2IDQA

Structure of m98a mutant of amicyanin, cu(ii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFARGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of Novel Copper Sites by Mutation of the Axial Ligand of Amicyanin. Atomic Resolution Structures and Spectroscopic Properties
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idqA00
3WNIA 3EF4A 2FJSA 2FQEA 3MBWB 5TK4A 4A67A 3FU8A 2PPCA 3DKHA 2X88A 1NIEA 1EZLA 2BO0A 5I5IA 3TASA 3PAVA 1RKRA 2IH8A 1BXUA 1PZAA 3JT2A 5I28A 1PAZA 1A4BA 3WKPA 2IWEA 3OM3B 1BYPA 1ET8A 4Q89A 5B1JA 1W6WA 2OCCB 1CYXA 4X4KA 1E67A 2PCYA 3TU6A 1KGYE 2P80D 2MTAA 3N2JA 5AZUA 1NTDA 3T71A 5I6PA 2FT7A 1JZJA 2AVFA 1J9RA 1TU2A 1AIZA 1SFHA 2X87A 1PMYA 4HAKA 2RACA 1XB3A 1XB8A 5TK2A 4F7KA 3NT0A 2WSDA 2IDUA 1L9OA 5AFAA 3RYMA 1JXDA 4G72B 2FT6A 2DWSA 3UACA 2HZHA 2IWKA 3T6XA 1DZ0A 3TBBA 1GS6X 5F7BA 4CSPA 1ET7A 4KO5A 1KBVA 4YSDA 2IDTA 1BYOA 1MDAA 4E9TA 2PPEA 1WS8A 4YSAA 4BDVA 2WO3B 3X1GA 4A2HA 1JXFA 4L0PB 1J9QA 4GP4B 3JTBA 4N4YB 2XV2A 3WNJA 3CG8A 3NJMA 2PP8A 3NJIA 1TKWA 3L45A 2HRGA 2VM3A 4RH4A 1OE3A 5D4IA 3QJQB 4E9YA 2XV3A 1ADWA 2J55A 1CUOA 3PCYA 1A65A 1SJMA 7PCYA 3AW5A 4YL4A 4BDVB 1IBZA 2PP9A 1V55B 3SBQA 2YXVA 1GS7A 3IE9A 3V9EA 2JXMA 1PCSA 3SBRA 1ZDQA 3QJVB 3FYEB 4TXVB 4GP8B 1JZEA 2AZUA 3N55A 9PCYA 3FSWA 3NJJA 3NSYA 4AKQA 2R7EA 3IN0A 4E9VA 2DWTA 2UXGA 1SDDA 3DIVA 1V10A 1L9SA 1SHWA 3ZIYA 3ABGA 1URIA 1R1CA 3CDZA 1ET5A 4JHUA 3ASNB 4YVNA 3H56A 2YXWA 1NIBA 2IDFA 2YARA 1T5KA 2CCWA 3FU7A 4DPCX 1WS7A 2PPAA 1E5ZA 3S3BB 4P5RA 1AACA 2B3IA 1JERA 1GY1A 1NPJA 3T9WA 2N0MA 1JZFA 1KV7A 3FQYA 3MX0B 3OMAB 2BWIA 3U25A 2EIJB 1AG6A 2ZOOA 2R7EB 1F56A 2VW4A 2I85A 1ZIBA 1L9TA 1KDJA 2GIMA 1WA0X 1NINA 2H47C 2J57A 2Q5BA 4PCYA 1JOIA 2PPFA 3TA4D 6PAZA 1PLAA 4KNUA 5B1KA 1I53A 3BQVA 2P80A 2XLLA 3CZUB 4YSUA 5D4JA 2XXGA 4QKTA 5D4HA 2FWLB 1JVOA 3UAAA 1NZRA 4A2FA 1NWOA 4KNSA 5I6KA 4NB7A 3KW8A 2VM4A 1KCWA 3X1NA 3AZUA 3CVDA 1OCZB 2QDWA 2J56A 3FSVA 3SQRA 1RCYA 4M3HA 4Q8BA 2BP8B 1VLXA 2QPEB 3FSAA 2IH9A 4DP1X 3HEIB 3UABA 4FAAB 2GC7C 2QPDB 5B3SB 2PPDA 1NIAA 2FQFA 1L9QA 1NDTA 2OJ1A 2J5WA 3QJSB 4AX3A 2CUAA 4YSPA 5I6NA 1XMEB 2XYBA 4P5SA 2XX0A 2CJ3A 2GC4C 4HHWA 2H3XC 2YQBA 2I7SA 4YSQA 2GBAA 1GW0A 1KCBA 2UX6A 2YAEA 2IWFA 1HFUA 1JZIA 2BW5A 2MRYA 2PP7A 4DP4X 1BQRA 4ENZA 1BQKA 1AZNA 1KDIA 3FU7B 3QQXA 4KNTA 4G7SB 1ID2A 3FS9A 5AKRA 2OV0A 3FQ1A 4UANA 1QHQA 3AG1B 1OCRB 1WA2X 3PAZA 2AANA 2YAQA 1X9UA 1BXAA 1FFTB 1W6LA 2HXAA 3FPXA 1OE2A 3SBPA 1ZDSA 2FQGA 5B7MA 1JZGA 1OV8A 1WA1X 3S8FB 1BQ5A 2BZCA 1J5CA 2JKWA 1TEFA 1AS7A 4DPBX 1AS6A 2QDVA 5E9NA 1PLBA 3X1EA 2LLNA 2XU9A 2CALA 4YVUA 3CVCA 4HCIA 3WKQA 1NPNA 2BW4A 1ZV2A 1IBYA 1AR1B 3OQRA 3KW7A 1ASOA 1AS8A 2BWDA 2BHFA 2FTAA 3NJGA 4HCFA 1AZCA 1PNCA 2HX9A 1AQ8A 5ANHA 2Q9OA 2VSKB 4G7QB 3CVBA 1PZCA 1V54B 4K9JA 4G70B 2UXTA 4KO6A 4YSRA 1MG3C 4DP7X 1ETJA 1CC3A 4GY4A 3C75A 2IDSA 3OD3A 3QJTB 4CSZA 2PLTA 1X9RA 2GI0A 3EH3B 3EH4B 2DYSB 2XV0A 3OMNB 3QJUB 3CDZB 1AZRA 1L9PA 1ILSA 1GY2A 4NAJA 5I26A 2EILB 2IDQA 4MFHA 5FC9A 4GP5B 4E9XA 2PCFA 1SFDA 1A4CA 4DP8X 4BWWA 1E5YA 1OOWA 3EH5B 4AZUA 4E9QA 3FT0A 2H5UA 4JKNA 3HB3B 5PAZA 1E65A 1QLEB 3BVDB 5I6LA 2UXVA 4G7RB 2BP0B 2XVBA 3T6WA 1BAWA 1TEGA 2EIMB 1FWXA 4A2EA 4KO9A 1ZIAA 4HCGA 4BK5C 2ZXWB 1PNDA 2EIKB 2VSMB 4DP9X 4W1TA 1FA4A 1IUZA 1JXGA 2VN3A 3H4FA 3X1FA 1BXVA 4F2EA 1M9WA 3NP4A 2CAKA 3NSFA 1EHKB 1PY0A 4HHGA 1DYZA 4DPAX 2W8CA 1NIFA 4YSTA 4A2GA 4A2DA 5A7EA 1PLCA 3NJHA 1MZYA 1SF3A 1HAWA 3NJNA 4A66A 5I5MA 2FNWA 1N70A 4ZK8A 5B1JC 4E9SA 4BWUA 2VW6A 2E86A 3QPKA 3NJLA 5PCYA 2Y1AA 3FSZA 3TBCA 3S3CB 3UAEA 1MZZA 3WG7B 3ZBMA 1AAJA 3PPSA 4GYBA 1JZHA 1PF3A 3PAUA 2A3TA 3T6ZA 3QJRB 2BP0A 2ZWNA 2EINB 2VMJA 3IBOA 1OCOB 1AANA 1AZUA 1IC0A 2BZ7A 5I6OA 1ASPA 2WO2B 3D12B 5B7EA 1ASQA 1AG0A 2IAAC 2GSMB 1GYCA 3S8GB 3G5WA 4E9RA 2TSBA 4YSEA 2FQDA 1A8ZA 4W9ZA 5B1BB 3S3DB 1B3IA 4HZ1A 4DP0X 4BXVA 2AFNA 4HIPA 4FA7B 3GXUB 3NJFA 3AG3B 4BWTA 1QNIA 2TSAA 3ZX1A 4AI7A 4YSSA 4DP5X 1NIDA 5IY5B 4DP6X 2XUWA 4WKXA 1YLBB 4JHVA 1KBWA 1SNRA 2BP8A 1NWPA 1KYAA 4KO7A 4NERA 1M57B 2XX1A 1MG2C 2YAHA 5B1AB 1E30A 2HX8A 1CURA 1OF0A 2UX7A 2DYRB 1AOZA 1RZPA 4UF7C 2DY2A 2CBPA 3NP3A 1OE1A 2YAFA 3FYIB 3GDCA 4M4RB 3OMIB 1GS8A 3AG4B 3NYKA 1AZBA 3NSCA 1N68A 1ILUA 2B08A 3FU9A 1RZQA 1PZBA 2GB2A 4UAHA 2UXFA 3ABLB 3H4HA 1A4AA 1L9RA 3AY2A 2HLEB 1WAEA 2GHZA 3AG2B 4QLWA 3EHBB 4YSOA 3IN2A 1J5DA 1NICA 3FPYA 3IEAA 4PAZA 1BEXA 2ZONA 3NJKA 2DV6A 3PLYA 2QT6A 2YAMA 1J9SA 4HALA 3WI9A 4A68A 3UADA 2JFCA 4AKPA 4KOBA 4AKOA 1SDDB 3ERXA 4E9WA 5I5JA 1ZPUA 2NRDA 5I6MA 1CYWA 1SHXA 1HAUA 4EF3A 3ABMB 2AZAA 4GXFA 2VW7A 1W8EA 1UATA 4N8UA 2YAPA 3ZDWA 7PAZA 4YSCA 1OCCB 2Y69B 3FQ2A 1A3ZA 5EHFA 3X2QB 1IKOP 4BXSV 4F2FA 1J9TA 2I7OA 2YAOA 3V9CA 5F7AA 6PCYA 3X1BA 5B7FA 2FT8A 3ABKB 1XB6A 2XXFA 3GYRA 4DP2X 8PAZA 2W88A 5LDUA 2HX7A 1GR7A 4G71B 2XWZA 3T6VA 2HRHA 3PXLA 1JVLA 3NSDA 3WIAA 1SF5A 3ASOB 1GSKA 4KOCA 3UGEA 1M56B 3DTUB 4WTQA
chains in the Genus database with same CATH superfamily
3BYYA 4P3WA 5KBKA 1CWVA 4Z78B 5ELIA 1VADA 4O2CA 4GAAA 2J4WL 1MFMA 1EZLA 1QO3A 3PDGA 4Z7OF 5SWZA 5J6SA 4B6ZA 5A2FA 2ZUQC 1CFTA 3WO4C 4RSVA 1DQMH 2DWEA 4IBTA 1HH9B 4IOSA 3MJ6A 5BXFA 2GEQA 2QQNL 1MH5B 2NY4C 3HZKB 4P48A 1H6TA 1E5CA 2EH7H 3GHBH 1B4LA 1IGFL 4QRQB 4F37K 5LB1A 1Y18B 1G5AA 4FHKA 3BPNB 3HLAA 4EAEA 1PLGH 4OW6A 5JXED 4ENED 2YPVH 3T65B 5DDHA 1JPGB 4LLUA 1FYTA 4OB5L 4OLXH 3N44B 5LNEA 4EI5D 3DPBB 5DFAA 2PW2B 1T21A 1EEZA 2R2CA 2ZP0T 4AM0Q 5CU5A 3LRKA 2XWJB 1X5ZA 2APTA 4BZ1L 1RZFL 3S5YA 3UJIH 3KNBA 4WY7H 3EDJA 4PJXB 4L4TB 4EDXA 2BSRA 1FH5L 1DN0A 2O5ZH 3D9AL 2XPGA 2ZOLA 3OWRA 2EEFA 5D2NC 3O45B 1G43A 1OP3K 4PI2A 3GBEA 4HC1A 1JPST 3APCA 3R1GL 2WXLA 3TBYB 4H4NA 1KPRB 2B16A 4U1LA 1KY7A 4S1QH 4W9FC 3L4XA 4BE5A 5L8KB 3VFVA 4XXCA 1PX4A 4A2HA 1IM9D 1N6UA 4G59C 1UH4A 4A7TA 4M5ZH 1I7ZB 5F7WC 2DD8H 2EADA 4HP5A 5TH2A 5IHUL 5FAAA 3QH3B 4Q9CA 1AD0B 4ZTOL 2EIDA 4JG0L 5DU7A 2IJ0C 4A38A 1ADWA 4N0UE 1ZT7A 2QHRL 5AB0A 4PRDB 2EEXA 3AW5A 5FOBB 1EO7A 3QEQA 5HI3D 4OCWL 5E9DD 4HIHA 5C07D 1JGUL 3Q8FA 1GS7A 1B0GB 4K2UH 1NKRA 5DQDH 4G8AC 3HG4A 2D8KA 1YMMA 2N0KA 3SBWA 4GP8B 2OX5A 1JZEA 4IMKA 4XN5A 3FUDA 1IV8A 3FSWA 3NIGF 4ZFFA 4KKCD 1RZ8B 3SO3B 5I8EB 2ZSVA 4ORGB 3DX4A 1VESA 1GJIA 3B2UD 3L1FA 5D2NA 4H1LA 4M7ZC 1ZJBA 1QMUA 1DVQA 1VIWA 3WN5A 1QP1A 43CAB 3MLUH 3VG0H 4CILA 2E4FA 3L3GB 1RZKH 4L5FE 3WXWH 3WY4A 4K5NA 5C0ND 4MDIA 3V4PL 4NENB 4ZXBB 3CFEB 4ZYKA 1A7RH 4DPCX 2R9HD 3S5LB 4LLAA 4E41B 1W80A 2WQXA 4H2CA 4PD4J 3H2QA 4OLZH 4NLAA 4JPIB 5DSCB 5DZLA 4ZFZA 2I26N 4QLRA 2DQJH 1RZGB 1WA0X 4J3VA 3F12A 3TA4D 4QRSB 1JL8A 2Z93B 1YNTB 1Z2KA 1DQQA 3LRMA 4KUZH 3LDBC 5L4MA 5D1ZI 3MV9A 5L2JB 5DD3L 3COOA 1T22B 4HLEA 3BP7B 4QKTA 2IDCA 4XP4L 1KIUB 4A2FA 1B9KA 1M6OB 1CGSH 5EOCJ 3U6XS 1T04B 5CCKH 5EF1A 1A9VA 3GJEB 4IGBA 3HAEA 2WWNA 3OHMB 4P04A 2XBZA 3QS2A 1IKFH 1YEIH 4MKMA 1J8HB 5C3LD 5E2UL 2EVHA 5GJTL 4PGDA 1FP5A 5TPWH 2UY7A 4LKXB 2GJ6D 4PTTA 4LNVA 3C6LA 4I85A 1E2VA 1RCYA 4U6HB 2E7MA 1ESOA 5E4EB 5KVFE 1JS4A 1JJUA 1CTOA 5E8NB 4OUOA 3A4FA 2DJMA 3HEIB 4TVPH 4LSVL 3PHSA 2JI3A 1XH2A 1S7TB 5DHMC 2ORBL 3G6JA 2OJ1A 2NZ1A 2V7NB 2ZXDA 5DTFB 3I3EA 3L4YA 4YHKH 2XYBA 3CFMA 7CGTA 2CJ3A 4GI6A 4D8PA 4PYHA 2FYVA 2PR9A 1IC7H 3CBRA 3HBPA 3HPJA 1FLRH 3OG6B 5C71A 5LKNA 1JZIA 4L4JA 4PV1C 2NQCA 3GC3A 4HS6A 2VLME 1AZNA 3TCXA 5JW3H 3RI5F 1M05B 1T5XA 3SZKC 5AKRA 1LD9B 2R4RL 3EYUH 3WKMH 1QBMH 2D3NA 1NGZA 3UZEA 5CHNB 3STLB 2CIIB 1VZGA 1HN1A 4M7JL 4R96B 3DV4B 1WA1X 3P4NA 4TLKA 1BQ5A 1KPUA 5JZ7C 1TTFA 4DEWA 1AS7A 4XNYL 1S7QA 1YYLH 1KGCD 2APFA 2A5UA 3QHZL 3BAJA 3KLQA 1QASA 1OPOA 3TJHD 3VXUA 3ZKMC 5HSFA 1WYJA 2ZXEB 4MCYB 3T8MA 1TPXB 4JS7A 4OSUH 2W94A 5F21B 4W9EC 1GOHA 1VFBA 1AHKA 2XQYK 3FUHA 5F1KC 4HUWA 2J5LB 5HJ3B 4HH9A 4HUUB 3EFOB 3DNKA 4OCNC 1R3HA 4DN3L 2OL3H 1HEHC 1PFOA 1WIOA 4NZFA 1JGIA 5T1LD 3N40P 4PJHA 4PJ7F 2BCKB 1TYJA 4DKFL 1Z7JA 4KO6A 3QFJA 3GSOB 1QSEB 3K6DA 1LMKA 1WFUA 3JWDC 4I3RL 5KYWB 2XICA 3BJ91 5EB9A 1I8AA 1CD1A 1WBYB 2VZTA 1HIMH 1RZIA 4X7TA 4ZSOB 3GSWA 4E41D 4CSZA 4HOWA 3QWOB 1I8IA 4X5XA 2IMMA 1XSIA 5I8CA 5LGJB 4NKDA 3LS5H 5IQLA 3TO4D 5LGKA 2L7JA 3QJUB 3MUY1 4P2RB 3WUWA 4PJAB 3E1ZA 5I26A 3QDJA 1B2YA 2PYEB 3E8UL 2XI9A 1A9BA 3VE0B 1F6AA 2KERA 4H0IA 4QJ5B 5BZDA 5FUOH 3ECUA 1DVFD 5EEZA 4B0MM 2BCKA 4H8PA 5BOJA 3NPSC 4J39A 4K8RL 1UD5A 2UXVA 7FABH 1Z6JT 4ERSL 2XVBA 1KN2H 3W5NA 1I1YA 1M2VB 1DR9A 2YOAA 1PJWA 4YO0B 2LLGA 2E4TA 3ALWA 5AVTB 1KJMA 4EQ3A 4N8VB 4EIZC 3ESVF 2BDNH 4KK8C 3D07A 3H4FA 5T5FA 3NP4A 3MNVA 2EO1A 1C8QA 4KJQC 3VACA 1NUGA 3ZE2B 5GS1B 3R18A 3CXDH 2CO2A 3DC0A 4GQ9L 4Z6AT 4Q97A 5IT2L 1QQDA 4GKOA 2AEWA 3MRPA 2DWXA 1LL1A 3BP4A 3SSGA 2FNWA 2EH8L 1YECL 1FZJA 1ORSA 3RP1A 4LCCB 2BRRL 4BH8B 3HJEA 1WHPA 3TBCA 1R5IA 3QXUA 3ZKNC 2WXHA 4RISL 4XNQB 1M2VA 5J5EA 4POUB 4RZCB 3JWNE 3TV3L 3MZGB 5MENE 3GIVB 2OL3A 2VMJA 4MGXA 5C0BE 3U2JA 1U8NB 3L6FA 4GRLB 1ZANH 3RVTD 3VXRB 2GSGA 1QI3A 3OAUL 3SE4A 1JHTA 3S8GB 3LPOA 1D5RA 2J8OA 4YSEA 3VE0A 4PJ9B 3U0WL 1JVKA 4ZXBC 2Y7MA 4QIRA 2PW1B 3SPGA 4P2YA 1OGAD 5IROA 3LEXA 3P4MB 2XFGB 3QEQE 1J8KA 3G6JB 1C08A 5G4NA 2FSEB 3NJFA 4Y4KA 3PYCA 1JNLL 4XN4A 2G75B 4AMKH 4D9LH 2O5NA 2ZUVA 2OYKA 1CLCA 2H9GA 1K8IB 1CZ8H 3KPSA 4XVUC 1JFQH 1KYAA 2Q3AA 4JZNA 4TLUA 1CFVL 3X3GL 4PJBA 4QOKD 4X6EB 3K1KC 5HI4C 1MHHB 3F58H 2D31B 2NNAB 2VDKH 4CN4A 5KS9B 4RWHA 3BAWA 1TZHA 3P77B 4IGBB 2ATKB 5E6UB 4ELDA 4PI0A 3OMIB 3L1EA 1OAKH 1LLAA 2EAEA 2VWEE 4LCCA 3UC0L 5TDNB 3AITA 4X80L 2C4FU 4P2QE 3RURA 3U0TB 1IBGH 5JXAL 4FMVA 4QYOA 3QR0A 4W4OA 3WNNA 2ENPA 2CLVA 4TSCL 1USZA 3VXPB 3WHE1 2B15A 2ZWLT 4UQBA 4Z7UE 1YSOA 2X28A 2ZWYA 3V4UH 1P5UB 5J1AB 2GHZA 3HE6C 1NCDL 1NC2B 4JB9H 1KLGA 5IZ7A 3MCYA 2R2EA 3QBTB 1FYTD 5E94A 4QHNA 3O8XC 4N0YH 3MKGA 4G8GD 2P8PB 2QLYA 3WMQA 1J1XL 3BWAA 4Q6YA 5T1LA 1JHKH 3II2A 1XF1A 4QO1B 4FQLH 1ES0B 1Q4NX 3VI3F 1M05A 1D6VH 2WYTA 1OQXA 4NOFA 2H1XA 3B2DC 2YD4A 3WLWD 1T2JA 3IJYB 3BT2H 5JIIA 4U6XB 1FNGA 1A1OA 2CKBH 3B43A 5ANMB 5I5RA 3ERXA 3DX1A 4N3UA 1GGIL 3JTTB 4YJZL 2P1YA 1SVZA 1SVCP 3O11A 2OPCA 1BX2B 1CYWA 4IK7A 4EF3A 1UB6B 1HK6A 1SVBA 4HKZA 1N0XH 1ONQB 2C4XA 1GGCL 4GW5B 1S9KC 4MA8H 3V8CA 3HMXA 4NNYA 3A6CH 3ARDC 3OLDA 2HN7B 4BXSV 5JPNA 5KANG 3PQYE 1A5FH 1UM4H 1M3JA 5F7AA 3PXJA 4PY8J 1MHCA 2G0KA 4XWOC 5I66A 5TFSH 1Y07A 2PCPB 3FT4A 2WQAA 2CR3A 2V3EA 3W37A 1YG9A 4BSVA 3H9ZA 1BMZA 2VLJE 4J4PD 1OQOA 4Y16A 4ZD3L 1IGTA 4M5YL 4RFOH 3TPKA 3OJMB 3VJ6A 3W0WB 1RPKA 5HYIA 4DUXA 5HHPB 3ASOB 1JHLH 3QUMH 1X5YA 3WNIA 2FJSA 1KCUH 1M7XA 2B7DT 2VWEC 1MJ8L 2WB1A 3NZ8B 2GITA 1UB5B 3MV9B 1KLUA 5L2JA 3TA3A 1NIEA 3MREB 1BM3H 4PJGB 5A2KH 5CJ8A 2AGJL 2LU3A 5BUAA 5F7LB 4R83A 3OGCB 1XR9A 1YUHB 5JIMA 5HVWA 4M7KH 1T7VA 4U6VL 4LAQL 1DN0B 1GKOA 2CO1A 1RUQH 2ZAIA 3GRGA 5B1JA 3EYQC 4LPTA 2HT3C 4FXKA 5H94B 3D30A 5FB8B 1EVUA 2W9EH 1AYRA 3UG3A 5FA4A 2ZX8A 3RNKB 2Q86B 1W8NA 1ZS2A 4LLUB 3CVHB 1KFGA 4NLHA 4WJKB 3DLQR 4GW5A 2A73A 4GKSB 4MD4B 4OM0H 3NPSB 1UOLA 5D5MF 1OTTC 1NGQH 4LHUD 2EIZA 4LEXL 1XIWB 2Y22A 3LKNA 5F1IA 35C8L 2RFXA 4NI6A 3HPJB 3QUYA 4FNLL 4UM8A 1DBBH 1FQ9C 4MXQD 1GC1H 4G72B 4UIMB 3V10A 5D7LE 2P26A 4NM4H 5AKSA 3DDGA 2PCFB 3QW9A 5D93B 3IMWA 4AQ8C 3N91A 4K7PH 1YA5A 4UILH 2W9DH 5F7BA 1PYWA 4KO5A 4MBOA 2JJTC 1MDAA 3D25B 1BQHA 5GS0C 1T2QL 1EHLH 5AOKA 3VXSA 4PLJC 2H3KA 3FZUD 5IJBC 2JQZA 2Y9RT 4P9MH 1QFWI 4P2QD 4ALAL 4F2MB 3T8VA 4LVNC 3V55A 4QEGA 1GIGL 2NSMA 2WSPA 3NJIA 4XPGH 2NY3D 4YC2C 3TEZA 3FO2B 2HRGA 1AR1D 2V2WB 5TH2B 3E3QE 2O5YH 1OE3A 3OGCA 5ICXA 4E9YA 3HNTH 4TV3A 1K4DB 4HQQH 4Q9QL 1W2KT 4JJ5A 1X5AA 1CUOA 1EHNA 1M6OA 3I85A 2AERT 3IGAB 2QMJA 1UOVA 2EE2A 2VLRA 4MA3A 2OMTB 1MQKL 3IE9A 4ZDHB 3GSRB 4OD3L 5KYUB 4UTCA 3IKKA 1G7MA 1GHFH 2FSDA 3AREA 3GTVA 4JFZH 3DVGA 1SPDA 4FQQA 4OGZA 3HUJE 2NYKA 5FPIA 4W9HC 5IVXF 5JO5B 1HCYA 5BRZA 2VR9A 3TVMD 4UUJA 4AGPA 4OFVA 4IMLA 5JUEH 5C86A 2EEDA 3ABGA 1S7SA 4WWPA 2BMKB 2CDEB 1NUDA 1BZDA 2IAND 5BJTA 1FCCA 2QVIA 1A6UH 2P5PA 3P3YA 3UIYA 3PGDA 4I87A 2OYLA 4LQ1A 5FA3B 1LWRA 1HU8A 1IAKB 2NQDA 4MNHB 4H44C 4QNPF 3ZT5A 3X11B 4WHTA 1ZLSH 1Y18A 2WBWB 5CAYB 1NPJA 4B50A 2VITA 2ZSWB 3O11B 2IBZX 1I85A 3LRSA 3FQNA 3FRUA 4HMCA 4XP6L 5SWSE 4Z7AA 4X6DF 4OLYH 3T0EB 1XIWD 1Q1PA 4L3EE 2X3AA 2VW4A 4Z9KB 4LVOB 4CA4A 5IP4A 4PBVC 4KXAA 1EHAA 1JOIA 1MFCL 5TQ2L 2R29L 3CXHK 3NRQA 3F7YA 3ULSA 4U31A 1GYVA 3CH1A 4TTDD 4PRHE 4XO3A 2YA0A 4X5LA 1PSKH 2P80A 3QQNA 1I1FA 4FJ6A 1NCUA 2IPUG 5CIPB 5D4HA 4YBLC 3QPXL 5GIRA 3TO4C 3TZVA 1NMAL 1IGCH 3BDXA 3UYRL 1P5UC 4I0PB 1ZT7B 3BLKA 4NQCA 2NX5E 1KCWA 1FRGL 2ZYSA 3T0ED 2NY7H 5BVJA 3ARBB 4AL8L 2OLDA 3Q2WA 1DJIA 2V4LA 4U1GB 1LP9E 2V2XA 4X8CA 1P84J 5HXMA 2CE6A 3ZSTA 1QFWH 2UZIH 4HJ0D 3MGTA 4HU2A 5D7IB 4AQ1B 4RIRA 3C60B 4M3HA 3R7RA 3L17A 1BJMA 3FSAA 4FLOA 3BFQG 4Y19D 3U9UA 2VDPH 4NNXB 3HI1B 4YO0A 4ZUUB 4DOHE 5IVXE 2DL9A 3QZMA 2HVJB 2Y5TA 3DMMB 3BN9C 4JM2B 1L6PA 1MAJA 2GUOA 5EORL 1WE5A 1F11A 5C2BL 1VEOA 4UTAL 2ZOLB 2I7SA 1QKZH 3VFTB 4DQOH 4WFGE 3SODB 1KB5H 3A6OA 3MRMB 3ML9A 2H32B 4DSYA 5K59E 3JV4A 5TE6L 4HMDA 5ITFA 1NDMA 4CVWA 2CIKB 2N7AA 2YQ3A 1P7QD 4UT9A 4HXBL 1KPVB 5D72H 1BAGA 1P2CB 3GF8A 1U8CA 4OLEA 3L3KB 2AANA 4OZIB 4G6FD 3TIEB 5EIIB 3LXCA 2KS0A 1WH0A 4IRJB 3GSNB 5DMKA 2BZCA 4HIJB 4EI0A 4PN6A 2QQLH 3FCBA 3AAZA 4QRRE 2QDVA 5IFHL 3QFJB 5FR3A 5FV1L 5LN4A 4UTBA 5DGQA 4A6YB 1MCNA 2CALA 2NY6C 1CU4H 3R06A 5EBGA 1NCOA 4XXWA 2YZ1A 2DWDB 4ZOEA 4PWJA 5C7XL 2VABA 4OUUB 3TH3T 2BHFA 5HHOE 4RFEA 3JWOL 4ELKA 4HCFA 3ARDD 3MA9H 2NY0D 2XTJD 2KLSA 2OZ4L 3MLVH 4TQEL 4XPTL 3ZHFA 4LK4A 2DS4A 1FL6B 5D7KD 1QRNA 5K39A 4QTIL 3MCLH 1V54B 4H8QA 2LOEA 1NOAA 1JFHA 2Z35B 1YEKH 3IETA 1JZ2A 4GQZA 2Z31A 4DOHB 3VRJA 4IIZA 5CJOH 1KPUB 2ICEC 1HXYA 4G2AA 4G80A 2K3TA 4AVKA 2FEDC 3VRLE 3U4EA 3ARED 1VF5C 2ADIB 3BZEB 2OTWB 3VWKD 5J6GA 3FC8A 2D0HA 3IU4L 5LVEA 2EILB 3L3OB 1HWHB 1AD9B 1AYOA 4PTUB 1JPFB 2V5TA 4N2HA 1HEZB 1AHWA 4E9QA 4BRVA 1FJ1A 1BYNA 2Y6TE 3B9AA 1HCVA 4G7RB 4FHBD 3Q8BA 4NHUA 4ONFH 4KY1H 4XBEH 2UZYA 5FGCE 2AJYL 1WG3A 5E51A 1CVSC 4OZFB 4XZ4A 4FABL 2ZUXA 4WHCA 2DQFB 3RG1C 2DYPD 2P24B 2I9TA 3U7AA 4GMSL 1ERNA 3L5WA 4YC2B 3UJJH 2Z9TA 1IAIL 2VN3A 5DZPA 5AOLA 3I50L 1FNEB 3RDTD 2XXCB 3W9EA 4YQXH 2FLBT 5DD5L 2FL5B 1DHKA 1KY6A 3D2UA 3HG1B 3C6LB 2XWEA 3DOHA 4FMFA 2FBJL 3BLPX 2F7OA 2CCVA 2JLLA 1I8LC 1NIFA 2WXPA 4HUMB 3SYPA 1T0NB 3NJHA 5HGHA 1HAWA 1MCRA 3DPDA 1YNKL 1DBAL 1NJ9A 1ROCA 2OYMA 5D71H 3MQIA 4IOSD 2C3VB 4OKDA 2VXQH 2VERN 1KENH 4ZMPA 2Y1AA 2BINA 5A16A 3BP7A 3LNGA 3ZBMA 1YY9D 4KJPD 4GYBA 4P4RA 3T3ME 3VH8B 4CKVX 2YEZA 4OM1L 3V6OC 3GSXA 2YPVL 2AK4B 2D7MA 5AYUH 5FLVA 2Z93A 4P3CH 4Q6IB 5D1QD 4ADJA 2E7CA 4P4KB 2X3BA 5F9WB 3IAGC 1KXTA 5I6OA 1NFDA 1TG8A 1ASPA 3D2TA 3A4AA 3BAXA 1JTTA 3ZL1A 3DOSA 2VXUL 2G5RA 4XX5A 5IBUG 3MRIA 1PG7X 2C9XA 4WY7L 4LCIL 4O2FA 5IMKB 4E41E 3WIHL 2CPUA 2IPTH 5BV7C 2NLJB 1A8ZA 5B1BB 1MRDL 3FT1A 4XBMA 1IL1B 5CHNA 3VWJA 4G42B 4J6RL 4N2EA 2F7QA 1C5BH 4HIXL 3AQDA 4N5EC 1D7CA 5TQ0H 1YY8B 1U8QA 1EAQA 3ZDYF 5JQ6L 1HHKA 4L29B 3ZDXF 3Q3GB 1FG9C 5CSZB 4UQ9A 4YZWA 3SE3A 3WENA 1MW0A 4JFVA 4YPGB 4JM0A 4L2YA 3QZWG 1NFDB 1XL6A 3ARVA 1UKQA 5F3BB 4H8VA 3E3QC 5KYNA 1RFDL 4DVBA 2J72A 3G6DL 3FUIA 2WWMD 1C7SA 3ZT6A 4YHML 4Z0XB 4GAJH 1MRCL 5EBWA 2VE6A 2R0ZH 4LDCA 1FL5B 1IKNA 4QWWD 3NSJA 1J0KA 4YBQC 3MV8D 3PUCA 4L0YA 1TJMA 2A74C 2YSSA 4BYHA 5E8NA 4AQ1C 1BIIA 4DCQA 5KSAA 3DGGA 3RUGA 1OTTD 4LFHD 3EO0A 3KYOA 1OAUL 4ABVA 3GMRA 3ZIMA 3W38A 1CL7H 2HTLC 4ACTA 4NHCH 1DL7H 5AOIA 2ZPKL 1UWXK 3WIIL 1QRND 5I74B 5HDQH 1KIUA 4RVBA 3DX8A 4Z0BL 2P24A 4FFWD 4FYTA 4JG1L 4PEEA 5EBWB 5AZ2H 4OAWA 1IL1A 1EO8H 4AG4L 3QUYD 5CZXD 3DRTA 4PJGE 4OIIL 1M71B 1TLKA 4E9WA 5I5JA 1KBKA 1QSFE 3K6OA 2NRDA 2OMBA 3Q3GA 3O6FB 4PJXE 3NK4A 3KNBB 1W8EA 5FCSH 3N3EA 3SE6A 1RK7A 7PAZA 4Y5YB 5J6GB 4AITA 3SDCA 1T0PB 1T21B 1Y6MR 2IWGA 4MDIB 3WNOA 2FJGB 3ZJAA 1OCCB 2DQJL 4FYSA 1BVKA 3QRFM 2N4IA 3H1ZA 5IOKA 1EZUA 2G5BA 1NCBL 4O9HL 2HB0A 5EOQL 4XRCB 2Y7NA 4DF9A 5DD3H 4DEUA 5CBAA 1KGCE 2CJTA 3UZVB 5I75C 3KWXA 2R4SH 1XO8A 1U3HC 4B9KC 3NN8B 4DP2X 1EO5A 3GNMH 1Q0XL 3LOWA 4JX0A 5LDUA 5EULV 4YHLH 1G9NL 1BLNA 3SDDB 4AIEA 4TMPA 2AQTA 2HKHH 1FG2B 2XBTA 4KOCA 1CE1H 5DRWB 5EA0H 4AQ8A 4Z7QE 4PWHA 1D9KA 5GGRY 5B39A 3UDWC 4XMPH 2HFGH 3UTSA 2AJ3A 3TN0D 1ZHBB 3D39E 4RDQG 1VGEL 2EXYC 3MODL 3PJNA 4JREB 3MV7A 1ADQA 4RZKA 3GHPA 1AD0A 4YK4C 4JRWA 3S8WA 4ZS6C 4G8FB 2F6AA 2DOCA 2IGFL 2W81C 4YHKL 4NGHL 2F19H 3HA0A 3N42B 5HGAB 3VD5A 2VQTA 3A5VA 3BXNA 1HJBC 1Y6NR 1NMBL 2FO1A 4X4KA 1H15A 2JI2A 4XX1G 2BLFA 1H8NA 3C8KB 3C9NB 2NT0A 3P4OB 4G9FA 4N9GA 3WSQH 1SGKA 2IOMA 4NIYE 2KBGA 4XH2B 3MRLB 3MOBL 4KHTL 3GO1L 4Z7QB 4NKIH 2CMRL 1DFBL 5JHMA 3U4BL 1NLDL 2JCCF 2Y1VA 1TTAA 2HUHA 4QYAA 1NC4D 4PH8A 4ZAKA 3WKML 5CU9A 3MRGA 5I15H 5JOEA 5AFAA 3B2XA 4BFJA 1BZ7A 1XGTA 2DQGL 2VDOL 2ZE0A 1MLBA 5GSRB 4WW1B 4EDXB 3C5JB 3TJPA 5C0JA 1N10A 4CVUA 1R47A 3NTCH 1IX2A 1JZDC 4XBPB 3TCTA 2RH0A 1PJ9A 3B9VA 5T5NF 5GZND 3AREC 4YSDA 1ZVNA 4X5WB 1KCLA 3CN4A 3U9UB 1XZ0A 4LSUL 1AP2B 5E00B 3VXUD 1UJ3A 4HXAL 2MEJB 2BVTA 3KCPB 1J9QA 3H9HA 4GP4B 1QNZH 2R0WL 3D52A 2ZCHH 4GG8A 5GSVB 2XZAL 3EOYG 1MJ7L 1LE5B 1CR9L 4RFNC 1A4JB 4QPEA 3PDOA 4ZOAA 3AAZB 2AV7A 4XOBA 3LSOA 3T0XA 2VM3A 3IAPA 2VDRL 3CLFL 5L4IA 1ECYA 3RGHA 3RFZA 3GSNA 4NQCB 3BWUF 3VVVA 4JVPA 2CGRH 2WGXA 5J56B 1CDUA 2JJSC 4ELKB 2AJSH 1ZGLA 5INDB 2V37A 5D6CB 5AD0B 4TNVF 4K55A 3VMNA 5FGRA 2WCPA 4Y4FA 1E7UA 1WPCA 3FCSA 4MLIA 3RDTC 2AZUA 3ZZ1A 4A2MA 1CE6A 4MMXC 3BQUA 4FNUA 5DZAA 4IDJL 1WF5A 4ZRGA 3S4SA 3QEHA 3W1ZA 1TVBB 3DBSA 3UPCA 3LPGA 1RJLB 3GM8A 2DB8A 2GW5A 2LTQC 2YFOA 3HNVL 4Z7VB 2VC2B 5EZJB 4FA8A 5HYJA 1HCFX 1J5OH 2HVJA 4UINH 3ZW3A 1E28B 3FOLA 2ITFA 2AEIT 4AEHL 1W72B 1XXFC 1U8OA 3OHXA 1J18A 4U05A 1X5FA 4Z3FA 4I4WB 4TNVK 3FTXA 1GZQA 1HX0A 4HWNA 3LH2L 1NGWA 1JRHI 4ETQB 3CSYA 2BVPB 4ZO9A 3SQBB 1I8MA 1ZV5A 1JF1A 3PNWB 2WBJC 2J57A 3H55A 3WEBA 2Q5BA 5HDWA 5I18L 4TQIA 3OB0H 1P4LA 4KI5F 2HG5B 3U7WL 5FYLH 3CHOA 4NX0A 2H3NA 2DQDH 5IR1B 2AK1H 3HI1A 4AGOA 3SKMB 1I1FB 3MBEA 1WZKA 1JVOA 4N5ED 1J86A 4NQEA 2CLRA 1SXZA 4Z95L 3FBQA 2VRKA 5KVEE 1D2PA 3RUGE 5C9JA 4NWUH 1C12A 2GTQA 1FGVH 3EJSA 2V2XB 3PHAA 3WL9B 4R90H 2FWUA 1U36A 3MNZA 4JQIH 5FO8A 1IZKA 2D9CA 2BP8B 1VLXA 1ZANL 3UABA 5GQBA 4CAGA 2IBZY 3A4EA 2QPDB 3G08B 1OGPA 4QTHA 3OMZA 2BNRD 5F9OH 5E2VL 3P30L 4PY7B 2O30A 1RUML 3VB9A 5C08A 3VXNB 4S10A 1S7SB 3IE4A 2P8LB 1IGIH 1NBQA 2JJVA 1BW8A 1CDIA 1ND0A 4OJFL 1NAML 2GBAA 5JOFA 5E6YA 2UX6A 2V17H 3EOAA 4PGBA 2VTFA 3HMWH 4ICWA 4XXDA 1OTUC 4L9LC 3V4VL 1JFQL 2JJSA 1NUFA 3U6RA 3LVEA 1BQKA 5FS5A 1FFNA 3RZCC 5TF1H 1TNNA 2PR4L 2OV0A 5EN2B 1IC4L 4I9XA 3KYMB 2BSEA 4HD5A 1RJZB 4AUUA 4ANVA 3P3UA 3PAZA 5H4ZA 1K3ZA 3S37X 1F5WA 3OXRA 4KJQD 1T3FA 1KYOK 4B9CA 4M4PA 3MRCB 4XE5B 1OV8A 4GW1A 3RBSA 4JCWA 2WM0A 5CZXC 4GIOA 4FEMA 3VTTA 2WXIA 4O51B 1GOGA 5DC9B 2VLKD 1FNSH 2LLNA 2XU9A 5JXAH 1AO7A 1WZ1L 1K8DB 4N8PA 4WI4A 4MYPA 2O6FA 4QT5A 3H2PA 1K85A 4QJ3B 4O02B 4PJGA 3G9AB 1AR1B 4NPYA 4DK5A 4UB0L 4KZDH 1OSYA 2A7BA 2YD5A 1NCDH 2WBXA 4XXWC 5GGSA 2HX9A 4BKSC 2F5AL 5I71C 4PPTA 4ZT1A 3N0PB 1IGTB 2ESVB 4G7QB 4WI3A 5DJ0A 2V2WA 4RWYL 1MG3C 3QUYB 1ZHLA 4G7YH 1WWWX 2B1HL 2JB5H 5EV7A 3BT2L 4V1DD 2DM4A 2P5ED 1GSMA 2YPLB 1UT2A 2VKWA 3GBNH 1ZS8B 5DUBB 3ETTA 2WVUA 3O2DL 1UH2A 4XNAA 2X4SA 4NNYB 2E7LC 3C6EA 4EN3C 4XOCA 1AZRA 1GGCH 4U1MA 1QLFA 5J57B 2PCFA 2X4QA 1BOGB 1ZHKA 2VZVA 2ZTBA 1TETH 4M03A 3V0FA 1A1MB 3WE6A 2H5UA 1CGYA 2LW3A 1SQ2N 5T5NG 1TEGA 4RMUA 5HHMD 5TFSL 3QXAB 1TYRA 5HYQA 4UOW0 4X4XB 3US9A 4JL2A 2Y72A 3F6LA 1FE8H 3T4YB 3VI4E 4RFNB 5FUZH 4DP9X 2E9IA 4M5YH 5TD4A 3H2WA 4O02A 5E94B 3N1QC 1WSST 2PWGA 4KRPB 4LOFA 4FDWA 2BNUB 5DJZB 4WW2A 5L2KB 3WCYA 1KELL 5IM7A 1QA9A 5I73B 2HT2C 4HDIA 1TMCB 1OW0A 5I66B 4ZW3A 3AGWA 2VN6A 1BPLB 1DUYA 2YR3A 4AQZA 4F58H 3TBSA 3MRCA 4Z7NE 4PJDA 2ZXBA 5EUOE 2EVGA 4X0NA 5KSBB 4O4YL 2TAAA 3I02A 3NZ8A 4HGMA 4YOKA 4ZPVB 4MQXC 5EC2B 2G9KA 3PPSA 2CNYA 3GLEA 1PF3A 5JORA 3SKNB 2ARJB 2PTTB 3CHRA 3QCTL 2G9HB 4OF5A 2EINB 4U2ZA 3II1A 5GS3A 3D4GA 2EDJA 4GPVA 1QBLL 1AG0A 1V7NL 2DQHH 5H2BA 3RKPA 4E9RA 2QZ5A 3KWWB 4LEXH 2WKOF 4G11A 3HS9A 4WI5A 1IC5L 5IBUB 3G5XB 3BZFA 2FEEL 2QJDA 2O4EA 4YWGH 5A3IC 1JDDA 2ZOUA 1NGXA 4WVRA 4Y19E 1E4HA 3IDMA 5E5UB 2DEYX 4YSSA 4OQ1A 4Z5RB 1B3JA 3ARRA 4FQ1H 3DBXA 3WFCL 5CILL 4G6JL 5J3HD 2D3LA 3GMLA 4LPCA 2APSA 4XWOD 5EU4B 3UZEC 5ABAA 1P5UA 5FM5O 1H9VA 3TT1L 2YZ8A 5EWIL 4G5ZH 5I8KL 2FX8L 1OWRM 1KF9B 3PGCA 4K9EH 4FKHA 4DVRH 1AKJB 4UYQA 4LCWD 4FYQA 4RMSA 2J88H 3V0EA 5T5FL 2R56L 3IJ7A 4FTVB 2X6CA 3D3VA 2E9BA 1JZ3A 3K5SA 1ES0A 3CFDB 5KBDA 4NWTL 2ED8A 3VGHA 4XE0A 3D85B 3B9KB 1ZLWK 2D7PA 4WO4B 2E8YA 3RWIA 4S1RH 4HQQL 4FHJA 4ZODA 3RIFF 3SE8L 4MJHA 1N3NB 1JGVL 1HNGA 1U41A 3FL7A 4X5RA 2B08A 4ZO7A 1A6WH 4QY8A 4F7EB 1IBHA 4PLKD 4D9RE 3W2DH 4Z7UA 4EXPX 3INUH 4LGRB 4Y8AA 3QJHA 5FW7A 2YK1L 4LEOB 3RE0A 3H42H 2W0FA 1EK3A 4LF3A 2CKBB 4YSOA 3CIQA 2D2CC 1NCWL 3ULUH 3KPSD 1U42A 3MUJA 5IB4A 3NJKA 4QGYA 3LQZA 4Z3EA 2P4AB 2VL4A 5EU7C 3LZNA 3QDGE 3PP3K 5DEFB 3P77A 3HZMA 4CSTA 1PW3A 2PW1A 3IF1B 2WKOA 1JV5B 3Q9QA 4I2XA 1LO0L 2GJZB 4EOWL 3QEHB 2N7BA 3H7BB 3LKQA 4EE2A 4M7ZB 1BSIA 2BHYA 4ZI8A 4I1NB 5HJGA 3TIDA 1BF2A 4YFLI 4HD9A 1EEQA 4M56A 3UG4A 5ADOH 3D39A 4KGJA 4L1TA 2IALA 3ABMB 4LSTH 1TQCB 2G9HA 2VDNL 4GXFA 3NCJL 2J6EH 4J3XA 2WLLA 3HI6H 2CBTA 1OPGH 4N5UA 4RZCA 4P2OA 4IBLT 3RA7L 1JUFB 5E03A 5I8CB 4ZMAT 3X2QB 3MXVH 1BVNT 4OZ4B 1X9LA 4JDZA 4NQDD 4U7MA 2XWRA 2NY2C 2X6VA 2DI8A 4U1IB 5T3XH 4BKLB 1QA9B 1S5HB 3SOBH 3CVIH 3QQ3A 5EZOH 1F4HA 2VRAA 1VFAA 2XKUA 1N26A 3FOMB 4A1RA 3MTXA 3L48A 2WNGA 3LEVH 3QEQD 5E1QA 1GSKA 1T1XB 4HA1A 5C0FA 3UGEA 2BJML 2GSIA 1DANT 4NFCA 4XNQA 3KS0H 1IM3A 2UZIL 3V4VB 1IM3B 3WXVH 1QWNA 2VKXA 3KYNB 2GFBB 1W72L 3MLYL 3F6IA 3OKEA 4MZ2A 4BFEA 4UBDC 2BOBB 1LDPH 4LAJH 2OXHA 1ZLVH 4ELMB 3HW7A 5E2WH 1XGTB 3ALXA 3S3SA 5F6IB 1ET8A 4U1IA 3TTYA 5HYJD 4P23B 3RHWF 4GUPA 5C0CA 3BESR 2B4CH 4Z5RA 4BQ6A 5JW4N 4LPYA 3UTTD 4BINA 4LLDB 4WTZG 1NTDA 5DQ9B 4LPWA 4B9FA 1F8TH 1TZGL 5A2JH 3ZVVA 4ZFGL 3QZBA 2LT9A 2X7LA 1TU2A 1U3HB 1I1YB 1AIZA 3BVUA 2WLLB 3ZDZF 3BI9X 1U33A 2XG4B 2YPLA 5D72L 2AEPH 4H8WH 3AGVA 3GLZA 1BJ8A 4LL1A 1L9OA 2XPZA 2YD7A 5D1QE 5GGTL 3WFHB 1TT6A 3WFHA 1JK8A 5TGBB 1SUHA 4WDIA 3MV7B 3N40F 2R23A 1J12A 1A9BB 3B7TA 2XYCA 4P59H 3VA6A 1CVRA 3MV9D 5IFHH 1ET7A 3MOQA 4LLQB 1R46A 3CCHA 1DSWA 4HGKC 4NKDB 1CU4L 2VAAA 3QUZA 4W9GC 4P46B 4B7LA 2PWDA 3ILQD 5DQ9A 4LLDA 3AB0C 3HJ0A 1BZQK 4NC1C 4PJIF 5IJKA 5KSBA 2YGPA 4I3SL 1J8HD 5AG8A 3CFNA 4XP1L 1LJMA 2BFVL 4Z8FH 5J9PA 3HTLX 2J2ZB 4M93B 1H9DA 3WGUB 2BM3A 1MHEB 3K2MC 4NQDB 1QSEA 3UYPB 2VRQA 3ARDA 3GTTA 3L7FA 5AW8B 4RH4A 4X9YA 1MAMH 2YD6A 1ZD6A 2BC4A 1BFOA 4GW1B 4ZTPL 3F83A 3MCLL 3QXDB 4JUSA 4OGAC 4JG9A 4HUWB 1YQ2A 4JLRA 3VX1A 3X17A 3RWIB 1F41A 5C0GB 1BF8A 2JXMA 4NQSA 3H3KA 5IESH 4ODSL 1O9VA 3QJVB 3TX4A 3L81A 2DICA 4U2YA 1CXHA 4FFTA 3E2HC 1PDKB 1WWAX 1I9RL 4FL4C 1A1MA 2X4RA 3NFPA 4J3OC 5KVEL 2Y06H 3VXSD 5F7NC 2VR4A 1U8PB 3B9EA 2NSXA 2B59A 2ZUYA 5DTFA 5HGGS 1T4WA 2BSSA 5I19H 2WQSA 2RCSH 3WS6C 3V0HA 5C97A 1ET5A 5E4AA 4JEGB 5CP7A 43CAA 3AS3A 2ZP8A 3S3BB 3LYRA 3QRBA 4FZEH 5AVRB 2APWA 4GSUA 4F9LA 1HKFA 3I6KA 5G55A 4NUJA 2CQVA 3IDNB 3DGGB 2I9LB 4JFHD 4J5VA 1RHFA 1P5VB 3BWZA 1Z9LA 5EU5A 1UM6L 3POHA 3BH8A 4APQA 2I5YL 2BSBA 4M8QA 3RY6A 2A4EA 5IR1A 1DBAH 3G6JE 4IHBA 4NPYB 5F9AC 1LO4H 4LVHB 2GABA 5IBTL 2C8NA 4N6RB 2DLIA 2QPFA 1NMCC 2VM4A 1Q9KA 2PCXA 2XWBB 3PWUA 4QOKE 3IRCA 4JO5A 4QRBA 1MCHA 5E8DH 4HDIB 3LZFH 2J1YA 1NM9A 3Q8AA 5LBVA 1DVTA 1OCZB 1FFPA 4WW2B 5EUKA 4AYFB 3TF7C 3MLSL 5FUCC 3SQRA 5F7YC 4EIUA 5CCGE 1QAWA 1G6RB 4BFIA 4OVUA 3S5LA 1QPXA 3UZQA 4NO2B 3S88H 2ID5A 1YY8A 3ARPA 15C8H 5KJRL 3VFVB 3BPLB 5ETUA 2X6MA 5C0NC 3SB3A 1N6VA 2OJEB 3VD7A 3U9PH 3B7SA 3QXAA 4H0GA 5F96H 4ICXA 1CI3M 1KUMA 5EZJA 4Z7VA 4FD0A 1HVXA 1SDYA 4XVSL 2NUPA 1L6XA 4HHWA 3N9GH 4JRLA 4RRPM 3UIZA 5T1DH 2HUEA 2JK5B 3ECVA 3H3BC 5JOFB 2X4QB 1E3ZA 1KXTB 3SKOB 1RZ8A 3IDJB 1S7UB 4I7ZC 5C6WH 5G5DB 1CB4A 4HWZA 4YL9A 1IGYB 3PWNB 4YEFA 5FO9A 3AUWB 2FH8A 1XMWA 4PVNA 4OGYH 5JHAA 1L3NA 3CX2A 2PETA 5HD8C 1LEKB 3HC2A 4EJ1C 4EKJA 4NZUH 1S9WA 2VXVL 4YHMH 1WBXB 1ZA3A 3C8HA 3KPQA 4JZJB 4FG4A 5GGUA 2R0ZL 4C55A 2JKWA 3KG5A 3QA3A 2FLRT 3LSOB 4QGTA 4PP1C 4DPBX 2B9AA 4AYDC 5ILTH 3QH3A 4YXKL 2WNXA 3UPRA 3O4OB 4Y19A 3D2UB 1OGAA 4BK5A 1I7UB 4QJ4B 4FQ2L 4UT7L 1BBJB 4PJAE 4XHJC 1RUKH 4JM2D 4XMKH 1XZ0B 1S9XB 2W92A 4OCXL 4UM9A 3WY1A 5JHLL 2XV6B 4WRLA 4U1LB 4CW1A 1C1EL 1AQ8A 5CEZL 3LQAL 4NHCL 5D8JH 5EU7E 4V1DB 4ZAKC 5AB9A 4XBGB 4EZJA 2VSKB 5SWSD 3HG2A 3MSPA 2NXYD 3HE7D 4XT1C 3HE6B 1HINH 2J25A 1Z3GL 3DX3A 5I30H 1JPFA 1QRKA 3K6SB 2DM7A 4MCMA 4MJ6A 1V3JA 5FF6B 4WFFD 2B8OT 4TSBH 3TJHC 3ZHNA 4GY4A 1EBPA 5F6IC 5LN8A 1S7XA 2VUKA 3OD3A 3V4PA 3MLTB 2ZCLL 4FXTA 2F8VA 2CUHA 3BX7C 3SJVB 4GRWF 4JO1H 1AQDB 4OJYA 4JPVL 3KPNB 4N8VG 1MUJB 3U4EB 5DD0L 4XX1E 4JRXD 1II4E 5C6TL 3KH4A 3BXNB 3SYAA 2MHAA 3CQQA 1S9VA 2OMUB 1A4CA 1RZKC 3B5TA 3ZMNA 1OM3L 1N12A 3VI4F 2WN2A 4YXLL 2A6KA 3FT0A 4WNJA 1KG0A 1MVUA 4P46C 5DJ2A 3KHQA 3DYMA 3VW3H 3T6WA 1QO3B 2R4SL 2H6UA 2ZXWB 3P2DA 4AZ8B 4JN1H 1E8YA 3MNWB 3MYZA 1XGYL 3B7UX 4MS8D 1ZGLB 1IAOA 2B1AL 5DFVC 4X4YA 5DUBA 4JM4H 2HKHL 2BP3A 2IH3B 4FKKA 2HFGL 3AB0B 3BVVA 2DQMA 3F05A 5DGRA 4DPAX 3M7FB 2FX7L 1Q38A 3NN8A 4XCEB 1DJWA 4WGVB 1TQUA 1U8HA 4B9JA 4TVSa 1OTSC 4B9YA 4Y5VB 4EIGB 4A66A 4MMZB 4NYLA 5IHWA 1C9SA 1DDTA 3N04A 2ZNXA 3K0WA 4G8IB 3Q0HA 4YHYC 3TYFB 5SV4A 4UMGA 4WEBH 1MZZA 4JCMA 3K6IA 3Q6FB 4D7PA 3VGGA 1NMBH 1N8ZB 1WAAA 3EH2A 3EZ8A 4Q56A 4ADIA 4R7DA 1W0WA 4P5KA 1PZUB 4R7NB 2JJTA 2LVCA 4PS7A 1TMQA 3AWEA 4G6ML 5FYKL 2YLKA 3UBXG 5DFTA 2O26U 5JTWA 4N1CA 3C60D 5E8OB 3VXTA 3MRMA 3D12B 1XGPA 5B7EA 2CO6A 3FBKA 4HWBH 1E42A 1MWAB 4KWUA 3EYOB 4UOW1 3VCLB 1J48A 2NUPB 3HE6D 5JLZB 3CMOL 1CO1A 2RAMA 3MLPA 2C3WA 5DHDA 4ZNCD 1AFVL 3OHXB 4N8CL 1UGNA 2EDKA 3ZKND 3BAYA 4BUGA 3BHBA 4FG6D 2BP5M 3PABB 4N2NA 3C8KA 1LO3H 3LAFA 1QEXA 4BCYA 2WB7A 2AV1B 2XUWA 4J7RA 1WWCA 2GAZB 3CZNA 3QNYB 2Q8BL 3B2VL 2X0UA 5ITBL 1U0QA 3QYMA 1I7TB 1UCBL 4HCRH 4UBDD 3O3AA 1I8KB 2QKIB 3ECBB 3QVAA 4IM8A 3RWCA 2EE9A 3UJTH 5BS0B 5F0PB 3ARBA 2R0WH 5FDWB 1FPTH 1MFBH 1RL1A 3C2AH 4RCAA 4KMQA 2ZOTA 4JY5H 5EBLB 4PRPA 4ODXB 4UAOC 3VFGL 1MXGA 1Y0LB 4LSQH 1JXJA 4MZ3A 5FKAA 3V6FB 2DKUA 1J7VR 2WBJA 3N1FC 4UM9B 3J8F7 1HE8A 3CLFH 4GI9A 3G08A 4AYBA 5DRXA 2Y5EA 4Z0XA 3WNMA 1WD8A 2R29A 3WEOA 1UVQB 3NSCA 1CN4A 4HUKB 3ULSB 3KBFA 3ZDYB 5KS9F 4AEEA 1G7HA 4LHUG 2HKFH 3QDJD 4Y1AA 5CR8A 5B3NA 4YHIB 3D4YA 4XO4A 1CICC 3GKZA 1SLWA 2IADB 3GGWB 1CDGA 4X8JB 5J13B 2PO6A 3N5AA 5C9JB 5I0WA 3ULVC 1TTBA 2ICWA 5L9DL 1G9HA 1O6TA 4HS8L 1TDQA 2OI9B 1CDJA 4MNHA 3TH2T 3Q01A 2ZWKA 1WK0A 3HNSH 4MMYA 3JWOC 1AGCA 5JIDA 1U8IB 2H1PL 4WI2A 1CXLA 2VLJA 3BQUC 1WT5A 2O5XL 4ZTEA 1J9SA 3NCYS 3C5JA 2JVUA 3KPOA 1AOHA 3PNWA 3LNEA 4W9LC 2ZXCA 1IEHA 3B9KC 1HS6A 3DRTB 1HAUA 1H6EA 1I7TA 4W9JC 3FCTB 1J5HA 3C6SB 1L7IH 1FAKT 1KEML 5HJBA 3WO3B 4X0KA 4AE0A 5CN3A 3W3BA 2AABH 2JCWA 3ZQWA 3NIDF 4R8WH 2X42A 5JHDE 1IKOP 5C09D 4WK0B 3LN5A 3GM0A 4P2QA 1S7XB 2X5PA 3JTSA 5I74C 3JV5A 2OCFD 3FFCB 2CNZA 5HBBA 4L8DA 5EC1B 5IFJA 4M8RA 1N59B 2BVQB 4M48L 3VD3A 1SEQH 4OCRL 2HRHA 5IHZB 1L5GB 3QCVL 5LBGA 1JPSH 3DTUB 1XVSA 1YEEH 4OCLC 2D7NA 4ZMXA 2FO4B 1D5XA 3BEWA 2I9TB 1TO4A 2PPCA 1UC6A 3BH8B 4JFQA 2ADGB 3ZZQA 4APQB 3O81A 4ZOCA 5HD8D 4MAYA 2MQ0A 1Q94A 3EYVA 3RFZB 1IILE 4MWFA 4EI6A 1HKLH 1TENA 1P4BH 3OB8A 5KSVB 3TN0B 3BPCA 1E8XA 2RIKA 2RFXB 5TE4H 2Q2EB 2AC0A 1QSFD 3QJOA 4OCYH 3D8MA 3C09B 3ABZA 1MFUA 1RK1A 3DARA 1E4WH 3VXOA 2WVVA 3MU3A 5DRZA 4EQ2A 4CMMB 3SD5A 1X7SA 4WU7B 3PWJA 3UPAA 1MCDA 5D96C 4QXUH 5I6PA 4NQUA 3DO7B 5HVFB 3MAWA 4ZFOB 1HL4A 1ZXKA 3LKRA 3N43F 1ETZA 3VFPB 1G1CA 4MS6A 4G80B 5T3XD 5D7SL 3QG6A 2Y2TA 5KYYA 3F04A 4F7KA 4QXTB 5J12B 5T3ZD 2CA3A 3IMUA 3TVMC 1XTLA 3EJTA 3RWGB 2Z65C 3N42F 1B4JH 2A6DB 4P46D 4QRFA 1K6QL 1L3WA 3OXSB 2JE8A 4I89A 4TLSA 1L0YA 2JKJA 4KV5E 4RA3A 4PJFB 2LFGA 5ID1B 1E9QB 2XTSA 4OAWB 3WO4B 1AY1L 3ETBF 2LABA 3LS4H 4RFEB 1BYOA 1CDCA 1FVDA 2MNWA 5KWYC 3Q06A 3HB3C 1WZ1H 3FQRB 5LBSL 4OUUA 4CMMA 2AJXH 4L0PB 5E2TL 2ATPB 5HHVL 1WFIA 3OR7A 3IWUA 4Y16B 4KK6D 1PGRB 3WHXA 1AE6L 2ZF9A 4MXQC 1B9ZA 3U36B 1VCAA 1E5AA 3DXAB 4AXWA 4EI5A 2PNDA 3QDHA 3MRQA 1HHGA 2XV3A 1I7RA 2DQTH 1UJTA 1VEMA 2YXFA 1FN4A 2QR0A 2AXGB 4WV1C 3S36X 3L3KA 4G7YL 2JB5L 1FL5A 2F54E 3L4UA 3O3EB 1SOQA 2WNKA 4KBPA 4ZMVA 4LL9A 4NFBA 2KUTA 1GOFA 4YHYB 3D9AH 1XR8B 4D94A 1TTCA 1W16A 2CIKA 2OSLA 3HN3A 4FXGA 3O2DH 5AW4B 1OSPL 3ETSA 3JTTA 1JYXA 4S1QL 1UXSB 3BLBA 3QP3A 5C08E 3LXBA 5LGHH 4RAVA 4AV4A 5I1HL 1LK2B 5E9DE 1MY5A 3E7JA 4CDHA 3LN5B 3QQ9C 4ENEC 4BH7A 1F6FB 4ZUSB 4HBCH 5JW4R 4NM8L 3VO0A 1BVKB 1ADQL 1UWYA 4M7LT 5C9KA 5GS0L 5FFOA 5BRZE 5IB4B 2UWEF 1S7RB 2H26B 1YEDA 2R1WB 1H3GA 1F3DH 4JQVA 4ZUVB 1T7YA 4AEFA 3LKPA 4ZTOH 1CYGA 1S78D 1EAPA 3IDIA 4KH2A 3SIKA 3UAJA 1AACA 3GBML 3ZMRA 5LUMA 2X1XR 4GB9A 4LSDA 1N4XH 2NSQA 5D1ZA 1EXUB 3M1BB 3OBAA 4QY8B 2ICWJ 4BQ8A 2WQ8A 2BNQD 1PDKA 2GK2A 3BIBX 3D18B 3HBQA 4EUPA 4NQEE 6PAZA 2W60B 1FL6A 2EDOA 1DO5A 4JKWA 3L8QA 4OZGF 2PMZA 1IE5A 1OHQA 5CGBA 3RWFA 5D4JA 3ULUF 5H35B 3D1MC 3FONA 3LHAA 3MBWA 2I60H 4FG6C 5EEYA 2JLPA 2X1OA 5D2LA 1ZLUK 1JWMA 3DSNB 5DHYB 4JY6B 4Z7OB 3IDYC 1QHPA 1Q9LA 2XFXB 4BFFA 3KW8A 2YA1A 1D7BA 2XVLA 2ZF8A 5I1DA 3OKNB 2CK0L 4NAQA 3EUDA 3QQ3B 3VRIA 3BYTA 1RZKL 2VITB 2ZSWA 2EYRB 3AXLA 3V4PH 3I6LD 1FSKB 3BUTA 4I13B 4Q8BA 4HPHA 3V7MA 4OV5A 3ZZSA 4PRPE 1QBLH 4U33A 3SGKC 1V7NH 4BFKA 1WVZA 4OZIA 1EXHA 5JQIB 1KBGH 4OLZL 1DQJA 1E6OH 3V0VB 5D7IF 4KTYA 2XSKA 4PWKA 4HJJH 1OAXH 2NW2A 1DVUA 4YWGL 3D39B 4WDIB 2YQBA 4WI0A 3NK3A 4XNBA 1JNHB 5I1CH 1WICA 4FQ1L 1NCIA 4I2XB 3SDYH 4XP4H 3L3OA 3UYOD 2OL3B 3NAAL 3FU7B 4G5ZL 2XWDA 1MCCA 3TFBA 1NGPL 3IFPB 2EZ0D 3AABA 3BGAA 3ZXAC 1OCRB 3MLWL 3V8OA 1W91A 3LH8A 5GS0D 4M61A 1KN4H 2IH1B 2OR8A 5D7EA 1ZWIA 1J10A 1HL9A 3FZUC 4R26H 2AITA 3UP6A 4GUPB 5C0CB 2AQNA 4W6WB 1RMFH 3RNQB 1A7OH 4MBRA 4TUUA 4JFXA 1U93A 1ZK9A 2GUYA 2P5WA 1UWEL 3FO2A 1XGPB 2GG1A 5F7EH 1T1ZA 2OSYA 1JSYA 2BX5A 4DTGH 5GGTA 1SXSA 3OLEA 4HYTB 1W0WB 1E9PA 2JXMB 4NQSB 3DDFA 2EE0A 1GZPB 2QVFB 1BFVH 1A7NH 1W0VA 2MCPH 4XCYB 4YDJA 3IDUA 4NN5C 1IO4C 3NJGA 3NIGE 4UU9A 2C3VA 4FZ8L 5F72S 2VIRB 4WUKH 4WK2B 4HLZG 5JMOC 4Y5VA 2UXTA 3L7FB 2ITDA 3FQUB 3NIDB 5FYJU 1A21A 2R4RH 3EYUL 2Y2YA 3HC3L 2CR6A 1M7DA 2WZ6A 3GMLB 4IRJA 4GXVL 3CSBA 3CZFB 5DMIL 5IJVA 2L04A 1I4FA 3FT3B 1MIEL 1OALA 1KTRL 1DQTA 2FIKB 2VR8A 2WYIA 4L3EA 1ZS8A 3NCJH 1XH3A 1Z5LB 3RIAF 1K5NB 3HI6L 1RURL 1HWGB 3AFLA 3IS1X 1PY9A 3O4LE 3KWWA 5FHAL 4F33B 4EN2A 1FFOA 2YRPA 2EDBA 4WSJA 4BM7A 3EFDH 1OOWA 4TNFA 3WAJA 4ZPTA 4PS4H 3ESPA 3VXQA 3ZRCC 5E6SB 1N64L 3HB3B 2XXMB 2NY6D 4TUKL 3MRFB 2WAHA 2Q8AH 4ZNEA 1JYNA 3T04D 5LXGH 1R6VA 1PX8A 4HUUA 5GRUH 5T3XL 1HYSD 2E8ZA 4KO9A 1ZIAA 3DVNB 4MQSB 3UEQA 4AV5A 2BWQA 2EIKB 5FK9B 3KJ6L 2D4DA 1W9XA 4LF3B 1TTGA 4I3RH 4WF7A 3GHEL 3K2UL 5HHMB 5GZOC 4FP8H 4ZMLA 4Y2OA 1I1CA 4Y4KD 1XF5B 1IT9H 3HR6A 2W8CA 3MRJA 2E75C 1F2XK 3L7EB 4K7FA 3VSVA 4BSVB 2Z8WC 2F8XC 2EDHA 4QRRD 1M4KA 1MZYA 5DJZA 5C3IA 2OK0L 2FEEI 2J12B 2AQ1A 1CFBA 5K39B 3QORC 1V5JA 5LGYA 2WWMC 3QT2A 2ZUWA 2WJ7A 2QQNH 3E8UH 2GVYA 2DIJA 4I1PA 4GRWH 1OP9A 4QWWC 3S3CB 4KVCH 1IGFH 4LCYB 5AAPA 1JYVA 4Z76B 1G0YR 1U92B 4CJ0A 4EZKA 5IJKC 4LL4A 3MZTA 1S8DA 1JV2B 5HYSB 1XCQA 1LWHA 2VDQL 1OGAB 7FABL 5KEZA 5MI0C 4LIQE 3IYLW 1QFOA 2VLKE 3EOAB 3HZVB 3SGJC 2ZUTA 4MNGB 3UJIL 1Q8MA 5GXBB 5ANMA 4HUXA 4NC2B 1AHMA 4KRPC 1Q0YH 1GGYA 3QQ9D 4XCNA 3HC4H 3SDCD 3NIGB 1XHHA 1FH5H 4K3GA 1EFXA 3CVHA 3CXDL 2K8QA 1SYSA 4KRNA 4OJCA 4DZBB 1P2CA 4QTHB 1NEZB 3TEWA 5SWZD 1T7XA 1GYWA 4AIXA 5IJCC 2NY2D 3FAWA 3MV7D 5D1QC 1OB1A 4K8RC 1SDAB 3TGXA 1YECH 3EHBC 4NERA 5H2BB 4N2IA 5D1XB 3TIDB 1OAZL 4UQ2B 1E90A 3M17A 2ICEA 4Y4FC 4J27A 4I3SH 2XTLA 2BFVH 1RZPA 4ORZC 4JCLA 4MX7A 2DF3A 3V6ZA 3VD2A 5EUOF 3IGLA 1D9KD 5C0CE 5FGCB 5AW0B 4PJ5E 1EAOA 3SEPA 2F74B 3TWYA 2IMNA 2DQCH 4B97A 3CSTA 1KXVC 4Z3JA 3CFKA 2FRGP 5DJCA 4LCWB 3RGVC 1AZBA 1IFRA 2BVUA 3OAUH 1SXAA 3PUUA 4Y9CA 3BW9B 3LZRA 5CNHA 4B9IA 3TBSB 5C0BA 3F12B 1QPKA 1IC1A 2EECA 3RIKA 2ZKHH 1JGEA 2COVD 4K2UL 2GB2A 3OHXC 2F18A 3L3IA 5DK0A 3L3IB 5DK0B 1F90L 3QUKB 3MTRA 4ODSH 5CMAA 2HLEB 2Y1YA 4K3EH 3T0VA 3ZT7A 5A2BA 1P0SE 4NAMA 4QLWA 1GMIA 3ZKMD 2AQ3A 1UZ6E 2FGZA 1JGLH 3WKYA 4ZXBA 2E9JA 1UYWL 2GPZA 4N86A 4S0HA 5ALCL 4AJVA 1IEBA 1A6TB 1KGUA 3M86A 2XPYA 1MCSA 3MLUL 1P5VA 1HL5A 1AGFA 5I19L 3RDTA 3WXWL 3MBEC 3BD5A 4KOBA 1I9JL 4B0MB 1U3NA 5KYXA 1RZ7L 2R1YB 3EUUA 3RB5A 2GK0B 2OMZB 4PRNA 4HUVB 1NFIB 4L3ED 1FVEB 3RWHA 2FLMA 3IM1A 3DBXB 4N8UA 2CG9X 3SYOA 4QHUB 3N85H 3PJLA 3V5HA 1CPUA 2CCLA 2IV9A 5JOPD 1DLHB 3MPCA 4O02L 3GRWA 5GISL 3QFJE 4FFWC 4NPJA 3DOIA 5T1LB 4HIHB 5BJTB 4HHAB 3ZR6A 1UUSA 2CD0A 3KGTA 1DTUA 3LRHA 5FB8A 3S36L 1NCHA 1TQSA 2FT8A 2I5YH 4JB9L 1HC1A 3PV7A 3VXMB 4WEUD 3PY9A 2DKMA 1N6QL 1M9SA 1V27A 5E1IA 5HHQB 5IBTH 1RIVL 4NN5B 4FFYL 4GG8B 5GSVA 1LE5A 2JV6A 3WIAA 4P4KD 2AI0L 3LZFL 5KYUA 1M42A 5KVFH 3SKJL 2F15A 2Z8SA 1KLUB 3EF4A 4DQAA 5EC2A 3MLSH 4A67A 2YQ2A 4D2NA 5CINH 3BRDA 2HVKB 1TQCC 2HG5A 3O2DA 2Y36L 4E5XB 1BFOB 5DZJA 2E76C 3WKPA 5F96L 5BMFH 1MCLA 1PZ3A 3DUUA 3IFNH 4Q89A 3V9FA 2DMCA 1MHCB 5E6ID 4H26A 1I9IL 1LILA 4MYWB 1JNNH 4I4WA 1OP5H 1T6WA 3MRLA 1IC7L 5EU6E 2WBKA 1UFUA 2GTWB 1BQHB 1LP9B 3CCHB 2H7WA 4Z3GA 1J9RA 4O2EB 4X4XA 4F8LA 2X87A 3WNLA 2QSTA 5HYQB 4NKOA 3VFMA 1BAFL 3NIFB 4MHHG 3T4AA 3MRFA 4X7TB 4DKDC 4RFOL 1SEBB 3BMWA 4ODHL 2V8LA 4BUHA 3UTQA 2EACA 3FKUS 3FTGB 3KGUA 1JK8B 4B41A 2E56A 4UTBH 2ADJA 3T2NH 4L1BA 3V0DA 5F7HA 1KCUL 2I07A 1WUNT 3A67L 5EU6B 3RZCB 3WTWA 5EEWA 3KJ4C 2QVKA 4L3EB 3TVMA 2X7LB 2W38A 4TTGA 2Q86A 3BGFC 5KAQG 4LLMB 3BVNB 1FG2A 2YMXH 1WD9A 1FZJB 2XV2A 1NC2A 2D4FA 2ENJA 3M6DA 5C3TA 3OTTA 2G60H 4TUJB 1EJOH 1T1ZB 3X12A 4LESA 3R8BB 4NFDA 1THCA 3LNFA 2CLVB 1WZMA 5AAMA 3I6GB 3QORD 2HLAB 3DX7B 2JNZA 5DYOA 3NCXA 2H8PA 1SJMA 4S1SH 2IGTA 3FO0L 4BDVB 3TNMA 1IBZA 5IUCA 1ED3B 1N2RB 3OKMA 2CO7B 4TSBL 4FNLH 3VXME 4PJGF 3PFQA 4A7GF 4NM4L 4XC1L 1PVHA 2AK4E 3AADB 4JO1L 2DAVA 4GFXA 3NSYA 3B7YA 3T3MB 3TZVD 4ZPTB 3ES6B 4NN6C 4UQAA 3UDWA 5DD0H 4Q6IC 2X1QA 4WI0B 2QL1A 4KRPD 1T2QH 3QZNA 5B38B 3AC0A 2Y7OA 1ZWIB 4X42A 2X3CA 4QRPD 1R1CA 3VWJC 4P9ML 5BV7B 3Q1SL 4MD0A 1WIUA 1ZJAA 3PP4L 1WZLA 4JVWA 4GXUN 2AW2A 1V3KA 2XC8A 5E9AA 1G6VK 5CKGA 4Z1PA 1RULL 2WANA 1NAKH 1A14L 4PJ9A 3W56A 1X5GA 2XVKA 3D50A 4N24A 2B1AH 4CGTA 2EDRA 3G3LA 2GI7A 3LHPH 4WFHE 4IKJA 5FWQA 4BFRA 2R7EB 3US0A 2MKLC 5IMLA 2GIMA 3EO1A 3FRPA 2VJ0A 4U6XA 4U6YB 1MQKH 5F1NB 4P5MA 4Y4FB 3QB7C 3GMPA 1OAYH 4OZHE 2A38A 2FX7H 4UU9B 4LE8A 5JXEA 3OAZH 4YSUA 2V3DA 5AEAA 4ZQKA 3FU6A 1T22A 1U9KA 2TRYA 2A9NL 2X2UA 4KAQH 4JFDA 1DQQB 4QTFA 2YOCA 1U4EA 2MOGA 1G7JA 2HSIA 2BRRH 2R2EB 3MNDA 4ANUA 1AJ7L 5AVQB 5AUMA 1JGDA 3E6HB 4DT2A 4A7GA 4WEBL 4ZG1A 3FULA 3RJDA 2VAJA 4TUOA 4TLTA 3AMLA 1A6UL 4W81A 3UZVA 5CZKA 5CBAB 4G82A 1A4KA 1X4XA 4LLVA 1KJ2H 4XAKD 3DV4A 3P4NB 4QXGH 2YPVA 3SYQA 5MERB 5TDNA 3VQLA 1LO2H 1MFDL 2C7UA 3BAEL 2BNRE 4OD1H 4PJ8C 3SPHA 4C58B 2OMWB 3MBXL 2X4UA 4HT1H 4HWBA 4IRSD 3VM5A 1H19A 4DH2A 5GHWL 2PPDA 4HZAA 4JG5A 3U0WH 5F7MC 3WAKA 1MCKA 5C1MB 2M83A 3MCKB 2I27N 1Q9OA 2ROYA 4Z7NB 1P4LB 2X0VA 1BD2E 1SN5A 2GC4C 2R29H 2Z3FA 3K6NA 2ATAA 2FJFA 3QG7L 2KQMA 4RMWA 4D8PB 2DBLL 4YBLB 1F6AB 4URTB 1XL4A 1F1DA 1RUAH 3OPZL 1G1YA 3ZL2A 5IGXL 4M8VA 3GLDA 1FRGH 4GKNB 5DCCA 2VDKL 2ZOKB 3KPMA 4C56E 3C9NA 4YE0A 2R0LL 4YS4A 1YEFL 3GMQA 5I0YA 3BFOA 1NJ9B 5F3HA 3AS0A 3FO1B 3FDWA 3DXAA 4AXWB 3S4SB 1OAKL 2NY4D 4PJEE 2C1OA 1L0XA 3X1EA 3LJ3A 2X2IA 5JA9A 3QAQA 4MTMA 2P43B 4FFZH 2NY0B 1UM5L 1KEGL 3HAEB 2K78A 4HH9B 5INDA 2XZCL 2BVOA 2F7RA 1A7QH 5ANME 1AZCA 5CN1A 4RDQF 3D6GA 3GKWH 2CUIA 4PREB 1T2XA 3X14A 4XMWA 3EHBD 3ME0B 1U3JA 1BMGA 1GYAA 3JVGA 1WBZA 1D6VL 1Y1DA 1YEHH 4JO8A 3QG6B 1QLEH 5GS1A 5HYFA 4ZYKB 1ETZB 4I18B 1J8RA 6FABH 2PLTA 2R1WA 1FYTE 4WWID 3O6FD 5KTEL 3SDXA 2QQLL 3O4OC 3Q44A 1LEGA 4TF4A 1ZTXH 2WVVB 5DRZB 2ERJC 2X4NA 4A7UA 4GO8A 3UCQA 2NLJA 1N8OE 1PG7H 4GP5B 1QR4A 4KJYB 3OXSA 1SFDA 2GHWB 1GGUA 3BPCB 4M6OH 5F70A 1KZYA 4UQ3B 4PW9A 4UV7L 5C7XH 2EUXA 1UA3A 3ROOB 3ME0A 3S5LG 1AI1H 4Q6IA 3T2QA 3VNZA 4DESA 1W0YT 3RU8H 4CN1A 3R7QA 1QR1B 1O6SA 2MIZA 2EIMB 4XNZB 4XMVA 2H45A 1F4YH 4HCGA 4PJ9D 4NJAL 2VSMB 1E7VA 5D1XE 1JMZA 3GB7A 4FNSA 5SWSB 4ZD3H 2EYTB 3GZPA 4DN4H 1IUZA 5FOBA 1MELA 2ICWI 3NJVA 5LO7A 1M9WA 4A2LA 1VGKA 5IIEB 3I9PA 2F5BL 2OMYA 3GZOA 4FQIL 4HHGA 4JE0A 4EI5B 2QFRA 3IDGA 2UY7B 3P9WB 2JB6B 1C5DA 2JB6A 4KXZI 1T6BX 5DJ0B 5KANI 5K1VA 1SF3A 1SJEA 3OR7B 2G3MA 2NMSA 2ESVA 3AQYA 3M45A 1PKQE 4NUQA 3GMQB 1R3KA 3U1QA 4AYGA 4F91B 3NCFB 3QPKA 4XP9H 2NXZC 2NZ9D 4N90D 2A77L 5PCYA 4MNGE 4NSKB 5IMOA 4YR6B 4PW3A 2WHVA 2Z4QA 4JHWL 2VZ3A 3VFOA 1YNTA 1FO0A 3IJSA 1ETB1 1NDMB 1OF2B 3QC6X 1XD1A 3GRWL 4KY1L 2A6DA 2H32A 1BD2D 3UAJC 2IAAC 4HJEA 5DF0A 5HDLA 4LRIC 4D9RD 1YNLL 4HJ0C 4OT1H 1MLCA 4FI7A 2VDLB 3IPEA 4W9ZA 2JKIS 4V1DE 4BXVA 1SHSA 2AFNA 2NY4B 2WXFA 4OKVA 5DD5H 4AW7A 1AGBB 1B4JL 3GXUB 3HI5H 2YWYA 2KDGA 1FYTB 5DR5H 5DD6A 1NSNH 3CAFA 2YFNA 5C8JB 3OGOE 4ZUWB 3NDZE 4HKXA 4HUNB 1T0MA 5D2NB 1ZGLM 2C3GA 5EF0A 2YAHA 1K2DB 5IFAH 2Z31B 2DDQH 3GS0A 2AJXL 4WEEA 3K8LA 1CURA 3BAIA 5HY9A 1ND0B 3ISWA 1MWAL 1Q72H 4P4KA 1J0YA 4UF7C 4JZOA 5HHVH 3A47A 5E6IC 4ALAH 4HH8A 2DLEA 2IC2A 3E9TA 1IM3D 1YAZA 3OZLA 3MXWH 4U1HA 1UT1A 1S6NA 2NW3B 3CFUA 3V7AE 3ILEA 1GS8A 2F54A 1MFEL 4MJ5A 1AGCB 1KIPB 4FFYA 3RWEB 1OHZA 1Y0LA 4WI9A 3EBHA 2J1KA 3FXIC 1OD9A 4LCIH 4P5MB 2XWTA 4Z7OE 2KI6A 4P2RE 3FU9A 5IMLB 5HGHB 2BS9A 1H3XA 2PABA 3AT9A 5FV2A 4P23D 2W07A 4PJEB 1P7QB 2BSTA 4OD3H 4UZSA 5DUML 1ZE3C 2G3XA 3BKMH 4YHIA 1NMCB 3AY2A 5TQ0L 5KVDH 4OZHA 4UI2A 2XNAB 1FNEA 4PJ8D 5JW5B 1T04A 1VAHA 4N2KA 3FPYA 2OTUA 4YDKH 3L5WB 1SN0A 3L2LA 4GKNA 2AEQH 1OO2A 4NBZB 1U8JA 3TM6A 1LK3L 2QPSA 3A24A 1HZHH 5LAXA 2RR3A 1KPRA 4AYSA 1NLBL 3PLYA 3B8YA 2E6JA 3ZR5A 3RGBA 3WLBA 5LCVA 4FXGC 1ACXA 4HBCL 1LDSA 5HDOA 3U9WA 1Z1WA 1NA8A 1YPZA 3G6DH 2CR0A 1AMYA 3U46A 5DSCA 2XHNA 5GRJL 5IB3B 5AZEL 5BRZB 5IB3A 2XG5B 3BKJH 3PWPA 2X9ZA 3KPOB 3KPRA 1HHKB 4L29A 2COQA 4RESB 4TPRL 4XP6H 4OTXL 2ROXA 4NJ9L 2VLJB 4QKXB 1NEUA 1RU9H 5E5MA 5IROD 4JFTA 1ED3A 1N2RA 3CPLB 3L3GA 2F08A 3UAFA 5EHFA 2OTUB 5G4MA 3NZUA 4I5BB 4JRYB 2Q6WB 4NUPA 4JO4H 5HHNB 3HLAB 4QRUB 4ZFOL 1G9NC 1DLFH 2XZQH 2Q3XA 1DL7L 3GYRA 3UGXA 3T2PA 1S7VA 1NMAH 4XXCC 3GUTB 1Z0MA 4U1JB 3VVWA 1EMTH 4TUJA 2HX7A 5I8EA 4BQBA 2GIXA 4PJAF 3LDBB 4ES8A 3GEWB 2VLJD 3E1F1 2EVFA 1YNTF 4AL8H 1QEWA 4LLMA 3VH8A 3VFUA 3LXAA 4FC3E 4XPHL 1JE6A 2A1WH 2AJZA 5TK4A 2AJZB 2EDNA 3KLLA 3UEZA 3U0PA 3G9VA 5L8LB 4ODTH 3EBAA 5FO7B 3ULAB 3ZRSA 3CX5K 4HPYH 3AJ7A 5FDWA 4F7MA 4GQPH 2NX5D 2PXYD 5I0DA 2VO5A 2O6EA 2X1WL 3FRPG 3OLIA 1E6OL 3EDKA 3QYCA 4JJOA 5A7BA 4P07A 3KXFD 2FL5A 4RMVA 3QIWA 1A6ZA 4QRPA 4PGEA 4B95C 2WUBL 4AM0A 1KGYE 2K4AA 4GKSA 2MTAA 5FA3A 4QHLB 2Z7ZA 5EOQH 2IGLA 4Y2LA 5ADPL 1INDH 1H8LA 3K4ZA 2P9RA 3F7PC 1JTOA 1YMHB 3AQZA 1OOAA 4PGCB 4RGND 3DSFH 2UZYB 4M7LL 1MI5A 3RWJA 1CGXA 3O45A 3WFBL 2CO3A 3CLWA 3L9BA 3MLWH 5EA0L 3KLHD 3F6JA 4CADA 1CE1L 1DVXA 1KN4L 3VAEA 2FT6A 3CFCH 4XMPL 3QYNA 4UOJA 1WT5C 1VACB 1CT8B 4ZX6A 2IWKA 4L4TA 3ESUF 5C0DB 1OF2A 1G7MB 5LXVA 1G9MC 5K1NA 1U8LA 3GTNA 32C2A 4CSPA 4X6FA 1KTBA 4S1DC 5F7EL 3WJJA 2IDTA 2CO7A 4P9HL 1IGJA 3MLRL 5AVVB 3F7VB 4H8UA 1NDGB 4G8IA 4KFMA 3VDAA 3SGDH 2XDHA 2NNCA 3ILPA 1KT2A 3RPBA 5BQ7B 4M6MH 3VJ6B 5ICXB 4OH2A 2BIHA 3NJMA 5D7IA 2PP8A 3BOVA 2FEJA 3G6JF 4ZJ9A 2VL5A 4GEIA 2F58H 3C2SA 5BXFB 3X12B 4P49A 3RL2A 4W68A 1ZVSA 4X4MA 4L8BB 4M1DL 3J7HA 5C0IB 3BO8B 3MOBH 4QCIB 4Y16D 3THMH 2MOQA 2J5LC 4HIQA 3RWEA 3VXSB 3MUGB 1MCOH 3MNWA 5T1KD 4QAWA 5CJOL 1SXBA 3C5ZB 3MACH 1NGYB 4L4VE 3V9EA 1ZDQA 4NZJA 2VDOH 5DRWA 3FF8A 5MP6H 2HG0A 9PCYA 4NN7C 3ZE0B 2R1YA 3HHSB 2VQUA 3KJ4B 4UT6L 3CJJA 4KXBA 4X6CF 1ZY9A 4MNQA 2YRLA 1A1OB 2QGCA 1AHWC 2BY3A 4WU5A 3T4AB 1Q9WB 2G5BB 4HXAH 2X09A 4MLSA 4ZUWA 4I5BA 4IRZL 5EIIA 5DJXB 1PKOA 4BA8A 1N18A 1XGQA 5ISZD 1CR9H 1NBVL 4XBEL 2X4PA 4J3OH 4LZKA 2IDFA 3PWPD 3TA3D 2AJYH 3MRBA 1KJ3H 3PWNA 1DN2A 4ZX4A 4JFEA 5BCAA 4I77L 1G6RA 3CQPA 4H26B 1S7UA 2XQBL 1GY1A 3L1GA 4OU3A 3F3HA 3SCMC 2CDFB 1ZA6B 4P2OC 3SDXE 2E3VA 1AG6A 4Y4HD 1CLYH 3LN4A 3X14B 2D03L 4YQXL 2X70B 4FJZA 3RAJL 4JO2L 2QGDA 3DX9A 4M6NH 4U4IA 3VDCA 2FWSA 1ORQA 2YA2A 3B3BA 1URZA 2XXGA 3UTSE 1JI1A 3VD1A 1ZHNA 1YNKH 1XGRA 3H8NA 4HKBA 1NEZG 4W9KC 3SQOL 1CXFA 1NCAH 2XA8L 3CVHH 4IDJH 2VXQL 1PZ5A 4UAOB 3SY0A 3NQIA 2IO5A 2UYLA 4RIRB 3UG5A 3QDMA 4N68A 3I6KB 3TXAA 3G04A 3VFNB 4UINL 1U3HD 5ESAB 4YMPA 3IJHB 4AEHH 1JRHL 3LMJL 5F3HB 4PR5A 5FYKE 3PQYA 1BQLH 3OG4B 1JWSA 4ZSOE 3VGAC 5FHBH 2EQDA 4YLBA 1G9MH 4POYA 4KPHH 2RQ8A 3GXDA 2VLKA 4Q74A 4JFYA 2ZOKA 3KLAA 5J13C 1NIAA 2FQFA 3MUHL 5A2LH 3VNYA 5CEXB 1PL3A 5M7QA 2Q10A 2B59B 1XMEB 2P8MB 5AL0A 3ZK0A 3MRNB 4KHXL 1UB6A 2GK0A 3OJVC 4XWGH 4XI5D 3SKOA 5F3FA 5EEXA 1QW8A 5FYLL 1HHJA 1V7ML 2JK5A 4JKPL 1ANUA 2FJFB 3TH4T 4WFGD 1QUPA 5F1IB 4BBWA 4DGWC 2QADC