QNNA 1C8LA 2O0LA 3NAMA 4IO0A 1AX9A 2PFKA 4MVJI 3DO6A 3L7BA 2FRXA 3DQPA 3LUHA 5IN5A 4TYNA 4UUMA 4YMTA 3I9KA 3BVPA 1KDPA 4LE2A 5BN3A 4KR3A 4UEKA 2RHCA 1XXHA 1YOVB 1PR5A 1TZKA 2XQGA 3OE7D 4LGMA 1VIVA 4UXJA 4MV0A 4RLSA 2W2LA 2DTXA 1Q15A 3WGJA 3WAJA 2E48A 2FPGA 4MARA 3W8NA 1P3DA 2BTQA 2FLWA 3WZMA 1IU9A 4UXIA 1E6MA 3ANXA 3T1TA 3D4NA 3SQMA 3OMWA 5B53A 2D7JA 1YRYE 4PG5A 2CYAA 3UJPA 1ISIA 1AM4D 2P6NA 2BFPA 1ZZEA 1GGNA 1BA3A 3MINA 1HO3A 3I9V6 1QYRA 4P35A 1BU8A 1KZ7B 1W88A 4YCBA 1ZY2A 2GJ4A 4XYLA 7YASA 3DZFA 3H65A 2JI9A 4UMEA 1Y81A 1K5GA 4OMCA 3U3JA 1KETA 4V0SA 1D4AA 5BQ5A 3O2SB 1BXGA 3KKQA 2OV1A 4MVJP 1C3LA 4GSKA 5ANRB 4NOKA 4BQRA 3ZOKA 3MEQA 4ZI2A 1H5QA 1JFFA 4ZT5A 3IR5A 1Q17A 1QC5B 1ZNXA 1V39A 1RHMA 3PQ5A 4BU1A 1II8A 5HKKD 4FOPA 4BNIA 5G4KB 2Q5QA 1TZJA 4R5HA 4B9EA 3ETGA 4QLOA 5AHRA 4EY4A 3VSEA 1BXRB 2ADOA 2D1SA 5JS8A 4RKFA 3Q4GA 5J2TB 2IZ5A 3UHPA 3ADDA 3C5CA 2I7VA 4G0OA 3C4QA 2ORYA 1MG0A 1XI2A 3BCSA 3DULA 4I3FA 5K6TA 1MOQA 2WM8A 4EY8A 1JKXA 5L3SA 1C9NA 1T1RA 2PZFA 1DTSA 4CMHA 5J63A 4X44A 4W1SA 1P2SA 3PFHA 3LDHA 4TKUA 4W5HA 2AZ4A 4JI5B 5DP1A 4F9EA 4IDBA 1W44A 1QHHA 2ZRBA 3FVRA 1TRHA 4TS1A 1QP8A 1QB8A 4L74A 1F3LA 1P73A 5FLEX 4C6TA 2J6IA 2ZWVA 4LRXA 3PEYA 3MG9A 1Y4AE 4MP8A 4TTRA 1CDOA 1LLDA 4RKWA 2AKEA 2VVTA 4CMIB 4JYMA 2OD2A 4PLGA 4R2IA 2C97A 3ZV7A 2XUAA 4TPKA 2BFCB 2VPPA 4BVEA 3WQBA 3U7RA 4LV5B 2C04A 4QGSA 4M0CA 1XN4A 1I6LA 4QQ8A 1V16A 4FDLA 1SBZA 1SULA 1T3HA 1NXXA 1WZEA 1ZRMA 1R6UA 5E9WA 3TW4A 1A77A 3SVLA 3UMYA 2UZ1A 3OOEA 3KFXA 4BQFA 4XLTA 4IUDS 3M4JA 3QF4B 4UULA 1FSSA 4NTZA 4KOAA 4FE3A 3K94A 2IT1A 3NUZA 1C2YA 5JLJA 4W5TA 3E9QA 1AUPA 1YZUA 3PS9A 1BCSA 1J8DA 5JJ5A 3R5KA 4C76A 4MI1A 2CCJA 3I12A 4WKCA 4PZCA 1RQ2A 4OMFG 3QQ5A 1HX7A 3D4BA 3CNQS 3AUAA 1Y7TA 3GJSA 4WZAA 2JGDA 4NMHA 1D7AA 2MU1A 3FY4A 4KUGA 2B9VA 1VG8A 2ENWA 1KOLA 3ZLVA 3ET5A 1PL7A 2P9YA 1ZJ6A 2GVZC 1R0LA 1Z6XA 1WE2A 3ENNA 4IJKA 3ZU3A 4BKOA 4CQLA 3OKAA 3IMFA 2IYWA 1OIWA 3PHJA 3JYLA 1JXAA 1F5NA 1RACA 4GX2A 4AMYA 1H5NA 2JEOA 3RUDA 5BUCA 1Y8RB 1YVEI 4QGFA 1CF2O 2JBHA 1O8CA 4LGVA 1HYEA 4HH3C 1KJYA 2H9YA 1NXQA 2CGEA 1AGRA 1J99A 1U2PA 4RV5A 3WB2A 2RAUA 1RWNA 4DG8A 4F5DA 7REQB 5IG2A 1APBA 3OQNA 1SXQA 4JU9A 3U81A 1U8TA 3HCNA 1DDOA 3HPQA 4HEA1 4M6WB 1I6MA 3HSKA 3WQSB 3I8OA 5HDBB 5EKSA 4KPGA 3JR7A 5K3CA 3HXQA 5KTNA 4MO9A 3OFNA 5EHXA 1FVOA 4TGLA 1G63A 4D3ZA 1Z9BA 1YULA 4EATA 2WF5A 1OWMA 1YMUA 1LW6E 1SU7A 4HVTA 3T7CA 3OPYB 1L7BA 5FR2A 4AZ3A 4DLVA 1TL7C 3NG1A 1U2QA 4NFHA 2YDYA 1QDLB 4PY2A 2HF8A 3ETJA 2LD4A 4LF8B 1X0XA 2MOKA 3QE3A 4PO3X 3BD7A 4AJKA 4K1XA 5DRTA 1QZXA 4ALKA 5C51B 3JAWA 1OASA 1UP7A 3ZWYA 2PH7A 4CR7A 3DBOB 1QJCA 3ONFA 1R0XA 1E2FA 2HO5A 2AOTA 3K4HA 4GYJA 3ZW8A 1NJFA 3LCMA 4U7FA 4D7AA 1KFJB 2QVXX 5DOVA 3R1IA 4LYEA 4LZJA 4GFDA 4CL0A 1XMJA 4GVLA 1OAOC 3TAUA 3FDJA 3MTJA 2YY7A 4Q24A 3ZDRA 1ABEA 1YJXA 1IXYA 2HT1A 1U7TA 3KXKA 2SECE 3C0KA 1F8GA 5DBGA 1EH5A 1GRQA 4DZZA 1MIHA 3ETNA 1M66A 5EZYF 3HKBA 1SM4A 1O5IA 4PZ9A 4DA8A 1XTUA 5GGXA 4H60A 5BQOA 3QXCA 2PIAA 4TZKA 2EAUA 3LCUA 1Y5MA 3KEQA 4TUYA 4TV9B 3E7FA 3PGA1 1T0PA 3SR4A 2ZBUA 4BLSA 2XYRA 4LN1A 1E60A 3FHCB 2Z08A 4OAQA 1RZRD 2FSVA 4TV8A 5FNZA 2AXEA 2OENG 1EK0A 1UK6A 2QPTA 3DBHB 3OPYI 2ZRHA 5K03A 5AI0A 4C2TA 3PSAA 5DN6A 2X4GA 2WSLA 3K0CC 4NCNA 4RVHA 4LOLA 4TS9A 3SF8A 2EFGA 1T29A 2EZUA 4WDRA 4P92A 1BN7A 3VYRB 1XL0A 1NPDA 3N2EA 5JY1A 1AC5A 1BXZA 1TQ8A 4RO0A 2GASA 4AROA 3P2IA 1A7UA 3FBGA 3M3DA 3RVOA 2ZBRA 1NW9B 3ML1A 2G6BA 2GN0A 2GD1O 2VJCA 1VSBA 4U7TB 5HFAA 3I2IA 4KE6A 5JASA 1VPWA 2KWIA 2VYNA 4GUDA 1NXTA 3UMCA 4PLPA 3WV5A 3OC0A 5CDYA 5B4UA 1XZFA 4WK4B 1VOTA 1I7DA 2LCIA 4PR0A 5FADA 4Z2YA 3SAJA 4R05A 4B34A 2C7GA 2H9AA 2BCJQ 3B85A 3FWKA 5FHQA 3AV3A 4Y7CA 2O14A 2O8CB 1V1MA 1DIRA 3LUFA 4QDXA 3RK1A 2O0JA 3AEKB 4X00A 1PVOA 4PW0A 1QANA 4WGFA 2FX5A 4IP0A 3KSBC 4U1RA 4D45A 1RRCA 5CB0A 1BGXT 3HMKA 4DMMA 1N5OX 3MW8A 4YJKA 3RJMA 7ADHA 2R65A 2G5PA 3R5JA 3K0CA 4FCWA 3FJYA 4JLDA 1Z26A 5JI2E 4DEXA 2QUAA 2CHVA 1GCIA 2MYUA 1S7GA 3GRKA 4HQNA 4IS2A 5HIAA 3QE2A 3PGLA 4C21A 2PANA 1RXCA 2V98A 3IUQA 3NM5A 2ZJ1A 1WMSA 1LFDB 2A92A 4TRJA 1JPUA 2AC7A 4ZP1A 2J3JA 4BUZA 2CE2X 5JZBA 1GGEA 4X97A 2H08A 3RFUA 2GFHA 1G66A 2Y3IA 3GN1A 4NBLA 4RNCA 1DZIA 3O2QB 1WAMA 1E2NA 2Q5FA 4CU5A 3N6XA 2OCBA 3TLJA 4I1YA 2WWWA 5HK9A 4NDNE 3RC9A 1PZFA 4X63A 3CSDA 4IOJA 2VS1A 4JENA 1KARA 2EW1A 1EVYA 1OTXA 2ZT7A 3ESDA 1MO2A 4M1WA 2R5FA 3BGIA 3P2OA 1Q21A 5T4FA 3TZCA 5A6VA 4CKCA 1II9A 5IKOA 4R16A 3GFTA 3T9AA 5IWCA 3R3HA 5AO9A 1DKUA 3C7TA 2W2LD 1X7WA 2W71A 5EP1A 2YMPA 3BFVA 4DCPA 4D4LA 1CUDA 1K98A 3BQMB 2Q8QA 1N9GB 5BW8A 1DPFA 5JXGA 4PLZA 1XJ0A 2JFWA 2Z1DA 4B6FA 3JALB 1DBIA 4LBYA 4KN9S 5EIWA 4NP6A 3MA0A 2XCUA 1TYEB 1JMVA 3F7OA 4PIPA 1SMKA 3JQAB 3HY3A 5HF9A 3HVJA 2O1WA 1SC4A 4OGKA 4CCSA 1Q1ZA 3H3JA 2QW1A 3E9EA 3U6KA 1UBHS 2IZOA 3FYUB 4PZUA 2WTEA 1ZMXA 4I1SA 3AERB 4GE0A 5AICA 5J3JA 1BHO1 1DPGA 2FMXA 2P79A 1SHJA 1EUYA 3PWTA 3D6TB 1A8QA 4D57A 1T3GA 2Q1UA 4UOZA 1NVEA 4PLYA 2OEPA 3CJRA 3D4PA 3QXJA 2G72A 3KP1A 2WD8A 4TL6A 3IUYA 5DM4A 2R8BA 3BDAA 4ZCRA 1XVIA 2RJNA 3AKCA 2FSHA 3UOWA 3SJ7A 1P0MA 3K73O 3GG9A 2HMUA 4PCUA 4QGGA 2P27A 5LYJB 4DM3A 3R6LA 4CTMA 2C31A 5GM2A 4W5OA 4M46A 5E2IA 1KI2A 3GV0A 3NW9A 4JYCA 2GM5A 5HCUA 2OYRA 5B4TA 4JR2A 4W5JA 3RUPA 4B6JA 4BPBA 3X2SA 2I1QA 4B48A 2DP4E 2Q07A 5SYNA 1JEDA 3UICA 1HY3A 2NVUB 1CUBA 2R84A 3KR2A 4Y30A 3P97A 1ZH0A 4EUNA 4NAHA 2D13A 1J9EA 1H8EA 4MOWA 3O9MA 4GGOA 4LYAA 5LNK1 5BPHA 1VCHA 1R8QA 5LYYA 3A06A 2XH8A 3DWIA 4ZI5A 1VBKA 1U98A 4FFRA 4GZMA 5K0LA 1L5LA 4BZPA 3GLKA 1G20B 2OUIA 1ZH4A 3UGKA 2C20A 3CUYA 3I9OA 1J21A 4RXUA 1E9SA 1S9HA 2O7VA 5DEOA 5BWBA 3L2OB 3K9GA 4UEQA 3TQQA 5E7IA 4ETIA 1YACA 3SNHA 1CEEA 2ECPA 1E0JA 3MOGA 1YU9A 1IPEA 3F71A 4IGAA 1E2JA 2Q6IA 4B9AA 3FOCA 5JAQA 1VC2A 5EUQB 5IJ0B 5JMOA 4R41A 2EW2A 1RJWA 1QPGA 2AWOA 3CX8A 3PG5A 4YALA 1KWKA 4X9XA 1OX4B 4GH5A 1U02A 2BSQA 3P26A 5EI5A 3EPHA 4NNJA 4BMDA 1IZ0A 1KI1A 3FUTA 4HL6A 5EE1A 3WDMA 1XFAA 4UUNA 4MYHA 4QFBA 2AR0A 2C4WA 4WDQA 2V8BA 1RJFA 1XVTA 2Z2IA 4Z53A 4MV5A 1KO1A 2XR1A 5TF4A 2QVLA 3JD3A 2AIRA 5LWHA 2OBXA 2ROQA 1RWVA 1BEEA 1QHYA 3M2TA 3M4XA 1UL1X 4QJIA 1HE2A 2J6HA 5A3JA 2ZYWX 1SUFA 4PV7A 4ZK2A 4JLJA 2QKYA 3WSTA 1PUXA 4OM8A 2NOAA 3CEPB 5AKIA 4C3VA 1WDTA 4UMVA 1FZQA 3NASA 4HB3A 2Q7DA 2O06A 3COSA 3OP4A 3I2GA 4UXHA 4N5DA 2XJ9A 1XZMA 1YZKA 3T35A 2CEKA 1BQ3A 1PJLA 1FK8A 5C8DA 3WV4A 5I7OA 1O8BA 3HFJA 4ND8A 3IUPA 4BB5A 1XIVA 4UASA 4HLQB 3VZRA 5HRAA 3I9MA 4KVAA 2D8AA 4AP9A 2N3ZA 4IDNA 2HO4A 1U3VA 1JLKA 2DJIA 1NI3A 3CH6A 3HBJA 4HNRA 1ULAA 1TVCA 1ZOPA 4G81A 1E0SA 1NBME 1NONA 5HTOA 1GPMA 1B23P 3NHKA 3DFKA 3ZC3A 4Q1AA 3OFND 1RRPA 3LVQE 4AJ2A 2IYTA 4DYVA 4ZCTA 1NFRA 4WXMA 4HT3B 2ZYRA 5AM2A 1E0AA 1XQWA 1KMNA 2I99A 3NWBA 4BTVA 4LQDA 5T64A 4D9CA 4QUAA 2FEOA 1E7SA 2HMYB 5LQUA 3IGFA 3ER9A 3AEZA 5K8JB 4KMRA 1S8NA 3PUIA 3BFKA 1NZFA 4LF5B 3N70A 2IIQA 4RL6A 3KTAA 4E03A 1LNQA 2RHHA 5C4GB 2B4YA 4RXTA 5FBHA 3BICA 2VJNA 1V7QA 4X24A 3AVWA 2O3RA 2ETXA 1X7XA 4B3GA 2EATA 4DV2B 2C5FA 3KJIA 3WYCA 4RTQA 4X41A 4AULA 2CDRA 3OEEA 3EH1A 3VUEA 2RH9B 3ENKA 1PR1A 2VSOA 3D8SA 3QUCA 3T3GA 5C7YA 1KMHB 4G97A 2D1RA 3DGFC 4GT1A 2VTBB 5EWLA 2NV0A 3OQIA 1VFNA 2W48A 1HEUA 2JI6A 3CC8A 3HKDB 4KQMA 4MPPA 4MUGA 1JDUA 5HOQA 1SN7A 3M70A 5TNXA 2PA3A 3N0WA 1ULTA 2UZ4A 3IEUA 2H5JA 1JLLA 5ICFA 5KAMA 3LUPA 1MAUA 3GLHE 4UNNA 3H2SA 3KXIA 2Q5OA 1JUDA 1Y1SA 1JDNA 5GJVC 4UU1A 1V35A 2BMAA 2YUIA 4NZZA 3RFFA 2REBA 2GK3A 2PUEA 1EG2A 4NCHA 1DADA 2Q62A 5I5EA 2XDYA 4GX5A 2OXRA 4TVBA 5C2JB 1E98A 4ZAFA 1IZ7A 1CY4A 4I9UA 3NNSA 5FWAA 1WVMA 3SXUB 4YAFA 3OETA 2G4LA 3H84A 2R2AA 2BUAA 1O96A 1VDZA 1GYQA 3BIJA 4IWYA 2J9RA 4UM8B 4WOPA 5DN6D 2ZBDA 4G0UA 4G8DA 3AVOA 1J0AA 1SWWA 1LI7A 2EX1A 1S2IA 1ZR4A 1IMOA 1KO4A 1U0FA 5LOVB 3VR0A 4CM8B 1N9ZA 4O2BF 5FULA 1A8SA 4ZRNA 4DIEA 3WZLA 1FDTA 2O2XA 4DZRA 4WOJA 2OO7A 4Q15A 1GCAA 4JBIA 3PVZA 1CQIA 3M89A 1U0LA 1XEFA 1R0CA 4JNKA 4MR7A 4M8SA 1TYZA 2FR8C 2PWPA 4R6WA 3DOIA 4WZBE 4J0EA 2EC5A 4XARA 3S7TA 1G59A 2CVHA 2GNAA 4D9IA 4B31A 3MGGA 3H2JA 4X6YA 3T5GA 4CRWB 1O0BA 4XSHA 3FB4A 5JCOA 1GRRA 2XV1A 1PV2A 4UHBA 1T2FA 1J2RA 1MO6A 1CUZA 1IH8A 1U6KA 1Z0SA 2PXCA 3CZ4A 2Z43A 2HDHA 2MJLA 2Y1KA 3QGMA 1MPTA 2X7JA 4EP1A 5BR1A 5JMPA 1OB2A 4ZYWA 2CY0A 1FMTA 2X4IA 1OTYA 1W0KA 3WIOA 2X86A 2KW5A 2LW7A 3A10A 5H1YA 2RGGA 3AX6A 3OZTA 3QU5A 5EZYA 5HMMA 5FT9A 2P3SA 4LY9A 5JHHB 3I34X 1WMAA 2H1SA 1O9HA 1T36A 3N8DA 2YH2A 3O82A 4YAKA 4HTFA 1Q1BA 2IZ7A 2FV8A 3IB3A 5J9FA 4ZIRB 1PFKA 1YTLA 2ZR9A 1P5JA 1CR0A 1L4EA 3K0AA 5F64A 4AO8A 2FR8A 1UOPA 2J08A 3SM9A 4ZCLA 1NDHA 2P68A 4KE7A 4D98A 3TLGA 4ZGGA 2P2CA 2XCIA 3EDQA 3AF6A 4IOKA 2FPXA 3HY4A 4YR7A 3AQ4A 5DTQA 4CKXA 1TDJA 2A7QA 2QL6A 2QE7A 3HKCA 3QBEA 3VKHA 3D1JA 2OVBA 3AESB 1MAWA 1Y5LA 2CLHB 1GN8A 5AKHA 3TBFA 4KXVA 4Q9AA 4C2UA 4L4XA 3CEAA 5FOSA 2FKAA 4FFPA 3AVYA 3OO0A 4PG6A 2XUDA 5CR9A 5REQB 1PAUA 3G9XA 4MP6A 5JHGB 4MRMB 3R9XA 1JTEA 4H15A 1A69A 5DDIP 4ZQCB 3ITEA 1PDOA 3FKSA 2EOAA 1MJGA 2CJWB 4OM7A 4MR8A 4BL5A 1HDIA 3T15A 4REQB 1XEWY 3QLJA 4BX0A 5BV0A 5AYVA 4M1YA 4LG1A 5COBA 2G25A 5AVJA 2CUZA 2VPQA 4QOSA 1W5EA 4HRAA 3MRXA 4DE5A 3H11A 2RARA 4ZAZA 5JG7A 1WD7A 3W8RA 5I8WA 2PWYA 4ARZB 4BQIA 1EDOA 3KTFA 4A3SA 3OFKA 1E2MA 1ECPA 5I9IA 1MRZA 4CDGA 3H6HA 3HB0A 4Z5XA 4DZTA 1TI7A 3P9RA 1SKYE 1H8HA 3RRZA 3PA8A 3F6YA 5CPBA 4Q3NA 1B6TA 2GFQA 5A03A 5F21A 5CDUA 2E6KA 4IDGA 2QPAA 1PUIA 4P5EA 1C4XA 3NHSA 4PCLA 3WP0A 3PF8A 2DTEA 3L07A 3C3EA 1OFVA 2D1TA 3UJ8A 4S0XA 8AT1A 4UATA 4LXGA 4XGIA 4PSKA 2BZ0A 4RV4A 3A27A 3HEBA 2IYEA 1X70A 4MS4B 3M6UA 1AO3A 5TRTA 5L3VA 3NFYA 4Q4DA 2O07A 2DC1A 1LVGA 1I4TD 1ZD4A 2XKBA 5L7WA 2OHVA 1VPEA 3CT4A 1KI6B 4KLZA 4TYPA 9LDBA 5I4IA 1RZUA 1N57A 4QT0A 2PRYA 2C59A 2XVMA 3GUVA 3UA3A 1BEUB 3KYCB 1GA6A 3UGQA 3NR2A 3MS2A 2PVSA 1HI9A 1KTVA 1H8ED 4IF6A 4NBVA 2O23A 2R68A 2ZIXB 2PSJA 4P3PA 1JQAA 4W63A 1X7ZA 3QPCA 1SEVA 3ZGVA 3SHTA 3NDBB 4GNRA 4V0NA 2QTRA 1KK3A 2I3DA 4FC6A 3NDRA 3IDZA 4M1EA 1LV7A 2HTFA 4NEQA 3O0TA 1BMDA 1PZHA 1XZBA 2AUTA 2Q49A 4M9QA 4P7FA 3LZDA 1DAHA 5EL0A 1W2HA 2CVQA 4Z86A 4A2WA 4ESHA 3NAZA 3A37A 4U2EA 4TMZA 3O91A 3T7IA 3TCXB 3H9JA 4GPD1 1ULZA 4G24A 2O54A 2IDKA 1BKYA 1GGMA 1NU8A 2HBRA 3K8QA 2R6CA 2GBCA 5IC6A 3T5TA 3TB6A 4EFNA 4Z54A 3S40A 1U9CA 1QP7A 3H4IA 1OILA 2CMFA 5CHEA 4KYIB 2FN4A 5I9NA 2P5YA 4FMDB 1EGVB 4C0KA 5IT0A 2ZM6B 2BGIA 1JFLA 2V6GA 2QTVB 2AUNA 4X8LA 1I36A 3Q11A 4YDSA 3OCYA 1CUYA 1Z6YA 1G64A 2DBZA 1U8FO 1VB5A 3AR6A 3MUOA 3N39C 3P9PA 4OK3A 4PF1A 3TRDA 1RPTA 2AJDA 5CFOA 3O8RA 3HUTA 1EZZA 3EGWA 3IUNA 4TRRA 4LWOA 1T5SA 4EGJA 3OF3A 3IOCA 3MWEA 3LG2A 1X74A 4K5QA 5A9SB 2O8BA 4M88A 1JV2B 5IKMA 4WEQA 1Y9EA 2C83A 2Q27A 1GAWA 4GX1A 4LI3X 1CZUA 1P4GA 1MW8X 3N2NA 5FBWB 4CMEA 3LT4A 2Z83A 2BJHA 2VAWA 1JNYA 4OG2A 1FUYB 3LD9A 1MJNA 1WUJS 4G26A 4LHYA 3N2GB 1XRPA 1CRWG 5IXYA 1HTTA 1E1DA 4WLFA 1JHZA 4M36A 3HV0A 2L0XA 3AF3A 4UPDA 4WXRA 4AZVA 5CLFA 3HA7A 1YKSA 2CNLA 2W93A 3ZHQA 5TS3A 3EPKA 3YASA 4E21A 4DMFA 2X40A 4XGRA 2IBMA 3AG5A 1NXOA 3ZDYB 2BSXA 6ABPA 3W5IA 3AUFA 1DT3A 2EFEB 2XNDD 1PQWA 3PITA 4JJKA 2J6CA 5CLHA 1R6DA 2JGAA 4L5AA 3VZDA 3CY6A 3COWA 1EHIA 1QH9A 3K6JA 4YP5A 3V32A 2FJUA 2X2PA 2B5VA 4D41A 3PP8A 4KNWA 4PS1A 2WQ7A 1FVHA 3OLVA 3RTDA 1FSGA 2OPHA 1QGUB 2JKVA 2H3EA 4Y6PA 1HUQA 3GY0A 5EJ4A 4UOEA 2AUMA 1I7NA 4AZWA 2VI5A 4DUGA 4CG3A 4GLLA 2G76A 1UM9A 2BKEA 2YV4A 5JC1A 1QO0D 2CLMB 3FZQA 4RA6B 2OOKA 5K3SA 1X1DA 4NHEA 5SICE 4FYJA 1SD5A 4RCZA 5H9WA 2Q4TA 3QFSA 1EE2A 4PGFA 3PE6A 3WYDA 2BZ1A 2JFGA 3FWYA 3SSAA 2V8OA 2L69A 3INGA 4KREA 2ZJ5A 2FN3A 4TM8A 4E6PA 5ED4A 2G9RA 1L4YA 1OZ0A 1D2HA 1B00A 3A1SA 3GCWA 3OEED 2P2ZA 4M21A 5ALFA 4A91A 5CB4F 2VQSA 1UJMA 2CN1A 4YMIA 4MW6A 3AUKA 2MINB 2XDQA 4V2UA 3WOHA 2XKKA 1VE3A 2G1JA 4FW9A 1GPWB 1NMQA 1G2PA 1OLXA 5IAGA 2BFEA 4Q39A 5K8CA 3UMFA 2ZIFA 1A9YA 1FFEA 4TWBA 2ATIA 1V4BA 2HGZA 1OI3A 3NGXA 3QBDA 2IGTA 5C8XA 4E2FA 1NBAA 1TM7E 2JBAA 3OZWA 1U3TA 1OPRA 2YASA 4R8RA 1JPJA 4O63O 3NI2A 5ITZA 2XDAA 2R0QC 3BRQA 2CNWD 4U00A 4TLMB 3WYNA 4B75A 4RVCA 1OH6A 3TMYA 2FSUA 2KBFA 4ARSA 5HIKA 3SC2A 1QHIA 4GKBA 2QLMA 2VPIA 3L0ZA 5DHUA 2HEGA 5LMCA 3L7CA 1HT0A 3QITA 2AZTA 1Y7IA 3FWZA 2JJ1A 3WBBA 3ZEIA 5JO0A 3W5BA 3RT1A 3PR2B 3NUQA 2PZGA 3EFEA 3QNMA 2O4UX 4B81A 2G9QA 2IBSA 1JSLA 1VPTA 3MTAA 4Q9IA 4DSOA 2X0DA 4Q3KA 4Y2SA 2DPXA 4JLUA 4FUQA 2JI7A 1DJPA 3A9CA 3KSDO 1NBIA 3TSCA 4ZHQB 1U8EA 4KYVA 2VWQA 2NO1A 4YRBA 5BWMA 4V24A 1BMTA 2ZS8A 1PBTA 1KWGA 2IBTA 2XWBF 1GKKA 2X4LA 1P7ZA 3F7MA 3PNSA 2Y99A 4KFTA 2EWWA 4QO7A 3QW2A 5ALPA 1B74A 2O2DA 3N8NA 4ZMSA 3VV3A 3ZXUB 5AFSA 2JK1A 4JASB 5GPBA 3UF0A 4MCAA 1W87A 3D8UA 3WJ7A 3T99A 3EB9A 3W6NA 1PP4A 3S2EA 4YR9A 5JMWA 3UKOA 1BH6A 2FVXA 5H59A 1V45E 2F62A 4GG1A 3X1DA 3ZZUA 1U4OA 1T0UA 4I55B 5TB5A 4MPJA 3V8BA 2J67A 1JHQA 5CA0B 3GGPA 3WLSA 1AGNA 3RUEA 2PXHA 1W0KD 1ZMRA 3EGVA 3F4LA 5BMVA 4LY0A 3E3OA 1TK3A 2ZSIA 4HPJB 2R00C 1L7VC 4BO4A 4F2WA 5C5DA 4MQEB 3WFZA 1MG5A 4A15A 1M8GA 3K72B 2Q28A 4LJ5A 3VNUA 1CW2B 3B5IA 2DB3A 5ER6A 5GJCA 1YK0A 3RK4A 1AKEA 3GLSA 3VR6A 1P2DA 1AV7A 5ISMA 3BTVA 3EQ2A 5M5BA 4QICA 1IVSA 3IILA 2HWWA 4EIWA 1XCMA 4OJKA 2GJSA 4CE6A 2WFLA 1AGXA 4V02A 4ZAVA 3B2QA 1YQWA 1NW4A 3NOVA 4ICIA 4EPYA 4TKLA 4P36A 5COQA 2CBZA 4I4NA 2QYHA 4QYTA 2GK4A 3NGMA 4O2BA 3PQ2A 2ZJ7A 4R8MA 1R64A 4F3NA 2PKWA 4M1TA 5KSYA 2R66A 1J8YF 1CHDA 2FKNA 2GPWA 3FHJA 2UVPA 5BSMA 3D6HA 1IXRC 5BWCA 2ZTMA 2JAUA 1P18A 4BVAA 4RELA 3VZQA 4ZVRA 1C7RA 2ZYGA 5JXWA 3W6UA 4M9CA 2JVIA 5CM2Z 1V7CA 1A2BA 1R4NB 3VO2A 4Q4CA 2W2VA 4GM4A 2R00A 1Z6QA 3IAS1 2WVHA 1W4CA 5TPWA 2BIFA 1V9SA 3K9WA 4C3ZA 5A4KA 1N1DA 2VJKA 1UPAA 2FEMA 3EGDB 3HB1A 4LSWA 4O1HA 2TECE 1ZD1A 3OZDA 1FP1D 4YVFA 2EP5A 1BDIA 1XMXA 1SRQA 3BMNA 2PGXA 3AH8A 3QMPA 1SVOA 4F38A 3C1TA 3BYZA 4I4IA 1XJQA 1T2VA 3SYNA 4ZTZB 2Q2NA 5DEIA 1J0DA 4U2BA 1P5ZB 1QGDA 4QTUB 1H8HD 2DERA 3FTEA 3U44A 4MJ7A 1GDHA 1HF3A 1FFCA 4B7CA 2ZTSA 4KQEA 4LYDA 3BOSA 1DEKA 1X14A 3UJAA 5FEUA 1J9GA 2B36A 2YW9A 821PA 3RK0A 2QUBA 3T4UA 3P9NA 2ZW9A 4KMOA 1N5IA 1UMBA 1Y37A 4DLTA 4E7OA 1JWBB 3D0RA 3BE8A 3WWYA 4DGSA 2EFDB 4ZYLA 2DWCA 3A2MA 3KDPA 1G5QA 2AXPA 2VQDA 3WDSA 1Z39A 2Q2VA 1IUOA 4RWEA 5IRCD 1E3WB 2PTHA 3BAFA 4V3CA 4YWHA 5AUPB 3G8CA 4NS4A 3QXXA 5ALTA 1O3YA 4RDIA 1OYWA 3DT9A 1FP4B 2VHJA 1LPNA 1RC0A 4BQNA 4ZCIA 1QVAA 3W2TA 2A33A 4UNPA 4OA5A 2KI5A 5L4NA 4FKZA 5B58T 2K5UA 4R71A 1G7SA 5AKKA 4F46A 1YT5A 3Q2IA 3ENVA 3JQBC 4QXRA 4HO1X 5DNWA 1KR2A 2DFPA 2G09A 4HH0A 5FL7A 3UB3A 4YT2A 1KQGA 2QYOA 2H29A 4ER7A 5A6SA 3KKMA 4YI5A 4BO0A 1DCFA 4GL2A 5NLLA 5GMOA 3QVMA 5BVHB 1Z7GA 2BDTA 3WGHA 3O3OB 5C7OO 2IX9A 3DZBA 3IXQA 4WN3A 1TQ2A 4C4ZA 3OJFA 1YUMA 1YZQA 4WTOA 1VCNA 1KH1A 1V7ZA 1IIBA 1MB9A 4OJTA 2HR1A 1LBTA 1ONOA 1M2NA 2GEJA 2NAPA 1QH0A 2RI6A 2NO7A 2XAUA 3A70A 3DXFA 3EVDA 3PC3A 3PNQA 5DTIA 5C8ZA 5CBPA 3L0OA 1E1LA 5ALZA 1VCIA 1TLLA 3IAFA 2B3TA 3ETDA 2Q1YA 2ZG6A 3F1LA 3M5PA 3NHRA 2J31A 4MIYA 1S8FA 4DLWA 3Q0TA 3K9FC 2J09A 3IJEB 3OMLA 3ZIUA 5KC9A 3FYDA 1AO0A 1BD4A 2HT6A 3TRHA 1YNOA 2HM7A 2X2FA 1W34A 4NOJA 5TT1A 4C5CA 3BCUA 1Q1AA 3IDQA 4PR3A 5EGSA 2YWEA 5LB4A 2PD6A 4Q48A 3NHYA 5JDCA 3VU3A 3MD0A 2GN8A 1D0VA 1T2NA 1Z0IA 2ZIEA 3Q5GA 3WYAA 1MC1A 4HNGA 2GEFA 4FKMA 5T6MA 1FX1A 1PYOA 4O4LB 3X2FA 3GR6A 3JQBA 1GVHA 3DLHA 2E4WA 4CQNA 3SMQA 4ER6A 3QXHA 3L92A 4OLHA 4Y1GA 3UJ7A 1A9QA 1CNEA 3A4IA 3E4DA 2HXSA 4FE4A 2J9FA 3LLVA 3HVIA 4PSDA 1WDWB 3BL5A 4N0DA 1J70A 3K9LA 4GU5A 1T6BY 5EIOA 1LJUA 2QUIA 3IQEA 4LNAA 3R7WB 4N82A 3CYFA 4IDFA 5JWOA 2VK1A 2ZQZA 3Q7QA 1JT9A 4XB1A 3UWPA 4D9FA 3MILA 1RQGA 1TOAA 3VKFA 5MHTA 1Q84A 3PJGA 1OFTA 3PQ6A 4JJGA 5FWDA 4HAZA 2HTEA 4PAQA 3TIFA 3JARA 4RS4A 1GRVA 3EDYA 3KD2A 1FUIA 4MPRA 1OWPA 3WBJA 3M6MD 3SR0A 5K0TA 1A88A 2PZAA 3CZCA 3QFRA 1RRGA 2V6FA 1X38A 5K0JA 3RS3A 2HYIC 4WK0B 4PBRA 3E2MA 2V7PA 3A8TA 4QVGA 2EV9A 1ISPA 2HQOA 3KELA 4BZZA 2WTNA 3VO1A 2ZZNA 3Q72A 2ZAGA 4YUZA 4Z2AA 4IG4A 3O5AA 4YJHB 2NT3A 4RPCA 1A9RA 1AUOA 3PHHA 4ZRDA 4F85A 5MGBA 3IB6A 1G6KA 4G0WA 1T9BA 3EF0A 2KLBA 2YWBA 4MRRA 3QV2A 4RACA 2Z2YA 1Z82A 5ELMA 5HK8A 2R6GA 4DA4A 1NQWA 3ZPXA 4RKYA 1PW7A 2XYVA 2YHSA 2GN2A 4J49A 3UMGA 3JQGB 4RBNA 5LA6F 1UPTA 3M0EA 4F92B 3F9CA 5E7QA 1FYFA 1R37A 4F3TA 2IHKA 2Q6TA 1B8NA 2B0CA 3CMMA 1GUFA 2A5DA 3LUGA 4ZT2A 5FPSA 5K7SA 5EJ5A 3PJRA 3HG7A 4CUKA 4R1NA 4RHYA 2XXAA 5IAAA 2BFWA 3V1LA 1AD2A 1PD1A 1YC5A 5E1OA 3PWKA 4ZI7A 3J80A 2MYNA 2C7VA 1FPMA 1XLWA 3HCBA 4P9NA 5DBIA 5JATA 4Y2JA 4ND1A 2F3RA 4UHJA 1D03A 2GN9A 1EA5A 1O4VA 4KXQA 4ZCPA 5IMBA 1U8YA 1O97C 1XDZA 3VR4A 4AB1A 2RHGB 1IQRA 3AFOA 4K86A 3CLSC 4WNAB 4R8LA 2AL7A 1NMSA 1VE5A 3EW9A 5AJWA 1SQFA 1XAIA 3A3KA 3H0CA 3PHGA 5T57A 2Q9AA 4PGAA 3P4YA 4QDTA 2GZ1A 4AC9A 1XPOA 1LNZA 2BM9A 4MPDA 2CYCA 5KTPA 4TMXA 5HPYB 1GPH1 5K8LA 3WGZA 2PWZA 4EG7A 1KK0A 1O08A 2GEDA 3KG2A 1SVIA 3D8BA 4I1UA 1U3DA 4EB3A 5K99A 1KU6A 2J45A 2WIDA 3MYRA 1SIBE 3OZFA 1DKPA 3PGXA 3WYEA 5JRDS 4MYRA 5EMHA 5JZSA 3ZWAA 5A2QA 4QUJA 2ZUTA 2LIVA 3MB8A 4A5OA 4L76A 4J3JA 4NZYA 1XZQA 4TWRA 4EQZA 2PJRA 4IVPA 2NUAB 2XPCA 3F2IA 1N0IA 4FW8A 2O8DB 2O2ZA 1GAEO 2QVYX 3OBIA 2QMEA 3CQ9A 1KEPA 121PA 2ZYIA 5CFNA 5G1OA 4R6XA 5CTJA 2NU6B 3NALA 2B98A 2J5KA 4N7RA 4E08A 3WKCA 5C1DA 1P6XA 1WSWA 2VXBA 3LNCA 2IPOA 2DVMA 4MB0A 3VUFA 2I87A 4B3JA 4E5PA 5BW4A 1MORA 4QGAA 4ZQFA 2DQYA 2B7LA 2QI9F 3E35A 4X8OA 4C0WA 1SVLA 3HDYA 4TT3A 3OVMA 3WADA 2BGLA 1PWEA 1XLTA 3NQ41 3CT6A 3ZCQA 4ND2A 4N6GA 3G6KA 3NMUF 3KBOA 5EHQA 2RGYA 3MUFA 1LPSA 1W48A 4K9DA 3FJ1A 4M0FA 4NZPA 5IVDA 2F17A 3F49S 3KQVA 3R7LA 4BMCA 1F8XA 1YB6A 3HPRA 1NR1A 3EOZA 3WLIA 3BB3A 1XAJA 3TTUA 1BROA 5FUXA 1GTVA 5EJIA 2W2QA 1GVNB 4AO7A 4ML3A 4OQFA 4EW1A 2A0YA 5CDFE 4C20A 4ZYYA 1JYFA 1U7WA 3FTCA 3TKLA 2FZLA 3L4BA 1ISFA 1AZLA 3H1BA 2OXFA 2YZMA 4KCGA 1QIFA 2I2FA 2RGNC 4MVJE 2CB9A 4EARA 2ZRQA 3PZRA 5ECDA 1FEZA 3NB0A 4DDKA 3PEFA 4O4JF 4Y9TA 4CFYA 2ZSHA 3DXYA 2A4KA 3GQBA 3QWAA 5CGQB 3UENA 5ESRA 2AG6A 3Q6NA 4EPRA 4LXUA 3TZBA 1EWKA 3KBBA 1YHZA 4X90A 3R6TA 3EVZA 2J87A 4MMYB 4ZOAA 1T4CA 3DFZA 1X80A 1T9HA 3DB1A 4X3OA 2GZAA 4Q4LA 1BWQA 3KDAA 2G40A 3KEGA 3KOXA 1AKMA 1CG6A 2LCQA 1Q14A 5G0WA 2A9FA 3ZYZA 4C0HA 2XDWA 3IDSA 3RBXA 1W7AA 1ZH2A 4DYDA 2XLBA 3ZD7A 3A1DA 1YTUA 1GNTA 3DA8A 3O94A 1DC8A 3L4JA 3I73A 3GGCA 4KB5A 1ZUNB 2XIJA 2R5WA 5ALUA 2B1IA 4MIOA 1AQIA 4HDMA 3ROTA 4CBVA 4DXAA 4ZYUA 1GCOA 1Q0UA 5J5AA 5F98A 4E1BA 3WGIA 4EYQA 1ZW1A 3MSCA 1TVKB 1VJGA 4QBKA 4J3FA 3VBCA 3W2IA 3MGKA 4LUCA 2Y71A 3KLOA 4AMVA 4PYJA 1Z2OX 3ISJA 1FS6A 4IIJB 2K2QB 1IN4A 3I6QA 5G0SA 3SC6A 1WS6A 4J1TC 4JL5A 4O4HF