2IDOB

Structure of the e. coli pol iii epsilon-hot proofreading complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
YDWNIAAKSQEERDKVNVDLAASGVAYKERLNIPVIAEQVAREQPENLRTYFMERLRHYRQLSLQLPKGSDPAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli DNA polymerase III epsilon-HOT proofreading complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA polymerase III epsilon subunit
total genus 28
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 2idoB00
2AE9A 2IDOB 2AXDS 1DU2A 1SE7A 2XY8B
chains in the Genus database with same CATH superfamily
2LE8A 4TNVA 1B7TA 2XM1A 3EVYA 1XMOT 1I94T 3B5MA 2C5KT 3RX6A 3K3QC 1YQ3A 4HGAA 4AKRB 2LSIA 4A56A 3O1HA 2UXDT 3LK2B 4DR6T 1MMDA 2DWKA 1BR2A 3VHLA 5LGUB 1IBKT 3A5XA 3KV4A 2UUBT 1E7PA 2CPTA 2MTQA 4LF5T 2EHOB 3RYHE 2KINB 3IHRA 4U31A 2KT9A 2E9XC 4X1IE 3AE9A 3HKCE 3N9QA 5DABA 3U3IA 4PJMA 3P4WA 4H9SE 2UUAT 1OEDE 2XQ3A 3FB2A 3H3MA 5FXVA 5H6QB 4JI2T 1ZOYA 4HFBA 4JBWF 4B6XA 1S35A 1MMNA 4UVBB 4BA9A 5IWAT 2W61A 3QUJA 5LNKA 4DUZT 2ZLYA 1YKHB 5JR9A 4LF4T 3RQUA 1ZP0A 4TNWA 1BR4A 5JRCA 1HTJF 2V5DA 2YDQA 3EDUA 4UF0B 5J2TE 4IL4A 4IE5A 4LMJA 3LFMA 1YW0A 4NUUA 4DVDA 4TWHA 3GA8A 1Z8UA 1HFAA 2KWIB 2NWBA 1KFYA 3FZFB 4BJMA 4AISA 5AQGB 3ANWB 3K1SA 4YHJA 3ABVA 2LSGA 3L8RA 3AB3B 2BZBA 2JJ9A 2ACXA 1QSDA 2RA1A 5DJQC 5HEGA 3R84B 3SS1A 2E9XA 3UU4A 1ZHCA 3F57A 2WZIA 3X1DA 3T1HT 4OX9T 5IUXA 5HCMA 2P9BA 3DJBA 3CK6A 2E9XD 3EHZA 3ZCJA 5LHHB 3Q5XA 3O9XA 2WY2A 4NXNT 2E8IA 3ZC1A 2CHOA 4AI6A 2KLQA 1YKEB 2XAHB 4UEMA 4IIJE 4P0AA 2WWUA 2XQAA 3B13A 2XHEB 2XQ8A 3M65A 2QYWA 3MA9A 3OYZA 3ZMTB 2H3RA 4ILUA 3TKLB 1BR1A 3H3AA 3PUSA 2YKSA 4IT4A 2PBIA 3AA0B 2W00A 4QHOA 3QB5A 2V6YB 5ABEA 3PUQA 1UK5A 5FXWA 5J2UE 1N32T 3CMLA 4U2YA 2YN6A 4UIGA 3P7IA 4AKLA 4EYYR 2IIUA 3N2OA 5JR9C 3LDQB 5AQHB 3O1IA 3QB5K 1SA0E 4PK5A 4OHFA 2XAQB 2A72A 3AVRA 4GK5E 5BR8T 4EXTA 1J5ET 1KNZA 3ZCIA 1AJ3A 3A8YC 2IDOB 4O4JE 5HAXA 3PUZF 4FI5A 2WZHA 5AQOB 3EABA 5FL1A 5HXEA 4U7YA 2MBGA 2K24A 3HL6A 4OK0A 3LJCA 1IJ5A 3FBLA 3KBTA 4DMWA 4LMKA 2V6YA 2WWVA 4YLHA 3B57A 2X0YA 3C4ZA 4KUMB 4O8SA 5LB7B 2R6GF 4HWDA 5FNVE 4FJOA 4H9QC 4ZI7E 2MOZA 4GIWA 1XMQT 2KSRA 2BBHA 3AE1A 5L4EA 1W9RA 4AXPA 5JDMA 1MIWA 5ADXL 4L5GA 2M6BA 2ZM0A 5AQLB 3JAFA 3RKOA 4U74A 2IC6A 4XAXB 3GN5A 3KINB 3V5UA 1ZEEA 3CQXC 2K48A 4IDPA 2D0UA 2LJLA 5ABHA 3OTOT 2B76A 2VURA 1IAPA 4AKHA 5AQPB 2JRKA 1IJ6A 4JYAT 3P8CD 2J1DG 2ZM2A 3VR9A 3HKEE 4CI3B 1QUUA 3I9WA 1IZNB 2H7VC 2WSSV 3EI0A 4O4HE 2KWHA 2OLTA 2XQ4A 3N2KE 4UV8B 4ZXLA 5L3FB 5LGTB 2PG8A 5AQFB 3RI5A 3UQ7A 4DV0T 4OYJA 4PAGA 4HN9A 4ZEYA 3RF1A 5GONE 4IHJE 4OYKA 2BVLA 1KK7A 4DO0A 1OWAA 4DV3T 5FXZA 3ESLA 1IBMT 4ZZBA 3WAKA 2AE9A 4TV9E 3ZMVB 5JDLA 5LG4A 3C98B 2EHOC 5L47A 3NZPA 5FVKA 2CA5A 4GKKT 3LSVA 3ZT6A 2XJ7A 3AXJA 4JI5T 4B3ST 1NAFA 3CKDA 4WBOA 5HXRA 4AIUA 2LHNA 4L0RA 3RYCE 3JC6D 3BK9A 3WI3A 2D5UA 5CJ5A 1Y64B 2WM9A 2XAGB 4UR9A 4YTNA 3IF8B 3KV9A 3UUMA 1KNRA 3EAMA 2VK9A 2Q9QB 4HEAA 4I55E 2DNXA 3ETUA 1KEYA 3MJXA 4ZHQE 4LMLA 2CRBA 3ZSSA 4PK6A 2C5JA 3ONJA 2IUBA 2CWYA 4EGWA 3L3PA 2W67A 4I4TE 2H88A 4ZZCA 3AEGA 4WW0A 1BR0A 3UUBA 2CXLA 2LEHA 3NZQA 4IDNA 1JNRA 2LSYA 4DV2T 3K8PC 1HR0T 4QH1A 4J2CA 5HEHA 2VQFT 1H7CA 3ANWA 4HFHA 5FKYA 2ZM6T 4LF6T 3AAEB 5HEOA 5LP6E 4PNIA 4UELA 2CXFA 1HNXT 3S4UA 4ILBA 1YXRA 1OEDB 1ZKEA 5C8YE 3HA4A 5ABGA 2AXDS 4ANJA 1N34T 4MALA 1WR6A 2VKOA 3ZMZB 5HEUA 3MK7C 4EOZB 2WMNA 2H7OA 1KNPA 2CLYC 4P0BA 3KVBA 2DL1A 2BKOA 5L2LA 1HCIA 5FMNA 2D9DA 2ZMAA 5AQVB 2VKDA 3FXEB 3KV6A 4NIQA 2XQ7A 4CN1A 1M62A 3VKHA 3K3OA 4PJNA 3NBXX 3MXZA 1LKXA 2NTXA 4PK4A 4X64T 2X9YA 1HNWT 3UU6A 1DU2A 5E0OA 3Q2MA 2KMFA 2CM0A 2HH7A 3OPCA 3Q5DA 5AFUL 1T98A 2PFVA 3PUWF 2WAUA 2E2AA 3QK6A 4UVCB 4B3TT 3NVOA 2E9XB 4P1NA 2YDSA 4E7ZA 3CPZA 4ZS2A 3GWHA 4NUVA 3VR8A 1VCSA 1D0YA 2W62A 4CXWA 4GKJT 2JQHA 4DNDA 5JDQA 3VKGA 1D1CA 2WB5A 5LJNA 1D0XA 2JMKA 4ISTA 3A7MA 3HKDE 5LHGB 3PURA 2UU9T 1W09A 5A1LA 3AE7A 1LVFA 2VQET 2HHHT 4B3RT 2RPAA 2WCAA 4HWFA 2CMRA 5JR9B 1N36T 1GQEA 4KX6A 3SRZA 2Y6XA 3N5LA 4CQIA 4COFA 4TWFA 1M7KA 4JI6T 2W4XA 2X0LB 3ONXA 2OA5A 2YDRA 4WZXA 4V1Av 2XQ5A 1U4QA 3TLWA 5JH7E 2CE7A 4WYVA 1UX4A 2BS4A 2IW5B 3RIFA 2QRXA 5CFBA 3N2GE 3JADA 4HFCA 2YK0A 4X66T 2HN1A 2WU2A 1W0BA 1Y01A 4JI0T 3PJAJ 2N1GA 4CXXA 4IE7A 4DR2T 5J0ZA 2N2NA 1HF8A 2IHR1 5IYZE 4NXMT 2F4VT 2Y8DA 4O2BE 2CLYB 3FZMB 4JEHB 2X51A 3LK3B 4U7IA 3UU8A 4KHZF 5L4HA 3RH3A 3F31A 2JMHA 2BS2A 3HI2A 3RIUC 1FIOA 1JNZA 4O2AE 5EZYE 4ZI2C 3C4XA 4AQFC 2BS3A 2JQKA 2FJBA 4DR7T 2RP4A 4X62T 1LVKA 2CEAA 3ZJ1A 3W15B 5LHIB 3AE2A 1J5WA 2VVNA 2K5BB 2B1EA 2PTFA 2WS3A 3MACA 2QVAA 5AQQB 4YTPA 3UFEA 2K9AA 3RIAA 3ZPOA 5HEJA 3ZJ2A 5BMVE 1UCUA 1MIVA 1X9BA 2VVSA 5JTGA 3AAAB 3OJAA 2X9XA 2CXDA 3SFEA 4UXNB 4G2AA 2WBLA 4O4LE 2LM2A 2V1DB 4PFPA 2C5IT 3CWZB 3CX6B 1L0VA 3UTKA 1HS7A 4IREA 2V8SV 5L3EB 2J47A 1KF6A 4U2ZA 3D0TA 3P4PA 5LOVE 2YEVC 1WFDA 3P4QA 4HWCA 4N78D 2UXNB 2NW8A 4HKAA 4NPPA 1HG2A 3ZMSB 4ILCA 4MHCA 4QXCB 5JRCB 2K3WA 3DP7A 4EIWA 4DR4T 5HXSA 4EEBA 4YHHT 1HG5A 4YJ2E 1WCRA 4BJNA 4DV7T 1OEDA 4WNKA 3NRYA 3I0QA 4I50E 4ZI3D 5L3CB 5LMUT 2KZ7B 4GOUA 2JQ9A 3N9LA 4KMCA 1XNRT 5AQSB 5JDFA 2WDRA 3CQGB 5LBMA 3E08A 4JLEA 3Q5WA 3SOLA 1FMWA 2Q9QD 2V7LA 5HCJA 1D1BA 5HYAA 4C90A 5AQMB 5HWXA 1WYBA 2LRKA 3E22E 4YFSA 4F8HA 5TAOA 4AKIA 2UXCT 1OXZA 3OKQA 2E5LT 4XBFB 1XZYA 2YU2A 4IE4A 4TN7B 2KXPB 1G8XA 1XWMA 3AE5A 2I0MA 2XAFB 4H9NC 5AQTB 3VU7H 2BG9A 1E2AA 2DWGA 3AEAA 5IHYA 3P4SA 3UU3A 4DMVA 5AQNB 4UV9B 2XUEA 3AE8A 3KVAA 3CX8B 3RC3A 2VKJA 4ILAA 4TX5A 4CI2B 1FJGT 3PV0F 5FY1A 3JCFA 3MZKB 4IGUA 4I0UA 3N9MA 2XPKA 3C50A 4ZS3A 1V9DA 1XDOA 2I6HA 2IMLA 3AEDA 3C64A 5AQRB 3AVSA 5LYJE 5ETWA 3N9NA 2LSJA 3PU8A 4GYSA 3RHWA 4YSYA 2V7KA 2J62A 5M4YA 1MIYA 2LM9A 4XZCA 2UXBT 1J1JA 3CIRA 2V26A 1HX1B 3I1AA 4CI1B 2LSKA 4EYUA 4X65T 2HN2A 3AEFA 3R6NA 4DBQA 4TZ4C 5LJMA 4EEDA 2IAKA 2Q9QA 5LCYA 1MNEA 3C4WA 5JVDE 3AA1B 3BQKA 2IC9A 4OFZA 2QA7A 3ZN1B 3HR0A 2V5CA 1XDPA 2BBJA 3FHNA 3I0OA 4ZI3C 4A5XA 2NW7A 4U33A 4E7SA 2J4GA 1VRBA 5LMNT 2FJAA 2L9QA 2MAWA 3M3ZB 3KV5A 4CN6A 5F8PA 4WBNE 3GN5B 4EV6A 2SPCA 4PW8A 3RKGA 2YU1A 2LKHA 4X5TA 5DQWA 4B3MT 5FY0A 4IE0A 3AEEA 3FZHB 3KDSE 1YQ4A 2BKNA 3N9PA 4GK0E 3TLVA 3LBXB 3NWIA 1FMVA 4EZHA 1QLBA 3UULA 3PUXF 4QH5A 2LOSA 2LHRA 1FEWA 1G73A 1T8BA 4G63A 3MKDA 4YSZA 4DR3T 2W66A 5FP3A 4A97A 1US7B 4JUYA 4X1YE 5C3JA 5CA1E 5JQGE 5HWYA 1NEKA 3UT5E 4L9IA 5L3BB 3IEEA 3T1YT 4EZ4A 2N9DA 4YJ3E 1MNDA 2A9UA 2WDVA 3RYIE 4JI4T 5FXXA 5KXJA 2BDEA 3PUYF 1MMAA 2I59A 2L8KA 3DTOA 4H9PC 3FBZA 3P50A 5AQKB 3V5SA 2ACZA 3ZN0B 4TUYE 5CA0E 2LRLA 3RRWA 2FUPA 2H89A 4X20E 3KBUA 3ZYMA 2XASB 1EZ3A 3IBPA 4LFCT 2WMOA 3TLUA 5FYMA 3OBVE 5FY7A 3VRBA 3P4RA 4YY3T 1UX5A 2D0TA 4JV5T 3ETVA 5F5WA 2D2SA 2W0GA 2NP9A 4GYRA 2M6IA 4YSXA 2A3DA 5DQVA 3PUAA 4QX8B 3IA3A 3Q5EA 4H63V 1XNQT 3CQCB 2BKPA 5L3DB 2DCFA 4IDQA 4KHPT 3SFDA 4BAYB 3RYFE 2DHRA 3RQWA 4HWIB 2M67A 3RIUA 1UGOA 5LXTE 2X0HA 4Q25A 4PFOA 5CGMA 2CWOA 3E0ZA 1OEDC 2FJDA 2XAJB 4HTEA 2ES0A 1R8IA 3BQLA 3FZKB 3RPUA 5J1GA 3UFGA 2KNDA 2QGSA 1T7SA 3K3NA 3N9OA 3AE3A 2VB6A 1LRZA 2UXXB 4EAHA 1NENA 3PE0A 2E5VA 3O4XE 4TWDA 5AQJB 3CX7B 4LFAT 4K0UA 2XQ6A 1T72A 2X67A 2YINA 3PDYA 4H9RC 4DR1T 4U3CA 4CN4A 2XZEA 4LFBT 4K0KT 4EB6E 3J9X1 1I6ZA 4UF0A 4AKGA 2BG9E 3J7Yq 1O3XA 2EHOD 2XQYA 3QNUA 4QH4A 4U72A 3O1JA 3ZT5A 3GMIA 1Z0PA 4KI0F 4CZZB 5F3JA 2X66A 1WRDA 3QOFA 4QKNA 2UUCT 4UVAB 3AAIA 4QWNB 3VRAA 4Z91A 4AQFA 3NRXA 2NOXA 1ZV4X 1UURA 2CBIA 4YTMA 3FZLB 4JI3T 5EK2A 1SUMB 1W0AA 1X79A 3I9YA 5KDMC 2Y48B 3QC9A 4IDZA 1HX8A 2JPFA 4H9OC 4KBMB 4DV6T 2G0UA 4LF9T 3AE6A 3ZC0A 5JDNA 4DV4T 1N33T 2FJEA 4IE6A 5FL0A 4F6RC 1VOMA 3PUGA 4QXBB 2GK9A 4LF7T 2BG9B 4YXDA 3ONLC 3Q9DA 5EK3A 3ZT7A 4DUYT 3JC6C 1WYCA 2V7IA 2Z6EA 3JAEA 2LOPA 4O4IE 2JIWA 5EK4A 3SWHA 3TLTA 4ERRA 3LK42 2WDQA 4C91A 3WAJA 3UUNA 4JEUB 1SHZC 2VL8A 2OV9A 2NTYA 4IDOA 2XQ9A 4ZOLE 2LLYA 2VWAA 1IBLT 2X68A 3FXDB 4ISSA 2VL0A 2W2UA 2ZM8A 2BVMA 4HFIA 2EHOA 3LBXA 3L09A 2LT3A 1U5PA 4AQGA 3CVRA 4M1PA 4HE8A 2X9WA 1MMGA 4PJLA 2WP9A 1HNZT 2C0SA 3AXJB 3L39A 4HFEA 2XSAA 4QX7B 5HXCA 5LBQB 5KMGP 3PJAA 5C2TA 2CHNA 5CB4E 2V7MA 3AECA 3H37A 3PU3A 4P09A 2NW9A 2JQQA 2X9HA 3RGLA 4ZI2D 5JDGA 4AQYT 4TV8E 4X1KE 3G06A 4YT0A 2XTLA 2CCQA 3EUHA 2ODUA 1E1HB 2FBWA 4MLKA 5FVLA 4DIDB 5KX5E 1UUSA 3PUVF 3ZKRA 2XY8B 4QXHB 4ASKA 4LF8T 4Z8XA 3ZYKA 3OVUA 3KFWX 3ZLIA 3UQ4A 2PJQA 2WQYA 3BQIA 3RC8A 3HKBE 3EDVA 4ADZA 4PJJA 4DV5T 4HFVA 4Z90A 4I43B 4KP3C 5JREA 2V6XA 5ABFB 2Q9QC 2VKHA 3ZEFB 5HXHA 1D1AA 2XM2A 3F2EA 2CBJA 3UU5A 4DR5T 2ODVA 3OYXA 5LGNB 1WLXA 1CUNA 4JI8T 2WU5A 4MFRA 4JI7T 5H6RB 3C51A 2HPLA 2DI4A 1VCTA 3AE4A 1SE7A 4JI1T 1YD8G 2DLRA 2HPJA 2LKGA 1D0ZA 3AA7B 3AEBA 5LA6E 2XSBA 3RRCA 2YOEA 4DBRA 5JDHA 3T8OA 4H63H 2W63A 3LG7A 4IL9A 4MBQA 3U78A 5LG3A 4CXYA 2MPKA 3ZYLA 4HWHA 2NR4A 5AQUB 3RLFF 3UUXB 4A98A 4HFDA 2L3LA 5ABFA 5AQIB 1WR0A 2V7JA 3PTRB 5L3GB 2A2FX 4DV1T 3AA6B 2BG9C 3ZMUB 1S94A 1NWMX 1CHUA 3ZSTA 3NKZA 3TLSA 2MYSA 2VASA
chains in the Genus database with same CATH topology
2AE9A 2IDOB 2AXDS 1DU2A 1SE7A 2XY8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AE9 A;  2IDO B;  2AXD S;  1DU2 A;  1SE7 A;  2XY8 B; 
#chains in the Genus database with same CATH topology
 2LE8 A;  4TNV A;  1B7T A;  2XM1 A;  3EVY A;  1XMO T;  1I94 T;  3B5M A;  2C5K T;  3RX6 A;  3K3Q C;  1YQ3 A;  4HGA A;  4AKR B;  2LSI A;  4A56 A;  3O1H A;  2UXD T;  3LK2 B;  4DR6 T;  1MMD A;  2DWK A;  1BR2 A;  3VHL A;  5LGU B;  1IBK T;  3A5X A;  3KV4 A;  2UUB T;  1E7P A;  2CPT A;  2MTQ A;  4LF5 T;  2EHO B;  3RYH E;  2KIN B;  3IHR A;  4U31 A;  2KT9 A;  2E9X C;  4X1I E;  3AE9 A;  3HKC E;  3N9Q A;  5DAB A;  3U3I A;  4PJM A;  3P4W A;  4H9S E;  2UUA T;  1OED E;  2XQ3 A;  3FB2 A;  3H3M A;  5FXV A;  5H6Q B;  4JI2 T;  1ZOY A;  4HFB A;  4JBW F;  4B6X A;  1S35 A;  1MMN A;  4UVB B;  4BA9 A;  5IWA T;  2W61 A;  3QUJ A;  5LNK A;  4DUZ T;  2ZLY A;  1YKH B;  5JR9 A;  4LF4 T;  3RQU A;  1ZP0 A;  4TNW A;  1BR4 A;  5JRC A;  1HTJ F;  2V5D A;  2YDQ A;  3EDU A;  4UF0 B;  5J2T E;  4IL4 A;  4IE5 A;  4LMJ A;  3LFM A;  1YW0 A;  4NUU A;  4DVD A;  4TWH A;  3GA8 A;  1Z8U A;  1HFA A;  2KWI B;  2NWB A;  1KFY A;  3FZF B;  4BJM A;  4AIS A;  5AQG B;  3ANW B;  3K1S A;  4YHJ A;  3ABV A;  2LSG A;  3L8R A;  3AB3 B;  2BZB A;  2JJ9 A;  2ACX A;  1QSD A;  2RA1 A;  5DJQ C;  5HEG A;  3R84 B;  3SS1 A;  2E9X A;  3UU4 A;  1ZHC A;  3F57 A;  2WZI A;  3X1D A;  3T1H T;  4OX9 T;  5IUX A;  5HCM A;  2P9B A;  3DJB A;  3CK6 A;  2E9X D;  3EHZ A;  3ZCJ A;  5LHH B;  3Q5X A;  3O9X A;  2WY2 A;  4NXN T;  2E8I A;  3ZC1 A;  2CHO A;  4AI6 A;  2KLQ A;  1YKE B;  2XAH B;  4UEM A;  4IIJ E;  4P0A A;  2WWU A;  2XQA A;  3B13 A;  2XHE B;  2XQ8 A;  3M65 A;  2QYW A;  3MA9 A;  3OYZ A;  3ZMT B;  2H3R A;  4ILU A;  3TKL B;  1BR1 A;  3H3A A;  3PUS A;  2YKS A;  4IT4 A;  2PBI A;  3AA0 B;  2W00 A;  4QHO A;  3QB5 A;  2V6Y B;  5ABE A;  3PUQ A;  1UK5 A;  5FXW A;  5J2U E;  1N32 T;  3CML A;  4U2Y A;  2YN6 A;  4UIG A;  3P7I A;  4AKL A;  4EYY R;  2IIU A;  3N2O A;  5JR9 C;  3LDQ B;  5AQH B;  3O1I A;  3QB5 K;  1SA0 E;  4PK5 A;  4OHF A;  2XAQ B;  2A72 A;  3AVR A;  4GK5 E;  5BR8 T;  4EXT A;  1J5E T;  1KNZ A;  3ZCI A;  1AJ3 A;  3A8Y C;  2IDO B;  4O4J E;  5HAX A;  3PUZ F;  4FI5 A;  2WZH A;  5AQO B;  3EAB A;  5FL1 A;  5HXE A;  4U7Y A;  2MBG A;  2K24 A;  3HL6 A;  4OK0 A;  3LJC A;  1IJ5 A;  3FBL A;  3KBT A;  4DMW A;  4LMK A;  2V6Y A;  2WWV A;  4YLH A;  3B57 A;  2X0Y A;  3C4Z A;  4KUM B;  4O8S A;  5LB7 B;  2R6G F;  4HWD A;  5FNV E;  4FJO A;  4H9Q C;  4ZI7 E;  2MOZ A;  4GIW A;  1XMQ T;  2KSR A;  2BBH A;  3AE1 A;  5L4E A;  1W9R A;  4AXP A;  5JDM A;  1MIW A;  5ADX L;  4L5G A;  2M6B A;  2ZM0 A;  5AQL B;  3JAF A;  3RKO A;  4U74 A;  2IC6 A;  4XAX B;  3GN5 A;  3KIN B;  3V5U A;  1ZEE A;  3CQX C;  2K48 A;  4IDP A;  2D0U A;  2LJL A;  5ABH A;  3OTO T;  2B76 A;  2VUR A;  1IAP A;  4AKH A;  5AQP B;  2JRK A;  1IJ6 A;  4JYA T;  3P8C D;  2J1D G;  2ZM2 A;  3VR9 A;  3HKE E;  4CI3 B;  1QUU A;  3I9W A;  1IZN B;  2H7V C;  2WSS V;  3EI0 A;  4O4H E;  2KWH A;  2OLT A;  2XQ4 A;  3N2K E;  4UV8 B;  4ZXL A;  5L3F B;  5LGT B;  2PG8 A;  5AQF B;  3RI5 A;  3UQ7 A;  4DV0 T;  4OYJ A;  4PAG A;  4HN9 A;  4ZEY A;  3RF1 A;  5GON E;  4IHJ E;  4OYK A;  2BVL A;  1KK7 A;  4DO0 A;  1OWA A;  4DV3 T;  5FXZ A;  3ESL A;  1IBM T;  4ZZB A;  3WAK A;  2AE9 A;  4TV9 E;  3ZMV B;  5JDL A;  5LG4 A;  3C98 B;  2EHO C;  5L47 A;  3NZP A;  5FVK A;  2CA5 A;  4GKK T;  3LSV A;  3ZT6 A;  2XJ7 A;  3AXJ A;  4JI5 T;  4B3S T;  1NAF A;  3CKD A;  4WBO A;  5HXR A;  4AIU A;  2LHN A;  4L0R A;  3RYC E;  3JC6 D;  3BK9 A;  3WI3 A;  2D5U A;  5CJ5 A;  1Y64 B;  2WM9 A;  2XAG B;  4UR9 A;  4YTN A;  3IF8 B;  3KV9 A;  3UUM A;  1KNR A;  3EAM A;  2VK9 A;  2Q9Q B;  4HEA A;  4I55 E;  2DNX A;  3ETU A;  1KEY A;  3MJX A;  4ZHQ E;  4LML A;  2CRB A;  3ZSS A;  4PK6 A;  2C5J A;  3ONJ A;  2IUB A;  2CWY A;  4EGW A;  3L3P A;  2W67 A;  4I4T E;  2H88 A;  4ZZC A;  3AEG A;  4WW0 A;  1BR0 A;  3UUB A;  2CXL A;  2LEH A;  3NZQ A;  4IDN A;  1JNR A;  2LSY A;  4DV2 T;  3K8P C;  1HR0 T;  4QH1 A;  4J2C A;  5HEH A;  2VQF T;  1H7C A;  3ANW A;  4HFH A;  5FKY A;  2ZM6 T;  4LF6 T;  3AAE B;  5HEO A;  5LP6 E;  4PNI A;  4UEL A;  2CXF A;  1HNX T;  3S4U A;  4ILB A;  1YXR A;  1OED B;  1ZKE A;  5C8Y E;  3HA4 A;  5ABG A;  2AXD S;  4ANJ A;  1N34 T;  4MAL A;  1WR6 A;  2VKO A;  3ZMZ B;  5HEU A;  3MK7 C;  4EOZ B;  2WMN A;  2H7O A;  1KNP A;  2CLY C;  4P0B A;  3KVB A;  2DL1 A;  2BKO A;  5L2L A;  1HCI A;  5FMN A;  2D9D A;  2ZMA A;  5AQV B;  2VKD A;  3FXE B;  3KV6 A;  4NIQ A;  2XQ7 A;  4CN1 A;  1M62 A;  3VKH A;  3K3O A;  4PJN A;  3NBX X;  3MXZ A;  1LKX A;  2NTX A;  4PK4 A;  4X64 T;  2X9Y A;  1HNW T;  3UU6 A;  1DU2 A;  5E0O A;  3Q2M A;  2KMF A;  2CM0 A;  2HH7 A;  3OPC A;  3Q5D A;  5AFU L;  1T98 A;  2PFV A;  3PUW F;  2WAU A;  2E2A A;  3QK6 A;  4UVC B;  4B3T T;  3NVO A;  2E9X B;  4P1N A;  2YDS A;  4E7Z A;  3CPZ A;  4ZS2 A;  3GWH A;  4NUV A;  3VR8 A;  1VCS A;  1D0Y A;  2W62 A;  4CXW A;  4GKJ T;  2JQH A;  4DND A;  5JDQ A;  3VKG A;  1D1C A;  2WB5 A;  5LJN A;  1D0X A;  2JMK A;  4IST A;  3A7M A;  3HKD E;  5LHG B;  3PUR A;  2UU9 T;  1W09 A;  5A1L A;  3AE7 A;  1LVF A;  2VQE T;  2HHH T;  4B3R T;  2RPA A;  2WCA A;  4HWF A;  2CMR A;  5JR9 B;  1N36 T;  1GQE A;  4KX6 A;  3SRZ A;  2Y6X A;  3N5L A;  4CQI A;  4COF A;  4TWF A;  1M7K A;  4JI6 T;  2W4X A;  2X0L B;  3ONX A;  2OA5 A;  2YDR A;  4WZX A;  4V1A v;  2XQ5 A;  1U4Q A;  3TLW A;  5JH7 E;  2CE7 A;  4WYV A;  1UX4 A;  2BS4 A;  2IW5 B;  3RIF A;  2QRX A;  5CFB A;  3N2G E;  3JAD A;  4HFC A;  2YK0 A;  4X66 T;  2HN1 A;  2WU2 A;  1W0B A;  1Y01 A;  4JI0 T;  3PJA J;  2N1G A;  4CXX A;  4IE7 A;  4DR2 T;  5J0Z A;  2N2N A;  1HF8 A;  2IHR 1;  5IYZ E;  4NXM T;  2F4V T;  2Y8D A;  4O2B E;  2CLY B;  3FZM B;  4JEH B;  2X51 A;  3LK3 B;  4U7I A;  3UU8 A;  4KHZ F;  5L4H A;  3RH3 A;  3F31 A;  2JMH A;  2BS2 A;  3HI2 A;  3RIU C;  1FIO A;  1JNZ A;  4O2A E;  5EZY E;  4ZI2 C;  3C4X A;  4AQF C;  2BS3 A;  2JQK A;  2FJB A;  4DR7 T;  2RP4 A;  4X62 T;  1LVK A;  2CEA A;  3ZJ1 A;  3W15 B;  5LHI B;  3AE2 A;  1J5W A;  2VVN A;  2K5B B;  2B1E A;  2PTF A;  2WS3 A;  3MAC A;  2QVA A;  5AQQ B;  4YTP A;  3UFE A;  2K9A A;  3RIA A;  3ZPO A;  5HEJ A;  3ZJ2 A;  5BMV E;  1UCU A;  1MIV A;  1X9B A;  2VVS A;  5JTG A;  3AAA B;  3OJA A;  2X9X A;  2CXD A;  3SFE A;  4UXN B;  4G2A A;  2WBL A;  4O4L E;  2LM2 A;  2V1D B;  4PFP A;  2C5I T;  3CWZ B;  3CX6 B;  1L0V A;  3UTK A;  1HS7 A;  4IRE A;  2V8S V;  5L3E B;  2J47 A;  1KF6 A;  4U2Z A;  3D0T A;  3P4P A;  5LOV E;  2YEV C;  1WFD A;  3P4Q A;  4HWC A;  4N78 D;  2UXN B;  2NW8 A;  4HKA A;  4NPP A;  1HG2 A;  3ZMS B;  4ILC A;  4MHC A;  4QXC B;  5JRC B;  2K3W A;  3DP7 A;  4EIW A;  4DR4 T;  5HXS A;  4EEB A;  4YHH T;  1HG5 A;  4YJ2 E;  1WCR A;  4BJN A;  4DV7 T;  1OED A;  4WNK A;  3NRY A;  3I0Q A;  4I50 E;  4ZI3 D;  5L3C B;  5LMU T;  2KZ7 B;  4GOU A;  2JQ9 A;  3N9L A;  4KMC A;  1XNR T;  5AQS B;  5JDF A;  2WDR A;  3CQG B;  5LBM A;  3E08 A;  4JLE A;  3Q5W A;  3SOL A;  1FMW A;  2Q9Q D;  2V7L A;  5HCJ A;  1D1B A;  5HYA A;  4C90 A;  5AQM B;  5HWX A;  1WYB A;  2LRK A;  3E22 E;  4YFS A;  4F8H A;  5TAO A;  4AKI A;  2UXC T;  1OXZ A;  3OKQ A;  2E5L T;  4XBF B;  1XZY A;  2YU2 A;  4IE4 A;  4TN7 B;  2KXP B;  1G8X A;  1XWM A;  3AE5 A;  2I0M A;  2XAF B;  4H9N C;  5AQT B;  3VU7 H;  2BG9 A;  1E2A A;  2DWG A;  3AEA A;  5IHY A;  3P4S A;  3UU3 A;  4DMV A;  5AQN B;  4UV9 B;  2XUE A;  3AE8 A;  3KVA A;  3CX8 B;  3RC3 A;  2VKJ A;  4ILA A;  4TX5 A;  4CI2 B;  1FJG T;  3PV0 F;  5FY1 A;  3JCF A;  3MZK B;  4IGU A;  4I0U A;  3N9M A;  2XPK A;  3C50 A;  4ZS3 A;  1V9D A;  1XDO A;  2I6H A;  2IML A;  3AED A;  3C64 A;  5AQR B;  3AVS A;  5LYJ E;  5ETW A;  3N9N A;  2LSJ A;  3PU8 A;  4GYS A;  3RHW A;  4YSY A;  2V7K A;  2J62 A;  5M4Y A;  1MIY A;  2LM9 A;  4XZC A;  2UXB T;  1J1J A;  3CIR A;  2V26 A;  1HX1 B;  3I1A A;  4CI1 B;  2LSK A;  4EYU A;  4X65 T;  2HN2 A;  3AEF A;  3R6N A;  4DBQ A;  4TZ4 C;  5LJM A;  4EED A;  2IAK A;  2Q9Q A;  5LCY A;  1MNE A;  3C4W A;  5JVD E;  3AA1 B;  3BQK A;  2IC9 A;  4OFZ A;  2QA7 A;  3ZN1 B;  3HR0 A;  2V5C A;  1XDP A;  2BBJ A;  3FHN A;  3I0O A;  4ZI3 C;  4A5X A;  2NW7 A;  4U33 A;  4E7S A;  2J4G A;  1VRB A;  5LMN T;  2FJA A;  2L9Q A;  2MAW A;  3M3Z B;  3KV5 A;  4CN6 A;  5F8P A;  4WBN E;  3GN5 B;  4EV6 A;  2SPC A;  4PW8 A;  3RKG A;  2YU1 A;  2LKH A;  4X5T A;  5DQW A;  4B3M T;  5FY0 A;  4IE0 A;  3AEE A;  3FZH B;  3KDS E;  1YQ4 A;  2BKN A;  3N9P A;  4GK0 E;  3TLV A;  3LBX B;  3NWI A;  1FMV A;  4EZH A;  1QLB A;  3UUL A;  3PUX F;  4QH5 A;  2LOS A;  2LHR A;  1FEW A;  1G73 A;  1T8B A;  4G63 A;  3MKD A;  4YSZ A;  4DR3 T;  2W66 A;  5FP3 A;  4A97 A;  1US7 B;  4JUY A;  4X1Y E;  5C3J A;  5CA1 E;  5JQG E;  5HWY A;  1NEK A;  3UT5 E;  4L9I A;  5L3B B;  3IEE A;  3T1Y T;  4EZ4 A;  2N9D A;  4YJ3 E;  1MND A;  2A9U A;  2WDV A;  3RYI E;  4JI4 T;  5FXX A;  5KXJ A;  2BDE A;  3PUY F;  1MMA A;  2I59 A;  2L8K A;  3DTO A;  4H9P C;  3FBZ A;  3P50 A;  5AQK B;  3V5S A;  2ACZ A;  3ZN0 B;  4TUY E;  5CA0 E;  2LRL A;  3RRW A;  2FUP A;  2H89 A;  4X20 E;  3KBU A;  3ZYM A;  2XAS B;  1EZ3 A;  3IBP A;  4LFC T;  2WMO A;  3TLU A;  5FYM A;  3OBV E;  5FY7 A;  3VRB A;  3P4R A;  4YY3 T;  1UX5 A;  2D0T A;  4JV5 T;  3ETV A;  5F5W A;  2D2S A;  2W0G A;  2NP9 A;  4GYR A;  2M6I A;  4YSX A;  2A3D A;  5DQV A;  3PUA A;  4QX8 B;  3IA3 A;  3Q5E A;  4H63 V;  1XNQ T;  3CQC B;  2BKP A;  5L3D B;  2DCF A;  4IDQ A;  4KHP T;  3SFD A;  4BAY B;  3RYF E;  2DHR A;  3RQW A;  4HWI B;  2M67 A;  3RIU A;  1UGO A;  5LXT E;  2X0H A;  4Q25 A;  4PFO A;  5CGM A;  2CWO A;  3E0Z A;  1OED C;  2FJD A;  2XAJ B;  4HTE A;  2ES0 A;  1R8I A;  3BQL A;  3FZK B;  3RPU A;  5J1G A;  3UFG A;  2KND A;  2QGS A;  1T7S A;  3K3N A;  3N9O A;  3AE3 A;  2VB6 A;  1LRZ A;  2UXX B;  4EAH A;  1NEN A;  3PE0 A;  2E5V A;  3O4X E;  4TWD A;  5AQJ B;  3CX7 B;  4LFA T;  4K0U A;  2XQ6 A;  1T72 A;  2X67 A;  2YIN A;  3PDY A;  4H9R C;  4DR1 T;  4U3C A;  4CN4 A;  2XZE A;  4LFB T;  4K0K T;  4EB6 E;  3J9X 1;  1I6Z A;  4UF0 A;  4AKG A;  2BG9 E;  3J7Y q;  1O3X A;  2EHO D;  2XQY A;  3QNU A;  4QH4 A;  4U72 A;  3O1J A;  3ZT5 A;  3GMI A;  1Z0P A;  4KI0 F;  4CZZ B;  5F3J A;  2X66 A;  1WRD A;  3QOF A;  4QKN A;  2UUC T;  4UVA B;  3AAI A;  4QWN B;  3VRA A;  4Z91 A;  4AQF A;  3NRX A;  2NOX A;  1ZV4 X;  1UUR A;  2CBI A;  4YTM A;  3FZL B;  4JI3 T;  5EK2 A;  1SUM B;  1W0A A;  1X79 A;  3I9Y A;  5KDM C;  2Y48 B;  3QC9 A;  4IDZ A;  1HX8 A;  2JPF A;  4H9O C;  4KBM B;  4DV6 T;  2G0U A;  4LF9 T;  3AE6 A;  3ZC0 A;  5JDN A;  4DV4 T;  1N33 T;  2FJE A;  4IE6 A;  5FL0 A;  4F6R C;  1VOM A;  3PUG A;  4QXB B;  2GK9 A;  4LF7 T;  2BG9 B;  4YXD A;  3ONL C;  3Q9D A;  5EK3 A;  3ZT7 A;  4DUY T;  3JC6 C;  1WYC A;  2V7I A;  2Z6E A;  3JAE A;  2LOP A;  4O4I E;  2JIW A;  5EK4 A;  3SWH A;  3TLT A;  4ERR A;  3LK4 2;  2WDQ A;  4C91 A;  3WAJ A;  3UUN A;  4JEU B;  1SHZ C;  2VL8 A;  2OV9 A;  2NTY A;  4IDO A;  2XQ9 A;  4ZOL E;  2LLY A;  2VWA A;  1IBL T;  2X68 A;  3FXD B;  4ISS A;  2VL0 A;  2W2U A;  2ZM8 A;  2BVM A;  4HFI A;  2EHO A;  3LBX A;  3L09 A;  2LT3 A;  1U5P A;  4AQG A;  3CVR A;  4M1P A;  4HE8 A;  2X9W A;  1MMG A;  4PJL A;  2WP9 A;  1HNZ T;  2C0S A;  3AXJ B;  3L39 A;  4HFE A;  2XSA A;  4QX7 B;  5HXC A;  5LBQ B;  5KMG P;  3PJA A;  5C2T A;  2CHN A;  5CB4 E;  2V7M A;  3AEC A;  3H37 A;  3PU3 A;  4P09 A;  2NW9 A;  2JQQ A;  2X9H A;  3RGL A;  4ZI2 D;  5JDG A;  4AQY T;  4TV8 E;  4X1K E;  3G06 A;  4YT0 A;  2XTL A;  2CCQ A;  3EUH A;  2ODU A;  1E1H B;  2FBW A;  4MLK A;  5FVL A;  4DID B;  5KX5 E;  1UUS A;  3PUV F;  3ZKR A;  2XY8 B;  4QXH B;  4ASK A;  4LF8 T;  4Z8X A;  3ZYK A;  3OVU A;  3KFW X;  3ZLI A;  3UQ4 A;  2PJQ A;  2WQY A;  3BQI A;  3RC8 A;  3HKB E;  3EDV A;  4ADZ A;  4PJJ A;  4DV5 T;  4HFV A;  4Z90 A;  4I43 B;  4KP3 C;  5JRE A;  2V6X A;  5ABF B;  2Q9Q C;  2VKH A;  3ZEF B;  5HXH A;  1D1A A;  2XM2 A;  3F2E A;  2CBJ A;  3UU5 A;  4DR5 T;  2ODV A;  3OYX A;  5LGN B;  1WLX A;  1CUN A;  4JI8 T;  2WU5 A;  4MFR A;  4JI7 T;  5H6R B;  3C51 A;  2HPL A;  2DI4 A;  1VCT A;  3AE4 A;  1SE7 A;  4JI1 T;  1YD8 G;  2DLR A;  2HPJ A;  2LKG A;  1D0Z A;  3AA7 B;  3AEB A;  5LA6 E;  2XSB A;  3RRC A;  2YOE A;  4DBR A;  5JDH A;  3T8O A;  4H63 H;  2W63 A;  3LG7 A;  4IL9 A;  4MBQ A;  3U78 A;  5LG3 A;  4CXY A;  2MPK A;  3ZYL A;  4HWH A;  2NR4 A;  5AQU B;  3RLF F;  3UUX B;  4A98 A;  4HFD A;  2L3L A;  5ABF A;  5AQI B;  1WR0 A;  2V7J A;  3PTR B;  5L3G B;  2A2F X;  4DV1 T;  3AA6 B;  2BG9 C;  3ZMU B;  1S94 A;  1NWM X;  1CHU A;  3ZST A;  3NKZ A;  3TLS A;  2MYS A;  2VAS A; 
#chains in the Genus database with same CATH homology
 2AE9 A;  2IDO B;  2AXD S;  1DU2 A;  1SE7 A;  2XY8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...