2IDKA

Crystal structure of rat glycine n-methyltransferase complexed with folate
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
291
structure length
277
Chain Sequence
DSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSKDITTSVLTVNNKAHMVTLDYTVQFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine N-methyltransferase
publication title 5-methyltetrahydrofolate is bound in intersubunit areas of rat liver folate-binding protein glycine N-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 71
structure length 277
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 2idkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2idkA02
3D2LA 4OQDA 2OB1A 3MTIA 4GEKA 3UA3A 5E1OA 1Q0TA 2XYRA 1R74A 3HCDA 5JR3A 1QAOA 2I62A 2ZZKA 3FPGA 2QM3A 3HVHA 3I5UA 4P58A 4YV2A 1RJDA 2PV0A 3OE4A 4X41A 5GWXA 4A6DA 2G72A 3AXSA 1N2XA 2P1DA 2QE6A 3G2PA 2PX4A 3UJ8A 2Q41A 5ICGA 1KPIA 1JQDA 2GA9A 2OXTA 3TR6A 3DR5A 1YB2A 4YMGA 1M0EA 3JWHA 3HM2A 5CIYA 4ER3A 4AZSA 3PB3A 4ER6A 3GRRA 2JHPA 3DTNA 4R8SA 1X1CA 4FP9A 4PCLA 1M6YA 2PXCA 1R6AA 2AOWA 2BZGA 2VDVE 2Y1WA 3IHTA 1RI4A 2AN3A 1JSZA 3JWIA 4YV1A 3LSTA 5IKMA 3P8ZA 3NDJA 2BM8A 5FWDA 3MHTA 2PXXA 3DXYA 2UYQA 4MTLA 4RX1A 5E9JA 1XDUA 5DXAA 2E5WA 4WVLA 3PFHA 3FUWA 3L8DA 5DM2A 3TMAA 4H0NA 1ORIA 4PYJA 2PXAA 5CVUA 1VBFA 2NXNA 4C08A 2O07A 2R6ZA 1WS6A 3DUWA 5D1HA 3SVZA 3AY0A 2JJQA 5EEHA 5E1BA 2ZTHA 1YZ3A 1NW3A 1JG2A 1TW3A 5DX0A 4RTKA 2AOUA 3I53A 2HV9A 4L7VA 3FTDA 3FUXA 4CKEA 1WG8A 3KQWA 3GNLA 4HTFA 4BP1A 3PX3A 4YMHA 1ZGJA 4DZRA 1YZHA 4PYOA 5K01A 1FJXA 3R3HA 3HTXA 5M5BA 3H2BA 1R8YA 2AOTA 1JQ3A 1VE3A 2YXDA 3GRUA 3CJRA 3BUSA 3KU1A 2KW5A 3OU6A 5CVEA 1MJFA 2VZ9A 3JWGA 3OZSA 5GM2A 3LECA 2XVAA 2FYTA 5K0FA 1SQGA 4IKPA 1QANA 4BY9E 4GOLD 1UWVA 3UJBA 3KQSA 3P97A 5EQJB 2O06A 2IH2A 4B17A 1AQIA 2BH2A 5DM0A 2ZWVA 3I9FA 3HCBA 5T64A 2FK8A 1JTFA 4K6MA 3IV6A 1ORHA 1XCLA 2CKDA 4QPPA 3B3GA 3HNRA 1YF3A 4ATNA 4FZVA 3HP7A 5F2OA 5EHGA 3BGDA 5B1SA 4YUZA 5LQNA 2P8JA 4GF5A 5EG5A 4PWYA 3TKAA 5LQJA 4ER5A 5DRYA 4C07A 3GIWA 1L3BA 2YQZA 3LDUA 2DPMA 2UZ4A 2YXLA 1NT2A 3CC8A 4XUEA 3R9XB 1XDSA 3FTEA 2PX2A 1G60A 4M38A 4EKGA 4DQ0A 2IP2A 3FPHA 3P2KA 4E2XA 3V97A 2AN4A 2P41A 2AOTB 3LCVB 4Y2HA 5K0LA 5E9QA 3SXJA 3ID6C 4ISCA 3LBFA 5P8WA 1L9KA 3TM5A 2C7OA 3MCZA 3BGIA 4UOEA 5K09A 2HMYB 3G5LA 4X60A 4EVIA 4QTTB 2XYQA 3LX6A 4G56A 4QDKA 2HNKA 1JTEA 4E70A 5K03A 3KKZA 3NDIA 4EMSA 1D2HA 2PKWA 3RW9A 3KPJA 2IH4A 3A26A 3B7PA 1SVUA 3NVMB 1WXWA 3UJ9A 4CTKA 5GP1A 2O57A 1G6Q1 1ZG3A 2BM9A 2G70A 2GPYA 3OPNA 3QOWA 3QOXA 4GQBA 5CM2Z 5EZQA 4RTJA 2HR1A 2BR3A 3PX2A 3B3JA 5T67A 10MHA 1G8SA 3DP7A 2NP6A 1XJ5A 2EX4A 4F84A 2XVMA 3WSTA 2B78A 1FP2A 4KRGA 1RI2A 5ICFA 3PTAA 3OZTA 5EIWA 5FTWA 2EJTA 5BXYA 3LCCA 1QAMA 3G7UA 3PVCA 4RTLA 3THSA 1KR5A 2PJDA 3DLCA 4M36A 4PIMA 4C05A 4E2WA 3CCFA 1JG3A 5DSXA 2NXEA 1DUSA 3I58A 3UWPA 4AZTA 2ZWAA 1NV8A 4EKIA 1P39A 3KQMA 4DMGA 3O7WA 3SSNA 2ZBPA 3EGEA 3SM3A 1G55A 3HVIA 1RI1A 1KPGA 3HCCA 3KR1A 3A4TA 4PINA 5FCDA 5BW4A 4RTQA 3HA7A 2QYOA 1BKYA 3KQTA 3CJTA 2ZIFA 2BR5A 4KVZA 3BXOA 5GOZA 1XDZA 4FSDA 2HTEA 4POOA 3TOSA 1XTPA 3KR9A 1WXXA 5EMLA 4YUWA 3C0KA 2ONYA 4BLWA 1VPTA 3EMDA 1BOOA 4RYLA 3T7SA 1QYRA 1IXKA 3EVDA 3PT9A 1R18A 1I1NA 4QDJA 5EZSA 4F85A 4RTNA 1MHTA 7MHTA 1EQAA 5E2BA 3KQVA 3FTCA 3V8VA 1L3CA 2BR4A 3ELYA 4HG2A 4BP3A 5K8VA 3EGIA 4HSGA 4CKBA 4MWZA 5ERGB 5EMMA 4AX8A 2Z6AA 1DCTA 5HFJA 1VIDA 1AV6A 2OZVA 2ADMA 3BWMA 4QVGA 3FYCA 2PT6A 4DF3A 1OR8A 3A25A 3GO4A 1EG2A 2FPOA 2ZBRA 3FRIA 2VS1A 5FADA 4PYIA 4RTPA 4KW7A 3MTEA 3FPJA 2PSSA 3M6XA 3ME5A 4FR0A 3S68A 3A27A 3G2MA 5FA8A 5FQOA 5KS2A 1EAMA 2IGTA 2JH8A 1P1CA 2YTZA 3HEMA 3M6VA 2UYCA 2IH5A 2OO3A 2OKCA 3LHDA 1G38A 4FT2A 4XUCA 5EMKA 3NMUF 4KWCA 2GAFA 3KHKA 3GDHA 5DTQA 2OBFA 4X61A 4GBED 1NKVA 3LKDA 5DRTA 4DA4A 1XVAA 2IIPA 3MGGA 2CMGA 4GC9A 5DWQA 4KIFA 1KXZA 1V39A 5EHIA 5FWAA 1UIRA 1SG9A 5DT2A 2VDUE 3F4KA 4GUAA 1INLA 2YXEA 4A6EA 1X1BA 4RWZA 4LWOA 1Y8CA 5FA5A 3VYWA 3BT7A 3PLAE 1VL5A 3GXOA 1BC5A 5DM1A 3DXXA 5F2KA 3IYLW 3U81A 2G71A 4OA8A 5LQAA 5GIOE 3SMQA 3GRYA 4WXHA 5KYGA 2YVLA 4RTSA 4R8RA 5FQNA 5K0GA 1NBIA 4M7RA 4R05A 5ICCA 4HRAA 3KQPA 2OB2A 2NYUA 3OFJA 2FCAA 2ZLBA 4R6XA 4EQZA 2ZULA 5EIFA 4ER0A 5K0EA 4Z2YA 3BGVA 1ZHFA 3OE5A 8MHTA 2PT9A 1B42A 2XYVA 3FRHA 4C04A 9MHTA 2P35A 2PWPA 4IV8A 1JSXA 3BWYA 4U7TB 2I7CA 4JXJA 5C0OE 2IPXA 2PGXA 3GJYA 3DH0A 5HIKA 3AJDA 3HCEA 4PONA 2P7IA 1T43A 5KVAA 1RJEA 1FP1D 2PX8A 3TQSA 4R6WA 1RJFA 2Y1XA 1KHHA 3FYDA 4PGHA 5LSAA 3EGVA 5EPEA 3BKWA 4C06A 2AZTA 3LKZA 5DPMA 3RODA 2Z6QA 2LD4A 3LGAA 2XBMA 4CXMA 3NWEA 3BZBA 4KDRA 4X1OA 5HILA 5IH3A 2JG3A 3EVFA 3LBYA 1X1AA 1I9GA 3KPWA 4LG1A 1JG4A 2AVDA 4RTRA 1VLMA 2QY6A 5C1IA 4QQKA 5HIIA 5K0JA 3HA3A 1ZGAA 3TLJA 3VC1A 3FPEA 2CMHA 5E9WA 3T0IA 4NECA 3UJAA 5K0BA 5DX1A 3HVJA 1D2CA 3OCJA 3UJCA 3HCFA 1G8AA 3M33A 3HCAA 4QPNA 1R00A 1AQJA 1D2GA 3KQOA 1O9HA 2PVCA 4V0RA 5CCXA 2C7PA 2QRVB 1RJGA 4PGGA 5GM1A 2UYHA 3SSOA 3R6TA 1F3LA 2YX1A 1PRYA 5GINE 1RI3A 3DMGA 2B3TA 2P3LA 3NVKI 2B2CA 3LDGA 5EGSA 2IDKA 2GB4A 3OU7A 1P91A 5LR6A 5K05A 3BKXA 2YUIA 3UJ6A 5E1MA 3DXZA 2VDWA 2YR0A 1DL5A 4LWPA 3B5IA 1U2ZA 3UA4A 4BLVA 4ZTBA 4YUVA 4DCGA 5HOQA 4XCXA 2NXCA 3P2IA 2P40A 3HA5A 5DTRA 5E1DA 5EC8A 3NWBA 3MB5A 3G2OA 3EEYA 1YFJA 4E31A 3MQ2A 5DM4A 3M6UA 2ZFUA 2PBFA 3NJRA 2AN5A 1IY9A 2AOVA 3P71T 3P9NA 5EKXA 5EMJA 1L1EA 3KR2A 4YUXA 4MQ4A 4QTUB 3ER8A 1JQEA 5DTMA 3GU3A 4LECA 3TM4A 3UBTA 2IBTA 1KPHA 3A7EA 2ERCA 5FHQA 3OZRA 4P7FA 2P3OA 2ZZNA 3THRA 1PJZA 5D1NA 1I4WA 1WY7A 2H00A 2HWKA 1L3IA 5EVJA 4FSXA 3DULA 3K0BA 4DKJA 2CWWA 2B9EA 4DCMA 3C6MA 3GCZA 3MCTA 1SUIA 1NW8A 4HH4A 5FUBA 3VC2A 3R24A 2EFJA 3LL7A 4CTJA 1KP9A 2O05A 4RTOA 3KPVA 3EVEA 2ZBQA 4GOND 2V7EA 1SKMA 3E23A 4PNEA 3FUUA 5FHRA 5E8RA 3UJ7A 1H1DA 1KYWA 4AUKA 4QQNA 2Z6UA 2VP3A 3OU2A 3M4XA 3UZUA 2F8LA 3E8SA 2ESRA 3G89A 5GIPE 1NW7A 3SX0A 3ELWA 2IFTA 1Z3CA 3G5TA 3CBGA 4P7GA 2IDJA 3FPFA 5KQRA 3T7TA 4YV0A 1X1DA 4E2ZA 1YUBA 4P7KA 4YUYA 3REOA 2C7RA 3M6WA 5CVJA 2PX5A 2WK1A 2EG5A 3Q87B 5CD1A 3C3YA 2OPBA 1NW5A 3O4FA 4M37A 5LQUA 2H11A 2CL5A 3E7PA 2GH1A 3A7DA 3G8BA 4IV0A 5ICEA 3PFGA 4OA5A 3K6RA 3C6KA 1EJ0A 3BWCA 3I64A 4PYMA 3FUVA 4QVKA 3C3PA 4C4AA 3R0QA 4O29A 5HEKA 1TPYA 3G2QA 3KQQA 2DULA 2ZSUA 4HGZA 1XXLA 3EVZA 3O31A 4C03A 5BW5A 3NW9A 5CVDA 4HGYA 1HMYA 3G8AA 5HIJA 1KIAA 1UFKA 1F38A 4GOMD 5DSTA 4FT4A 1O9GA 2FK7A 3P9KA 1O54A 3Q7EA 2QRVA 2N47A 2K4MA 3E05A 4AZWA 2I9KA 4AZVA 5C9ZA 1JG1A 2NNWB 3T7RA 2R3SA 4E33A 3P2EA 3EVCA 1FBNA 3EVBA 3CVOA 2WA1A 1QZZA 4Y30A 3KQYA 5DX8A 3SR4A 1NV9A 4PYQA 3SSMA 2A14A 5LQKA 5U4XA 3HVKA 3EVAA 1RI5A 4PYNA 5LQCA 1Q0SA 4BLUA 3TRKA 2PLWA 1VP3A 4KIGA 2AS0A 5K0NA 1EJ6A 3GWZA 2G8NA 5EKUA 2ZZMA 4FGZA 5KQSA 3IEIA 4OBXA 4MHTA 1M6EX 4CKCA 4IWNA 3AXTA 1YFLA 3MERA 1JR4A 3VSEA 2ZCJA 2FHPA 1QAQA 4HC4A 3KPYA 4KDCA 4RSRA 2JHAA 2B25A 3ER9A 4U7PB 1R8XA 4XUDA 4DM3A 1NW6A 1XCJA 1TW2A 3AWIA 3G88A 1KYZA 3FUTA 1N7IA 4PYLA 3TKYA 3LPMA 1VQ1A 4OBWA 2AR0A 3LCUA 4PCAA 5FULA 2OYRA 3TFWA 5HZMA 3JWJA 2NP7A 5BP7A 2O0LA 1FPQA 3MAGA 2AOUB 2ZIEA 4PIPA 3ANXA 2ONZA 2ZIGA 4V0QA 2V74B 4HTFB 3QV2A 5MHTA 3EMBA 3DOUA 1HNNA 1SQFA 3CKKA 2FRXA 3ELUA 5CUQA 3GGDA 3GRZA 4F86A 2P3QA 1ZQ9A 4RV9A 3X0DA 2I6GA 5EOVA 3TPZA 3B3FA 4E30A 4OX9Y 1AF7A 1SUSA 1X19A 2EJUA 3EEOA 5K0CA 5JUWA 1BHJA 5LQRA 4GOOD 3KPUA 4FS8A 5F2NA 2UYOA 4PYKA 1EIZA 2GLUA 1IM8A 1WZNA 2ORED 3KR0A 3PS9A 5HIMA 3P9IA 4RVGA 2ZVJA 4E2YA 3RIEA 3EPPA 2WA2A 3B89A 1N7JA 2C7QA 5E2AA 2OY0A 3DMFA 5DLYA 3FZGA 5EEGA 1VP9A 2GS9A 2NXJA 3BWBA 3LDFA 1NE2A 3CJQA 4P7JA 3NTVA 4RVHA 5G02A 4RTMA 4GC5A 4OQEA 1NBHA 3CGGA 2P7HA 3GRVA 3UJDA 3SGLA 3ERCA 4MIKA 5E8JA 3EVGA 4E32A 3M70A 1ZKDA 3P9CA 2PY6A 4CWAA 2G1PA 2IBSA 5DXJA 3OFKA 3FTFA 4RVFA 3ORHA 2PWYA 3DLIA 2ZW9A 4RVDA 3DMHA 5H02A 5CCBA 5T6BA 2JHCA 1P1BA 3UFBA 3ELDA 2JH9A 5CVVA 4EK9A 4ER7A 2AVNA 4X63A 2AOXA 2H1RA
chains in the Genus database with same CATH superfamily
4X45A 4C30A 5BOSA 3HI4A 2BKXA 1DINA 1X7YB 2XNDA 3HR4A 3HCDA 5CIYA 1OC4A 3HZHA 3IAUA 4CBVA 5HBRA 4QNMA 3W7VA 2H2IA 3SHFA 1N6NA 2PPVA 2AC7A 1H6CA 2CEAA 4LXUA 2PZGA 1DFHA 2RONA 4A2PA 1QQ5A 3KVOA 2PX4A 3P2OA 4PHCA 3CRVA 5DKFA 1FNMA 2WDPA 2YN4A 2OXTA 5BVHA 3G9XA 1YQTA 4U8GA 4ER3A 2NN3C 3DW1X 1FYFA 1YJQA 5E2IA 2BCEA 4UHHA 4Z7JA 3F67A 1VTKA 4R8SA 3UB2A 2EQAA 3L4JA 4FP9A 1JKFA 2O0HA 4U00A 2W6NA 1NASA 3I2HA 4G8DA 1TCCA 1U4OA 1R0LA 3KALA 1JDZA 3PA8A 3JWIA 2PQMA 4NHEA 3TLBA 3L7IA 4L5YA 1ZY2A 1FX0B 3ZI4A 5FWDA 3FOFC 2PS1A 2DC1A 1YIDA 4RX1A 1CX9B 2JS7A 4DHEA 4D8YA 3L8DA 3MTGA 4K3UA 2VSOA 2PVSA 5C8ZA 3V1MA 2A5YB 1FUIA 4TTPA 5EUBA 4IHJF 4NCKA 3VR4D 1MA0A 2EBWA 2QRUA 2VNAA 1B2LA 4H6VA 4N65A 4QREA 1QIFA 1PWZA 5TMEA 4X54A 2QOEA 4LTDA 1SKQA 2BFDA 1XJWA 4C7VA 5KNLA 1AS0A 2B99A 2J31A 3GRKA 1UH5A 2A9QA 1PCXA 5CLFA 3EZ9A 4DZRA 1GD1O 1NF9A 1YZHA 1TVEA 2DJ5A 2OWDA 2P30A 3P94A 5K01A 2PRYA 1OT5A 3U4GA 5CDGA 2IHZA 2O2SA 3MUNA 2AOTA 3GLHE 3S7ZA 2V7QA 3P9ZA 1QP0A 3BRQA 1VZ2A 2V4MA 4CR6A 4BGEA 1WXGA 4DILA 1Q2UA 3FCEA 1H4QA 4KAJA 1JH9A 2R6JA 3LECA 1E0KA 1TO2E 2VJYA 2E21A 1V35A 1RZRA 3JD2A 4DB2A 1RC1A 4TVOA 4BY9E 2JDID 3SE0A 5B64A 1DAGA 2IH2A 5DBEX 1AZTA 2YWDA 4CM9D 5AJYA 4OOFA 3I9FA 3HCBA 4K9PA 1MOPA 1ZGCA 4M21A 1R6BX 1FFSA 2QLFA 3BFXA 3ZNQA 2V0GA 1B26A 1HFKA 4NONA 2XE8A 1GRNA 4ZQIA 5IABA 3HP7A 4C2AA 1ETHA 1NUUA 3ICPA 3S8EA 1M34A 5K8CA 1IONA 1YS6A 5HCIA 1Y3BE 3C85A 1A9XB 1AKNA 1IWPB 1DAFA 2NZYA 3IT3A 4ER5A 1QCZA 1NLYA 1OZ0A 1TF5A 2VBCA 3DDHA 3FDXA 4XUEA 2UZ4A 3PKJA 1L5SA 4ZAXA 1JXOA 4O5OA 1ZD9A 4HDKA 3LDHA 4YJKA 1YE8A 2GQ0A 3QW2A 1LPPA 1B3RA 4ZOCA 4FCCA 5B3AA 1OLOA 2AN4A 3V97A 2HDNB 2VRBA 3N5CA 4HUJA 4N49A 3KBOA 3GGGA 3ONFA 3ROGA 4AO7A 5EJ9A 3LBFA 2KLHA 2NO1A 2QN2A 3FOWA 3WYCA 1ABEA 2JIZD 2WTAA 4KDEA 3CF2A 3NYIA 4EATA 1K6MA 1TFRA 2FZLA 1KKUA 3CSSA 4HLUC 4KBFA 4L51A 2APJA 3A9VA 5K4AA 4ZCIA 1YOVB 3DTVA 1HRDA 2CC2A 3UATA 3GCGA 5AK5A 3BD6A 1FRQA 2J5RA 1RU3A 4QU0A 4JLBA 5C80A 3DM5A 3A26A 3WWDA 5BMVF 2ZU6A 2VUUA 5E4JA 1CP2A 1PQPA 3DBRB 2YV5A 2YDXA 2Q7OE 2OBYA 1DV1A 1NFRA 3HJHA 3F6PA 1VIVA 1RZVA 1ZM4A 3D8BA 4X84A 5ALMA 2O0JA 5GJCA 3T3PB 3HXMA 2CK3A 1OLSA 3AUTA 3HCOA 4MR9B 3S2UA 3ENWA 1JBKA 1K8QA 3OT1B 1QP7A 3N05A 1XQ9A 3DZKA 2OD7A 2WIAA 4KMOA 3N5KA 3OF3A 1H1TA 5FWYB 4E2WA 1UQTA 2NXEA 3ZX5A 3KCQA 4LC0A 1GPYA 4JB0A 4F8YA 1XXHB 1O8CA 1GPLA 2VPPA 4IUDS 1RI1A 3ESQA 3I5AA 4MVJD 1XPUA 1DCFA 1H2EA 3KR1A 1XLVA 4KVZA 4CZ2A 4XFKA 3KKMA 3OWHA 3V80A 3NEYA 1RAEA 2P79A 3TRIA 3LY8A 3DNMA 1TCAA 2OZKA 2R7MA 4XARA 3I30X 1ZVVA 3AR4A 2PUAA 2B4RO 2FN8A 3IA7A 1J97A 4OYHA 4S0XA 4Y0NA 1ZK1A 3X3HA 3FYUC 4MPDA 5FTLA 5IHXA 1FYEA 2BCJQ 1TIPA 3QU9A 5B37A 5A5FA 1BVUA 5J2TA 5C1BA 3UV3A 1OYYA 3VOSA 3A6LA 1Z34A 1NBMA 4CU5A 2WV9A 3CCCA 3V2GA 2RHLA 5A0FA 5BQ3A 3I2JA 1SOVA 2Z6AA 3NBAA 3W5UA 1RMTA 2O8EB 3P1JA 1QU2A 1C3JA 1G7TA 4AJ1A 2I7TA 3WGYA 1XAHA 1Q15A 1UMDB 2A1UB 2HU2A 2JEOA 3H7IA 3OCUA 1NLZA 1JE1A 3P9SA 2PMKA 4M1KA 5CPBA 3T1TA 1G4UR 1GVNB 1IOZA 4F9TA 5JCJA 4MDEA 1IY0A 4PAQA 1YULA 4RJIA 2MYTA 3WKAA 2P6RA 5JJKA 4QRHA 2WRZA 4KITB 1MG5A 1BCSB 1H0HA 3LHDA 2B5VA 5HKKA 5IUKC 3ZKAA 3OZAA 1AKTA 4QELA 2D0PB 3RSGA 3X44A 4B71A 4KK4A 1ADFA 1EWRA 1QS0B 2XQFA 4NBRA 2IEDA 4XLLA 3ROPA 4FU0A 3GJQA 1HXHA 1SB9A 2FSSA 3DO5A 2G07A 3OEED 2QL9A 5LNK1 1OU0A 4MKFA 1H1LA 5EUCA 2Q1UA 3RRYA 3FGNA 4UM9B 5JSYA 3T12A 1P2TA 3M0EA 4RKQA 1VMAA 3BTOA 4BQEA 2YXEA 2Z57A 3B9RA 2VAWA 4KR9A 4A6PA 1OOEA 3UAGA 3T5BA 5KX5B 2DHEA 3KZCA 1MW9X 3MT8A 4L16A 3CNLA 3DZBA 4MUIA 1O94A 1R16A 2FLVA 4B45A 3AM5A 2QVXX 1DBVO 1US8A 1I4LD 4TROA 3RCBA 1W0KD 3UMSA 5FQNA 4WBNF 1ZESA 4L75A 3T1VA 4IGFA 1H66A 3A3KA 4DDUA 6GPBA 3MT7A 4ER0A 2CSXA 1WUYA 4K0RA 4UMDA 3NEPX 4X92A 1AA6A 4AJJA 2VP2A 3R3SA 4FQ5A 2DBQA 1NHGA 3HYTA 2UDPA 3LXMA 4HPJB 3B1VA 2R7KA 4RK5A 2IIBA 2PAFA 4WUVA 5ARBA 2FDCA 3A4IA 4U2FA 2G76A 1YVUA 2QRNA 2UUPA 3GT3A 1X7XA 3DO6A 4PQYA 5A3VA 4JQOA 5KHLB 3AEKA 1YR1A 4ME6A 3K30A 1UDCA 4GZ5A 4DUGD 4EKDA 1LTKA 2Y68A 4I9GA 3S6JA 5BV8A 3BQ9A 2M1XA 3TI7A 3HZZA 3PQ8A 4G0OA 4YECA 2VP9A 3K8ZA 1E6CA 4RKWA 4EJ2A 1J23A 3KM0A 3NWEA 5AJZA 2BHTA 3ANNA 1ISIA 1GNVA 1JP7A 2RJOA 1KC3A 2JB9A 3NOXA 4U7FA 5FUWA 2F1KA 1CBUA 1YA6A 5H81A 1LFDB 4LJ7A 1NQXA 2ZE5A 3LUKA 4DNPA 4DYVA 3HN2A 1AN0A 3FPEA 3STYA 5J47A 3MT9A 4B3TB 1OILA 2R6DA 1NFQA 3TZEA 4FMPA 5HXAA 3I9V6 1OI2A 4GLBA 4OHYA 2PYZA 3NFYA 1D0IA 2H16A 2V9ZA 3BILA 5ESRA 3UAXA 4UPVA 5PGMA 1JEJA 3F7MA 5LOVB 4G5RA 1KKLA 2J41A 2CUNA 3LU1A 3WLPA 3N8GA 1D2GA 4LMRA 1AG9A 1F3LA 1UODA 2JASA 2PZFA 3H65A 1V2HE 3VO2A 1Z37A 4EL0A 3ECSA 3BEDA 1DKQA 4MPTA 1UM9B 4UNPA 1DARA 2B2CA 2VSYA 2QZSA 1D4ZA 1HE8B 1N2CA 2IDKA 2QRGA 2VNSA 1VSUA 2HWWA 3N7TA 3RUPA 1L5YA 4I1IA 1MO2A 2OGWA 1QR2A 5IDWA 3IKJA 2XIJA 4IDOA 5IJXA 4DCGA 1XRRA 2IY9A 5HE8A 1Z62A 3TZKA 3UPDA 2FE4A 4PQGA 1DQRA 1ZI8A 4PV7A 5CNJA 1AMOA 2H4FA 3LPCA 5JMOA 4MR7A 4Z4EA 1N2GA 4HYEA 2ONJA 4X90A 3T7EA 3U4MA 2LUOA 3EARA 4DQLA 3Q40A 4OH1A 4J2TA 1PG2A 2NZUG 4W7SA 2CJPA 3P9NA 1NYQA 4HY3A 5DYWA 4EHFA 4YYEA 3BIXA 2XE4A 1QLHA 4BVJA 4ZVRA 5KKNB 3GJ4A 4RV4A 2YHIB 2X4GA 2OCXA 1QP8A 3P0EA 2R6AA 4RHCA 4NCXA 5D00A 1YZQA 1Z9BA 5K6AA 2IBTA 3EDYA 2ZZNA 2C4WA 4E14A 1J6UA 1SKYB 4PR0A 1DKOA 2PO5A 1VKNA 3AGPA 1N2ZA 4YCSA 2FN7A 4E12A 3RGGA 5BR4A 1LWOA 3MD9A 1WM1A 3HWX1 2CWWA 3MHPA 2VNJA 3GP8A 5KO2A 4CTJA 4ZJPA 1J2EA 2CJWA 2GDJA 3TEFA 1DDGA 2JIBA 3UFXA 2H52A 5JNSA 2XCIA 2EZ4A 5CDUA 3VRHA 4RQAA 1GL7A 1SKMA 3UOWA 3E23A 1XVUA 1EM8A 1QG2A 3PQDA 4QFCA 5JSHA 1DB3A 2V5VA 1G7CA 4GWKA 1H1DA 2MYUA 4ZAYA 1RC8A 3KB6A 3PXDA 4L8FA 4BDSA 2V7QD 3OU2A 5K45A 4C78A 1JPUA 2NYVA 5GIPE 4L0CA 3RKUA 4ETMA 1XC7A 1RZRD 4ZGGA 4P81A 2PKQP 4X1KA 4KV9A 2P9FA 4P7KA 2Y99A 1ULUA 4V0NA 3FMIA 2WK1A 5CVJA 3UCEA 4ZZ0A 5JASA 1NW5A 1YTLA 3NC4A 3Q11A 3T3NA 3FHOA 1L4NA 1MQ8B 3LHKA 2CL5A 4G0MA 1T6XA 1HV8A 4IIFA 1QCDA 2C9DA 1GTVA 2M9MA 2BKAA 3I2KA 1WO8A 1UPFA 1VB5A 1W1UA 2Y0EA 3FGOA 1VCMA 3ZWKA 5A2QA 4GL2A 3OT4A 3A6JA 1XXLA 3EVZA 1FQKA 4RIIA 2GDZA 4X8LA 3PXGA 2D2VA 2SNIE 3RUIA 3RYFB 3SNKA 5G1OA 5KAPA 1HX7A 1W93A 3O8OB 2X2FA 4DL9A 4AF8A 4FT4A 4UMEA 3NETA 1QO9A 5AQEA 4W1PA 2PRIA 1GR0A 2D7CA 1S7GA 2PGLA 2ZTVA 3C6BA 3VTKA 4LJKA 1N5KA 5AHOA 1U9IC 2FZCA 3WO1A 1XLUA 2R5WA 4IDCA 1ZIOA 2IW1A 2HYDA 2JAUA 3STWA 3ZWBA 4C1NA 5ELXA 1YGPA 4CEHA 3ENVA 3DTVD 3NIDB 3K1YA 3PDCA 2XF2A 4BLTA 5IAAA 5MN6A 1J70A 2GEDA 2GHQA 4ZKDA 5K0NA 3U1BA 3RHZA 3BK2A 2UU9B 3ICQB 1ISMA 1FP4B 3HUDA 1OVGA 1UR5A 4A73A 4XSHA 4OKNA 3QEJA 5J5AA 1L7DA 2BF4A 4QDOA 3HP4A 4PRZA 2P6OA 4TX1A 4Z1MD 5JCOC 2Z1MA 4D8UA 4DIKA 2VJAA 5DHRA 1ZI9A 3ST7A 1Z5UA 4GKJB 2I6SA 4PCVA 5AXAA 2AF3C 4EUKA 2R66A 4MV4A 3ZW7A 2ERYA 4WNAA 4DEYA 3CUEF 3DMTA 4RF3A 1JZSA 4X20B 4CCWA 3IVMA 1SUBA 4R1QA 1O1YA 2C0CA 2RKWA 2V03A 2VC2B 4BX3A 4Y6LA 4EMUA 2ZIEA 1R4NB 4V0QA 4MAMA 4HTFB 5JAUA 4GQAA 3M3DA 4FW8A 3PC8A 4BQRA 1Z6ZA 1HNNA 1B8UA 1UINA 3VDRA 4XYLA 5JFGA 1OXVA 2IEGA 2FRXA 1F8UA 4WMLA 2RC5A 3ROMA 3LA8A 1KK2A 2DWUA 5FLEX 4YAIA 3WNQA 4JLNA 2H1VA 2VHUA 1BRTA 3KTAB 3S2GA 4D3YA 3FXAA 3FKSA 2HHCA 4HUQA 2E4XA 5FOTA 3FNFA 3ADOA 4FBLA 4HO1X 4MB2A 4PGMA 3A06A 2ISCA 2OG2A 2OAQ1 4B2LA 4CM4A 3AF6A 1QIIA 4MPJA 1AS2A 3BB3A 3GUUA 4LZZA 4PYKA 3L4BA 1N5RA 1EU1A 4F3NA 2HC9A 4P2BA 2QTTA 2KLBA 1KAGA 4R54A 2B2XA 3IJ5A 1JSLA 2CYBA 4MQLA 3FNBA 4ZYZA 1ZAYA 3IRUA 3ZWNA 2L82A 1WKBA 3GB9A 3FZGA 3IURA 5EEGA 5KVCA 1GKKA 1UQUA 3NHFA 4ZAWA 4I1SA 3ZGLA 4I14A 4L85A 4COOA 1FJ2A 1NBHA 3IP6A 1EVZA 3C3AA 1KHTA 3AUJB 2CHQA 4PX2A 4HDAA 2X2EA 3EHEA 4KH0A 4L6CA 4MGKR 2QTAA 1J8DA 2Q07A 1WEKA 3DLIA 4XEUA 2WZQA 3R5XA 5KQLA 2VZEA 2ZIXA 3QWHA 1JIJA 2VWQA 1O0SA 2B6NA 3KTDA 3GROA 4G0VA 3OO1A 4JI7B 3T9CA 1ZUIA 1BA3A 3BIWA 5ALHA 1MDFA 2ZETA 3HKEB 1NJ1A 1W94A 4J03A 1OMOA 1M2NA 2OB1A 3DL2A 2R7LA 3ACDA 4YWHA 2OE2A 3GZNB 1T5TA 2LZ0A 3QNWA 2YMLA 2PH5A 2ZYDA 3FTNA 3GFGA 3O8NA 2FSGA 3K05A 3CRQA 5T3YA 1ZD2P 3SU8A 2ZSAA 5GWXA 2W4MA 4M53A 5CHEA 3IE2A 4C22A 2OBBA 1RSZA 2H1LA 1XLTC 3GARA 1JR2A 4S1VA 4ZYTA 4HNAB 4Q7KA 3RS5A 5EZYA 2G0TA 4D57A 4TLLB 3R4CA 4EOGA 3I09A 3O94A 4HLDA 1YHNA 4IJQA 4QT0A 3E8MA 5AXDA 1Z15A 3KJEA 4ZTZB 4LKOA 4EPWA 3OUZA 1UK9A 4ZKEA 1LZLA 1UKYA 2A0YA 1YFKA 2YHBA 3K70B 3EXG1 2FEWB 1BMFD 2FPIA 3Q7IA 2IYLD 1PGNA 2CVPA 2FSHA 3FYHA 4HFMA 2Q7DA 4Q01A 1JECA 2RKOA 4EA8A 1LBIA 4HQNA 3PC4A 3LQQA 4MUJA 3L7LA 3DEAA 1N3BA 3B53X 3L4KA 3SLRA 2WFLA 2GXUA 4WY5A 1MNQA 2JLBA 3EVNA 5DCUA 4BVFA 2WV7A 4C9BA 1SUDA 5AI9A 1VPEA 1PS0A 1RM0A 2JIRA 1U8UA 2XWPA 2UZ3A 4ZODA 3I53A 5A5DA 2BPOA 3GNSA 4C3UA 1VL8A 2NM0A 2C99A 2ZIZA 4CKEA 4AQ7A 5HE9A 3HU2A 1A7UA 2WIDA 3ZC3A 4PYOA 2BEVB 1KQNA 1F0PA 3TRFA 1XZ8A 2AKAB 4YWJA 4E5NA 1IRXA 1PFGA 3ADKA 1KYQA 4LCBA 3U0VA 3DE2X 3U0BA 3BRSA 3KOZA 2F3PA 1KI9A 1FUEA 1NYRA 2A78A 3CO0S 5IYZB 1KFEB 4JEUA 3ZDBA 3MT0A 4UFNA 4JUIA 1V6AA 1RZ3A 1K8ZB 3ZE2B 4CIDA 5AVUA 3U61B 1EGMB 2BHNA 3BF8A 3KJGA 4GOLD 3Q7SA 3SF8A 4E5MA 1E98A 3KQSA 1II8B 5F98A 2XTMA 1HDEA 1X9GA 3QYFA 2HDWA 4U7JA 4V03A 5G53C 4B17A 4UOZA 1USKA 5K4HA 2FK8A 1DAKA 1H2FA 5FT9A 2CKDA 1J5PA 3HRHA 3U80A 4U8HA 4Y7DA 2WJVA 3EEIA 1THMA 2AUNA 2YCLA 2ZPAA 3OQIA 4M1TA 4OJTA 4ATNA 5EHGA 4KMSA 4YUZA 5IH3A 2GD6A 3CNOA 3LX5A 4JOBA 1QF7A 4U1RA 4Z9YA 4PWYA 5AM4A 2PWAA 2Z5GA 4J0JA 4YMSA 5GONB 2ACVA 4L3OA 1N2SA 1OC2A 3U7EB 1YA4A 2QLBA 2QG6A 3JS5A 4M38A 5KJFA 4TKUA 5DDIP 1GO2A 2C4HA 3TCKA 1E1CB 1FE8A 3PQ5A 4L95C 4KQ6A 1V1MB 5D85A 5BWLA 5IXSA 1UADA 1X7DA 4DXHA 1ZD4A 1PIWA 3MJ4A 1ZVKA 2O54A 1NI5A 2Q5HA 1W0JA 3DQQA 3ID6C 4YUAA 3QTBA 3UXHA 1N4DA 3GPIA 2RHWA 1ISFA 4DMMA 2GF2A 2RH5A 3RO7A 2VBIA 1OXTA 2N1BA 3RW9A 1CY4A 3G68A 3UTCA 4LGCA 4K9MA 3VR5D 2ID4A 1B15A 2XA2A 5MF6A 4HNGA 4RMIA 3INYA 1OLXB 1W1WA 4A0RA 4FDMA 3QNMA 3QOWA 4AO8A 4MRRA 4RANA 3ZHTA 3BK1A 2VRCD 1XNJA 2YJNA 4F1JA 10MHA 1BDMA 2BFPA 5CGQB 3OZWA 4MWDA 3WSWA 2PSDA 2GILA 4W6ZA 4FFLA 3HDVA 4R8KA 4MYCA 1N1EA 2JGMA 4JJ6A 4P98A 5TJ9A 1UJCA 1PSDA 2CXUA 2I2DA 3M4YA 3AB8A 1EQUA 3G7UA 5EKSA 4DIUA 3OT5A 1NAIA 3RNLA 2OK7A 4YMLA 1KFCB 1S2LA 3DG9A 1GTZA 2WYHA 4J7AA 5CDYA 1LSJA 2JFXA 5CTJA 2JHGA 1GZSA 3PXXA 2Q5QA 3H9CA 5JZSA 1DBIA 2I99A 3SG0A 4FOPA 2IW3A 3PUJA 1E3JA 1JYFA 1BE6A 2V7WA 4ZGBA 1AB6A 2RD2A 3HXPA 1Z7GA 5BWNA 4MI3A 3IP9A 3GAAA 4POOA 3KQKA 1QK5A 2DHDA 2NTJA 4JXZA 4L0QA 3VV3A 2IUUA 4JLJA 5IJ0B 4TYWA 5THKA 4G85A 1BMDA 3P2YA 4UHBA 3RYTC 1QYRA 1Q0LA 2RGBA 4WLEA 2QJRA 5AESA 2VZ8A 1ML3A 4LF7B 1HNWB 4OXXA 1CJVC 2YKGA 1U65A 5ALVA 1WMSA 3I1YA 3MQ4A 2ALJA 2PBZA 2BR4A 3H2JA 3T4XA 3CEJA 2ZBEA 5AMXA 3RC3A 1AURA 1ICEA 4HSGA 3TTWA 4NOKA 3AMVA 2QTCA 2Z2JA 3K92A 4CM6A 2ZVDA 3IHLA 3JR3A 5K0ZA 4AJKA 3F5MA 2O8VA 4V0LA 5ALRA 2ZE6A 1ZJ5A 1ZOPA 2CHGA 3VDXA 2NADA 3WB2A 1ONSA 2ZI9A 5IYZF 4BB0A 5AVVA 5KYVA 1EIWA 3QELB 3TE7A 3CUVA 3DAYA 5GJVC 2Z2XA 4DCCA 2GBPA 5IM4F 1T9KA 1D2NA 2JLCA 3THXB 1XA4A 4XVHA 5K3FA 5FEUA 4D9JA 1ZC4A 2JBAB 2BW0A 1S9DA 4QFBA 3H99A 3T38A 1IPFA 2J87A 2BKVA 1GAEO 2XNSA 4UAJA 3YASA 5CT9A 5B1DA 5JE8A 1FNBA 5BORA 4B4DA 2BRUC 2REBA 3L7AA 3T9BA 6ABPA 2CMGA 2SKDA 4JKIA 4KIFA 5HQTA 3NIGB 1QBGA 4AKGA 4BE4A 3HY3A 5EHIA 4ZO9A 2C20A 3BGOS 3TH5A 2YIMA 3QVMA 3EODA 4GUAA 4HHEA 5F9FA 2OYSA 4IP0A 3DFMA 5LDDC 2XUOA 2OVFA 5L3SB 4WXYB 2VHZA 5GONF 2Z9BA 3QUBA 3VYWA 4R5MA 3WYBA 5ARDA 5EE1A 5DM1A 4YCAA 4ZT6A 1ZJYA 5F5LA 4DR6B 2GZSA 1KWKA 2WI8A 3EWNA 1EFUA 5HRCA 1LNZA 1Z2CA 1GTJ1 3VTFA 3WGZA 3TW0A 1QHGA 4RMHA 4EQZA 4F6CA 3NTQA 3W7AA 5AKLA 4ANFA 3IERA 1MX1A 4IF6A 4CR8A 8MHTA 4KQEA 2PWPA 2OILA 1M10A 1PNVA 2VTKA 2VJMA 3S2ZA 2GWRA 2H7XA 3D3JA 4Q4JB 4B3HA 1A9SA 2ATVA 4AKTA 3HE3A 4B5KA 1LF0A 5HKAA 2TRSB 5KVSA 3Q7PA 4RL6A 1GDDA 2PX8A 3QV1A 3PLRA 2YHAA 1JBQA 2JFPA 5JH7B 4L2IA 3ZJ5A 2ZPUA 3BKWA 5ENVA 5HTKA 2RFLA 5L3ZA 1DRJA 4LF8B 3LGAA 5F23A 5J2UA 1GUBA 2O3UA 3ESCA 3O8BA 3O93A 2XGSA 3QZUA 4X1OA 5FBHA 2QUIA 3RV3A 3A6PC 2VHEA 2XODA 3A9SA 1KVUA 2RHDA 1VLMA 2DM6A 4ZREA 5A4KA 1QRDA 2HWUA 5CVTA 1IJBA 1AQUA 4XDYA 5BSWA 1KYIA 1F51E 1I36A 3L6UA 4MP3A 4NAVA 4PY2A 3HVJA 3UJAA 4L9AA 1BMQA 4ZCSA 4CN8A 4HD8A 4QPNA 9LDBA 4FFMA 4X7RA 3IH5A 1QHFA 3P9YA 3EXHB 2Y05A 2CFSA 3HSSA 5AW9A 5ISMA 5C51B 1AUVA 2O2HA 1SVWA 4ZQEA 4M1WA 2AZXA 3TSYA 1QCYA 3H11B 5IWAB 4XW2A 4FYPA 2P67A 2BGGA 1P91A 1U8TA 4XX0A 4KIUA 1HQKA 5B7NA 3TDKA 1ZD8A 3I2GA 3INTA 3BIJA 1UBCA 3OSZA 4B6QA 4BNMA 4BBPA 1U2ZA 1OV6A 3RVBA 4YAGA 4B4OA 4D6XA 1K89A 3NLLA 1EM6A 1GFWA 1OYWA 5H0IA 4H1HA 1ZH6A 1LPBB 2ZYIA 3CZRA 3HBFA 3QUCA 4G2TA 2X8JA 4RM2A 5AKXA 1XNHA 2PGAA 1N77A 1Y5RA 3HJRA 1Z2NX 5TRTA 2H2WA 1GRRA 4FYYA 5CURA 1E7SA 3PQ7A 3RWBA 1OWOA 3OCVA 5FPHA 1TXGA 3HY4A 2XB6A 1UBOS 3IOCA 4EITA 4GVXA 4HAIA 3VGPA 4XEHA 1VYUA 3GLHB 4CM8B 1JQEA 2D8AA 3F5FA 5IFLA 5J3JA 4Z53A 2OR3A 3V4RA 3BF7A 1JG6A 2NVBA 3ZKWB 4I50B 3CX6A 4NIMA 1Z26A 2ETVA 2CV1A 1MP0A 3TAUA 3UGJA 2W22A 1X3LA 1XRMA 2DLNA 3NH9A 4Q4DA 1ZRNA 4WAUA 3RWMB 1U11A 1JLKA 2RE8A 1FNSA 3QKRA 1J99A 4OP2A 4TXJA 2BZSA 2PZEA 3ADPA 3AUXA 2B9EA 2EU8A 5A6SA 3C6MA 4ESEA 3LD9A 1SUIA 3OX1A 3A9TA 4CIVA 4M89A 5JPIA 1Z35A 4RTOA 2A67A 1IHDA 3BGSA 1S3SA 5BWCA 2X4DA 4LK2A 4YRDA 1A8HA 3H6GA 3FCSB 1HY3A 2FF5A 3G1WA 5L45A 3HJFA 3RRMA 2BV3A 1XDDA 5CBKA 2FG6C 2JIOA 1WNTA 1PJRA 2Q1YA 1CY2A 1N1DA 1PYDA 2QD1A 5JY1A 1OFUA 3C39A 1ODJA 2F8LA 5CLIA 5D3ZA 5ALDA 4BZXA 1DUIA 3ELWA 3R44A 1E4VA 1M2VA 4W8GA 4AJEA 3AF4A 1M75A 2ECFA 1MXFA 2ZJ0A 3EW7A 1G6OA 2IZ6A 3TLKA 4WZAA 5T8KC 1FVXA 1M2GA 3K1TA 4UUOA 1TEZA 5KYXA 4WESA 1M5TA 1EDBA 4BP9A 2ZYGA 3DBLA 2Q9BA 4P0PB 3FSEA 3VZBA 3CB4A 3I12A 4OLAA 3RJMA 2ZTSA 4MMYB 1LH0A 1E2HA 2IWHA 1IOWA 4GG1A 2H48A 1OX4A 3QA3E 4C7OA 1DV2A 2FG5A 4NFSA 5EA2A 3K6KA 3L46A 3WDSA 5JH7F 1JAYA 1UMBB 4KJZA 5DM60 1G8HA 5CVDA 2JJ2D 1J4AA 1TYAE 4HGYA 4ND8B 4RCZA 221PA 3BJZA 2O6HA 1UFKA 2XLBA 1NN1A 3D7LA 3JRXA 1GPAA 4HYQA 3H2GA 4YMIA 5GVRA 5JNLA 5FYQA 4K0KB 3OP1A 2FPSA 2HPHA 1C3VA 2BBOA 2RGNC 4PSUA 4NE7A 4ZOBA 2F55A 4PLTA 2ZM5A 1R3UA 2F43A 3CVOA 1PR9A 3PI6A 3OM9A 1YWGO 4X3CA 1ZISA 1NV9A 2C3PA 1PJ3A 4E51A 3EVAA 3M81A 1T9ZA 1VG8A 2ZSDA 4YRGA 5IF9A 3GLFA 4JYAB 1FRVA 2O7SA 2PBRA 2C92A 4WOJA 4C4RA 4KIGA 5HP4A 4ZO7A 3L6BA 3IR7A 5EKUA 4IY1A 4D3SA 3GYGA 2ZZMA 1BD4A 3DZDA 5H70A 3U4AA 3L8MA 5KQSA 5JJIA 3D6NB 1E3TA 1Z75A 3HYRA 2WNHA 2QTZA 2JA2A 4MA5A 1LS1A 4A0FA 5GOTA 1Y98A 1NFFA 3I0NA 3D31A 2BSXA 2HA4A 4IIHA 2H5JA 4IG4A 4LYYA 4MEJA 4Q3LA 4F9GA 1E9SA 2C04A 3KBBA 3HYNA 5BRAA 3KZXA 4J0KA 1U9JA 3ZH9B 3FUTA 3TUJC 1JLMA 4YAKA 1N1GA 3BXFA 1FJGB 3RC8A 1V7QA 2AR0A 1DT5A 2FJPA 2ZJ2A 2AFHB 2WM9B 3DFZA 4IIVA 3DV2A 2EP7A 1ABFA 3AB7A 1ZOLA 2E87A 3MYRA 4MWCA 4TMWA 2ZJBA 4PGAA 5IJAA 5A9TA 1W44A 2OPHA 2XMDA 4L78A 1R0CA 1TD9A 1E2KA 1EHIA 1GDHA 3EISA 4D4HA 3H5TA 1P17A 3AW8A 1FFYA 2AC2A 4IEIA 1AKUA 1OT3A 4IUCS 5FNVB 2ACKA 4KPUB 4O0MA 3O4HA 4LJLA 2YMMA 5JFOA 4JP5A 5F9MA 1I2AA 3GEMA 3CURA 3D5TA 3PK0A 5BYKA 1QKIA 2EC5A 2WP0A 4IOLA 5E3JA 4J1TC 4I50F 2REQB 3ORQA 1QCCA 1TEHA 2LWIA 3CRZA 3DOEA 4HDRB 1J24A 2C31A 4EO7A 2I33A 1XGKA 3QX7A 1QM5A 2E2WA 5AVKA 2QI9F 3OLCX 4HT3B 4YCCA 5LQRA 1GNQA 1Y1KE 3EQZA 5DZSA 1P33A 4WOKA 3RU9A 3ZJ4A 4B9EA 1U7OA 3OAAA 5C8YA 1IE3A 4L9RA 4WT7A 3A11A 3VYVA 3DD1A 4MRPA 3I42A 3AKYA 1MFPA 3EPPA 5AVYA 4C6RA 1WSWA 2C54A 3HFJA 5GJWC 2FSVC 2FQXA 2UUOA 1BAPA 5GOZA 1C7FA 3O0DA 1ZU4A 3P27A 3NTVA 5EAIA 4UCFA 2YIVX 4AXXA 1SFRA 2NTEA 5TQ2A 1KARA 3CZ4A 4IV5A 4HL6A 5E0KB 3IUJA 1F2DA 5IT0A 3W1EA 1KP2A 1PTJA 5AW0A 2GO1A 1K9VF 5K8IA 1EUZA 1I51A 4DLTA 1L7BA 3W5AA 1XB2A 5CYOA 2O2JA 4WA8A 1QGUB 2C7VA 2C4MA 1GFZA 1NJ5A 4X63A 2CE7A 4F3YA 3WNDA 5DN6D 3LA6A 1FMCA 4EF4A 3OCYA 5REQB 2PV0A 4P93A 3AOEA 4FZJA 1BVRA 3AJAA 3JQBA 3KUKA 3NXSA 2H06A 1K7XB 2QE6A 4L73A 2XZTA 2G4CA 2ZSKA 2C2BA 4EI9A 1KDOA 1CCWA 4KX3A 2G9VA 5K6RA 1U7WA 4YJGA 1E94E 1CDDA 2GN8A 1U2QA 3G9TA 3OIYA 2V4UA 1R6XA 5AP9A 3OC6A 3TNLA 4BWGA 2X9QA 2X0DA 3CR7A 4BPBA 1I32A 3PXEA 4DM4A 2Q4RA 5B2EA 1KMQA 3F9IA 4WXPA 1WXIA 2VDVE 3IHTA 2WWVD 2CHFA 5EXXA 1O08A 3LSTA 4EZBA 5LD2C 1JPVA 2BM8A 2OQRA 3S1AA 1LSOA 4JJ8A 3WL5A 5CB4A 1H69A 5E9JA 4NYMQ 5CYFA 1PZGA 3VBEA 4WVLA 3OOEA 1PQ4A 3NORA 3ZCSA 1UOQA 1KF0A 4L9SA 2RHCA 1ORIA 4RPKA 4LRUA 4ZOAA 1ZD5A 2YL2A 2X7JA 3SYMA 2H7VA 3ZJYA 5EXPA 4Q19A 3JAWA 5B1YA 1QG6A 4RDXA 5EEHA 4M0KA 3H3XA 2IYSA 2ZTHA 4YFYA 4J3JA 5IZ4A 3N87A 3RC9A 2TMKA 3OQOA 5PNTA 2HV9A 2W6CX 2PJUA 3KHUA 1TTQB 3VBCA 3L0CA 1QYXA 1L5HA 4YVFA 5LYYA 1ZGJA 1U7TA 4NS4A 2X1LA 2QORA 3EPLA 3ISVA 3LUBA 1FTNA 2PA0A 3FNQA 5ER9A 1R8YA 2P6MA 5BXQC 1JQ3A 5AUQA 3KLNA 4U7GA 5I4CA 1Z8HA 4DT1B 3BUSA 5TQJA 4B0PA 2BEWA 3SS9X 1J25A 4X24A 4B2YA 1GQSA 2VZ0A 3AP2A 4LA4A 1Y9ZA 1E1QA 1E96A 4GXQA 4JP2A 3ZIAA 3VR4H 5I7RA 1QANA 3TECE 1WAMA 2OT3B 5KWJA 2QE7A 5G4LA 1EUCA 2OCPA 1ZCBA 2ZI6A 4LOJA 1AQIA 4W82A 2XLCA 1FK8A 1E61A 4RD3A 3UWMA 1YRBA 4JI4B 4UNSA 4WNCA 3CPEA 4MRSA 5AXBA 2FKAA 2GK7A 5B3LA 1NF2A 5JS2A 2XSZD 1WCV1 1SBCA 2QSUA 1NXVA 4DWOA 3LVQE 4ZMRA 5LQNA 3DDNA 5AW5A 3WWZA 5FJJA 1ZBQA 4KBGA 1DTSA 2ANBA 5B1HA 2OAP1 4N9QA 4RQUA 3C1TA 2AEFA 4G4SO 2A3RA 1VJ1A 4RCYA 2PX2A 4BNWA 3K5PA 5K3DA 4WGGA 4ZVMA 3FOCA 2AZDA 5F3DA 4F7WA 1KBQA 1JEQA 1R0KA 2OQIA 5FWXA 3USZA 3W2FA 4GP9A 3RLFA 2WZCA 4OQMA 4Y6SA 4CMCA 4EQ6A 2OXCA 3PIRA 3H3FA 4IINA 5L7TA 1X7YA 4R8LA 1V45E 2YYAA 4MWEA 4ARZB 3LT4A 4YRRA 3GDOA 2J9FB 3AUAA 3G5LA 2HNKA 1GZHB 4JJGA 1VSQA 1Y7LA 2AQHA 4KFTA 4RS4A 5LU9A 3BHNA 3NRJA 4Q9IA 4DNXA 2RG1A 1E0AA 5DOZA 3PIIA 1NWCA 2HLHA 4A6XA 3UK0A 2PL1A 1DG1G 3VVLA 4WKNA 2O57A 2XE7A 4KSCA 2FDRA 3KJXA 3ZE8A 2ZRDA 1T5SA 3DDSA 4MEBA 3LQKA 1YZFA 1G8SA 2ZB2A 4M3NA 3RVDA 5HHTA 3E5NA 1VPDA 3DLPX 1L8QA 1IUKA 4WBSA 1D9XA 4AZ0B 1FX0A 4FW9A 5C52B 1KQGA 2Q3JA 1CS0B 2OQVA 2EW8A 2ACWA 4RFVA 3S28A 2HX1A 2ZRHA 4HR7A 2ZRGA 3QLUC 4LOHA 1M8PA 1ZN8A 4BN4A 4O8ZA 1D4FA 2FA9A 2O3SA 4C05A 4BJ1A 1XPJA 4E13A 3A6EA 2VH1A 3HJTA 2H1CA 4YR9A 1JVBA 4AMBA 2P2LA 2IS4A 3GJ7A 1NNSA 2VJPA 1KZ1A 4BMOB 1LK7A 4BNLA 4B3MB 1UBFA 5C2JB 2QMUA 2ICAA 3KQTA 2XT0A 5DE3A 1Y6GA 2BMDA 2I78A 4S2EA 4WGFA 3F90A 3V8MA 4YUWA 2HRCA 1LSSA 2ONYA 3ICEA 1IN8A 5CEJA 2VUHB 1LQTA 4GW3A 3QFHA 3EVDA 5EZSA 1DKLA 1I1NA 4HP8A 1NIJA 4PHGA 4HRXA 1Z8DA 4BMCA 4KXLA 3V8VA 2O7VA 4URFA 2NO5A 3SQDA 1DCMA 3RFVA 1HWYA 3NHAA 4KLRA 3QBEA 4ABYA 2K2WA 1TC2A 3P5BA 3ZWCA 2GXSA 2G28A 3NTRA 5ALYA 4Q1VA 3ASUA 1SPBS 5FX2A 3A1WA 3ILVA 3O75A 4ECEA 4EHJA 3OFND 1M74A 5I01A 4MKIA 3ZTYA 4HDSB 4D56A 1SXQA 3IUYA 1EG2A 3DSRA 4NABA 4R2IA 4KZPA 1S7CA 4WCFB 5E7MA 1QB8A 4B4UA 4NBUA 3MTEA 4E21A 5AW8A 2EL7A 4B7UA 1HFJA 1X38A 1VI6A 2VSNA 4D8VA 3SQXA 3EIXA 1G5QA 4CIYA 1RJWA 2I4NA 4I9FA 1Y4AE 4H08A 1NMSA 3M1AA 4MV0A 2LE0A 1CPYA 2E49A 2OKCA 2UKDA 3KLBA 3QF7A 4H6PA 4QUDA 4TXMA 1A9XA 1M6NA 3KOXA 4H3VA 1O94C 2GAFA 2H0RA 4HNQA 5DYYA 4ZGWA 5LNK6 4RMNA 5CDSA 1Z13A 2WG2A 2ZR9A 4BWYA 3L7JA 4XWOA 3TL2A 5I9MA 1DC3A 1Y6ZA 1ZQ1A 2ZSBA 1H65A 2HNAA 2JFWA 3AIMA 1J7KA 3GN2A 3LF2A 3NBZC 3NHSA 3P32A 1JR3A 1OAOC 4JJKA 2DT8A 3OQVA 4JS0A 4BLOA 1WKVA 5JOQA 3V4PB 3DS8A 4WHMA 1X94A 2QD3A 4FZ5A 1OI3A 5F35A 1FU8A 4DM7A 3UPTA 2XBUA 2LIPA 4HB0A 1YOVA 1ZK2A 4ARBA 4OA8A 3IB3A 4IPTA 3E5RA 1T0UA 1I4EB 1S1CA 1WCIB 1Z0SA 2FZWA 1A9ZA 3CUUA 3H9GA 3KSDO 3LHIA 3QX9A 2YY7A 4C3VA 4CRWB 1OWMA 2CNNA 2C84A 2WKSA 2Y4NA 5EIFA 1ZD3A 1SM4A 1ETUA 5M04A 2C97A 2HUNA 3BGVA 1QG4A 3DBRA 2A0KA 3FWKA 3FRHA 4G9BA 3Q8XB 1SPXA 3EXAA 4XYGA 4NBSA 3W8EA 1WE2A 4WOBA 1J22A 4KJXA 1OB2A 1Y5IA 1ZUNB 4EO9A 1GCIA 1Z82A 4N01A 3K20A 1AE1A 1P1RA 4G8JA 4MR9A 4QKQA 3FMFA 3I9NA 2PM8A 3E3MA 3KV1A 1DC6A 2DGDA 3OT1A 1G59A 1FP1D 4MW6A 3R7BA 1SIBE 4OP1A 2JAOA 4R6WA 5LZ5A 5BUSA 4NOMA 2YS6A 4Q21A 5FWYA 1G8FA 4OB7A 4HLNA 4PHFA 2XZOA 3VOBA 1RRGA 1AGNA 2L2QA 3QU4A 1G19A 5LA6F 1T91A 1EAYA 1XXHA 3VZDA 1Z45A 2RI1A 3S5UA 3EXEB 5IJWA 5KC9A 2D7DA 1EXWA 1PO7A 3NVAA 4NR0A 4FMDB 3OHMA 4GXRA 5DHPA 3V32A 3UAVA 1NJFA 2GJAA 3A4MA 3KOYA 4XPZA 3VC1A 2AJTA 3TQHA 1F7VA 4GLOA 1A1VA 4UAGA 5ALXA 4BO3A 1EPUA 5DX1A 5CJJA 1T5IA 2W9XA 3AETB 1Y7PA 1MRNA 2BFMA 3HCAA 3BRWA 1OCEA 3AY6A 4CODB 1RRKA 1NY5A 3C6QA 3LLCA 3T35A 2HRZA 2CLCX 1KQPA 1HDZA 2ZIAA 5EMHA 3ZZ0A 4PGGA 1RIIA 1DC8A 3VU0A 1V6CA 4N8DA 1Z68A 3C5CA 1GU0A 1CK4A 2JA1A 4EW2A 3I8OA 1BQEA 2BVNA 4P7BA 1LCIA 4OKIA 1F2TB 3HU1A 3QUSA 5EGSA 3ZU2A 2O8EA 4TV8B 1M2WA 1WRBA 4IXMA 1T6ZA 5KSOA 5CDHA 1DELA 3LP6A 5LU8A 1M73E 2A1UA 3UA4A 4PC2A 1P74A 1H9CA 4BMSA 3BWEA 5SY9A 5K6AC 4FDTA 2FWJA 3Q3VA 1SAYA 2QZPA 3I04A 5KVVA 2HLDA 3GL9A 4Q48A 5D5QA 1BCSA 2BKEA 2Y67A 3ENZA 1RE1A 2J08A 2MYPA 5H4HA 3UUFA 4DJFC 1DQYA 5EKXA 1NXPA 1SBTA 2I6QA 1ESNA 4MPPA 1E3WB 3PFCA 3CX4A 4GAEA 1QS0A 3NM6B 4UJ5A 2FRDA 3AG5A 3RTDA 4B75A 3HH8A 3OLYA 1F1BA 1HTBA 4W7HA 4D4KA 1WD7A 2WNSA 3KP1A 3FN4A 1YTUA 2P3OA 4E94A 1PJLA 2JGEA 3H5WA 1E5XA 4ROSA 4LHZA 1QUFA 2AC4A 3LGXA 2LKCA 5B5SA 1BOFA 3D3QA 2Z8ZA 3IAAA 5EVJA 1CZNA 3C6XA 5KX5A 4TOIA 5IN4A 4OAQA 5ALZA 1ZJZA 1M66A 2YIDA 5LWHA 1XD2B 1KI8A 3JQQA 3N7UA 4LXTA 3PNBA 3P4XA 3W04A 2WU8A 2AQIA 1TZJA 2AG1A 4ARSA 1C8KA 2CHEA 3FUUA 4F1KA 4GKKB 1RM5A 1RT9A 1Z4JA 2BE7A 3GHYA 1VHDA 2B92A 1E2QA 3TSZA 3C8ZA 4ASUA 5JAHA 1VKRA 2LCFA 1WZUA 3M4XA 1PLLA 3IBGA 3Q41A 4OI2A 1RCFA 5FLKA 4BFVA 4I1VA 5JZMA 3I5XA 2JCBA 4U7WA 5T7BA 5I9LA 2XUHA 1N36B 2XZPA 2E55A 4L72A 2Q5JA 5JDCA 1GL3A 1Q77A 3COZA 2Y6UA 3U39A 4CR7A 4MLZA 2UVDA 4YV0A 4Q3CA 1XMVA 4O4IB 5F3WB 5AXCA 4XDHA 3LOQA 1W34A 1F3OA 2GN9A 3O4FA 5F2EA 2DCUA 4FHGA 4Z1OA 2I76A 2WD7B 2XECA 2ZXFA 2QGNA 5EIOA 4EG5A 5CFPA 5F1YA 1F6WA 1Z33A 3SP1A 3AL2A 3VHXB 3RKSA 3W8NA 1JU3A 3UC9A 3L7KA 2BEUB 3ICCA 2JCYA 2VNHA 2YRWA 4ARAA 2ZSUA 4HGZA 4QJBA 3R0ZA 4OMUA 1ZA2A 4BV2A 5A6VA 3LIIA 2AUMA 4UFOA 1AV7A 2IT1A 3MC1A 4G89A 5LOVA 4MRAA 3IIKA 3HBNA 1R12A 1P2UA 2O2IA 4EB8A 2HW8A 1G6KA 2A5DA 3E7FA 2C4TA 3TKLA 1NXSA 5IAGA 1UBKS 2HMUA 1NA5A 2INGX 1Z7BA 2QG4A 1Q0UA 4MI1A 4ZOLF 3WWEA 5C9ZA 2QRMA 3WAGA 2GJSA 2HJRA 5DW3A 5TC4A 1UM9A 3UQYS 1YR9A 1M2OB 1SBYA 1NBOA 4JLWA 1XKXA 4YMWA 3ND6A 1T4CB 4XWAA 1EWQA 4MUXA 2B7LA 1ESMA 1ULZA 3PLNA 4KWHA 4MEAA 5SY6A 1WZCA 3SJAA 2BT4A 1EHCA 3DMTC 4CF3A 4R9NA 1ZLYA 2B5OA 1NR7A 4OBXA 5JSFA 2PRJA 3FVWA 3PWZA 3R0VA 1QPGA 5C1OA 5FV4A 5JI2E 2ZCJA 2FOLA 3CRRA 5H83A 1RRMA 3PC8C 1UXJA 1YVDA 2XMZA 3KVYA 1L4EA 4KDCA 4RSRA 5T4EA 2XITA 2B25A 5EWJB 3QOFA 4IQ4A 1ZNZA 2BKLA 2ZROA 4CT0A 1MEJA 2YHIA 3HJAA 3R0XA 4JU9A 1NUSA 3RIYA 1A71A 5CLHA 3VR3D 5LKAA 4M60A 1AK9A 2VHTA 1PL0A 4UDNA 5FULA 2CHUA 1G9XA 1IHPA 4M6WB 4E0BA 1JFFB 4CJXA 2VNKA 4G4IA 2FQWA 3RAPR 3WYNA 3HJGA 1G18A 2Q0XA 4EL5A 1G42A 2PKYX 3DAGA 6Q21A 1X7GA 3SJCA 1IZ7A 2JAPA 2EJWA 3JR7A 1VLHA 2EZ8A 1UFRA 3F6BX 1Q17A 4WN3A 3ZI0A 4DR4B 2I6GA 5NLLA 2R86A 1SG0A 1ULAA 4U5XA 3QXSA 4ED9A 1OZGA 2Y71A 3D59A 1YQUA 3D6FA 5EPOA 2XHEA 1LY1A 4YT8A 3AVWA 2BD0A 1BHJA 1WQ4A 2R11A 4AMYA 4F5DA 5I51A 2ZGVA 1L4GA 1CDOA 4O4HB 1WZNA 4JR1A 1HEYA 4KQCA 1O9BA 1DX6A 5CK4A 3KKOA 1ADGA 1KZHA 1XCOA 1HFEL 3KJNA 1ZOIA 4HNRA 2QBYB 2GRUA 1G8KA 4CPDA 2EBUA 2W70A 3ZIDA 2RB4A 4HQRA 2I65A 3JYQA 3M4ZA 3PG5A 5B1EA 1V8BA 4JBYA 4NNOA 1JQBA 1J5XA 1PZXA 2QBYA 1IIRA 1QQ7A 1K9SA 2AYYA 2DHCA 2HM7A 2WWGA 3GRVA 3QGMA 1N2JA 3L0BA 4K05A 3GD5A 1RPAA 2GNOA 4MOWA 3R7WB 2JFHA 4OQQA 3UAWA 5IP5A 4BKRA 4WJZA 3WHLA 1VJGA 2OCBA 2RCNA 3LLMA 1WCYA 2C5FA 3IPXA 3NHWA 4NEQA 2Z1NA 3CU5A 3DMHA 4N3BA 4BTEA 5HM8A 3DFUA 3HYLA 3MWLA 3EFEA 1AKRA 1C30B 2C5BA 1M0SA 1M8FA 2PSHA 2RSLA 3DB1A 1NUAA 3H87A 3EAQA 4HWRA 1V5IA 3D6AA 4NDAA 4O4IF 5KYNA 1PFUA 4ARUA 1CF9A 4H0FA 4QGHA 3RYFA 1G98A 3LDGA 4FX5A 2JZCA 5D1HA 4GEKA 2WTBA 1SIWA 3O8OA 4JOSA 4QX6A 1LBSA 5DIFA 1R74A 2MINB 3K9LA 2QM3A 1KVSA 1KJJA 4OY3A 1AQ6A 3AVUA 3PNMA 2G72A 3JQEA 4X44A 5F12A 5LP1A 1E64A 1N2XA 4J0FA 3EG9B 3LPLA 1T3ZA 5ESWA 2WEKA 5ES3A 3BYZA 4YMGA 3UHFA 5K0TA 5KWVA 4TN1A 3ZWVA 4N3GA 4K8RB 4A3SA 1CUEA 5L8VA 1Y4SA 1RXSA 1KJYA 1DXQA 1U3WA 2VJOA 4LHYA 2A5LA 2JD0A 2PEYA 2BN4A 2XADA 1BN7A 4EG4A 3VUEA 3DOIA 3LWBA 2P5YA 3E3LA 3PNSA 5E6SB 3SBXA 4EAAA 1FP4A 3PICA 3ZUGA 3TDMA 4B40A 1AZWA 2FLWA 4D5EA 1DZIA 3AESB 1GU1A 1EFHA 3JZMA 3Q3EA 4KH1A 4YP6A 4WY8A 3T3OA 2C42A 3IEKA 4J4HA 5EP1A 4Z3DA 1OX5A 4E5PA 4M9RA 1PNTA 1QHNA 4NBTA 5DHTA 1YQGA 1A69A 1BFDA 3H8JA 3AUFA 3WBBA 3DLTA 4FFOA 2P3SA 2AMYA 3HB9A 1GCOA 2ECKA 3R2JA 4FGUA 3KUUA 4MGIR 5KU7A 1Y6FA 1NKSA 2AXNA 5KYTA 1MBZA 2X4IA 4EFKA 1NBEA 3NEJA 4X20A 3TINA 2B1IA 2JZNA 3M1IA 4KE6A 3CLRD 3FM9A 5HYVA 4JC4A 1PP4A 1PJAA 2QD4A 1IBKB 2VQDA 3UMBA 1R4NA 3KQWA 4HTFA 2YY5A 3PX3A 2A5JA 4YDRA 2H9AA 3RTGA 1POXA 2BBTA 3TTSA 5DNVA 3HDTA 1CP3A 4JBWA 5EESA 4HBGA 3LFTA 4MK4A 2GEUA 3G7NA 3PDIB 1VE3A 3KTAA 3QU7A 4WE3A 4IM7A 3KC2A 4K9RA 2WTXA 1MJFA 4MI9A 3ZV5A 3K8QA 2QTVB 4LHSA 2Z4SA 5LP6F 4LFBB 2FEAA 3MGCA 5I9SA 3KOWA 3ZU3A 4U2DA 4Y1FA 4ZVLA 3TYXA 4EAQA 3KSZO 1PZFA 5TNXA 1JN0A 1A8UA 2XMGA 1LJ8A 4NI5A 1V71A 4N7BA 2ZATA 2UZ1B 5DM0A 4JIGA 3GJ0A 2BSQA 4K6MA 2QYSA 5HF8A 1XTIA 1RAHA 1U2GA 2R8OA 4ALKA 3ZVMA 1P3Y1 2H65A 3A14A 3FAKA 4L8LA 1DJPA 1A2BA 3I04M 4L3VA 4RGYA 4Z9XA 3T3MB 3LQ1A 5D01A 2OGUA 1JJ7A 4L57A 5DRYA 1GITA 1W4CA 1ZX1A 3QBJA 3RTBA 4EG8A 3G2LA 3W79A 2HCFA 2QUBA 5KEIA 3KKNA 1JT2A 4JGIA 1R0RE 2WIBA 4FE7A 1SCNE 4UE6A 2JLXA 1L7PA 4DQ0A 4Q02A 1GEGA 3EDRA 2GSDA 1FQWA 3HKEA 1X8XA 4R3NA 3AJEA 2C82A 1KAQA 2P41A 3L5OA 1XD8A 3GZNA 1C4OA 4DA9A 1MEEA 1HLDA 3NU1A 2BFBB 3CM0A 3RBZA 4DLPA 2XOKD 3MCZA 3ITDA 4G56A 3H1FA 3WIBA 1SVOA 4BB5A 4MGEA 2CE2X 4HNAA 5ALQA 1UDWA 4ZXPA 4HVLA 1QPZA 2PMDA 3KPJA 1XTRA 4LYAA 1SY7A 2ZYUX 2F2TA 3I0MA 3REQB 2CDBA 3PKIA 1RWNA 3AILA 3AHCA 3C97A 3MJEA 4MYTA 3L07A 4AY6A 3TIFA 4XLZA 3OPNA 3Q5EA 3PYMA 4M22A 2QPOA 3TMKA 1KH1A 2L19A 3WLJA 7ADHA 3NDBB 4JODA 2QGFA 1IN5A 2GEBA 3IDQA 4DY6A 2E4YA 5EIBD 3DVLA 1MLDA 4PLHA 4OLFA 2EJTA 4K6KA 3LCCA 3QI7A 1X2EA 5EIWA 1V3TA 4E3ZA 2I22A 2J46A 1JKJB 3G6KA 1MVOA 4HOYA 4RC9A 5KSPA 4D46A 3T1YB 5CFNA 4C1BA 1KNQA 2HV8A 4TSKA 3QBTA 4RGVA 3CCFA 3ZDZB 3ZU5A 2PKQO 2CY0A 1B6GA 3MINB 1NMZA 2YV1A 4X6UA 2HU8A 3BRCA 4LZNA 3VR5H 2QSJA 3JZAA 1XN1A 4O33A 5BRJA 5CB6A 4GSLA 2WDZA 5EUQB 1KPGA 1IHXA 1T1EA 3SC3A 2ZCUA 4H1WA 5JECA 1ZNXA 2GK6A 5K3AA 4FB4A 1E3MA 3L1UA 4F3CA 1MGPA 5E95A 4WFQA 2HTEA 2VDKB 3OZIA 2BEVA 2WU1A 3B1KA 2R62A 5JS6A 1NVWQ 2GCNA 4LJ8A 3L8ZA 5AJTA 1D6MA 1Q1EA 3EOAI 2OK8A 4F85A 1MHTA 5AI4A 1T24A 4MIYA 3UHJA 2QYHA 5BQFA 1U2SA 3AEQB 5H3HA 3KYBA 1G4AE 3VYRB 1A97A 1SCIA 5M7EA 4Y7CA 2XB4A 4J4TA 1ZH4A 3G02A 1XAIA 1O7JA 1ULSA 4EHHA 1II8A 2PE5A 1II0A 1KAOA 4PO1A 1I10A 1HH4A 2BDTA 1F8YA 1RKXA 2XGMA 3N0RA 3VNQA 4KGDA 1H8HD 3X43A 1AUXA 1I7DA 2PFKA 3EJWA 1J0XO 3PHJA 4I9NA 1HE2A 5AWFC 1VHQA 1NVVQ 4GI5A 3G2MA 1XMIA 3TD9A 1SD5A 1EAMA 2Q3HA 2YTZA 1HZJA 4Y9TA 1U6IA 2DPHA 3I2YX 2DR3A 2JGFA 4CF4A 5EMKA 2IIQA 1NM5A 3WX0A 1U8EA 4UNQA 5F73A 3WLTA 2EW2A 4JBXA 4C3ZA 1C2TA 1KEUA 3OWOA 4P53A 4RY2A 3ZN2A 3L1HA 3UICA 4BE7B 3BCSA 1D9ZA 1LBQA 1KXZA 2DKNA 1E1CA 2IJGX 3O4VA 5AI0A 5AOAA 1V1MA 4NZPA 4LOIA 1PFVA 2B30A 4NCJA 2ZYAA 4IO1A 2QAJA 3RSFA 4REMA 3ZWWA 4A2QA 2AFIB 2PX0A 1X1BA 2W48A 1G0NA 1MT0A 3PGA1 1JIVA 2Q3DA 4EEXA 3BT7A 5DHSA 2V0NA 2AX4A 1YK1A 3F71A 2D2FA 2W2OA 1JHMA 4G1CA 4HCJA 1Q84A 4P5DA 3A9WA 4BASA 4FCWA 1W9HA 3JQAD 5GQSA 4IDBA 5CH8A 1T4MA 2C3OA 2Y1DA 1QRSA 1N8KA 4IS2A 5JJBA 3UK1A 5DGDA 1OLXA 1GT91 4FFWA 4LJYA 4RZQA 4M9ZA 3EDMA 3JVIA 4Z2YA 3T0FA 3WLRA 5KTNA 2C88A 1ZR4A 4BZZA 4O4LB 4EJ0A 4ENPA 3AJ8A 2V97A 4HQ6A 1LX7A 3A32A 2HQ1A 1KMNA 2W8BB 4GI2A 1J2JA 1ISJA 3HCEA 3WQQA 3RBVA 3I83A 2Z83A 3OLXA 1ZONA 1QYVA 2DFKB 4MWGA 3R23A 4D7AA 4F38A 3Q8KA 1NXTA 2XBMA 3JPYA 1EK5A 2HMTA 3ZK8A 2B0CA 2H2GA 2JG3A 1AGXA 1QVVA 1T4DA 1BJKA 1ESDA 2O50A 2OZLB 3SYRA 1GV1A 3FPCA 4GPAA 4TRRA 4DQUA 2W6JA 2EFDB 1MN6A 3K5IA 1F6BA 1FFHA 2I7XA 5IJ0A 4RELA 1X8KA 2OVBA 2D00A 4OYRA 4TMVA 4B1FA 2XYGA 3OM0A 5I45A 4KNWA 1BDJA 4URZR 4EPXA 1GRVA 1H8EA 1RJGA 2DYKA 4U5QA 2UYHA 1H85A 1Z07A 1ZXLA 3L7CA 1A9OA 4FMCF 2CF5A 6AT1A 1HT3A 1F60A 1WHTB 2B3TA 1TYBE 3D0OA 5I7OA 2VI5A 2WF7A 4KTVE 1UPAA 3GLTA 5KHAA 1K0UA 2B4AA 3H5IA 3TPFA 2I8CA 4J0CA 3GJ5A 1MB0A 4HDOB 1BHSA 1K3TA 2M98A 4R84A 1UBTS 2G8LA 1U02A 4AS1A 1CQJB 1W73A 3BSYA 3QELA 3UMGA 1WV0A 2X1HA 2C59A 5SICE 4NXMB 1EK0A 3NOOA 4I1OA 3FNRA 1G63A 3EEYA 3N2YA 4NWIA 4ROTA 2QTFA 3A3PA 3THXA 1PFWA 4IRMA 4Q93A 3TN7A 2JBAA 2PBFA 4O3MA 3VNVA 2TECE 1RW4A 3JZFA 3TTUA 4CQLB 2YYZA 1E5DA 4BUJA 3PDWA 3A1FA 1Z4OA 1VYVA 1T0IA 2QLMA 4TXNA 3JYOA 3LNCA 4URXR 5I47A 2JANA 5DP2A 4OF4A 3E53A 1GPUA 3EEBA 3H19A 4MX8A 1AIPA 1WDKA 1XJQA 2IEZA 4GBGA 4NU6A 4Z9FA 3TTVA 4CYMA 3TS1A 1EVEA 1BDIA 4WWHA 1YB6A 2B1QA 3H16A 4WFIA 2YJ6A 3CW8X 1KORA 4H6XA 4QU5A 5JEDA 4C7BA 3HQ4O 2PDAA 3JQRA 2K6GA 4AN4A 5L3SA 1IATA 2FFHA 1U0GA 4W1SA 1GHTA 1ISSA 4XJVA 4HH4A 3I5MA 5ICGA 5J4LA 1PJTA 2O05A 2JLSA 3AW9A 4G0QA 5KB3A 2VQ3A 1A9PA 4FGSA 2XVXA 2HLNA 3VR6A 1Z4KA 1D1TA 1R6TA 2HO5A 1CW2B 4HVAA 4MRNA 4NK4A 5CBPB 2WE7A 1U80A 4LQ4A 3I2IA 4LFAB 3WXBA 3LYUA 4LE0A 4IYRA 1YMVA 1N4AA 2VYNA 2C9YA 1CQIB 4FKBA 3SBOA 4Q4JA 2LP4Y 3S1SA 1GDTA 1NW7A 1QH8A 2W0MA 3MJRA 5C8VA 1WTAA 1O3YA 3HVRA 5CX1B 5HJ2A 5HVNA 4I7EA 1N33B 1ESEA 1H0KA 1K75A 1TFUA 4CE6A 4YPVA 5JH7A 5LMNB 3C3DA 3X2EA 4BNXA 1SCDA 4RYDA 1XTBA 1T34A 1T35A 1XK7A 1OFUX 1A76A 1CUIA 4G1MB 4O4LF 3PJFA 4JHLA 4NYIR 4RUKA 3T99A 3W9YA 1VPVA 1XZEA 3VNSA 2YXPX 3EIFA 1IWBB 3K6RA 3EDCA 2WWRA 3LC1O 1RXIA 1XHFA 1MR3F 1P1IA 4FN4A 4FS3A 2OHIA 4C4AA 2Q9AA 2A5GA 2C4KA 1A9QA 1TPYA 4FHCA 2XTAA 4P92A 4OJKA 4RPCA 1K8YB 5F52A 3BXZA 3P7MA 2G7MC 4IJVA 2P6PA 3ETGA 4KXYA 2FGKA 2AW5A 2ZUWA 4YC7A 4N41A 2OFOA 2GYWA 3O74A 2K5UA 4BMZA 3V42A 1Z6PA 1Z0JA 2O3JA 3DONA 4M76B 3B52X 4BLRA 1OBFO 4UBIA 5KWSA 3EXHA 3R7NA 1R4ZA 3VYTB 2C58A 3CN7A 3RG2A 2P4QA 4FNAA 4CI0B 1UAGA 4DGSA 5EIHA 4JWTA 1MT3A 5AVWA 1C7QA 4XH9B 2GXAA 3K0AB 4LHXA 1SQSA 1KVRA 3H11A 3UMVA 3K53A 5H8WA 4ALJA 4DE5A 2HF8A 3SR4A 3SSMA 5EHXA 5LQKA 4JLSA 4L22A 2EX1A 3IP5A 3HVKA 3VA7A 3WB1A 2ET6A 2MR5A 2X8AA 2BKUA 4DBLE 3TRKA 2PLWA 1AXGA 3D6UA 5J5VA 4TL7A 1EJ6A 2QTGA 2GEKA 4L50A 3T54A 3ZBUA 2JBHA 2ZI3A 1KJNA 5D6OA 3Q3IA 3KZMA 1XMPA 3LK6A 1V2GA 2WOJA 3F4LA 5A7HA 4KREA 2WM8A 1GTG1 1JR4A 3FJ1A 2Q27A 4DABA 4RVCA 1QAQA 3JRNA 2QGZA 1FLDA 2X9LA 5G41A 4ADSG 4FX2A 2X2OA 5JARA 2WQ6A 4MB0A 4DPKA 4QUJA 2W58A 1PT5A 1SUFA 3HUUA 3W6NA 3TUIC 4AF7A 1X7ZA 2VQEB 1TQ8A 3GLHA 4X71A 3W0LB 4CM8A 1Q95A 2Q8QA 3LCUA 4D0RA 4PCAA 3IQIX 4OHCA 1NQ5A 1MO3A 4I1UA 3ZKWA 5JEEA 4I50A 1GR1A 3DHEA 3SOPA 4OUDB 1QDUA 1I6KA 1UXHA 2B1RA 1C9EA 2IOYA 2QX8A 2ZSHA 3EZ2A 3NNSA 3QF4A 4ZVQA 1PE0A 1Z5ZA 1HOXA 1UF9A 5JJLA 5JYDA 4YJ2B 1QZTA 4KQMA 1F06A 4JYCA 4EW3A 4KQHA 5TPZA 3FZYA 2V7TA 4DJTA 3AF0A 1FX1A 2W2TA 1HRKA 1WPXA 3PC6A 1DHTA 1SVLA 4G0XA 3PHHA 4LZLA 5AUNB 1HEUA 3E9DA 1NUHA 2FPWA 1L8OA 2WFMA 4OQLA 3PS9A 3TFWA 5TDHA 3NBFA 4OXIA 3ZQ4A 1PTJC 4DR5B 1L5ZA 2MSDB 1VL6A 3LQRA 2YASA 4HDQB 3GLIE 3FVTA 2XNCA 4GPTA 4P36A 4OQFA 3OMXA 3WY9A 1IC6A 1RJ9B 1T15A 3KEQA 3OA2A 4G41A 3R41A 4XWGA 4F46A 4KUGA 4J1QA 3EUEA 2P9TA 1SULA 3V9AA 5AVSA 5EINA 4JUFA 1ZH0A 4RTMA 3KQUA 1XNQB 4U4AA 2DWPA 1JZTA 2NUTB 3TLCA 4PHTA 2QZ4A 4MQ5A 7YASA 1J8YF 4J2HA 3IMGA 1NQOA 4TRMA 3JQBC 1PHPA 2X0EA 3VSCA 5HK8A 4G0YA 2FY8A 2JAQA 3CPSA 3ELDA 3EMVA 5CVVA 3WZLA 1P6QA 3MRSA 2YZ7A 1DRVA 2Y93A 4TS3A 4ND8A 4IDHA 4V0SA 2OZEA 2WMOB 2NZXA 3B2EA 1FA9A 2A57A 3I5UA 2QPTA 3COPA 1N2IA 3CNBA 2J4FA 3DAFA 1Y4DE 3KB2A 3AXSA 3IIIA 3IT1A 5AKEA 4JKYA 1V11B 3ND8A 4MITA 4IZOA 3RIGA 4D3XA 4US2R 4UVHA 4Y6RA 1E2EA 5I3CA 3G85A 3DR5A 2JAWA 1T6BY 2VSQA 1M0EA 3T4UA 2BIFA 3ZLJA 4AZSA 3N2IA 3OEHD 4HEA1 2WWXA 2ASVA 2XIQA 2AK2A 1ZICA 3DTNA 4YJFB 1N0VC 4JYZA 4N6OA 1C1DB 2B94A 2XKAA 3WLLA 2QU7A 1M2JA 3JD0A 2VF8A 3OLVA 2RGWA 4OL0A 2K7FA 1B0UA 3KLMX 3TCNA 2FFRA 1E63A 4DLRA 2H4WA 3A9CA 1UAAA 3T3EA 5C5DA 1TD1A 1A0OA 4NDNE 3S1LA 1MPTA 4ZI7B 1T2UA 5JALA 4KQJA 1YASA 3SF0A 3ZNPA 1ODLA 1PWHA 1TKBA 2IUYA 4ZAZA 3WK8A 1QFZA 1O95D 2I66A 2NXNA 2Q7XA 4KN9S 5A7GA 3T95A 3UH1A 3WQHA 4GQIA 1GPDG 2AFHA 5AW4A 3EH2A 2QQFA 2JJQA 2KPOA 4JDPA 1OJ7A 4ZQHA 4YP5A 5IVKA 3OEWA 2LKDA 3BHMA 1OF1A 2RG7A 3REGA 4LWZA 3ONNA 3LHFA 3GNLA 4IVQA 5AK6A 2WJIA 3S8YA 1NP7A 2NPOA 5AKGA 1Y7IA 1YC5A 3GBSA 3ETDA 4KPUA 5FNVA 1FJXA 4ODIA 4UATA 4KAAA 4PAGA 4TYNA 1Z4NA 4Y9RA 4E09A 4FWBA 3CJRA 1QRAA 3KU1A 3JTEA 5IW8A 2REQA 4CEJB 4HDRA 1SWWA 5GV8A 4OK5A 1TRKA 4ZYVA 4J7CA 4HMOA 4TZ0A 2XVAA 2EVWX 1PJCA 5D3MB 3VJMA 1WXDA 2Z3VA 2M6RA 4IKPA 2RI0A 4PPQA 4DTCA 3HYCA 1UZLA 1BN6A 1XQVA 3QJGA 3NPMA 5AOBA 3O9VA 4BGDA 3RABA 2O06A 3FW1A 1RBYA 4YGXB 3PSHA 5FFFA 1GNSA 1M33A 1PV1A 1DIAA 4KIJA 4TKZA 4S1WA 2CSUA 2O4UX 2QZJA 4TSRA 1TAQA 4MVWA 5AI6A 1WUTA 1YAJA 4HI0E 3EWIA 5KQMA 1ZM7A 1YF3A 3OZEA 4DLWA 3K71B 3ZDDA 1ZXBA 5CXUA 2GEVA 1PGQA 5DBIA 5AVZA 4NAUA 5CD9A 1Y4ZA 2P1RA 2XVZA 2AJLI 2J5BA 1JEAA 1RKQA 4GF5A 2AWOA 4JZYA 3ZQUA 4F5ZA 4IG9A 4OI0A 3LRTA 4B8ZA 3U4CA 1RM3A 4G3XA 1W47A 1P4JA 4JLDA 2ODPA 4CMEA 4DV0B 1G60A 3D3WB 5JD6A 4B09A 2X0FA 1QGUA 3R75A 4EG6A 2PFSA 1XZQA 3PL5A 2CCKA 1O97D 1IXYA 2O2EA 4KE7A 3T3IA 3LCVB 5K0LA 3GT0A 2C7OA 3H0EA 5DTIA 2CMKA 2Q5FA 3MRTA 5REQA 2I91A 2EYUA 2H29A 4WY2A 5A05A 3X1WA 3GEPA 4HGQA 2VCYA 1YZKA 1C9YA 4HAOA 2E0IA 2GCOB 5EYPB 4WKBA 4DXAA 3DWEX 2GI4A 3S3TA 2YRXA 4R9VA 2WZBA 4PZEA 1SXPA 2RHMA 1WXWA 1R37A 3PUYA 2XJ4A 3G23A 2FI1A 3T5MA 4C88A 4B44A 4ZAVA 1WVGA 3P45A 2V7XA 4X1IB 5LL6P 1T9GS 5FPPA 1XELA 2OBMA 4XAQA 2NP6A 3KXPA 1ZD1A 2P9JA 2V3CC 1SC6A 4CF5A 1T2AA 5KINB 3DOFA 4NK5A 1ZUHA 3BOSA 1HOTA 4U0JA 3S44A 3PNYA 2ZAYA 1JQLB 2LV8A 1QORA 2VYND 3NG1A 1VE7A 2BELA 3THSA 4QPCA 4LRSB 3DLCA 4LXGA 3N9IA 4CCYB 1MDBA 2Z95A 2CD7A 3MJSA 2NU8B 3QFTA 3A6DA 3Q12A 4EKIA 2QTHA 3EGOA 3TZLA 4AIIA