2IDOB

Structure of the e. coli pol iii epsilon-hot proofreading complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
YDWNIAAKSQEERDKVNVDLAASGVAYKERLNIPVIAEQVAREQPENLRTYFMERLRHYRQLSLQLPKGSDPAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase III epsilon subunit
publication title Structure of the Escherichia coli DNA polymerase III epsilon-HOT proofreading complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 28
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 2idoB00
1SE7A 2AXDS 2AE9A 1DU2A 2IDOB 2XY8B
chains in the Genus database with same CATH superfamily
3EHZA 4MLKA 4Z8XA 3PJAA 3UULA 4LF4T 1HNWT 5LHGB 3N9LA 1KK7A 3VHLA 1U4QA 4P09A 5FYMA 5TAOA 1D0ZA 4UVBB 3ZN1B 1HX8A 1NAFA 2NW8A 4EEDA 1WR0A 4PAGA 4LF7T 5JQGE 2ZM0A 2ES0A 3TLWA 5JH7E 4DV4T 3PJAJ 5L3CB 3OYZA 5L3DB 2X68A 2BS2A 4X20E 4DV6T 2BG9E 2CWOA 4AISA 1SHZC 5HXCA 2VB6A 3O1HA 4I50E 5LNKA 1MMDA 1KEYA 2V8SV 4MBQA 3N2KE 5AQIB 4I4TE 3AE7A 3AE9A 2OA5A 4CN4A 5LCYA 4B3ST 3RKOA 4KHZF 4WYVA 1KNRA 2W63A 1N33T 5LGUB 3P4QA 1MMAA 2H89A 3A7MA 4EYYR 3ONLC 5LBMA 2VASA 5EZYE 3AE8A 3AB3B 5AQOB 3VRBA 5DJQC 4A98A 5HEHA 4UV8B 4O4JE 3UUMA 3I1AA 4DR5T 1V9DA 4B3TT 4JYAT 4U3CA 2M67A 4K0KT 2KNDA 3ZN0B 2A72A 2X51A 3JAFA 3ZLIA 2BG9B 2XQYA 2WDVA 2CWYA 4TWDA 4F6RC 4QH4A 5JDMA 3ANWA 4IDQA 4G63A 1Y01A 1BR2A 3WAKA 4DIDB 1OEDC 1UK5A 4O2AE 4DBRA 2KMFA 3KV6A 4JI0T 4Q25A 4H63H 3QB5K 4GKJT 4X62T 3OKQA 3A8YC 3MKDA 4DV3T 3L8RA 5C8YE 2WMOA 2QVAA 3PUYF 3SOLA 5L3GB 1ZEEA 2E9XD 1IJ6A 3FZHB 2FJEA 2H7VC 1SA0E 3AAIA 3BQIA 4E7ZA 3AXJB 4OX9T 4OK0A 4IIJE 4PJMA 2QA7A 3AA0B 4NPPA 2WU2A 4DNDA 4HFVA 4Z91A 2C0SA 3FHNA 4KX6A 1M7KA 5AFUL 5H6QB 4KI0F 3L09A 1MNEA 4YSYA 1D1CA 3IHRA 4TWHA 4UEMA 4LMLA 1MMNA 5LGNB 2XAGB 1IZNB 2EHOD 5FP3A 4HWIB 2CHOA 2WWVA 3SFEA 5LP6E 1HTJF 3AE4A 4GKKT 2CCQA 3RC8A 4UF0A 5AQRB 2K9AA 2DWKA 3TLTA 2D0UA 1UURA 3TKLB 2X0YA 4JEUB 4CI1B 4YFSA 1L0VA 2FJBA 1EZ3A 1QUUA 1Z8UA 2GK9A 1E7PA 5AQPB 1IBMT 2DL1A 2VURA 5LG4A 3LSVA 2WZHA 5HEGA 3IF8B 5HWXA 4UIGA 2NTYA 3GWHA 3HKDE 3F2EA 5AQKB 1XMOT 4EEBA 2BG9C 3E0ZA 2XJ7A 4AKRB 2VL8A 4JI8T 2LM9A 1WYCA 4DV5T 3FZLB 3C4ZA 4YHJA 3HL6A 2LHRA 3MA9A 4HE8A 4DV1T 1OEDA 2DCFA 5HEUA 1UX4A 1CUNA 2YK0A 4GIWA 2V6XA 2KT9A 2XAFB 4MALA 2C5IT 2H3RA 3SS1A 4EAHA 3N2OA 2IUBA 3HR0A 4JI7T 2FJDA 3WI3A 4X1IE 4HGAA 3B13A 2X9WA 5ETWA 4DR1T 2SPCA 2WY2A 1T98A 3PUXF 2NW7A 4O4HE 3H3AA 1S35A 4HFHA 3KBTA 3KVBA 2XY8B 4ZI3C 5HEJA 2V7IA 2JRKA 4I0UA 3KDSE 3N5LA 3OTOT 5JVDE 1ZOYA 3OPCA 3PDYA 3FZFB 3KFWX 4PNIA 1QLBA 3FZMB 3VR8A 5DQWA 4L9IA 5HAXA 2VQET 5FL1A 4EIWA 2YOEA 2ODUA 3RYFE 4Z90A 3KINB 3NRXA 3ETVA 2BZBA 4HN9A 1T7SA 1E2AA 3CVRA 5EK3A 1I6ZA 3OBVE 4N78D 4ZI2D 2YDSA 5ABEA 4LFBT 4HFIA 4ILBA 3JADA 4K0UA 1G8XA 4OHFA 2MBGA 1UX5A 2XUEA 4TX5A 3P50A 4HFCA 4EZ4A 4EOZB 2IC9A 4I55E 2B1EA 2FBWA 3EUHA 1VOMA 5IHYA 1I94T 1FEWA 4OYKA 3MACA 4XBFB 3HKCE 2VKOA 2BG9A 3AEDA 4IGUA 2XQ8A 2ZLYA 3RC3A 3V5SA 2I59A 1IBKT 2E5VA 4U7IA 3K1SA 4NIQA 3ZSSA 4GYSA 2RPAA 2W00A 4YXDA 3CX8B 2KXPB 4X5TA 1SUMB 5FKYA 4LMKA 3HKEE 4DMWA 3M3ZB 2N2NA 4YLHA 3MJXA 2XASB 2WDQA 2LT3A 5HCJA 5IUXA 5AQSB 3PUAA 5JRCB 1S94A 3UFGA 2JQKA 3JCFA 4L5GA 2HPJA 3R6NA 2YDQA 4NXNT 5FVKA 1XMQT 1J5ET 2WWUA 2Y8DA 1FIOA 4KHPT 1YXRA 4UVAB 1D1AA 5AQTB 1IJ5A 4HFEA 3B5MA 3RQWA 2V7MA 3PUGA 3VRAA 3RGLA 3H3MA 4YJ2E 2WB5A 4CZZB 4O8SA 4LMJA 2LLYA 4HEAA 3PUWF 3JAEA 2XQAA 1D0YA 3O9XA 2E9XB 2D2SA 3K3OA 4UVCB 5LA6E 1WYBA 3DTOA 3G06A 3ETUA 3JC6D 2LOPA 2Q9QA 2Y6XA 2QGSA 1IBLT 1QSDA 2J1DG 2KZ7B 4YT0A 2CPTA 5FY1A 2WBLA 4JV5T 4IL4A 5L4HA 5FY7A 2JMHA 5LJMA 5C2TA 3PU8A 4F8HA 2XAJB 5AQUB 5JDFA 4FJOA 3TLUA 2DI4A 2D9DA 2WDRA 2BDEA 3WAJA 3ZMSB 2XHEB 3C64A 2EHOB 3C4XA 2FJAA 3RRWA 3AA6B 3CX6B 2CHNA 1XZYA 3N9NA 2J62A 2BBHA 1YD8G 3O1IA 5LHHB 3C98B 4OFZA 4DMVA 3OVUA 5HWYA 3FBZA 5JDLA 1WCRA 2N9DA 4H9RC 2HN2A 5AQMB 4JI2T 4BJNA 2VL0A 2ZM2A 4BJMA 2JIWA 5KMGP 3UU8A 3EVYA 2IMLA 3RH3A 3CK6A 4CN1A 4PJLA 3ZSTA 5FXVA 1HFAA 2YKSA 2XQ6A 2W66A 3RPUA 3GN5B 4IDPA 1O3XA 2X9YA 1HNZT 1J5WA 4ANJA 2UUCT 1LRZA 4HFDA 4ILUA 5L4EA 5LOVE 4X1KE 4CXYA 2IW5B 4B3MT 4QXCB 2A3DA 3F57A 3ZC1A 2ZM8A 3UFEA 1XNQT 2ACZA 2K24A 1MIYA 2UUAT 2YU1A 3AE6A 2BKNA 3CMLA 2KWHA 3AEFA 4AI6A 3TLSA 3ZYLA 3T8OA 2MPKA 3RX6A 3SWHA 3I0QA 3RYCE 3NVOA 2W4XA 3LDQB 4UV9B 2E9XC 1T8BA 2AE9A 3VKHA 3RIFA 4X64T 3BK9A 3ZMZB 4IE0A 1MIVA 2NOXA 3AVRA 4V1Av 2UXNB 5AQHB 2JPFA 2KINB 2IDOB 1KNPA 2WZIA 2KSRA 2XZEA 2X0LB 2CE7A 2UXBT 4IDNA 4ZEYA 2XAQB 2VVNA 2LJLA 2V7JA 2FUPA 3AE1A 5L3EB 3GMIA 4WNKA 3N9MA 3M65A 5IYZE 3ZEFB 2EHOC 4JUYA 1B7TA 2HHHT 5J2TE 5JDQA 4TV9E 2YINA 4IDOA 3A5XA 2W62A 2WAUA 4EGWA 4AQGA 3C51A 3AA1B 3Q2MA 2A9UA 3FB2A 2UXDT 4A97A 4ILAA 4JLEA 1ZKEA 2JQHA 4U2YA 1BR0A 1HS7A 1SE7A 4P0BA 2ZMAA 3P7IA 2R6GF 1UGOA 3CQXC 5JRCA 2VQFT 5AQFB 4JI3T 3ZC0A 2IIUA 3SRZA 2LE8A 2LRLA 5LMUT 1UUSA 4IREA 3UUNA 3F31A 1X9BA 3AEBA 5FVLA 5FY0A 3QUJA 2LSYA 5HXEA 3LFMA 3E08A 1W0AA 3PUVF 5J1GA 5AQGB 3RQUA 2DNXA 5JREA 2OLTA 4DUYT 4GYRA 3PE0A 2LHNA 1US7B 5LB7B 2A2FX 2RP4A 3N9OA 2CXFA 2WU5A 1OXZA 2UU9T 4BA9A 4P0AA 2E9XA 2WCAA 3UT5E 4DO0A 4I43B 2IAKA 2PG8A 3AE2A 1GQEA 4HWFA 1LKXA 3OYXA 3AE5A 1Z0PA 5M4YA 2MYSA 4QWNB 4BAYB 3UU4A 1MMGA 3KV5A 3Q5XA 4AKIA 1X79A 5FL0A 3IA3A 3NBXX 2LSGA 5BMVE 5JDHA 3CKDA 3EI0A 4HKAA 3I9WA 3PUQA 5CA0E 3AEAA 5ABGA 3PURA 1AJ3A 3ANWB 4WBOA 1VCTA 3P4WA 4YHHT 5HXRA 2J4GA 1M62A 4AIUA 2LRKA 1MIWA 2EHOA 2LM2A 5KXJA 2DLRA 4UELA 1R8IA 4PK6A 1FJGT 4IE6A 3N9PA 4IDZA 2WM9A 4LF5T 3VKGA 2UXXB 2XTLA 4JI6T 2CBIA 5AQJB 4C91A 1KNZA 3BQKA 2LSIA 4XAXB 4ZI2C 2L3LA 3NRYA 4ISTA 4CXXA 3UQ7A 1CHUA 4CQIA 1OWAA 4GK0E 5BR8T 4ZHQE 4KMCA 1XWMA 4KP3C 3ONXA 2Q9QD 3P8CD 2M6BA 1YKEB 2RA1A 4ISSA 4ERRA 4A5XA 4DR6T 3GN5A 3KVAA 4DR2T 2YDRA 2K3WA 3RHWA 2XQ5A 2X66A 4H9SE 2QYWA 4QH1A 1D1BA 4LFAT 2M6IA 5CA1E 1BR1A 4G2AA 2HH7A 3EABA 3VU7H 3ZYMA 3LJCA 5HYAA 3FBLA 2YEVC 3DJBA 4KBMB 1OEDE 2LOSA 5CFBA 4HWCA 2PFVA 4ADZA 2MTQA 4ZZCA 4IL9A 3N2GE 5ABFB 1HR0T 1W0BA 4DV2T 3J7Yq 1JNZA 3J9X1 4EXTA 5F5WA 2V1DB 4H9NC 2J47A 4U7YA 2L8KA 2WP9A 2CRBA 2C5KT 3AXJA 5KDMC 1W9RA 2XM1A 3ABVA 1HX1B 3ZMVB 3CIRA 4QH5A 4NXMT 1FMWA 3R84B 2V7LA 1XDPA 1H7CA 4HTEA 1YW0A 2N1GA 3PV0F 1DU2A 3U3IA 4H9OC 4NUVA 2XSBA 4ZXLA 5L3FB 4TV8E 3HI2A 4NUUA 4O4IE 4FI5A 4QXBB 4L0RA 2OV9A 5JDNA 2V6YB 1YKHB 5FMNA 4DR7T 4A56A 1BR4A 4B6XA 2HN1A 3Q9DA 4PJJA 2I0MA 4U31A 3AA7B 5LYJE 3JC6C 4DR4T 3RI5A 4H63V 3UTKA 3AAAB 4YTPA 4DUZT 4ZOLE 4TWFA 5H6RB 3ZYKA 1NENA 5JR9B 3ZJ2A 3FZKB 2DHRA 1WRDA 5HXSA 3QK6A 2NP9A 1NWMX 2VK9A 3DP7A 4HFBA 4PFOA 2WSSV 1T72A 2X9XA 4J2CA 1HG5A 5ABHA 4JI1T 3O4XE 5FXZA 4LFCT 2W67A 2VKHA 2W0GA 4CI3B 5JDGA 1JNRA 2V26A 2Z6EA 4YSXA 1ZP0A 2E5LT 4H9PC 3D0TA 2IHR1 2V5CA 3K8PC 3PUZF 4JEHB 5LMNT 3O1JA 5F8PA 4IE4A 3Q5EA 2BS3A 2NW9A 4QXHB 5HXHA 4AQFC 4GOUA 3HA4A 2JQQA 4ASKA 2V5DA 5DQVA 1HG2A 2UUBT 2B76A 3P4RA 3EDUA 2MOZA 3K3QC 3MK7C 3QC9A 4O2BE 3ZMTB 3KV4A 3IBPA 4EYUA 3CPZA 5JTGA 4X65T 4TNWA 1KF6A 2AXDS 3P4SA 4ZS2A 3S4UA 4C90A 2DWGA 4PK4A 2XAHB 2UXCT 2F4VT 2H7OA 4ZS3A 3ZT7A 4JI4T 1IAPA 4X66T 3ZPOA 4UR9A 2NTXA 2XQ4A 5L2LA 2V7KA 2HPLA 3N9QA 4TZ4C 1WLXA 4PW8A 2BKPA 4DVDA 5DABA 3LK42 3RIAA 3T1HT 2BVLA 3ZT6A 3EAMA 2NR4A 5A1LA 2I6HA 1FMVA 3LBXB 2BVMA 4TUYE 2NWBA 2ACXA 4PFPA 4AKGA 4COFA 5JR9C 2PJQA 4DV7T 3SFDA 2CLYB 2VKDA 2WMNA 4KUMB 4ILCA 5LHIB 2KLQA 2LSKA 3RKGA 2CA5A 2CBJA 3VR9A 5LGTB 1W09A 3C4WA 4EV6A 4UXNB 2CXDA 2L9QA 4EZHA 4DV0T 1HCIA 2PTFA 2P9BA 3T1YT 1NEKA 3KV9A 3AEGA 3KBUA 2XQ9A 4HWDA 5CB4E 3CX7B 4JI5T 2LEHA 3RYHE 3ZCJA 2VKJA 3K3NA 4AKLA 3LK2B 5EK4A 3ZT5A 2Q9QB 2BKOA 1J1JA 2G0UA 5ABFA 4B3RT 4AQFA 3AE3A 2VVSA 3U78A 3UUXB 1YQ3A 3UU5A 5L3BB 4TN7B 1HNXT 4QX8B 4WW0A 3EDVA 3E22E 3I9YA 3CQCB 3RF1A 5J2UE 4ZI7E 1HF8A 4P1NA 3GA8A 5FNVE 2X0HA 1ZV4X 5C3JA 4MFRA 4AXPA 4HWHA 2JQ9A 4QHOA 3UU6A 4AKHA 4ZZBA 4WBNE 4XZCA 3AECA 2D5UA 3RIUC 4QX7B 5AQQB 3HKBE 1E1HB 2V6YA 2CXLA 4DBQA 3NZQA 3AEEA 2E2AA 5AQNB 2XPKA 2XQ7A 2LKHA 2Y48B 4PJNA 2C5JA 4E7SA 1YQ4A 1WFDA 5LXTE 4IT4A 4YTNA 4U72A 5CGMA 2E8IA 4O4LE 2H88A 5JR9A 3UUBA 4WZXA 3PUSA 1VRBA 1UCUA 2YU2A 3UQ4A 3QNUA 3CQGB 5ADXL 1U5PA 3NKZA 5KX5E 1N36T 3NZPA 3OJAA 5L47A 1XDOA 1D0XA 2CLYC 4ZI3D 3P4PA 4CXWA 4U33A 4AQYT 5LG3A 3AVSA 2ODVA 2IC6A 5AQLB 1VCSA 2ZM6T 3QB5A 3W15B 5CJ5A 3V5UA 5IWAT 2BS4A 2JMKA 3QOFA 5FXXA 4U74A 1LVFA 4U2ZA 3ZMUB 4OYJA 2XM2A 2KWIB 3TLVA 4X1YE 3RLFF 5FXWA 2Q9QC 4H9QC 3X1DA 3Q5DA 1ZHCA 5HCMA 5EK2A 4YSZA 3FXEB 5GONE 4YY3T 4CN6A 2D0TA 5LJNA 1KFYA 3H37A 3LK3B 4IE5A 4IE7A 3I0OA 2JJ9A 2LKGA 3C50A 2QRXA 3ZCIA 2XSAA 4M1PA 2K48A 4DR3T 4MHCA 5HEOA 3NWIA 1MNDA 3IEEA 2W2UA 2PBIA 2CMRA 3Q5WA 3RRCA 3L3PA 3PTRB 3ESLA 3RIUA 4JBWF 1WR6A 3BQLA 4UF0B 1LVKA 5LBQB 4TNVA 2MAWA 2W61A 2YN6A 3CWZB 3MZKB 2BBJA 3MXZA 2X9HA 4LF8T 2X67A 3AAEB 4LF6T 2K5BB 4LF9T 4YJ3E 3L39A 1N34T 2WQYA 3ONJA 1G73A 3UU3A 1Y64B 1XNRT 4IHJE 2WS3A 2CM0A 3PU3A 2LSJA 3LBXA 4GK5E 4QKNA 1N32T 3LG7A 4PK5A 3B57A 5E0OA 2XQ3A 4EB6E 5J0ZA 3FXDB 1OEDB 5AQVB 3RYIE 3ZKRA 3ZJ1A 4YTMA 2VWAA 5F3JA 4CI2B 2CEAA
chains in the Genus database with same CATH topology
1SE7A 2AXDS 2AE9A 1DU2A 2IDOB 2XY8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE7 A;  2AXD S;  2AE9 A;  1DU2 A;  2IDO B;  2XY8 B; 
#chains in the Genus database with same CATH topology
 3EHZ A;  4MLK A;  4Z8X A;  3PJA A;  3UUL A;  4LF4 T;  1HNW T;  5LHG B;  3N9L A;  1KK7 A;  3VHL A;  1U4Q A;  4P09 A;  5FYM A;  5TAO A;  1D0Z A;  4UVB B;  3ZN1 B;  1HX8 A;  1NAF A;  2NW8 A;  4EED A;  1WR0 A;  4PAG A;  4LF7 T;  5JQG E;  2ZM0 A;  2ES0 A;  3TLW A;  5JH7 E;  4DV4 T;  3PJA J;  5L3C B;  3OYZ A;  5L3D B;  2X68 A;  2BS2 A;  4X20 E;  4DV6 T;  2BG9 E;  2CWO A;  4AIS A;  1SHZ C;  5HXC A;  2VB6 A;  3O1H A;  4I50 E;  5LNK A;  1MMD A;  1KEY A;  2V8S V;  4MBQ A;  3N2K E;  5AQI B;  4I4T E;  3AE7 A;  3AE9 A;  2OA5 A;  4CN4 A;  5LCY A;  4B3S T;  3RKO A;  4KHZ F;  4WYV A;  1KNR A;  2W63 A;  1N33 T;  5LGU B;  3P4Q A;  1MMA A;  2H89 A;  3A7M A;  4EYY R;  3ONL C;  5LBM A;  2VAS A;  5EZY E;  3AE8 A;  3AB3 B;  5AQO B;  3VRB A;  5DJQ C;  4A98 A;  5HEH A;  4UV8 B;  4O4J E;  3UUM A;  3I1A A;  4DR5 T;  1V9D A;  4B3T T;  4JYA T;  4U3C A;  2M67 A;  4K0K T;  2KND A;  3ZN0 B;  2A72 A;  2X51 A;  3JAF A;  3ZLI A;  2BG9 B;  2XQY A;  2WDV A;  2CWY A;  4TWD A;  4F6R C;  4QH4 A;  5JDM A;  3ANW A;  4IDQ A;  4G63 A;  1Y01 A;  1BR2 A;  3WAK A;  4DID B;  1OED C;  1UK5 A;  4O2A E;  4DBR A;  2KMF A;  3KV6 A;  4JI0 T;  4Q25 A;  4H63 H;  3QB5 K;  4GKJ T;  4X62 T;  3OKQ A;  3A8Y C;  3MKD A;  4DV3 T;  3L8R A;  5C8Y E;  2WMO A;  2QVA A;  3PUY F;  3SOL A;  5L3G B;  1ZEE A;  2E9X D;  1IJ6 A;  3FZH B;  2FJE A;  2H7V C;  1SA0 E;  3AAI A;  3BQI A;  4E7Z A;  3AXJ B;  4OX9 T;  4OK0 A;  4IIJ E;  4PJM A;  2QA7 A;  3AA0 B;  4NPP A;  2WU2 A;  4DND A;  4HFV A;  4Z91 A;  2C0S A;  3FHN A;  4KX6 A;  1M7K A;  5AFU L;  5H6Q B;  4KI0 F;  3L09 A;  1MNE A;  4YSY A;  1D1C A;  3IHR A;  4TWH A;  4UEM A;  4LML A;  1MMN A;  5LGN B;  2XAG B;  1IZN B;  2EHO D;  5FP3 A;  4HWI B;  2CHO A;  2WWV A;  3SFE A;  5LP6 E;  1HTJ F;  3AE4 A;  4GKK T;  2CCQ A;  3RC8 A;  4UF0 A;  5AQR B;  2K9A A;  2DWK A;  3TLT A;  2D0U A;  1UUR A;  3TKL B;  2X0Y A;  4JEU B;  4CI1 B;  4YFS A;  1L0V A;  2FJB A;  1EZ3 A;  1QUU A;  1Z8U A;  2GK9 A;  1E7P A;  5AQP B;  1IBM T;  2DL1 A;  2VUR A;  5LG4 A;  3LSV A;  2WZH A;  5HEG A;  3IF8 B;  5HWX A;  4UIG A;  2NTY A;  3GWH A;  3HKD E;  3F2E A;  5AQK B;  1XMO T;  4EEB A;  2BG9 C;  3E0Z A;  2XJ7 A;  4AKR B;  2VL8 A;  4JI8 T;  2LM9 A;  1WYC A;  4DV5 T;  3FZL B;  3C4Z A;  4YHJ A;  3HL6 A;  2LHR A;  3MA9 A;  4HE8 A;  4DV1 T;  1OED A;  2DCF A;  5HEU A;  1UX4 A;  1CUN A;  2YK0 A;  4GIW A;  2V6X A;  2KT9 A;  2XAF B;  4MAL A;  2C5I T;  2H3R A;  3SS1 A;  4EAH A;  3N2O A;  2IUB A;  3HR0 A;  4JI7 T;  2FJD A;  3WI3 A;  4X1I E;  4HGA A;  3B13 A;  2X9W A;  5ETW A;  4DR1 T;  2SPC A;  2WY2 A;  1T98 A;  3PUX F;  2NW7 A;  4O4H E;  3H3A A;  1S35 A;  4HFH A;  3KBT A;  3KVB A;  2XY8 B;  4ZI3 C;  5HEJ A;  2V7I A;  2JRK A;  4I0U A;  3KDS E;  3N5L A;  3OTO T;  5JVD E;  1ZOY A;  3OPC A;  3PDY A;  3FZF B;  3KFW X;  4PNI A;  1QLB A;  3FZM B;  3VR8 A;  5DQW A;  4L9I A;  5HAX A;  2VQE T;  5FL1 A;  4EIW A;  2YOE A;  2ODU A;  3RYF E;  4Z90 A;  3KIN B;  3NRX A;  3ETV A;  2BZB A;  4HN9 A;  1T7S A;  1E2A A;  3CVR A;  5EK3 A;  1I6Z A;  3OBV E;  4N78 D;  4ZI2 D;  2YDS A;  5ABE A;  4LFB T;  4HFI A;  4ILB A;  3JAD A;  4K0U A;  1G8X A;  4OHF A;  2MBG A;  1UX5 A;  2XUE A;  4TX5 A;  3P50 A;  4HFC A;  4EZ4 A;  4EOZ B;  2IC9 A;  4I55 E;  2B1E A;  2FBW A;  3EUH A;  1VOM A;  5IHY A;  1I94 T;  1FEW A;  4OYK A;  3MAC A;  4XBF B;  3HKC E;  2VKO A;  2BG9 A;  3AED A;  4IGU A;  2XQ8 A;  2ZLY A;  3RC3 A;  3V5S A;  2I59 A;  1IBK T;  2E5V A;  4U7I A;  3K1S A;  4NIQ A;  3ZSS A;  4GYS A;  2RPA A;  2W00 A;  4YXD A;  3CX8 B;  2KXP B;  4X5T A;  1SUM B;  5FKY A;  4LMK A;  3HKE E;  4DMW A;  3M3Z B;  2N2N A;  4YLH A;  3MJX A;  2XAS B;  2WDQ A;  2LT3 A;  5HCJ A;  5IUX A;  5AQS B;  3PUA A;  5JRC B;  1S94 A;  3UFG A;  2JQK A;  3JCF A;  4L5G A;  2HPJ A;  3R6N A;  2YDQ A;  4NXN T;  5FVK A;  1XMQ T;  1J5E T;  2WWU A;  2Y8D A;  1FIO A;  4KHP T;  1YXR A;  4UVA B;  1D1A A;  5AQT B;  1IJ5 A;  4HFE A;  3B5M A;  3RQW A;  2V7M A;  3PUG A;  3VRA A;  3RGL A;  3H3M A;  4YJ2 E;  2WB5 A;  4CZZ B;  4O8S A;  4LMJ A;  2LLY A;  4HEA A;  3PUW F;  3JAE A;  2XQA A;  1D0Y A;  3O9X A;  2E9X B;  2D2S A;  3K3O A;  4UVC B;  5LA6 E;  1WYB A;  3DTO A;  3G06 A;  3ETU A;  3JC6 D;  2LOP A;  2Q9Q A;  2Y6X A;  2QGS A;  1IBL T;  1QSD A;  2J1D G;  2KZ7 B;  4YT0 A;  2CPT A;  5FY1 A;  2WBL A;  4JV5 T;  4IL4 A;  5L4H A;  5FY7 A;  2JMH A;  5LJM A;  5C2T A;  3PU8 A;  4F8H A;  2XAJ B;  5AQU B;  5JDF A;  4FJO A;  3TLU A;  2DI4 A;  2D9D A;  2WDR A;  2BDE A;  3WAJ A;  3ZMS B;  2XHE B;  3C64 A;  2EHO B;  3C4X A;  2FJA A;  3RRW A;  3AA6 B;  3CX6 B;  2CHN A;  1XZY A;  3N9N A;  2J62 A;  2BBH A;  1YD8 G;  3O1I A;  5LHH B;  3C98 B;  4OFZ A;  4DMV A;  3OVU A;  5HWY A;  3FBZ A;  5JDL A;  1WCR A;  2N9D A;  4H9R C;  2HN2 A;  5AQM B;  4JI2 T;  4BJN A;  2VL0 A;  2ZM2 A;  4BJM A;  2JIW A;  5KMG P;  3UU8 A;  3EVY A;  2IML A;  3RH3 A;  3CK6 A;  4CN1 A;  4PJL A;  3ZST A;  5FXV A;  1HFA A;  2YKS A;  2XQ6 A;  2W66 A;  3RPU A;  3GN5 B;  4IDP A;  1O3X A;  2X9Y A;  1HNZ T;  1J5W A;  4ANJ A;  2UUC T;  1LRZ A;  4HFD A;  4ILU A;  5L4E A;  5LOV E;  4X1K E;  4CXY A;  2IW5 B;  4B3M T;  4QXC B;  2A3D A;  3F57 A;  3ZC1 A;  2ZM8 A;  3UFE A;  1XNQ T;  2ACZ A;  2K24 A;  1MIY A;  2UUA T;  2YU1 A;  3AE6 A;  2BKN A;  3CML A;  2KWH A;  3AEF A;  4AI6 A;  3TLS A;  3ZYL A;  3T8O A;  2MPK A;  3RX6 A;  3SWH A;  3I0Q A;  3RYC E;  3NVO A;  2W4X A;  3LDQ B;  4UV9 B;  2E9X C;  1T8B A;  2AE9 A;  3VKH A;  3RIF A;  4X64 T;  3BK9 A;  3ZMZ B;  4IE0 A;  1MIV A;  2NOX A;  3AVR A;  4V1A v;  2UXN B;  5AQH B;  2JPF A;  2KIN B;  2IDO B;  1KNP A;  2WZI A;  2KSR A;  2XZE A;  2X0L B;  2CE7 A;  2UXB T;  4IDN A;  4ZEY A;  2XAQ B;  2VVN A;  2LJL A;  2V7J A;  2FUP A;  3AE1 A;  5L3E B;  3GMI A;  4WNK A;  3N9M A;  3M65 A;  5IYZ E;  3ZEF B;  2EHO C;  4JUY A;  1B7T A;  2HHH T;  5J2T E;  5JDQ A;  4TV9 E;  2YIN A;  4IDO A;  3A5X A;  2W62 A;  2WAU A;  4EGW A;  4AQG A;  3C51 A;  3AA1 B;  3Q2M A;  2A9U A;  3FB2 A;  2UXD T;  4A97 A;  4ILA A;  4JLE A;  1ZKE A;  2JQH A;  4U2Y A;  1BR0 A;  1HS7 A;  1SE7 A;  4P0B A;  2ZMA A;  3P7I A;  2R6G F;  1UGO A;  3CQX C;  5JRC A;  2VQF T;  5AQF B;  4JI3 T;  3ZC0 A;  2IIU A;  3SRZ A;  2LE8 A;  2LRL A;  5LMU T;  1UUS A;  4IRE A;  3UUN A;  3F31 A;  1X9B A;  3AEB A;  5FVL A;  5FY0 A;  3QUJ A;  2LSY A;  5HXE A;  3LFM A;  3E08 A;  1W0A A;  3PUV F;  5J1G A;  5AQG B;  3RQU A;  2DNX A;  5JRE A;  2OLT A;  4DUY T;  4GYR A;  3PE0 A;  2LHN A;  1US7 B;  5LB7 B;  2A2F X;  2RP4 A;  3N9O A;  2CXF A;  2WU5 A;  1OXZ A;  2UU9 T;  4BA9 A;  4P0A A;  2E9X A;  2WCA A;  3UT5 E;  4DO0 A;  4I43 B;  2IAK A;  2PG8 A;  3AE2 A;  1GQE A;  4HWF A;  1LKX A;  3OYX A;  3AE5 A;  1Z0P A;  5M4Y A;  2MYS A;  4QWN B;  4BAY B;  3UU4 A;  1MMG A;  3KV5 A;  3Q5X A;  4AKI A;  1X79 A;  5FL0 A;  3IA3 A;  3NBX X;  2LSG A;  5BMV E;  5JDH A;  3CKD A;  3EI0 A;  4HKA A;  3I9W A;  3PUQ A;  5CA0 E;  3AEA A;  5ABG A;  3PUR A;  1AJ3 A;  3ANW B;  4WBO A;  1VCT A;  3P4W A;  4YHH T;  5HXR A;  2J4G A;  1M62 A;  4AIU A;  2LRK A;  1MIW A;  2EHO A;  2LM2 A;  5KXJ A;  2DLR A;  4UEL A;  1R8I A;  4PK6 A;  1FJG T;  4IE6 A;  3N9P A;  4IDZ A;  2WM9 A;  4LF5 T;  3VKG A;  2UXX B;  2XTL A;  4JI6 T;  2CBI A;  5AQJ B;  4C91 A;  1KNZ A;  3BQK A;  2LSI A;  4XAX B;  4ZI2 C;  2L3L A;  3NRY A;  4IST A;  4CXX A;  3UQ7 A;  1CHU A;  4CQI A;  1OWA A;  4GK0 E;  5BR8 T;  4ZHQ E;  4KMC A;  1XWM A;  4KP3 C;  3ONX A;  2Q9Q D;  3P8C D;  2M6B A;  1YKE B;  2RA1 A;  4ISS A;  4ERR A;  4A5X A;  4DR6 T;  3GN5 A;  3KVA A;  4DR2 T;  2YDR A;  2K3W A;  3RHW A;  2XQ5 A;  2X66 A;  4H9S E;  2QYW A;  4QH1 A;  1D1B A;  4LFA T;  2M6I A;  5CA1 E;  1BR1 A;  4G2A A;  2HH7 A;  3EAB A;  3VU7 H;  3ZYM A;  3LJC A;  5HYA A;  3FBL A;  2YEV C;  3DJB A;  4KBM B;  1OED E;  2LOS A;  5CFB A;  4HWC A;  2PFV A;  4ADZ A;  2MTQ A;  4ZZC A;  4IL9 A;  3N2G E;  5ABF B;  1HR0 T;  1W0B A;  4DV2 T;  3J7Y q;  1JNZ A;  3J9X 1;  4EXT A;  5F5W A;  2V1D B;  4H9N C;  2J47 A;  4U7Y A;  2L8K A;  2WP9 A;  2CRB A;  2C5K T;  3AXJ A;  5KDM C;  1W9R A;  2XM1 A;  3ABV A;  1HX1 B;  3ZMV B;  3CIR A;  4QH5 A;  4NXM T;  1FMW A;  3R84 B;  2V7L A;  1XDP A;  1H7C A;  4HTE A;  1YW0 A;  2N1G A;  3PV0 F;  1DU2 A;  3U3I A;  4H9O C;  4NUV A;  2XSB A;  4ZXL A;  5L3F B;  4TV8 E;  3HI2 A;  4NUU A;  4O4I E;  4FI5 A;  4QXB B;  4L0R A;  2OV9 A;  5JDN A;  2V6Y B;  1YKH B;  5FMN A;  4DR7 T;  4A56 A;  1BR4 A;  4B6X A;  2HN1 A;  3Q9D A;  4PJJ A;  2I0M A;  4U31 A;  3AA7 B;  5LYJ E;  3JC6 C;  4DR4 T;  3RI5 A;  4H63 V;  3UTK A;  3AAA B;  4YTP A;  4DUZ T;  4ZOL E;  4TWF A;  5H6R B;  3ZYK A;  1NEN A;  5JR9 B;  3ZJ2 A;  3FZK B;  2DHR A;  1WRD A;  5HXS A;  3QK6 A;  2NP9 A;  1NWM X;  2VK9 A;  3DP7 A;  4HFB A;  4PFO A;  2WSS V;  1T72 A;  2X9X A;  4J2C A;  1HG5 A;  5ABH A;  4JI1 T;  3O4X E;  5FXZ A;  4LFC T;  2W67 A;  2VKH A;  2W0G A;  4CI3 B;  5JDG A;  1JNR A;  2V26 A;  2Z6E A;  4YSX A;  1ZP0 A;  2E5L T;  4H9P C;  3D0T A;  2IHR 1;  2V5C A;  3K8P C;  3PUZ F;  4JEH B;  5LMN T;  3O1J A;  5F8P A;  4IE4 A;  3Q5E A;  2BS3 A;  2NW9 A;  4QXH B;  5HXH A;  4AQF C;  4GOU A;  3HA4 A;  2JQQ A;  4ASK A;  2V5D A;  5DQV A;  1HG2 A;  2UUB T;  2B76 A;  3P4R A;  3EDU A;  2MOZ A;  3K3Q C;  3MK7 C;  3QC9 A;  4O2B E;  3ZMT B;  3KV4 A;  3IBP A;  4EYU A;  3CPZ A;  5JTG A;  4X65 T;  4TNW A;  1KF6 A;  2AXD S;  3P4S A;  4ZS2 A;  3S4U A;  4C90 A;  2DWG A;  4PK4 A;  2XAH B;  2UXC T;  2F4V T;  2H7O A;  4ZS3 A;  3ZT7 A;  4JI4 T;  1IAP A;  4X66 T;  3ZPO A;  4UR9 A;  2NTX A;  2XQ4 A;  5L2L A;  2V7K A;  2HPL A;  3N9Q A;  4TZ4 C;  1WLX A;  4PW8 A;  2BKP A;  4DVD A;  5DAB A;  3LK4 2;  3RIA A;  3T1H T;  2BVL A;  3ZT6 A;  3EAM A;  2NR4 A;  5A1L A;  2I6H A;  1FMV A;  3LBX B;  2BVM A;  4TUY E;  2NWB A;  2ACX A;  4PFP A;  4AKG A;  4COF A;  5JR9 C;  2PJQ A;  4DV7 T;  3SFD A;  2CLY B;  2VKD A;  2WMN A;  4KUM B;  4ILC A;  5LHI B;  2KLQ A;  2LSK A;  3RKG A;  2CA5 A;  2CBJ A;  3VR9 A;  5LGT B;  1W09 A;  3C4W A;  4EV6 A;  4UXN B;  2CXD A;  2L9Q A;  4EZH A;  4DV0 T;  1HCI A;  2PTF A;  2P9B A;  3T1Y T;  1NEK A;  3KV9 A;  3AEG A;  3KBU A;  2XQ9 A;  4HWD A;  5CB4 E;  3CX7 B;  4JI5 T;  2LEH A;  3RYH E;  3ZCJ A;  2VKJ A;  3K3N A;  4AKL A;  3LK2 B;  5EK4 A;  3ZT5 A;  2Q9Q B;  2BKO A;  1J1J A;  2G0U A;  5ABF A;  4B3R T;  4AQF A;  3AE3 A;  2VVS A;  3U78 A;  3UUX B;  1YQ3 A;  3UU5 A;  5L3B B;  4TN7 B;  1HNX T;  4QX8 B;  4WW0 A;  3EDV A;  3E22 E;  3I9Y A;  3CQC B;  3RF1 A;  5J2U E;  4ZI7 E;  1HF8 A;  4P1N A;  3GA8 A;  5FNV E;  2X0H A;  1ZV4 X;  5C3J A;  4MFR A;  4AXP A;  4HWH A;  2JQ9 A;  4QHO A;  3UU6 A;  4AKH A;  4ZZB A;  4WBN E;  4XZC A;  3AEC A;  2D5U A;  3RIU C;  4QX7 B;  5AQQ B;  3HKB E;  1E1H B;  2V6Y A;  2CXL A;  4DBQ A;  3NZQ A;  3AEE A;  2E2A A;  5AQN B;  2XPK A;  2XQ7 A;  2LKH A;  2Y48 B;  4PJN A;  2C5J A;  4E7S A;  1YQ4 A;  1WFD A;  5LXT E;  4IT4 A;  4YTN A;  4U72 A;  5CGM A;  2E8I A;  4O4L E;  2H88 A;  5JR9 A;  3UUB A;  4WZX A;  3PUS A;  1VRB A;  1UCU A;  2YU2 A;  3UQ4 A;  3QNU A;  3CQG B;  5ADX L;  1U5P A;  3NKZ A;  5KX5 E;  1N36 T;  3NZP A;  3OJA A;  5L47 A;  1XDO A;  1D0X A;  2CLY C;  4ZI3 D;  3P4P A;  4CXW A;  4U33 A;  4AQY T;  5LG3 A;  3AVS A;  2ODV A;  2IC6 A;  5AQL B;  1VCS A;  2ZM6 T;  3QB5 A;  3W15 B;  5CJ5 A;  3V5U A;  5IWA T;  2BS4 A;  2JMK A;  3QOF A;  5FXX A;  4U74 A;  1LVF A;  4U2Z A;  3ZMU B;  4OYJ A;  2XM2 A;  2KWI B;  3TLV A;  4X1Y E;  3RLF F;  5FXW A;  2Q9Q C;  4H9Q C;  3X1D A;  3Q5D A;  1ZHC A;  5HCM A;  5EK2 A;  4YSZ A;  3FXE B;  5GON E;  4YY3 T;  4CN6 A;  2D0T A;  5LJN A;  1KFY A;  3H37 A;  3LK3 B;  4IE5 A;  4IE7 A;  3I0O A;  2JJ9 A;  2LKG A;  3C50 A;  2QRX A;  3ZCI A;  2XSA A;  4M1P A;  2K48 A;  4DR3 T;  4MHC A;  5HEO A;  3NWI A;  1MND A;  3IEE A;  2W2U A;  2PBI A;  2CMR A;  3Q5W A;  3RRC A;  3L3P A;  3PTR B;  3ESL A;  3RIU A;  4JBW F;  1WR6 A;  3BQL A;  4UF0 B;  1LVK A;  5LBQ B;  4TNV A;  2MAW A;  2W61 A;  2YN6 A;  3CWZ B;  3MZK B;  2BBJ A;  3MXZ A;  2X9H A;  4LF8 T;  2X67 A;  3AAE B;  4LF6 T;  2K5B B;  4LF9 T;  4YJ3 E;  3L39 A;  1N34 T;  2WQY A;  3ONJ A;  1G73 A;  3UU3 A;  1Y64 B;  1XNR T;  4IHJ E;  2WS3 A;  2CM0 A;  3PU3 A;  2LSJ A;  3LBX A;  4GK5 E;  4QKN A;  1N32 T;  3LG7 A;  4PK5 A;  3B57 A;  5E0O A;  2XQ3 A;  4EB6 E;  5J0Z A;  3FXD B;  1OED B;  5AQV B;  3RYI E;  3ZKR A;  3ZJ1 A;  4YTM A;  2VWA A;  5F3J A;  4CI2 B;  2CEA A; 
#chains in the Genus database with same CATH homology
 1SE7 A;  2AXD S;  2AE9 A;  1DU2 A;  2IDO B;  2XY8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...