2IDKA

Crystal structure of rat glycine n-methyltransferase complexed with folate
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
291
structure length
277
Chain Sequence
DSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSKDITTSVLTVNNKAHMVTLDYTVQFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 5-methyltetrahydrofolate is bound in intersubunit areas of rat liver folate-binding protein glycine N-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Glycine N-methyltransferase
total genus 71
structure length 277
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 2idkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2idkA02
5FADA 3ORHA 3OZRA 4KW7A 4RX1A 4RYLA 3UJCA 2P35A 2VS1A 3A25A 3JWGA 4GOOD 4AZVA 2B78A 1NW6A 1XJ5A 3EEYA 1EJ0A 1VP3A 2PX4A 3CC8A 4HTFB 2QE6A 2JHCA 4HTFA 3UA4A 3FTEA 3HVJA 4DF3A 2QY6A 3VYWA 4E33A 5FULA 2BR5A 3NTVA 4JXJA 4PYIA 3A26A 2ZCJA 1ZHFA 2IPXA 3GWZA 3IEIA 3G89A 4IV8A 5ICCA 1NV8A 4RTPA 3KQYA 3QV2A 2JH8A 4YUYA 3ME5A 2GLUA 1I9GA 1VL5A 5DTQA 2VDUE 5LR6A 3NW9A 2AOVA 5LQJA 2PGXA 3PT9A 3A7EA 2P7HA 5LQNA 5CM2Z 3FUXA 3SSMA 3OU2A 3C3YA 3CBGA 5CCBA 4PIPA 2ZZNA 4OA5A 1P1BA 4V0RA 1XDZA 3DR5A 2C7RA 1YB2A 5K0EA 4BLUA 1VE3A 2PY6A 3D2LA 1Q0TA 2V7EA 5DX8A 3MGGA 2G70A 3DXXA 4F86A 3M6WA 4M36A 5FA8A 5CCXA 3GCZA 4QVGA 5GOZA 5KYGA 1X1DA 3PB3A 4FSDA 4UOEA 4BLWA 5GIPE 4DQ0A 3NDIA 2UYQA 3MQ2A 4RTQA 2YXEA 5CVUA 4HH4A 3KKZA 5EQJB 5DM2A 4HGZA 5T64A 4C08A 3HNRA 2P8JA 1F38A 5K0JA 4QPNA 1XDSA 2C7QA 3LCUA 2OYRA 1YZHA 3QOWA 2UYCA 1QAQA 5EVJA 1H1DA 4V0QA 3Q87B 5H02A 3BUSA 4ER3A 1UFKA 4GC5A 4P7KA 1SKMA 1QYRA 5K0CA 1HMYA 4MTLA 4RVDA 5ERGB 3B3JA 3HCEA 5GP1A 1R6AA 2G8NA 3GRYA 5E1DA 3UZUA 1QZZA 5K0GA 1KR5A 1R18A 5FQNA 1RJGA 3GGDA 3UJDA 3EGVA 3R6TA 4LECA 1FP1D 5B1SA 4KRGA 5DM1A 1RJDA 4QQKA 1ORIA 5E8RA 1SVUA 3MERA 3P9IA 4GC9A 4XCXA 5D1NA 5T67A 2UYHA 4O29A 3UA3A 3B3GA 1G55A 3G5TA 3RODA 4GBED 4R8SA 5U4XA 1AQIA 2GA9A 1VQ1A 5F2OA 1AV6A 3IHTA 3F4KA 1EJ6A 3B5IA 1Q0SA 5FWDA 1M6EX 3NWEA 3GNLA 3I9FA 3P97A 2I6GA 2BZGA 3GXOA 3NWBA 1WY7A 4PGHA 5DM0A 5DSTA 1L3IA 1RI1A 2AN4A 2AOUB 3FUWA 4GEKA 2AOTA 2R6ZA 4R8RA 2VDWA 3BGDA 4RVFA 3JWHA 3MTEA 2ZIGA 5EMKA 2YXDA 1P39A 3O7WA 2JH9A 2Z6UA 3DULA 5HEKA 2O05A 4AZSA 1EAMA 1P91A 3KQWA 3E8SA 3P9NA 2I62A 2YVLA 3BWCA 4HGYA 5E1OA 4Z2YA 3T7TA 3VSEA 4KDRA 3P2EA 4E30A 3JWJA 4E32A 2CL5A 4DKJA 1YUBA 1RI2A 1FJXA 3V97A 3HA7A 3SX0A 5F2NA 3BWMA 4C06A 5CD1A 5T6BA 4ATNA 5DPMA 5EIFA 3AWIA 5ICFA 4YV0A 3EEOA 2OB2A 3CCFA 3MCTA 3B3FA 3GDHA 3JWIA 2NNWB 3L8DA 4NECA 4AZWA 5CVJA 3LBFA 2IH2A 4L7VA 1O54A 2P40A 3PS9A 2FK7A 2PT6A 5HIIA 3FTDA 1KXZA 1DUSA 1X1BA 2VP3A 3R3HA 5C0OE 3M70A 3VC1A 3DTNA 3NDJA 3E05A 3GJYA 3OFJA 5FQOA 5DXJA 2NXJA 5EEGA 1N7JA 1JSXA 4GOLD 3REOA 4HC4A 3THRA 3FTCA 3M33A 3NVKI 2GAFA 3C3PA 3R24A 3BWYA 5K0LA 2JJQA 5DT2A 4EVIA 3OE4A 2P1DA 2P3OA 3C6MA 1XCJA 1ZKDA 2IP2A 4FP9A 2E5WA 4X1OA 2AZTA 1VPTA 3PFHA 3PVCA 5CVEA 2EX4A 5DRTA 5EC8A 4DM3A 5DXAA 1Y8CA 4P7FA 3UJ7A 4DCGA 4K6MA 1JG3A 5K0FA 1FPQA 2HV9A 3KQVA 5CVVA 2JHAA 2QRVB 3P71T 3EVDA 2QM3A 3G5LA 3NJRA 3MB5A 3G2QA 4P7GA 5FA5A 1JTFA 4DZRA 2GS9A 5GIOE 4P58A 3CVOA 2FK8A 3HM2A 3TKAA 3ELUA 3SVZA 5K0NA 8MHTA 4YUVA 1UIRA 1IXKA 3DP7A 3FUTA 3P2KA 3SXJA 3OE5A 2P3LA 1IY9A 2BH2A 3OU7A 1XCLA 2P41A 3KPVA 5BXYA 1D2HA 2BR4A 4G56A 4QDKA 4PYKA 1M0EA 3G8BA 4YMGA 2I9KA 1QAMA 2IBSA 5HIMA 3RIEA 1YF3A 3HVHA 5DTRA 3LDFA 2EFJA 2WK1A 4ISCA 2ZSUA 3K6RA 5K0BA 3HCCA 4CTJA 3T0IA 5KVAA 1NE2A 3P2IA 1PRYA 3KQPA 4RSRA 2JHPA 3G88A 3LKDA 3T7SA 5HFJA 3HP7A 2G72A 1NBHA 4BP3A 4RTJA 3EMBA 4RTLA 4GOND 5P8WA 2UYOA 2Y1XA 1DL5A 4PGGA 2FHPA 3I58A 5GWXA 4A6DA 3LX6A 2GB4A 5EOVA 1X1AA 1FP2A 3NVMB 2A14A 3GRZA 4OX9Y 5EMMA 4RVHA 4RTMA 4FZVA 4ER7A 4WXHA 5K01A 3R9XB 4LWPA 3OCJA 5E1BA 5FHQA 5LQKA 3KQTA 3R0QA 3MAGA 4C4AA 1P1CA 2AVNA 3DUWA 3KR2A 3QOXA 3T7RA 3KQOA 4RTNA 2K4MA 4KIGA 4YUXA 3O4FA 4R6XA 5D1HA 4IV0A 4RTOA 2VDVE 1MHTA 2AS0A 3H2BA 5E9JA 5EZSA 2B9EA 3AJDA 1WZNA 4C05A 3EVZA 1RI4A 2FRXA 1IM8A 2I7CA 3CJQA 4E2YA 3BWBA 1HNNA 1O9GA 2PWYA 4PCLA 3C6KA 4X41A 4F85A 2NXNA 1QANA 1XXLA 2PT9A 5EMJA 2OZVA 3TPZA 3SGLA 3U81A 4PINA 5E2BA 4KWCA 5LQUA 3RW9A 2B3TA 2BR3A 3I5UA 4PYQA 3TMAA 5FTWA 3TM4A 1SQGA 4PYNA 4FGZA 3AXTA 5E9QA 3HCFA 2YXLA 3GRUA 2AN3A 4OA8A 5GM1A 4FR0A 2AN5A 2PLWA 2ZIEA 4YUWA 5DX0A 3BGVA 4LWOA 1JQ3A 2AOXA 4BY9E 3EGIA 4YV2A 3TM5A 1FBNA 3MTIA 3TLJA 3AY0A 1RI5A 1I4WA 2IDKA 4MIKA 4QPPA 5HZMA 3ELYA 2OXTA 1SQFA 2NXCA 3SM3A 2IH5A 2XBMA 4OBWA 1Z3CA 2HMYB 3A4TA 3EGEA 5EG5A 4RTKA 5EIWA 4PYJA 5BW5A 3EVAA 5KQSA 1T43A 1XTPA 1DCTA 3PX3A 3MHTA 2OKCA 5EPEA 4H0NA 3HCDA 5DM4A 2G71A 4XUCA 4WVLA 4CKBA 1JQEA 2H1RA 4EKIA 2ZBQA 5GINE 10MHA 3UWPA 4IWNA 3UJ8A 2B25A 1KIAA 3C0KA 2BM8A 3KPJA 4R6WA 5DSXA 3TRKA 3DXZA 5LQCA 2QRVA 1AQJA 4PWYA 1UWVA 5KS2A 2AOWA 4M38A 4PYMA 1I1NA 4CWAA 3BT7A 1ORHA 4OBXA 1VP9A 4PIMA 1F3LA 2OBFA 2ORED 5LQRA 1R00A 1B42A 2AOUA 2HWKA 3CGGA 1R74A 2GPYA 2O06A 1WXWA 2EJTA 3TQSA 1V39A 4R05A 5GM2A 4E2WA 1U2ZA 2PWPA 2O57A 3DMGA 4X60A 1OR8A 4CKEA 5K05A 4RWZA 2Z6QA 4X63A 1M6YA 2PX5A 2ZTHA 3FPJA 3LCCA 4MHTA 4KIFA 3VC2A 5HOQA 3DXYA 2PX8A 2XVAA 5C1IA 3ELDA 1KPIA 4E70A 1WXXA 2PBFA 2ZULA 1SG9A 5BW4A 2Z6AA 5MHTA 4PYOA 3DMFA 3HCBA 4QDJA 2XYQA 1G8AA 4AUKA 1RJEA 5E1MA 2HR1A 3O31A 1YZ3A 3PLAE 4OQDA 2ZBRA 1X19A 4GUAA 1XDUA 3TKYA 1JG2A 4C04A 2B2CA 2ONZA 4ER6A 2NP6A 4KDCA 1SUIA 2G1PA 3LDGA 2DULA 3KPYA 5EGSA 3K0BA 2VZ9A 2XYRA 3TOSA 3OZSA 1YFJA 2KW5A 4KVZA 2YQZA 3EVGA 3HVKA 3OPNA 5E8JA 3ER8A 3ERCA 4E31A 4EK9A 2O0LA 3KHKA 2H11A 2OB1A 3KQMA 2ZBPA 3UJAA 1ZG3A 5E9WA 3IV6A 4MWZA 1JR4A 1EG2A 3LHDA 3EVBA 5ICGA 3HCAA 1YFLA 1ZGAA 5JUWA 1NKVA 5K03A 2JG3A 1NT2A 3PX2A 4FT2A 1XVAA 2FCAA 3ELWA 3FUUA 4Y2HA 1PJZA 3UFBA 1INLA 3E7PA 4C07A 3AXSA 1TPYA 1L9KA 5FHRA 3DLCA 2F8LA 4FT4A 2ADMA 4QQNA 4U7PB 5HIKA 3BKXA 2YTZA 2PXAA 1JG4A 3M4XA 3HEMA 3FYCA 3LGAA 2CWWA 4ZTBA 2XVMA 5FCDA 3WSTA 3OFKA 3S68A 3Q7EA 5G02A 5DTMA 1D2CA 3M6VA 2YUIA 1EQAA 2IDJA 3I64A 1NBIA 4P7JA 4XUDA 4BP1A 4EQZA 4M37A 4RTSA 4F84A 2IH4A 4QVKA 3P9CA 3B89A 3GRVA 4M7RA 5CVDA 3GU3A 4POOA 3P9KA 3LDUA 1AF7A 4PONA 4X61A 2NXEA 3LCVB 3GIWA 4RVGA 5F2KA 2CMHA 5KQRA 5DRYA 2UZ4A 5M5BA 1BOOA 1BC5A 3DMHA 1R8XA 2H00A 5BP7A 3IYLW 2OO3A 5FUBA 3FUVA 2CKDA 2IGTA 1TW3A 2N47A 3A7DA 3HA5A 5EEHA 2NP7A 3KQQA 3TR6A 4HRAA 4DMGA 2OY0A 2IFTA 1L3BA 7MHTA 4LG1A 4DCMA 4AX8A 1VBFA 2C7OA 1MJFA 2ZLBA 1VLMA 2QYOA 5K8VA 3PFGA 4DA4A 3E23A 5K09A 3FPGA 3LSTA 2IIPA 3SMQA 2C7PA 3G7UA 3EVFA 4RV9A 5LSAA 3LL7A 4E2XA 5LQAA 1G6Q1 2PX2A 2EG5A 1ZQ9A 3KPWA 5HIJA 3EMDA 3MCZA 2ESRA 3FYDA 2ZWAA 3FRIA 2ONYA 3UJ6A 3FPHA 1D2GA 2OPBA 5EHIA 2PXXA 4GF5A 2DPMA 1N2XA 2YR0A 4AZTA 3GRRA 5HILA 5IH3A 5DLYA 4CKCA 1KPHA 3DOUA 4CXMA 3BXOA 2PJDA 1JTEA 3HA3A 4YMHA 1NW5A 2GH1A 2ZW9A 3CJRA 2ZIFA 4EKGA 4C03A 2PV0A 4FSXA 5CUQA 2EJUA 2FYTA 3B7PA 3BZBA 3SR4A 1NW8A 1SUSA 5JR3A 3M6UA 3KR0A 3G2OA 4IKPA 3BGIA 4XUEA 2PKWA 3SSOA 1JSZA 2HNKA 3KR1A 3X0DA 3KR9A 3EPPA 3FPEA 3OZTA 1NW7A 2P3QA 4A6EA 5FWAA 4CTKA 9MHTA 4EMSA 3LECA 3OU6A 3NMUF 2ZWVA 5EMLA 4YUZA 1QAOA 2ZZMA 1G8SA 4PCAA 4BLVA 4RTRA 3FRHA 5E2AA 3LKZA 2FPOA 4Y30A 1VIDA 1KYZA 3KPUA 1ZGJA 1KPGA 5DWQA 4FS8A 2WA2A 2O07A 3EVEA 4GQBA 1BKYA 3I53A 4HSGA 2AVDA 5EHGA 1WG8A 2LD4A 2Q41A 5CIYA 1G38A 3ER9A 3LPMA 4OQEA 4U7TB 3HTXA 3SSNA 3FPFA 3KQSA 2PXCA 5EZQA 1BHJA 3A27A 3P8ZA 4B17A 2IBTA 4HG2A 3G2PA 1KP9A 3G8AA 5ICEA 3UJ9A 2NYUA 1L3CA 1KYWA 1L1EA 1NV9A 2P7IA 1RJFA 4PYLA 3CKKA 5DX1A 3TFWA 4MQ4A 3UBTA 3LBYA 1JQDA 3KU1A 4ER5A 1EIZA 5IKMA 3PTAA 1NW3A 2PSSA 1JG1A 3BKWA 4QTUB 2CMGA 2ZFUA 3GO4A 2YX1A 3V8VA 3DLIA 3THSA 2PVCA 5EKUA 2V74B 3ANXA 1G60A 2ZZKA 4E2ZA 3FTFA 1KHHA 1RI3A 1R8YA 1N7IA 3EVCA 3FZGA 2AR0A 2ZVJA 2BM9A 2Y1WA 3ID6C 4PNEA 4YV1A 3HVIA 2WA1A 3G2MA 3M6XA 2AOTB 1X1CA 2ERCA 2HTEA 3UJBA 4QTTB 2XYVA 3CJTA 4GOMD 5EKXA 1O9HA 5C9ZA 2R3SA 1WS6A 3DH0A 4ER0A 1TW2A
chains in the Genus database with same CATH superfamily
5JZMA 3OZRA 4CKZA 4KRFA 2P3SA 2P35A 3JWGA 6YASA 1S3GA 3Q2OA 2ODAA 4JJGA 5B1IA 3UYLA 3J7TA 1UCFA 2O0KA 2J0QA 4TXMA 5JPCA 1NXTA 3D0OA 3OQJA 1U3TA 1H2AS 1Q7GA 2QE6A 1MO3A 2HRQA 3R4CA 3CINA 5ALSA 3LXMA 2WOOA 3UA4A 1TE2A 5HKKA 3OT5A 2DXIA 3L06A 1JE0A 2Z8YA 2M98A 4WD3A 4PYIA 4NDNE 1G2IA 3QY0A 4C78A 4AJHA 2OXEA 2VP6A 3RVPA 5J2UF 4Z3DA 1UDWA 1VJ0A 4KLCA 1MB0A 1RXUA 2H4JA 4DPMA 2FEKA 3ZU2A 1X38A 4QOJA 1IBRA 2Z3VA 4LMPA 4PVCA 1N2CA 2QNIA 2QX4A 2J4DA 3VHXA 1LPMA 3BJEA 4NOMA 5DNUA 3I76A 3K5PA 3B1ZA 2IIQA 4HNHA 3Q8KA 5HBRA 4EECA 2Y1EA 1MBZA 1X6VA 4IIJA 4DDHA 5G2OA 3FMFA 1YDEA 5CDUA 2W2LA 3BH0A 4PNHA 1KGDA 1PJ3A 3MWFA 3KDPA 4G0ZA 4H0CA 4ZDJA 5B7QA 1HL7A 2IYZA 2X23A 1VE3A 3JR3A 4ZT6A 1TC2A 1ZRHA 2FSSA 2IP4A 5ER6A 4JA0A 1YZTA 2P2SA 5K3AA 4CFSA 1CHNA 3ML1A 3NC4A 1JA1A 5CCXA 3ZXSA 2XTNA 2F7SA 3MCVA 4J3FA 1LWOA 3C87A 1NBEA 4CMKA 2W2MA 4FLMA 3RYTC 1SCJA 3C70A 3M5PA 1AK9A 2FUKA 3N2YA 1KE2A 4HGZA 4K86A 3TX2A 2OA0A 2PUAA 4N3AA 5J4YA 1J07A 1D0VA 2WI8A 3RHFA 4QGGA 3ICQB 1R1DA 2NU7B 3FROA 3GVXA 4KFRA 4Q1EA 5JD3A 3DBOB 4L72A 1ISFA 4Q3OA 1C7EA 1USKA 2OE2A 4TTAA 5LA6A 5B1HA 4CCSA 1W1WA 4B3BA 3JZAA 4GX1A 4XYEA 4DSZA 1QYRA 2C9MA 2VJOA 1HMYA 3D7LA 3R6GA 1W0KD 1QHHA 4CKWA 1H2WA 3WXBA 1USVA 1LVUA 2OZLA 1R6AA 5ER9A 5JDCC 1OFUA 2P9CA 1VFPA 3FGOA 2MMCA 1YDGA 1FMJA 5CX1A 4EH1A 4P2GA 4O63O 4PEVA 4RXUA 1QZ3A 4QRHA 1XHLA 2V54A 3R6TA 5FTJA 1QRTA 4NP6A 4Q9LA 4AKIA 4MB6A 1NNSA 4NRDA 4C0HA 4F96A 1ORRA 1BX3A 4RLFA 3G9UA 4ILKA 4TVKA 2AW3A 3OTHA 2POQX 5AK5A 1WSBA 1PUJA 5LQMA 1YRWA 1QTNA 1G3UA 3BYZA 4AQ7A 4DOMA 3LGXA 3H4IA 3RRNA 1FSPA 1Z5VA 2GA9A 4HB0A 1GJRA 2P2YA 1RYZA 4KN8A 1U0EA 5U9CA 5KO2A 4PRYA 5C8DA 4UCWA 5ABPA 2C2MA 4GRDA 1N8TA 5DM0A 3RLFA 5CG2A 2X58A 3S28A 3V6LA 1SB9A 2PAFA 2Q5QA 5F23A 2IHUA 1X15A 2Y2VA 1KFBB 2GCPA 1ZICA 4JLWA 2JH3A 3MTEA 3BERA 1NI5A 2OG1A 4WT7A 3RS0A 3CLSC 1M1UA 1Z5UA 1IBCA 3AK4A 2VA8A 4IQ8A 3ZQJA 1DO0A 1WXDA 1XWWA 3AC0A 3RYFA 3JVIA 4P4GA 3UMMA 1EAMA 1OAAA 1RACA 1TIPA 2P9HA 3MNFA 3OJLA 3P9NA 1WZEA 4JJAA 5DF1A 1KRHA 4DEYA 3FETA 1E9DA 1W1UA 3UANA 4FUQA 5JBQA 3L0IB 1QS0B 2Z3ZA 4E3ZA 2ZSDA 4MV6A 1A27A 3R20A 1KO7A 4YA6A 1CBUA 3U7RA 3ZGNA 1A77A 1W7AA 3L4BC 3ETDA 2WJYA 3KALA 1U7XA 2VNJA 3BWMA 1UXOA 3M1AA 2OQRA 5C31A 5I4KA 2WYOA 3QJ5A 1TA9A 3DUFB 1MT3A 3K1AB 4B6QA 4D9FA 2WD9A 3AU8A 4PFQA 2YFKA 2Z2XA 1O54A 3QMPA 4RK7A 4HZGA 2Q9CA 3EF0A 1JKJA 5FRDA 3G9XA 4YDQA 3UOGA 1KBQA 5A9TA 1RDFA 1RWXA 4DLYA 3C1AA 2Y8EA 4MW2A 5JO0A 4N48A 1FLDA 1HE8B 3THRA 1VSUA 2UYGA 2P6RA 2ZRCA 4EG3A 1TCAA 4XB1A 2RCYA 3KC2A 4GMKA 3NVAA 2XTZA 3NBFA 5F51A 1E2EA 1S8OA 1X9HA 1HEIA 1ZCBA 2PNFA 2BH9A 4WZ6A 4BFVA 4UC0A 4D81A 2HWYA 4CT0A 3LBAA 1EM8A 1B8OA 1P61B 2JFOA 3AR7A 2AJBA 3JX9A 1P2GA 2G7MC 1EFDN 2N1MA 4Q37A 4C0BA 1AK1A 1CVIA 5JBIA 2CV0A 3CIOA 1BDBA 1P18A 3MRXA 4HGQA 4YQYA 2ZJYA 2X2FA 4P33A 3U40A 3P71T 4O4LF 4BO4A 4C3UA 4H77A 2HLDD 2GS9A 1FBTA 1IATA 2WM3A 2FI1A 3LYHA 1MW9X 1UC8A 5AHRA 2RD2A 3VTZA 4Y9SA 3WISA 3F1KA 4H15A 4IF4A 3BXHA 3QWFA 1PL7A 1SOAA 4R1OA 3O83A 5JZOA 3OE5A 1A1VA 2DB3A 4WWHA 2PO5A 3QFHA 3W77A 4R8LA 1Z73A 1XTTA 5AK6A 9ATCA 2FP3A 3V2GA 3F6BX 1RLOA 3KKMA 4MGHA 1NG9A 1G16A 1G21E 2A8YA 1N92A 1BXZA 3ANNA 1JB1A 3GT0A 4PSAA 3U44B 3B7WA 1M5TA 3DZHA 1Y9JA 1I4OA 3KAQA 5F77A 1E32A 4ZV7A 3RIEA 3UXYA 2ZDQA 3HO6A 4IIJF 5I5EA 4GBGA 1UJCA 4CF5A 3ANYB 1X9GA 3IUYA 4I4TB 3QU4A 3NBZC 3IJPA 1GQRA 1L8AA 2Z4RA 2I71A 3BIFA 3NT4A 1HDZA 3SJCA 3WSWA 4BP3A 5MGNA 3H9BA 4D56A 1Y9AA 5LB2A 2AD5A 3X1JA 4DILA 3N2IA 2J31A 3L84A 1MG0A 3REQB 1OKKD 2RH9B 1A5BB 1WXHA 5K0ZA 4AG3A 3A6PC 3PQEA 2NUAA 3NIFB 4U5QA 1LD3A 1QX3A 4DCTA 2P75A 1KYIA 1DX6A 1HG0A 3AF3A 3IIKA 4G0OA 1AOXA 5ALXA 4B2IA 1V8OA 3X1XA 5BVGA 4WY5A 2LIVA 3FDJA 4AAYA 5HNKA 1AKMA 2H3HA 1K7EB 3KQTA 2ZDHA 1H6DA 1N2ZA 3LPLA 4CQLB 1L5HA 5A4MS 2WWHA 2Y1FA 3L8EA 1L4GA 4MV4A 4QBGB 4Q16A 1V4NA 1P0PA 2O3QA 2X0KA 5F3RA 3L07A 2CFTA 3LVFO 2O3SA 3OKCA 4RTOA 1K2WA 1NR7A 3EXIA 3LHFA 2VBCA 5ED0A 3M83A 3BICA 1UIMA 1QFYA 4PLPA 4EB3A 1ODSA 1YC5A 4OQQA 2NSYA 3DKPA 1NKTA 1WQ3A 3T1QA 2JB9A 5CFMA 4RF3A 3TMAA 1Q12A 1LQ2A 4AUMA 4K0KB 2QX9A 3AXTA 1ABEA 2DUMA 3AVPA 4OA8A 4C0JA 1JR2A 3WLNA 5K8UA 5J2TF 4US0R 4Z4EA 3WK9A 3TRIA 1J5PA 1JQ3A 4RF2A 5AJZA 2QGZA 4U39A 4C14A 3CVWA 1XL0A 3OCCA 5B7GA 4DBLE 4QPPA 1P29A 1KAOA 5HUHA 3QPDA 1OLUB 1M2FA 3ELYA 2QN1A 5B7NA 4AY2A 1OLUA 3TW0A 3CRVA 3N76A 1W29A 3D1LA 2QW1A 5F1OA 1ND5A 1MQ9A 2Z2IA 3FPBA 3JQ7A 4IJMA 5F7ZA 3UJHA 2EZ4A 5A3RA 4UAGA 4B6EA 1L7VC 1FUUA 1T43A 4PW0A 2W43A 4QUKA 1LY1A 1IIRA 5EPEA 1KQFA 2IYTA 4H0NA 3OBBA 3IODA 4XUCA 5FV4A 3WK7A 3UJ8A 1XEXB 1Z7GA 2KM1A 1XLVA 4RC9A 2V7BA 2E55A 3JATB 3RK1A 4CM4A 5BQFA 4B5KA 1IWBB 2ODTX 3JATA 3ICCA 3JD0A 4TLDA 4CM4B 4ZKDA 5KYYA 3CNLA 3ZD7A 1B14A 3ET4A 4MROA 4M38A 1E9FA 3ORFA 2J6HA 1LSOA 1P2DA 2X6RA 3FWKA 4HLCA 1VI6A 4WZBE 2GSWA 4FNGA 2X7HA 1C3OB 3TL2A 3ZV3A 5HRCA 3JR7A 4PS0A 3NJ8A 3OZFA 3F3KA 3MXTA 4C0XA 1OTHA 2JGDA 4CL2A 3ZX5A 3VYUB 1W0CA 2MDTA 5IAKA 3R2JA 2QJOA 5H5JA 5CXXA 1DARA 1N2CE 5I8PA 3NBQA 1O6FA 3O4IA 4IDCA 4JJKA 4UBIA 3M1YA 2CDNA 1M34A 3SC6A 4BN4A 1U2ZA 2GO7A 1J21A 1I5EA 3QENA 4K0RA 3ZOKA 1RLTA 1RFGE 1ZVQA 5IAEA 2Z6QA 2FSGA 3D0QA 3KCQA 4LV8B 3ZV7A 1XVVA 2B4TO 1PFYA 4Y9DA 3U26A 121PA 1IJEA 5B4UA 5K0SA 3K6KA 1XG5A 1PWXA 3A6FA 3IXQA 5BMVA 3KQKA 1D0SA 5DN9A 3X44A 4QEDA 2WFZA 4AP5A 5JS1A 2X13A 1VLVA 2E89A 3IEVA 4ARZA 3QU5A 4KKXB 3WLQA 1IOLA 3ZK9A 4C04A 1NBMD 3OFNA 1I4EB 1XCOA 1VCNA 3MWKA 5AW3A 4P3YA 4HH3C 3D7RA 2HF7A 1RC0A 2RONA 4KVZA 3QVGA 4ZPJA 3GN1A 3OESA 1U0HC 7REQA 3QEAZ 2RH8A 3TSCA 2I7XA 2OB1A 5D84A 3SDZA 5J2TB 2WIFA 3AEZA 3IUNA 1I5OA 1NUAA 3L1KA 2DQ4A 3QVLA 4BUJA 3FZQA 1JECA 5JUWA 2G3YA 3ABQB 3BREA 3NTUA 3RVKA 4O3MA 4DDKA 2B8NA 3B5JA 3VKHA 3NRBA 1INLA 2ZAIA 4MSUA 3ZK7A 1TRHA 5GADl 1CQIB 2CYAA 3ZHBA 5TQ2A 4IO1A 2YTZA 2A33A 4NK4A 3UXEA 1W5BA 3OSZA 1XVTA 3NFYA 4JJ7A 2ZS7A 1Y8QA 1NJ2A 3IELA 1Y8QB 4QG7A 1K6XA 2XVMA 3QHQA 3QK7A 5DI3B 4E07A 3T5PA 2PZGA 5E6SA 1CUAA 2A9VA 2ZSKA 3HKCB 3IIMA 5LQDA 4MUEA 3L92A 1S5PA 3AESB 1NSYA 3QVOA 4BWFB 3ZWVA 4EHFA 1XNJA 3QPBA 3B2NA 4PAGA 3K73O 2I4TA 4FMCF 3IJEB 5B2FA 2KLHA 4IR7A 3H7AA 2IPAB 4ZQEA 1OU0A 4FCVA 4G9EA 3HDGA 1E64A 2H18A 3CG4A 1F60A 3DMHA 2PKEA 3I6BA 3PFWO 3WTBA 4MNTA 2OO3A 1JKIA 4YPVA 4U2KA 1E0KA 2VBFA 1X7XA 1M1XB 2IU6A 1JS1X 4BP9A 1O5TA 3QKWA 2R48A 4ZK6A 5I9IA 3TH5A 2PPLA 1T3SA 4N3CA 3PBKA 2B83A 5JYDA 3GP5A 4PZDA 4OLAA 4TS3A 5LXTA 2G5TA 3UAWA 2VXYA 3GJXC 3WIOA 3E23A 2AH5A 1QDUA 3W2HA 2C5AA 2WV9A 2YIDA 5HCUA 2WSLA 3B1WA 5HQ3B 3C7CB 5KUTA 1DHTA 3DV9A 1XNGA 5BR8B 1DAGA 1Q0UA 4KOAA 1EZ1A 4E08A 3FVRA 5EHIA 2XMZA 4B3HA 4J3JA 1B93A 1N2XA 3QOFA 4JOCA 2XUQA 2MINA 1ZDMA 4Y9UA 5HILA 5IH3A 3FLEA 3RNOA 4CKCA 1YA6A 1BQ3A 3F5MA 3LV8A 3N6XA 2PLRA 1TM5E 1JMVA 2GHTA 1S2OA 1ISIA 2X4GA 3PHJA 5AXBA 1AMOA 4OM8A 2YRXA 3AL3A 1ZUHA 1ZVMA 4YLGA 5TARA 5CFPA 2P4HX 1D2AA 3CEJA 3K2BA 4I55B 4OG2A 1KL7A 4NZNA 2OD7A 3WOVA 2FOIA 5IYZB 4HO1X 5A7GA 1I3KA 4N8DA 3TVYA 4EARA 4YRNA 1TO2E 3AI3A 4KUGA 3ZJUA 2XOXA 1DX4A 4CLRB 4ZMSA 1QFMA 4ZEWA 1GRVA 1WZUA 3CN7A 1LDYA 1QGED 2PD3A 2JIQA 1MP0A 3A1DA 3VNSA 3G49A 2WYVA 1G8SA 3M1IA 4NSNA 5T41A 4E5DA 5KNBD 4HAIA 4RTRA 2KJQA 3K71B 4EIWA 1GOTA 1BW9A 2HM7A 1YL6A 3HHEA 4XEUA 1RLMA 2C7GA 3K5IA 1EUYA 1J56A 3KPUA 2V7QA 3KLNA 3NHAA 3TSOA 3SY8A 3AHHA 4C7OA 3FNFA 3ZE8A 4ASUA 1VB3A 2FA9A 2W90A 3GUVA 1A9YA 2DHCA 4YP7A 2ZJFA 2Q1TA 2Q41A 2R68A 1G38A 1WMBA 1BCSB 1IUKA 4RU1A 3V7YA 1MTZA 2IC5A 1EJBA 4QWMA 1WB4A 2PXCA 1XR3A 1N2EA 3H04A 3REGA 1IBLB 4PPGA 2BEVB 1FW8A 1KJZA 2VXCA 3BMQA 3JTEA 3MJFA 3UVEA 4B34A 2IZ5A 1RYFA 4DHEA 1YVRA 3W04A 2AE2A 3T8YA 1KA9H 3UPTA 3U7IA 1M74A 3RVNA 1NNLA 3O21A 4K81B 2YCLA 3BHIA 2HDOA 1FJGB 3UAGA 3EZ7A 5IKMA 1M1YA 2BUAA 1NW3A 3NC1C 5B7PA 4NBLA 2GN4A 2IXFA 4QTUB 4TX1A 3CTMA 3LJKA 3UPUA 1IHUA 1X42A 3GO4A 5EHZA 5IJ0A 1K0UA 5KTOA 3TGPA 3ZVRA 2OHJA 1ZC4A 1DKLA 1L4LA 1QTRA 4JVMA 5J59A 1EWVA 5BV2P 3QBJA 3VR5D 4M0FA 3VR6D 5GOTA 3K1YA 4AB1A 1R8YA 5AI5A 3FZGA 1UXKA 2AR0A 5BWBA 1CG6A 1TNDA 1AKVA 3PQ7A 1OWPA 4HNQA 2DWCA 1QRRA 2WA1A 2W2KA 4IIUA 4LDQA 4C4ZA 2J5BA 4JGGA 1NTOA 4M1OA 1XI2A 5ERYA 2CC2A 3RF6A 5D00A 3VR2D 3WB0A 5IF9A 4FWBA 1WF3A 1ODJA 1WS6A 5DX0A 3ZG6A 4REQB 2CE7A 1B41A 5GGXA 1BEUB 2QN9A 5BMVF 2FUG6 4ZZ1A 1P3Y1 4UNQA 4D9IA 3DF7A 4KMOA 2QTHA 4HX5A 3WL7A 4M22A 3IAUA 1Q22A 1FSZA 5BYJA 5JXHA 1H6AA 2C04A 1XZCA 2YFYA 2VH1A 1LCIA 1QG4A 5HX7A 4DXAA 4P92A 1OXVA 3O1LA 1P7YA 5ICSA 1XRQA 2DBZA 3QVVA 4NBWA 5I7FA 3A1VA 2A5YB 1ZHFA 1HDEA 2H0RA 1EYZA 4JQZA 4L8GA 1TU0A 4PFJA 4C3OB 4NV3A 4GKAA 1J70A 5KNDH 2J5XA 4KU4A 3ZU4A 3TTWA 1ECBA 5A7HA 3PXCX 1IVNA 4RDCA 3QMMA 4H17A 1SNYA 5AP9A 4Q4JB 1XALA 3VGJA 3CH4B 5SV2A 5L7YA 5B55A 3CYFA 4QTZA 3SC4A 4F1KA 3AKZA 3E7DA 1XZPA 4KTVE 4NZMA 1I24A 1Q92A 4L07A 3OU2A 4JELA 2FPGA 3NUQA 4FR2A 3HU2A 4HEQA 2FE1A 4MDHA 4YWJA 3SQXA 1UF9A 1Y48E 3HLTA 5L9AA 4TXJA 2EF1A 2CDBA 4DIFA 1AA6A 1Q0TA 1VE9A 2FUCA 3SHVA 4FIDA 1G8FA 3DXXA 3IBTA 5FA8A 2WU8A 1H8ED 4BNDA 1TT5B 4F3TA 4KQEA 5GIPE 3D3NA 4ZAVA 3COZA 4KYVA 4J4BA 4YRRA 5DM2A 4BNLA 4C08A 2VEDA 5KHLB 3X1DA 2JVIA 2AFIA 3LCUA 3KV1A 1SA0B 3AFNA 2ZI3A 4RFVA 4NZPA 3Q87B 2J3IA 4O2BB 2R2GA 5KOIA 2CXNA 3JARB 4K88A 3MUOA 4RA9B 2DR2A 1JMKC 3ABSB 4JKIA 3TZKA 2Y4OA 1COWD 4P1ZA 2TMGA 4PXYA 3LAWA 3FHLA 1SWWA 3AG5A 1J1ZA 3VNBA 2QMZA 3O8QA 1HEYA 2G8NA 2V8OA 5ADHA 1GZUA 4GOXA 3STXA 3JVVA 2R5NA 3R41A 4WUVA 1T9ZA 1DC7A 4KR0A 5CLLA 4K05A 4LECA 3TQHA 2Q49A 2VYVA 4KQKA 5KYUB 3ZY4A 4CKBB 1CIJA 5DM1A 4HKTA 4B4KA 4M8LA 3PL1A 4QOEA 3U56A 2WUFA 1AC5A 4YJ3F 3SF0A 4RA6B 3ZH9B 4MINA 4TXNA 1ZOOA 2XPCA 1FFGA 5AHOA 1FS5A 1EEHA 1HT1E 4H9GA 2O23A 4WJKB 4TTQA 3F5DA 4UBOA 1RZ3A 5ANRB 1J0EA 1I51A 2O3JA 4R2XA 4XX0A 1YR8A 4M0MA 3CT4A 3W8EA 4XDZA 1JG6A 3D2BA 1G66A 4QJ5A 2OVBA 2FEMA 1RRVA 4Q1VA 3SHWA 3TNLA 1MNAA 3LRTA 4OQZA 4UEOA 3USCS 3AU9A 3JWHA 1ZIDA 2OCLA 5K8LA 1IJKA 1MAUA 1OIXA 1ZK1A 4LXXA 1DFHA 4WINA 4BXOA 1GV1A 2WSYB 5I4IA 5K9ZA 2IQ5A 4ETWA 3AYZB 2VLIA 4TQ9A 2GXQA 1E20A 2QD1A 1VM6A 3HJBA 2I62A 4BX3A 5FH9A 1V9SA 2YVQA 3GG2A 2Y2UA 4FDUA 4INPA 3P2EA 1DNPA 5JWRA 2REBA 2A6PA 1SBCA 2ZXFA 1NW9B 2UU9B 4KTTE 3GRPA 4EYGA 1YUBA 1QV6A 1SBIA 3IVRA 1G7SA 2VK8A 3JQAD 4RE6A 5A71A 5LIRA 1VE7A 1E61A 4ZCPA 2AMYA 1WTCA 3WWDA 2WWFA 5FUMA 3TGLA 1P44A 1Z6ZA 1XPJA 2GBCA 4D9MA 4JLVA 1KAHA 1L7RA 1W30A 3B6KA 5TEVA 3VYVA 2LCIA 3MOSA 4NECA 5ES4B 2XCRB 3PS9A 1ZVVA 2VG8A 2B8WA 4I3FA 4WERA 5JSZA 4MS1A 4YCSA 2GXUA 1JAHA 2VRBA 2R8PA 4TSKA 3UHFA 5KYKA 2C0QA 4CKWB 4N39A 3COYA 1JR6A 1XMOB 4MR9B 3NVDA 1D2RA 3R3ZA 1E1CB 3RAJA 6GPBA 4ZCIA 1N75A 2BAGA 3QPAA 1CY4A 3SJAA 3SZRA 1H2ZA 2YL2A 3DE6X 3ILYA 3ZV6A 4EVIA 3C6MA 1XCJA 3QVJA 1ZKDA 1LI7A 2IP2A 4FP9A 5DRTA 3VR5A 1P0MA 3W2FA 3LUHA 2IYPA 4W1PA 2LCQA 3V55A 1BSVA 3M5CA 5BN1A 4ZAGA 2CK3D 1E63A 1QH1A 1U7TA 3F67A 1JA0A 1DJMA 5TJ9A 3VYTB 5A4AA 3DT6A 1NA5A 3KCNA 3KWMA 4AIRA 2FDRA 1XV5A 1SQSA 2VVTA 5BURA 4C7VA 1R0XA 3PYXA 1QXSA 1I0LA 3CVOA 3EJWA 4MCIA 4PS1A 3U13A 2J7PA 3X2FA 3KFLA 4DCPA 2P67A 2VDRB 1JKXA 3CRQA 1UBGA 1VJ1A 1BROA 3ZQ4A 4A82A 3RUHA 3W34A 3FJYA 2ZYIA 4C29A 1US8A 3I8XA 5BOSA 1G8PA 3DVSX 2KMLA 5ADWA 3UYKA 3C4JA 4DNQA 1RLIA 1IIBA 2E48A 4AXBA 2NV0A 2R2AA 3FB4A 3I6MA 4GECA 4MUJA 1KQGA 2QJFA 1OKKA 3OM1A 1L1RA 2OHXA 2AC2A 1E6EA 2NTVA 3TL3A 1NE2A 1K63A 4G5GA 1KI6B 1PZFA 2YYYA 4OQYA 4U2GA 2C58A 1NVUQ 3WYFA 3EXG2 3T7SA 2XOEA 3W5BA 3ZLUA 1JQJC 4IJ6A 5JVDF 1KO8A 5D85A 4TXHA 1PLKA 1CYEA 4GOND 5G3YA 1RM4A 5KI6A 1J97A 2L0XA 3DHNA 3DDWA 1Y3IA 4BMDA 2RHTA 1POWA 3HEAA 4HFRA 1QHSA 2CJWA 4A6DA 3KXPA 5ECYA 4MP8A 4II3A 3KHUA 2EARA 4LKOA 2V0CA 3EE6A 4RTMA 2BFCA 2D4HA 3NALA 3QKTA 1PK7A 1QB8A 1CP2A 4LWPA 1SQ6A 3BTUA 1XZAA 3QKSB 4N7BA 3SNHA 4DQXA 4JBGA 1PK8A 5AVOA 3AF5A 1Z22A 1BEZA 3GRKA 2W70A 4CV1A 4D4LA 3H8VA 3KDSE 1VKRA 2NM0A 2P65A 3PFIA 1L7NA 2X22A 1URPA 4N7MA 1AKRA 4OGFA 3QU7A 2WHXA 4LYJA 4BQNA 5L4SA 4MLPA 1LTQA 4XJXA 3RSHA 4W1SA 5CB6A 3H2BA 1WZNA 2IY9A 1WD7A 5CFRA 3H0KA 4EVRA 2BFOA 4GO1A 3BF7A 2M1ZA 2PU7A 4JYPA 4Y2VA 4ARAA 2FEAA 2I67A 1I13A 5EWJB 1QZUA 3CWCA 3TPZA 5FBWB 4BVAA 3I2HA 1YIDA 4UNIA 5BWMA 5DGIA 3VPGA 2CNWD 4RAOA 2AN5A 2XI4A 2ZE7A 4MKHA 4MZDA 1E58A 2CL0X 1KO5A 3BWEA 5IWCA 3CSUA 1JIXA 4ND5A 3SIXA 4DC0A 3J80A 5LA6F 1FBNA 1BE1A 1TDJA 4BVKA 1GZ7A 2JI9A 4HDSA 5T8KC 3M3HA 4O4JB 4U6SA 1HY3A 2RDMA 3ITNA 5EQDA 2BD0A 4Z0PA 3ZGOA 4D1YA 4I8XA 5FR2A 3A4TA 4MV7A 5DHPA 4CLHA 1M2NA 4L9SA 3L41A 4FQ8A 1SBTA 4DMUB 3JQ7B 1UP4A 4B8YA 1T4BA 2GGSA 1AKUA 1J2UA 2LCFA 1QP8A 5DHUA 4BO8A 1JDJA 4GP7A 4ZOLF 3DJFA 4WXPA 4O25A 4PZZA 2JAUA 3H2SA 1GL7A 3PI7A 4ZXFA 2MSKA 2LTAA 2DH5A 1PW7A 5DIFA 4Q6WA 1ESDA 2C4TA 1AQJA 3RF7A 1ORDA 5IP5A 1BVYF 3IDZA 3VYSB 5JANA 1E0JA 1CQXA 4JUFA 3PUXA 4MWSA 3I2KA 4WJLA 4BQPA 5K6RA 1KZ6A 1V5GA 4MPPA 1PJ2A 2QWXA 4XFJA 5FWYB 3TB4A 2DT8A 2PKQO 5IJ9A 1SUBA 2DRIA 1DCKA 1Q77A 3M2TA 4FMPA 5CTJA 5AHWA 5FTMA 1P9WA 1WXWA 3PFCA 1W88B 1YDMA 4OTZA 3TI9A 2Z08A 1TU3A 3F7TA 3TQSA 3PC7A 4POAA 2GBLA 2BI7A 1OBFO 1E6WA 2PWPA 1F8FA 3ORYA 1T26A 3A10A 2C2YA 5L6LB 1UOEA 4CI9A 1VPLA 4S1TA 3TBFA 2CUZA 5T7BA 1JB9A 4OHMA 1OH5A 1EZZA 1SG9A 1ZEJA 1PNVA 2IHVA 3VZSA 2WJ3A 3L8YA 3RFCA 1YQQA 3NZEA 2D1FA 3OZIA 1Y1QA 2C3MA 1W34A 4R1QA 2V96A 4EY3A 2GJ8A 3UAOA 2G07A 1MB4A 1T2VA 5HBGA 4UTRA 1GT6A 1ILWA 1VE1A 3GDOA 3QPWA 4Y1RA 2XA9A 5CGQB 5TX7A 5IASA 3I2GA 4P5DA 1WDMA 1JFRA 3FPLA 4ITUA 1TUIA 2WF9A 4OHKA 3F7MA 3KQMA 2B6NA 4ND2A 4YCLA 1ORVA 1UK6A 3TW8A 3WGZA 4R2WA 4WQMA 2PWZA 1AQLA 3A9CA 4ILEA 1Y9EA 4YCBA 5JRDS 4LFBB 1GEGA 3OAAD 3PX2A 3OOYA 3PXGA 1W87A 1GYRA 1P0FA 5IKEA 2QPAA 4QT0A 2O1SA 4RY2A 2X40A 3SS9X 5LVAA 4YVFA 3KOWA 4J1TC 3CONA 5ENZA 1R27A 2CF6A 3CUEF 3VBCA 1LJLA 3L8MA 1XZGA 4MVJM 3GMIA 4C43A 3S6JA 1U4SA 1RPTA 3PDIA 2X14A 4WXMA 4WN9A 1CJKC 2V5VA 5LB4A 1YDWA 4LWQA 2WPDA 4S24A 1CUUA 3VPDA 1X7WB 4QQ8A 5G02A 2IJGX 3ZXYA 4ECEA 1ZU4A 3I64A 1A9QA 3VAZA 3I9KA 4F8YA 2W2LD 4GE0A 3GRVA 5K2OA 1CD5A 4JDPA 1CPYA 4F93B 3FSRA 4Q9AA 2L42A 2YJGA 3GIWA 5KX5B 2BJWA 1FFXB 2C9OA 5AMXA 4IRXA 1EMDA 1DDOA 1XAHA 4AJJA 1E5QA 4B6FA 3C3EA 1KEUA 4X20B 1QOQB 4J0HA 5JVDA 1ZS9A 1W52X 3JQCA 1U04A 5FTNA 2C7OA 1P80A 2AL7A 4A0HA 2WPDD 3FOBA 2QYOA 3RANA 2H8KA 1L7BA 3WMGA 3K9CA 1S9DA 3PU6A 5TMBA 2EW1A 4ZRNA 3DQZA 5LXTB 3T3DA 1SXGA 3S1AA 3KVYA 4ZO4A 2R11A 1VLZA 2VF2A 1Y34E 2AN1A 3DB1A 2X1MA 3IT3A 3W1VA 2Z4TA 2QPTA 3CMMA 1NBOA 1CEXA 2ZWAA 3FVTA 2I87A 5EIBD 4C4TA 1UFOA 2P27A 4ZDWA 5BSEA 1BO6A 3W6NA 1K4MA 1OX4A 4WESB 4WOPA 2FSVC 3GUZA 4DRZA 1EVQA 1OOEA 3JCZA 1QIIA 2GMWA 1MB3A 3DM5A 3GRFA 5B3JA 4BBPA 2Q0SA 4MVYA 3TNDA 1DSSG 2QSJA 3FAZA 3K9HA 3Q8LA 2QLLA 1LLFA 3H1TA 1Z74A 1DAHA 3G2OA 4G4JA 2YDXA 3WKAA 3BGIA 3L4KA 2OAQ1 1M5RA 1LSUA 1C4KA 4QICA 5AOCA 4DIEA 4CLRA 4G5FA 2DFVA 2ZIXA 3UOAB 2EW2A 3O94A 2ZZMA 4TTVA 1F6BA 3IA7A 1I3LA 2MJLA 3DBHA 3LRPA 5KVVA 3P7MA 3ZU3A 1G9XA 2BY4A 5DI3A 5E2AA 3KSBC 4L6AA 1KBOA 1ZMOA 2J3MA 3QA3E 2Q21A 5AK3A 3GEDA 2D74A 1A3CA 4ARIA 1FIUA 1ZGJA 1KPGA 1LS6A 2B5VA 3EMKA 3ND8A 1GTSA 1TX4B 1W48A 2C61A 1R3DA 1MIOB 4GLFA 4F11A 1ISPA 1GKKA 1BKYA 1PD0A 3DXFA 4RESA 4YN3A 2X0DA 5JSHA 4FYWA 4ZC1A 2H2IA 1PX2A 2C2KA 4KXVA 3HTXA 4TKUA 1P4RA 2R751 4GGPA 1CSEE 3A27A 1ODFA 1R3UA 1V9LA 5EP2A 3PL5A 1PJLA 3I01M 5ICEA 5DZSA 4UVGA 4UW9A 1DJOA 4DTIA 2IU4A 2VHEA 1S3SA 4PG8A 1VG8A 1N3LA 2ZWOA 3THOA 1GVHA 4HHEA 1EIZA 3KOMA 1L8QA 4K2HA 1PF7E 3LCJA 4N47A 1E2GA 2EL9A 5EQTA 1FDOA 2PSSA 2HSJA 4F12A 4QYXA 2TMKA 3WNVA 2FQQA 3M3DA 4WX2B 1MDFA 2YX1A 3L49A 4OL0A 3VPSA 5B6IA 4OMFG 1CNMA 5K8TA 3R0XA 4XKJA 2XMRA 3HP4A 5CXQA 5HWSA 1N57A 4BB6A 3I32A 2LDXA 1CDEA 3CFYA 2R8ZA 4B7ZA 2X0NA 4AMUA 1J7KA 4X7PA 1ZK3A 3T7CA 2YMQA 2JGFA 2HH9A 2NSLA 2RAFA 3BSYA 4LTNA 4LC1A 3QVKA 1RWQA 2QQGA 3IUMA 4ZODA 2AKYA 2OUKA 5FAXA 5BSUA 1WD5A 5SZJA 3WI7A 2QI9F 4B4DA 2OXIA 1SHUX 1RKXA 1XHEA 3EB9A 3LG2A 3UJCA 3D5TA 4X6UA 2VS1A 5DYGA 4QODA 4JP2A 4LRTB 2WF6A 1M72A 1U0SY 3H5TA 2C83A 3DAOA 3KTAB 4LA4A 3RUEA 3ADOA 5K6AC 1MV8A 3L6BA 1VP3A 3T4PA 1V9CA 2GXAA 1RC8A 1NMZA 2JHCA 4J0DA 4CTNA 4M46A 2RAVA 1M0WA 4M86A 5DMXA 3TEJA 5EIHA 2WUDA 4YAWA 1M8KA 1ENPA 5JPIA 3BCSA 2C7BA 4ZYWA 4EKYA 4AJPA 4KQGA 1JL3A 4N01A 1PJSA 3LLCA 5GJWC 1IOWA 3AM1A 3BVPA 2OV3A 4AZ3A 4WKOA 1DJQA 1EA5A 1W49A 3VDNB 3E03A 1AUVA 2SBTA 3DZJA 2J08A 3GLIB 1BHSA 1QH0A 2HXYA 3MGKA 4UOZA 3EYAA 3EDQA 3B70A 2PQ0A 5MN4A 2QE7D 3KTOA 5FP0A 5C52B 1E3WB 1XQ9A 2PSEA 3BCUA 3DE1X 3LX8A 4MYSA 3PEUA 2NU6A 3QUAA 4M1QA 4BNXA 3DV2A 5I3CA 1CEEA 3DEHA 3GCZA 3RGWS 3EQZA 3TQQA 4RFSA 4TMWA 4JLPA 3VNVA 1K3FA 2JAXA 1SHTX 2MU1A 3FPCA 3GJ8A 3MTJA 3NDIA 4OREX 4Z3KA 4HOYA 4E13A 5FWXB 2Y1OA 3ZV4A 4RYDA 1KKLA 1F51E 1N8KA 2C7QA 3F74A 4ND8A 1HNWB 4NOLA 2UYCA 5DV9A 4LYAA 3DYIA 2O1WA 2RBGA 1OE0A 5LMZA 5ILGA 3W5SA 1PWEA 3G13A 2LRHA 3K92A 3MMSA 3R0JA 3GFGA 4UZEA 3KD3A 5B4VA 3OHSX 3KAKA 1YNSA 5GP1A 5IAAA 1VHQA 4IW3B 3JPYA 1UKYA 5TRTA 1AO0A 1NXOA 1LLDA 1OFTA 2PGJA 2X9LA 2OQIA 4JXKA 1JSLA 3COWA 4LVCA 4RSHA 1FP1D 4M54A 1NOIA 4FOTA 4OKNA 5AW0A 4GC9A 2QVYX 3IAFA 2K87A 2LBPA 3PE3A 3I73A 1CNEA 1I7NA 2C0CA 3IMEA 3NATA 3QM1A 2WU1A 2GN6A 3OD5A 1SPBS 1CR0A 2YC4C 3PIIA 4CCWA 2O2DA 3N9IA 3IHTA 3F4KA 1Y1LA 1L4YA 2D1RA 3E1KA 1RYHA 1MAHA 1ZH4A 3UW1A 3PKIA 4PG4A 2WHEA 1F8XA 4Z4CA 2F8SA 2HJSA 3TLBA 2BZGA 4R1TA 2JCVA 1UBCA 1N2CB 4CDMA 1RI1A 3T4EA 4UPDA 3GOQA 4M87A 3U3JA 4L8YA 4WK4B 5BRAA 1DKUA 3KSZO 4NY1A 2YXDA 5A6VA 1B8VA 3AVQA 1Z36A 2JH9A 1CKEA 3FJ1A 4L7QA 1NZDA 2O05A 2PMDA 1N7GA 3AIOA 2G0NA 2DBVO 2E4UA 2EGHA 1Y4ZA 4LYHA 4S35A 3HABA 3SQDA 5MN5A 2IXDA 4IJWA 1A50B 1VL6A 1UAYA 3BWCA 5E1OA 5FEUA 2FFAA 3DLHA 2EWWA 3LP5A 4MA0A 4BGDA 2OOSA 1F06A 3FFTA 4HNVA 1L4FA 1UK8A 1NVKA 1WM1A 3H2ZA 3IDFA 1BGVA 4MW7A 2EKDA 3P0RA 3ZBPA 4E6EA 2TS1A 3NYWA 3TXXA 3OIUA 4Y6RA 1N6HA 4ARZB 5HKKD 1JH9A 3B3FA 4J07A 1ADJA 1W6UA 5DHAA 4E1AA 2D8AA 2P79A 4XD2A 3Q3VA 4Z0NA 4MJXA 1WULS 1GRCA 1Q1EA 1FRVA 2C29D 4QAQA 4ZEXA 1JLLA 1VKHA 2ID8A 3FMIA 1WKVA 3E05A 3GJYA 3OFJA 3OM9A 4LTMA 5FQOA 3STWA 3TIIA 3JD2A 3BCRA 1N7JA 3P2JA 1L5HB 4XQ9A 1G20A 2EFDB 3KVRA 4XIIA 3WWYA 3S3TA 4A0RA 4TYPA 3QJGA 1QV9A 2EAUA 3G82C 3I2YX 3VPHA 1TF5A 2CMFA 3ZKWB 5C35A 3D8SA 4JR1A 3VR4H 5B3LA 3M6MD 3H75A 1GDTA 3ZR4B 3PVCA 4IDAA 1F17A 2EX4A 1IC6A 2P5UA 1YQUA 3A14A 3NV7A 3OEYA 3PC6A 2X0RA 4CM8B 3ADBA 3KO8A 1KU6A 4ZYLA 3CHYA 4X24A 2FWPA 2QS9A 4HXYA 5CH3A 2W48A 1HFEL 2I4NA 1KIMA 3BFJA 4YJKA 2FFQA 5JW6A 2WF8A 4DZRA 4N7RA 3VSAA 1Z4LA 3OMLA 3CZPA 3HM2A 2DKOA 4DCSA 3SVZA 4E2FA 5E6RB 2H7CA 3RC7A 2QB5A 5TC4A 3A2KA 2IS4A 3ZDFA 4LCJA 3A6DA 2OHHA 3F8SA 1TYDE 4FWIB 1XD2B 3GT3A 3JTMA 4OJYA 2LKDA 1WCIB 4PYKA 4YMGA 1K06A 1UPXA 1JKFA 3FPKA 1WDWB 4NMWA 3WRXC 2JJ8A 1YF3A 5EIBC 3FFBA 1U8FO 3FF1A 3HKDA 4LHZA 3GX1A 4GRIA 3ZHRA 2IUYA 3GA0A 3JYLA 3OA0A 4Q1DA 1D5WA 1HLFA 2Y0DA 1IJBA 2FR1A 3N8HA 5ALDA 4OYRA 1Q7RA 1J8QA 1T9CA 2W6NA 2XYGA 3HRHA 4FKZA 4IVQA 3ILHA 4UFOA 5SZHB 3S7ZA 2D5AA 4EHDA 2FSHA 3EC1A 3KB1A 3PR2B 4TKLA 2ADFA 5GONB 2X5NA 5GWXA 3VJMA 1B8NA 3V6MA 2QORA 1VB5A 1VLJA 2GB4A 2G08A 3AEQA 3OQIB 4K9SA 3UJ3X 2B21A 3QG5A 1PP4A 2IW1A 1DDGA 2BT4A 2OWEA 2X0JA 2DKFA 3DKKA 4WW0A 4QDXA 2H1WA 1WPGA 3JV7A 3ENQA 1R0YA 3I05A 3H16A 4QATA 4ZARA 4BB0A 5IAGA 1YU6A 3R0QA 5H9WA 2W6JA 4C5CA 5AI6A 3L8HA 1M6VB 5IARA 1M6VA 3JQGB 4QYWA 1LPBB 1C4WA 2AXNA 3EOAI 3IURA 4FYVA 1DKMA 3VUEA 1BU8A 4DUYB 4BEBA 1JDUA 1IPEA 1KJIA 3VJLA 4KRYA 4BAGA 4RVSA 4C05A 4E0BA 3E9DA 2FRXA 2IPLA 4GI5A 4J8PA 4D8XA 4ARSA 2O8FA 4M0UA 5EGNA 4BNWA 4Z6KA 4L5IA 2HSZA 2QDKA 1RCTE 4JITA 2QN6A 3RUAA 1PR0A 3U81A 2XXAB 1UBMS 4PYQA 5C34B 1I2DA 2B4QA 3F2IA 3UAYA 3WGOA 3M3PA 5EP1A 2BGWA 4I6GA 1W2HA 2ZIEA 3BGVA 4TWRA 4LWOA 1BXRA 1PW5A 2IYEA 3HDQA 4ZOEA 2BKUA 4J0CA 1BXRB 4BNUA 4BY9E 4N8EA 4CM5A 1N9GB 3UKOA 1WUJS 4O5AA 2I91A 2ZCUA 1OB5A 1KZGB 1ODCA 1IQPA 1VC2A 1RQGA 4WAUA 3B82A 1XO1A 3L7JA 5EG5A 1EIWA 3VHLB 2EU8A 2DX7A 4PYJA 1RT9A 1YR2A 3WIUA 3ZDAA 1DCTA 1L5NA 1SC9A 2J9FB 3PHHA 3FF4A 3PGMA 3KZXA 3PVZA 3HCDA 4RIFA 3VR5H 4BQRA 4FM9A 10MHA 5JS7A 1FTNA 5DIZA 1HTTA 4JVLA 1SVLA 4J7AA 2OCBA 5LDHA 2MR6A 3R8CA 5LYJB 4H3KB 4PC6A 3TRKA 1M2WA 3ON5A 4RHTA 2ECQA 3N0RA 2XRFA 1XRNA 5CCDA 2WF7A 3VH4A 4E14A 2DBYA 5EZ6B 1WXFA 1WXEA 5EAIA 3DMRA 3AKYA 3UFXB 1VP9A 1G1MA 2ORED 3OAAA 4ZVSA 5ESWA 4Y1EA 2W2KB 3E3AA 3WWPA 1ZQ1A 2Y0CA 4U2EA 1A7UA 4Y2UA 1KGSA 3ESDA 4OP3A 3OPQA 4TLAA 4AG6A 5AQEA 2YFQA 5IHXA 4HJXA 5JD6A 1E3LA 4GS5A 1YRBA 1GNTA 1Y3BE 3HB0A 1EXWA 5CIWA 3DHVA 3S2EA 3T54A 1ODKA 3L8FA 4TKMA 1H3EA 5EUCA 2AWOA 2IOFA 2XMPA 5JY1A 3JWEA 1W25A 2IK8A 3W4KA 5FLEX 2LUOA 1GGFA 2N0SA 1N8NA 3KUUA 1HRDA 4C4YA 5HOQA 5IF3A 3SN6A 1XK6A 4U8HA 1C7ZA 5DBHX 2COKA 1V71A 1ZNZA 3HCBA 2RG1A 4WEQA 1A5ZA 4W5QA 3AVTA 3TKYA 1NQVA 2VJNA 5JXJA 3WA6A 3MTBA 4TL9A 3T0GA 4HGRA 3ZC3A 3USES 4YB8A 2I2BA 2GM3A 2OCPA 2PKRA 2Z95A 4WA8A 4CCYA 4PPYA 3FSGD 1Y98A 2IGBA 2G9NA 3A1WA 4W5WA 2VHXA 2PZLA 1EG2A 4OHYA 4N49A 5CW1A 621PA 1FFAA 4ZRMA 3PEVA 2PGOA 3Q10A 4MV8A 2J0UA 3KB2A 5LMCA 5IYZA 2FCAA 3H3FA 3PUJA 1NRJB 3QKRA 2IY7A 1GA4A 1WUYA 2MSCB 3EZXA 4IDBA 1DMSA 1LWNA 5DGDA 4ZQCB 3RADC 2HK7A 1TVMA 1N2IA 1R9MA 4Y3UA 3ONWA 4QGHA 4NOJA 2OYCA 4ZGWA 1EP3B 2E2WA 4X95A 4JUCA 3BFXA 4NG5A 4X6YA 4DCNA 4ESHA 3ABOB 3QFCA 2DBRA 4H0FA 5J43A 2XV1A 5JXIA 5EI5A 3ZWPA 3HUTA 2RKOA 4PZ9A 3T3OA 1YI8A 3A32A 1ECFA 1LC3A 1TU4A 1VCMA 2ZJOA 1QZXA 3VO8A 6REQA 1XJCA 2ZRLA 5G4LA 4FHZA 2BE9A 2NWQA 4P7JA 4FCCA 4Z99A 3CLTD 1I6KA 2R00C 3NG1A 3VNUA 2YJ5A 2VP4A 3RFFA 4UAJA 2EKQA 3PNPA 3PXBA 4R8KA 4RVGA 2QLFA 4FGSA 3GLIE 1T3GA 3RBAA 1R8XA 2H00A 1UKBA 4KGVA 5H3HA 1K2VN 5KSOA 2ZSBA 4WUTA 4CEJA 3UMVA 3OTOB 3FSGA 4IZOA 5AVXA 2F3TA 1SXJB 2R1VB 3STUA 2WAMA 1XZIA 1SR8A 4I36A 3SYRA 2Z30A 2EIXA 3U4HA 4CCAA 4NYJR 3UK0A 3FHTA 1ITZA 2OAGA 4YRJA 3QY9A 2GM5A 3AUSA 3IV7A 4EPRA 5CDFE 3WBKA 1GKLA 3C6QA 4G5YA 4NU0A 1GV0A 1BVHA 2AYZA 5AM4A 3PR3A 5GGYA 3SMQA 3GFOA 3IQWA 3G7UA 4CTOA 4D3ZA 1KTVA 3O74A 3P26A 2K2QB 3M1LA 1TD1A 3C1TA 1D3AA 3PFBA 1ZQ9A 2VAVA 3C98A 1UFVA 4QL3A 2YY5A 4XR9A 1KFJB 1PGOA 3SS7X 3FMPB 1JJVA 4V1CI 1JDPA 1JPNA 1WPXA 1ZK0A 5JAZA 1C4OA 4GF5A 4GRAA 1F0NA 2H4FA 1MABB 2XVZA 1T5DX 4WESA 3DWFA 1OZAA 1TVCA 2OZKA 2JI6A 1PWHA 1WB5A 3RU7A 3BXOA 4CF6A 4EQ6A 5CB4A 1D6JA 1DJLA 3ROPA 3IRVA 3H2IA 1G8KA 1J2JA 3OZAA 3HADA 4FSXA 4MUXA 3U4IA 3CF6R 4C7BA 1WTAA 5FPKA 4G97A 4J0FA 1FRFS 5D5PA 4CKEB 2WDPA 2I2WA 4PZCA 3IILA 4A8TA 3BFKA 1DXOA 1YULA 1KH2A 2VHWA 2PKWA 1ZM4A 2G0AA 3DC7A 1PNQA 4WFKA 5ILQA 1XIVA 3DDUA 1NW7A 3GY0A 4C88A 2ZRAA 5A62A 2OL4A 4DBZA 2QBYB 3OU6A 1GYQA 1K5HA 1QAOA 3CNNA 4MUKA 1HQCA 6CHYA 1N2BA 3DDZX 3FRHA 4AD8A 4NMHA 2FPSA 3DAPA 2W2NA 3C6ZA 5HRAA 1J39A 4WNCA 1M33A 4DRXB 2L69A 1I5RA 1UMBB 3CQ9A 5EJGA 3G2IA 2IYVA 4LYYA 5YASA 4DRXA 5EIXA 1HLGA 1POXA 1H23A 1PK9A 2ZE5A 2IELA 2Q6VA 1XJWA 3MWLA 1J09A 3IHWA 4DA7A 1SD1A 1AS3A 2XLCA 5ADVA 1FFCA 1I7PA 1QG0A 2PGAA 4OSEA 3UBMA 4D4HA 3N58A 5B3KA 6AT1A 4HYYA 5AUOB 5HKBA 2Q50A 1T5BA 4JWKA 4K6GA 4F9GA 5EUMA 2VKTA 2YXBA 4EP1A 2BKLA 1T4CB 4UM9D 3O2SB 8GPBA 2R86A 1TTQB 3RUPA 3DTVD 3U3ZA 5BN3A 1TT5A 2ID9A 1JN0A 3E9NA 2FW9A 2PL9A 3HB4X 3RYCA 4G4SP 3HPQA 2PUGA 2W4MA 3FCAA 1NG1A 1YV9A 4MKRA 1BWPA 4KG7A 2AJCA 1Y3AA 1DT5A 2ODPA 2OPHA 1CZHA 2V74B 4C3VA 1N9KA 3ROXA 2LR0A 4LGCA 4O33A 1K86A 1UP7A 3BCHA 3QIAA 2HKIA 4H6PA 2QMEA 3Q8XB 2ZCVA 3L0PA 3Q8WA 1GG8A 4IOJA 4M6WA 4M8SA 3JD4A 1QIFA 1G6KA 3O8OB 1CVLA 4PBSA 4ZKEA 4YV1A 4ZZ0A 4LN1A 4YNBA 4UU7A 4CGYA 4K28A 3S1LA 1ZAYA 1TYAE 4OMCA 3UJBA 3QWAA 5EKXA 2JZCA 1JT2A 2HV8A 3DH0A 2PV7A 5IM4F 1K6IA 5LBTA 5KYVA 4ZJUA 4HDNA 1GG2A 1XJ5A 3BWXA 4OQ4A 4QOIA 1Y7PA 1ZXXA 1QGAA 1JMYA 5B1YA 3GD5A 3M81A 5IXJA 2PX4A 1KI1A 5AXAA 2RGCA 3WE7A 3K96A 2VFAA 1J8FA 4GMXA 4MARA 4CE6A 3VYWA 4DBLC 4F04A 2MYUA 1USGA 3SWWA 2QM0A 1GFSA 1LBQA 4TROA 5LFAA 3TBHA 1JA9A 2KLBA 3IEIA 1DI0A 1JHAA 3DMPA 1RYDA 4OD0A 1BW9B 5BRNA 1FSSA 3K8OE 1M2VA 3WDMA 1I9GA 3NB0A 4MKIA 1O0SA 1DAKA 1P4JA 4BDSA 3T3MB 4AZ3B 3E9QA 2PGXA 3IQIX 4EHAA 1NMEA 5I47A 1WLSA 4G23A 3ZS8A 1Z2EA 3CH7A 3TAHA 4ZHQA 4LJ9A 1E4VA 1JJIA 1HLPA 1Z13A 2YMPA 3HUDA 3ISTA 4NG4A 3SSMA 3WG9A 4JI0B 2ZZNA 2BMWA 4NR0A 1E8DA 4BVHA 1N4DA 1UK9A 2QTZA 3CZMA 2IRWA 1E9CA 3BMQB 5ELMA 4IDQA 3HCNA 1NJ8A 2DHDA 3SQWA 3G0GA 5TNXA 3UK2A 4AO8A 3MMXA 2BM0A 4ZICA 1MH1A 4FFWA 1ST2A 3LW7A 4IGAA 4WCFB 3TJRA 3JALB 1OBCA 5B58T 4ACAA 3E7FA 1Q1QA 1SO8A 3R5JA 2VNKA 1J20A 1OFGA 3JXEA 4RF5A 3T7JA 1L4NA 1YKFA 3BB3A 2PZFA 2V4UA 5K0JA 1Z18A 3DFZA 4GD3Q 4QPNA 2PN1A 4KN9S 5JATA 1G18A 3PXDA 5AVVA 2PA3A 4N6NA 1WMDA 3AEXA 3BUSA 4UOQA 4DSAA 1QJ4A 2I2FA 1EH5A 2COUA 2BMDA 3O3OB 5BN5A 1UFKA 4P7KA 2ZYSA 3QZUA 3ZGXA 1SKMA 4NCKA 1Z34A 3S29A 1AF4A 4JROA 5J4KA 3VR4A 2W2XA 1UBKS 2C5GA 4F3KA 1U3FA 3JYHA 3OOHA 3OT4A 2CNLA 3T7TA 3KSRA 1Y5MA 4KK4A 2WM9B 5IUNC 3U44A 1GCUA 1P62B 1K88A 2CLKB 4IZIA 3DPSA 4TM7A 4MDEA 2RI1A 2R8OA 2HJRA 4DIBA 5ALZA 4H7PA 1PZGA 2J07A 2Z5GA 3L0OA 4OMUA 1T34A 3ICOA 4DLTA 4X00A 1FOEB 3ETHA 3UA3A 3VYRB 5KMGB 3D8TA 3NASA 5FUQA 4I9GA 4PXAA 5BSKA 1U8EA 5DHFA 1G9SA 2KHZA 3HBNA 1NRIA 5E3JA 5TPZA 4MW5A 4PWYA 2DQYA 3Q40A 4PQYA 3B5IA 4F5EA 1GG5A 3BMXA 3H13A 3MGAA 1C1YA 3GNLA 4TL7A 2VN8A 3ZDDA 5IK2D 3GXOA 5F1YA 5LJLA 1V5FA 1C41A 1ULSA 1XXHA 2EJVA 3BIXA 1ICIA 2B3DA 2RHWA 3QXGA 1JR3D 2NV2B 3GLFA 2X4LA 1NJ5A 3GLFB 1ONBA 5ALGA 1AHHA 1V5IA 3D9QX 4BYGA 1XRMA 4QXPA 1JIVA 2DM6A 2MSEB 3MBKA 3ZWYA 3EDYA 3E8SA 3NHYA 2JKYA 3NOXA 1D2EA 1L9XA 2O7NA 4URFA 1EDBA 2ZYUX 5ARBA 2B1RA 2JFZA 4OOFA 2IYOA 4BNDB 1F48A 1J8MF 1XVIA 3MCAA 1XAJA 3V97A 3N8GA 4YRZA 4DTCA 1NOKA 4MAMA 2I8AA 2Z1MA 4K6OA 3S5UA 3HI6A 5T6BA 1Z37A 2OCIA 3O0DA 4ATNA 4DPLA 5JCXA 1ZH8A 1FXSA 1IVYA 2BCGY 4K8RB 2PSHA 1KC3A 1N0IA 3ZHXA 1IY8A 1RQLA 1NFRA 4NHEA 4EKEA 5JCPA 5JJBA 1YCFA 1VE6A 2VJMA 1GSAA 4D0RA 3PJRA 3M70A 3OE1A 1ZCAA 4QXQA 5JMWA 1YCDA 1WX1A 3PC8C 4D3FA 4ZCSA 1KJ8A 2IX9A 2NSDA 1R9JA 2BGNA 5JAOA 4V39A 3OLCX 3FTCA 1IZ7A 4I3GA 4CBVA 1A72A 4BMOB 2PIDA 3NDBB 3RKRA 5JU6A 2HHAA 3EF3A 2NU9A 3ZKWA 2P1DA 3JAWA 1PBTA 3EN0A 2PBLA 3ONVA 1DVRA 4II7A 4MA4A 4BX2A 3AINA 1L5WA 2WFMA 3KOZA 3DR3A 4ZO6A 3TCNA 3KQVA 3O7MA 4WN9B 3WS7A 5C32A 4LVNA 4RPIA 4ZVQA 2XH8A 2XCSB 1N5LA 3IQXA 4BWVA 2HK6A 1LW7A 3D3JA 4P7GA 4Y2RA 4FE4A 4W1QA 2A5GA 1PJTA 2FK8A 3RKSA 3IKTA 2AV6A 1MX1A 1W9HA 4RHFA 1JFTA 2V7UA 1UIRA 1IXKA 1SUAA 5ECDA 4EVSA 1KMNA 4B84A 5E4JA 4YIKA 4US1R 3WKDA 4F8EA 3CRW1 4WCFC 2A84A 1Z5ZA 2WKWA 3OU7A 3MWEA 4RVNA 1DRKA 4DG5A 2QKYA 4HATA 5EXDA 4WBSA 5SYNA 4CMEA 4DYHA 5IAJA 1M0EA 2H4YA 4KGZA 2X9GA 1W0JD 4BAZA 2WSSA 3GLQA 3PFNA 5JVDB 3LDFA 4K7JA 2BHLA 5C8YA 4PRZA 4BO7A 3T0IA 1NHGA 2O2HA 3SEFA 5FAKA 5FI0B 2EKPA 1XZQA 1V2HE 1NU8A 4OGKA 5TVGA 4KUEA 3TO5A 4BPBA 5T4HA 4EEZA 4R2LA 1OLXA 1K3TA 3R5KA 4MGEA 3TKLA 2WWGA 2Y67A 2JGJA 4NATA 4FYXA 4XCVA 2NUAB 2BRUA 1TQ2A 4D9EA 4BRWA 1RAFA 1IM2A 2Z56A 1YJCA 5EJFA 4CN8A 4D98A 2IT1A 1GVNB 3GGOA 1GYPA 3HSYA 1Z0IA 1HTBA 4MS1B 4Y67A 5CM8B 4CM1A 4E88A 4M0EA 4RKWA 3IKLA 1P1CA 2FFJA 3O95A 3SR3A 3DUWA 4D97A 3CPHA 1GD1O 2ZQ5A 1PJBA 4JQOA 4FGWA 4GNKA 4OFWA 3KJEA 2VDOB 3U3OA 1ONNA 2X8WA 4H1UA 1E0AA 1MHTA 4IH1A 4FBMA 4J43A 5E9JA 3AJDA 1P7VA 1Q95A 4B3CA 1BAPA 2NO4A 2OYSA 1DIHA 4UHEA 4CM8A 3I0NA 2JGEA 3KJHA 3QI2A 3LX4A 2VRWA 2MR5A 3NDRA 5AICA 4IRMA 1AJEA 1USUA 2R6R1 2XE8A 3L02A 3GRUA 1R9NA 2FW0A 1RYNA 1AV7A 1KVTA 3DYBA 3WLSA 4BO9A 4ES6A 5LYJF 1S2GA 2FF5A 4V38A 3I0ZA 2PYIA 3QX8A 2WU4A 1OCEA 3AONB 3O90A 5I7UA 5JRZA 1GSIA 3EXHA 3S8EA 3MTIA 1J4AA 3TQIA 1DEXA 3CUTA 4F56A 2IDKA 5HZMA 1EFKA 1KC1A 1KVRA 4QUEA 3WYGA 1FYFA 3SEAA 4BLPA 5BVHA 2V0GA 2B35A 3D8BA 2G7ZA 3LNTA 3EBPA 1Z3CA 3O4RA 3PWKA 4MITA 3ZY2A 5KTKA 3H1AA 1Q3HA 1NPDA 1QLJA 1X1EA 1ECPA 3CG0A 3L6RA 2EZ8A 1X7XB 3OZXA 1AURA 4HEJA 4IGEA 2Y1KA 4OU4A 4X7RA 2ERXA 3N5CA 1EK0A 3OFVA 4HUQB 2QQ0A 4FYJA 3URKA 3ZI4A 2VQDA 4OKSA 3N07A 1X7HA 2H1RA 3OT1B 4R31A 1Z4NA 3SIPA 5JC1A 3EZ9A 1A4UA 1KIAA 1UZMA 2OFFA 3Q6MA 3NFRA 2D5IA 4I50A 4G36A 1EDZA 3O2NA 1GGHA 2OV2A 5JCZA 3V4OA 2G4VA 5K1ZA 5KS2A 1BDMA 3OCWA 3MT8A 3CZRA 4LY6A 4EUFA 1N2GA 2JIPA 4I9UA 1JLHA 1OD6A 4YPOA 3OX3A 1ZI8A 1TCUA 4QECA 1A0OA 3E9YA 5K3DA 2O0MA 3PRYA 4FN5A 1ISJA 1A04A 1VDZA 2B9VA 1F3LA 2WKQA 3NTRA 1OJ7A 5E38A 1JXQA 2RAPA 2QRPA 3VBEA 5LQRA 3G0HA 3IAAA 4TWIA 3PCXA 1U2PA 1NBWB 2JRCA 3CCCA 3WL4A 3GJRA 1R74A 3VU0A 1LLCA 1JLMA 4RHXA 1Z12A 4BX0A 4G1BA 1EJ2A 1V39A 1Y5LA 4HLUC 1QRDA 4UUAA 4AIIA 1VYUA 1F12A 1FFSA 1DKRA 1Y82A 2BBWA 4QGFA 3V00A 3K9FC 2XUFA 3IOCA 1Z4PX 1H4TA 2PMEA 4QELA 3KTFA 5DFAA 3CNQS 4OCZA 3G79A 4YIHA 4GKBA 3FNHA 2D1SA 1CY6A 4U02A 1M8FA 4AK9A 5JCOC 5C1IA 1T25A 4L74A 4B6SA 4G84A 3TEFA 4AUKA 3LFHA 3P4YA 5E1MA 4ZANA 3HFSA 3QU9A 3QLVA 3O4VA 3V4SA 1XTRA 1XDUA 4LI3X 3PPWA 1JEQA 2BSXA 1BMDA 4FFRA 2XNDD 2Q29A 1E1RD 4I1VA 2EIHA 5F73A 3NNSA 4OXXA 4JL5A 4A10A 3Q98A 1IN8A 1GTMA 4RZXA 4EFMA 4HWOA 1XU9A 4KI0A 4R1NA 4EB6B 5FLYA 2CVFA 1J2YA 5FLXA 1GNLA 2OK7A 3UJAA 2D7DA 1JFLA 1E3EA 4U4AA 1C9NA 2R6JA 1FUYB 3HKEA 2X3YA 3EWIA 3N74A 2BGMA 2R7MA 1BKSB 2CFOA 3MJHA 4YRAA 4Z8YA 3ELWA 2UUBB 1UC4B 2J3LA 3JQ9C 4C30A 2JIZA 1I1OA 1U99A 4NULA 5HIKA 4CV3A 1YXMA 3R5FA 4X7BA 2XMBA 1W8IA 2WHYA 2I1QA 4E4RA 5CD9A 5ILOA 5IYZF 2QTMA 1DUIA 4Y9RA 4FFDA 4AYTA 1HDRA 1XCPA 2VT6A 1LGYA 2F2TA 1UKVY 2PA0A 3DTVA 1J00A 2X8AA 4EGCB 3CB2A 3KZVA 2DU8A 3LOUA 1DTEA 5JMPA 4BP1A 5KJFA 3ZNQA 4F84A 4C6HA 4PONA 1H2XA 4RY8A 4FFBA 5DHQA 4EF6A 1YHZA 3VZDA 1M9NA 2HCFA 5BP7A 4I1IA 3F6EX 4JB0A 4HWSA 5BYAA 1XXHE 3UG6A 4NMMA 1HX7A 2WWWA 1YBFA 4KP7A 2NTJA 4DC1A 2XCUA 1N32B 4D9HA 2OY0A 4Y2YA 3ZWAA 2YBDA 4LG1A 4TRJA 1JZQA 1V16B 2QL6A 5HCNA 2YVKA 2I3AA 4TQUS 5T4FA 3V46A 3ZHUA 3W05A 3D6HA 1MJFA 5C7IO 3PF8A 3T5BA 4TVOA 3EY9A 5F4ZA 1XNQB 3RHTA 3STTA 1U0GA 3U4GA 3EGXA 3MJVA 1JDNA 4Q3DA 2I03A 3JQBC 4PX2A 1G6Q1 4F8JA 2PS9A 5LZ7A 3OPYB 4E5UA 5KKCA 1A7KA 1SVIA 3HHPA 1CQZA 1RADA 3N05A 1FEZA 1O94D 3NH9A 4AP9A 2C57A 3WDLA 1VL1A 3W5AA 1AKTA 4KQ6A 5KC8A 2PMKA 1JX6A 4D57A 3EG5A 3HV0A 1Q0LA 2PRJA 4GLJA 1ML4A 2BHTA 1TYEB 6PFKA 4AMBA 5JCJD 1F14A 2E7ZA 3IOBA 4DPKA 4EG1A 4GGOA 1AVTA 2Y9PB 3ANMA 4IDOA 3OLXA 4PNPA 4Z1MA 3CUVA 3E82A 1YD7A 1NC3A 3SEZA 5IMSA 4ZZIA 2V9PA 2JRLA 3ZWCA 3IMCA 4DR3B 1HOXA 4M8NE 1UKAA 1M5UA 4WFIA 2FR8C 4BFWA 5HK9A 2CXTA 2X1VA 4M8KA 4MUHA 1XQWA 1BHO1 1U7ZA 2V45A 4Z4HA 4EF5A 4ZYTA 5F78A 3GVIA 2W0SA 1FU7A 2QEQA 4OJTA 1PT6A 1W9MA 4ERXA 1FX0B 5EE5B 3AGQA 2VHZA 5IULC 3UJNA 2JFVA 3WLMA 4RK5A 1NI4A 3DZGA 5ITSA 4EJSC 4G8BA 2JIOA 2ISSD 3HPRA 2GAJA 1GQQA 5AHXA 3H9CA 2BKEA 4MLZA 2JASA 1G3QA 3L0ZA 3UG7A 2HF2A 2VRCD 2PWBA 4D2IA 2F3UA 3EG9A 1O6CA 2O4CA 4RZUA 1GGJA 3NU1A 1FFXA 3KQSA 4EYOA 1PGJA 2GKOA 2D4AA 2QTGA 2E0IA 3L93A 5EZQA 2HLNA 2HU5A 2C2BA 2OUIA 2Y1LA 5B1DA 2OD2A 3C45A 4IX1A 2AG6A 4ZD6A 2WNSA 4TLEA 3ZWWA 4BVLA 4Q3LA 2PNJA 4QLBA 4TVSA 3OCVA 3GNSA 1OXMA 5H3LA 2XGOA 2R7LA 3TS1A 2C96A 1OXUA 1U7UA 5ITWA 2GVDC 1XTUA 1JIQA 3A04A 1C1DA 3IP7A 1X2EA 3LUGA 4OB8A 1Z6QA 1FVOA 2I54A 3LP6A 5AVSA 4W5RA 2QUIA 4WZAA 1KWGA 1OH8A 2RHDA 1A9XA 1HPLA 4M9RA 4JI7B 2Z8XA 3QUQA 4G6ZA 1G60A 4Q3NA 2KBEA 4HEHA 3ZLJA 4H2DA 4A2PA 3NTOA 3QYFA 1YNOA 5A1TA 1N7IA 1YS6A 1GGMA 4YAEA 2NQ8A 1YB5A 4Y6LA 3W7BA 1T4DA 1TGVA 3AUTA 3NP9A 2QP9X 4YCNA 4RULA 5J4HA 2HEIA 3JQ9A 5THXA 1X1CA 4C0SA 1L4UA 2ERCA 1MZPA 5A4KA 1VHDA 1IQRA 2QMQA 2QR5A 4BGIA 5FADA 1NXWA 3NKVA 4IDHA 1I14A 5FFMA 2IYNA 4BJ6A 3OPMA 3ZW7A 1C81A 3E5NA 4PAMA 1O94A 3HR8A 3QKIA 1LDGA 4Y6SA 2ZQYA 3R5TA 1BN6A 4YECA 1PT9A 2P6UA 4LOKA 1MRNA 2C84A 1LF0A 1TJ3A 2PH3A 3STHA 4PLZA 3QVWA 1RKBA 3S55A 4P0PB 3DAFA 3ZHVA 4F3RA 3VH2A 5I8ZA 2K5UA 3LQQA 1QCZA 4MQEB 1A8PA 1OH7A 3DFUA 1QIHA 4K6KA 1GCAA 2GHQA 5DNVA 4XWKA 4YUYA 5CTAA 4YGXB 3DZCA 1VL5A 1A2KC 3NW9A 4HXGA 1PFUA 3REFA 3F3MA 2V97A 4PPFA 4UUNA 4M2LA 2VCYA 2OLEA 2ZVDA 2WU0A 4EDHA 3AFOA 4JQSA 3Q3GE 5AI8A 4Z9BA 2OQVA 4EF4A 1B43A 4ZHQB 2NPIA 4XQEA 1GL6A 4O4LA 2EFEB 1P1BA 4Y7DA 3V8RA 5JJIA 5JT1A 2I5PO 1MG5A 1L7AA 3DZDA 5D8DA 3S2GA 2O2SA 4J75A 1T3LA 4TYQA 4RAQA 4QVGA 2OBXA 4KXMA 3OC6A 4EUKA 4NU6A 2P4EA 2HCBA 4BLWA 5G40A 2WP8J 1H1LB 3PCRB 1E96A 1Q2UA 5EQJB 2AI3A 4RLHA 2VSFA 3GC6A 3HNRA 1J5EB 1WUIS 3VTFA 4B0PA 2TMYA 5D6NA 2OYRA 2H9YA 2XB6A 4P54A 4WK6A 4IDEA 5IEBA 2BPOA 5KHAA 1UBTS 3B9PA 5H4GA 5LD2B 3TGWA 3QEBZ 3GVCA 5DASA 1U1EA 1RD4A 2NUBA 5TV2A 1NVBA 1ONOA 1NDQA 1YO6A 2IZ6A 3V4VB 3O92A 1KTIA 1D4FA 5BOSB 1YL5A 1W0KA 3GFRA 3GRYA 4N0DA 3WK5A 2G63A 3WLTA 1GM5A 5TT0A 4YXWD 1FA9A 2O1EA 1A1SA 3EH1A 2XNDA 4L4YA 3SS8A 3TLGB 5TDHA 1A71A 4L15A 2FG7C 3WLFA 1KAEA 4G4SO 1P74A 1N0VC 5JYBA 1JVSA 1E18A 2YASA 4RA6A 4L28A 3GLVA 4HRVA 1Y7TA 3I61A 1II8B 1W5EA 3L7OA 3MK31 4IJVA 3RODA 1TA0A 4EMTA 5MFPA 4CMAA 3NGXA 4XX0B 1YBAA 2PZMA 4BMNA 4DCOA 3NWEA 4NMLA 3ETLA 4QARA 3P97A 1LPPA 4ZA2A 1ZISA 1VBMA 3EDOA 3MOIA 1UMCA 2O0HA 1IXYA 4L85A 2AN4A 4PNZA 3WAKA 4ZCTA 2R6ZA 2VDWA 4MW6A 3IE2A 1XD2A 3GZNB 5FO0A 2W8BB 4EA9A 1QIMA 2R1TB 3BRSA 3RVDA 4RHEA 3K1JA 4W5HA 1G8GA 1J8VA 1W96A 2PGDA 4W5JA 4ZAWA 3T5MA 2B4AA 2HNAA 2Y1CA 3ABRB 5D3KA 1BQEA 5AM2A 3FIUA 4IXDA 1R0LA 5IW8A 1NJFA 1U2DA 1XBTA 3O84A 4A9AA 2CL5A 2I3DA 1U63A 4FFVA 1Z2DA 4Q7LA 1RWPA 4HMQA 2WRZA 4D4KA 5KTYA 1QQTA 3KT0A 3OICA 3C3DA 5ICFA 2FFHA 2VP0A 3ZHQA 5A5GA 1LPAB 2EL7A 2H5EA 4NS4A 3TQCA 1CB7A 5JZVA 2REOA 3L7NA 5B53A 1VMDA 2P40A 4YP9A 4CL0A 4QDZA 4LF4B 1TZMA 4B4UA 1V8BA 1EK1A 5K4AA 1U0BB 2VP3A 5C0OE 4DT1B 3L04A 3TRHA 5K6TA 1HYGA 4O4JA 3CISA 4ZU3A 1JYFA 3KYCA 4LDJA 4C5BA 3DPIA 1II9A 2YRFA 1DAIA 1CRWG 1MU0A 3AUAA 3B8EA 4N65A 4UEWA 5GY7A 3ZWBA 4WKNA 1N2OA 2IOQA 4C5AA