2IDQA

Structure of m98a mutant of amicyanin, cu(ii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFARGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Generation of Novel Copper Sites by Mutation of the Axial Ligand of Amicyanin. Atomic Resolution Structures and Spectroscopic Properties
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idqA00
3ASNB 1J5CA 1NZRA 1PLCA 2PP7A 4JHVA 3NSYA 1GS7A 1AS8A 1NICA 2FT6A 3FSZA 5B7MA 2BZ7A 1MZYA 2EIJB 3AW5A 2BO0A 2YXWA 1BQ5A 3ZIYA 2IAAC 2IDQA 3QJQB 2IDSA 4GP4B 1AZBA 4W9ZA 3IN2A 2AFNA 2JXMA 5LDUA 2IH8A 2YQBA 2W88A 4G7RB 2Y69B 3FQ2A 5I6KA 2CJ3A 4E9TA 2FT7A 2X88A 4A2DA 2DY2A 4ZK8A 3NP3A 1RZQA 3BVDB 3CVDA 2BW4A 3AG4B 3X1NA 1X9UA 5D4HA 4GP8B 1E5YA 1V10A 2CBPA 1A3ZA 2FQEA 4BXSV 4E9XA 3H56A 1OCCB 4HHGA 3ZX1A 1IKOP 4BWTA 2GB2A 3MBWB 3FYEB 4DPAX 2P80A 3ABGA 3PXLA 4HZ1A 2HX8A 3AY2A 4GP5B 4FA7B 2X87A 4M3HA 3NJMA 1AZCA 2GBAA 3NJHA 2YAFA 5PAZA 2XX0A 4AZUA 1W6WA 1PNCA 1TEGA 2FQDA 3NSCA 5I6OA 3IBOA 3CDZA 4KO6A 1WA0X 9PCYA 4HALA 4KNTA 4YVNA 3UGEA 3DTUB 2QDWA 4AX3A 4G7QB 3FSWA 5TK4A 1PZCA 2XV0A 2XX1A 2GI0A 2I7OA 3WG7B 2VM4A 2CAKA 2XLLA 2J56A 1JXDA 5I5MA 1NPJA 4E9SA 1TU2A 2BWDA 3NJFA 2WO2B 2VN3A 3ASOB 3TBBA 4A2GA 3X2QB 3QJUB 5FC9A 2CCWA 2HX9A 3T6VA 2AZAA 2VSMB 3FQYA 5B1JC 2HXAA 1L9RA 1W8EA 1IC0A 4KNSA 1ET8A 1NPNA 3U25A 2OCCB 2IWKA 1GS8A 2BZCA 1NIEA 1HFUA 2XUWA 5I26A 5B1JA 1KDIA 1PLBA 3EH4B 3D12B 4MFHA 3TA4D 3FSAA 4UF7C 5B1KA 1JZGA 4UANA 4YSPA 2PCYA 2VW4A 3EH5B 2VMJA 3T6ZA 3FU9A 1OE3A 1RZPA 4A2FA 4AKOA 4DP7X 4A2EA 4E9WA 2GC7C 4YSDA 2FQGA 2PCFA 3X1EA 2HLEB 3L45A 2XYBA 4FAAB 4E9QA 3FU7A 2HX7A 5I6MA 3PAUA 2GSMB 1KV7A 4ENZA 1JZIA 2FJSA 3NJLA 3H4FA 3T71A 1OE2A 4BDVA 6PCYA 2ZONA 4P5RA 1SF3A 3HB3B 4RH4A 5D4JA 3V9EA 1BEXA 2H3XC 5I6NA 3QJVB 1OF0A 2Q5BA 1PAZA 2EIMB 4DPCX 3OM3B 3WI9A 4Q89A 4Q8BA 3IEAA 1XB8A 3SQRA 3TU6A 1PZBA 3FS9A 1AIZA 2OV0A 1R1CA 2XU9A 4N4YB 3SBQA 1DYZA 1HAUA 1WA2X 1AOZA 3NSDA 2ZWNA 1JZEA 4L0PB 4UAHA 2JFCA 2RACA 2PPCA 4G71B 4BK5C 1JZJA 4PCYA 1GSKA 1BQRA 2LLNA 5EHFA 2BWIA 4HCIA 2B08A 3BQVA 2VM3A 1L9QA 4QLWA 1NINA 2Q9OA 2EILB 4CSPA 3HEIB 4YSAA 3H4HA 2YAMA 4DP8X 5B7FA 2IDFA 3AG1B 3CVBA 2BW5A 1OOWA 2QT6A 1J5DA 1L9PA 2BP8B 1FA4A 1JZFA 2IWEA 3T6XA 3PAVA 1BYOA 4HCGA 3EHBB 4PAZA 1CURA 2MTAA 3JTBA 5AFAA 3FYIB 2XWZA 4QKTA 2P80D 2R7EB 2AZUA 2J55A 2XVBA 1NDTA 6PAZA 2UXFA 1SJMA 3OMAB 4YSOA 5I6LA 2TSBA 3QJTB 3PPSA 1JXGA 1GYCA 1AZRA 1NWPA 3FSVA 4A2HA 1PF3A 3PCYA 1KBWA 2DYRB 3UAEA 2VW6A 4YSRA 4DP6X 2XXGA 2J5WA 1A8ZA 2A3TA 3X1BA 2I7SA 1EHKB 5PCYA 1A4CA 1ZDQA 2DYSB 4DP0X 5B1AB 4HAKA 2FT8A 3CVCA 3WIAA 1JXFA 3NJGA 2UX6A 1AANA 1SDDA 4KO7A 1GW0A 3FPXA 1OCOB 3OD3A 3S3CB 4JHUA 1QHQA 4BWWA 1XB6A 2IDUA 1HAWA 7PCYA 3T9WA 4E9YA 4F7KA 1NIDA 4YSEA 1L9OA 1ILUA 1ET7A 3X1GA 8PAZA 1AG6A 3GYRA 2PP8A 3QJSB 4JKNA 3WKQA 3ZBMA 5E9NA 3FPYA 3UABA 2WO3B 1J9SA 5B7EA 1WS7A 3ZDWA 1CC3A 2BP0B 1E5ZA 1JVOA 3S8FB 4K9JA 4F2EA 2FWLB 3FQ1A 3DIVA 4P5SA 1V54B 1BQKA 4KOBA 4YSUA 1FWXA 1AQ8A 1ASQA 2YAQA 2DWSA 2HRGA 3JT2A 1GY1A 1NWOA 1CYXA 2XV2A 1CYWA 2Y1AA 2W8CA 4DPBX 2PPFA 4NAJA 3S3BB 4KOCA 2XXFA 5B3SB 1BAWA 1SHWA 1SNRA 2PPEA 1NIAA 1WAEA 1PLAA 4E9VA 1DZ0A 2FQFA 4GYBA 3NJNA 5AZUA 1ETJA 4G7SB 3NT0A 4AKPA 1ID2A 2GC4C 1AS7A 4N8UA 2OJ1A 1OCZB 2VW7A 1KCWA 3GDCA 4WKXA 5A7EA 4KO5A 4W1TA 2CALA 1A4AA 5B1BB 3CZUB 2PPDA 2PPAA 2UX7A 4A66A 1PZAA 4BWUA 2ZXWB 4WTQA 2EIKB 1CUOA 1ZIAA 1XMEB 1BXUA 5F7BA 2UXVA 4A67A 1GS6X 4DP1X 1KYAA 3WNJA 3PLYA 3FT0A 2YAOA 3MX0B 1IBZA 2YXVA 3OMNB 3QPKA 3WKPA 3NJKA 4F2FA 1ZPUA 1AZNA 3EF4A 3AZUA 4DP4X 4TXVB 1E30A 1OCRB 1X9RA 2E86A 4G72B 3T6WA 4E9RA 3TBCA 4DP2X 3CDZB 1BXVA 5I6PA 1PCSA 4KO9A 3N55A 3NSFA 2BP8A 3S8GB 1SHXA 3ABKB 3UAAA 3RYMA 4X4KA 3IE9A 2I85A 5D4IA 3CG8A 3C75A 1NIFA 1KBVA 2YAHA 1ZDSA 2R7EA 1ADWA 4AKQA 1OE1A 1W6LA 3UADA 3EH3B 1B3IA 4HCFA 3X1FA 4NERA 1QNIA 3G5WA 2B3IA 2NRDA 1AACA 1FFTB 5AKRA 1J9QA 4DP5X 4HIPA 2HZHA 1BXAA 1TKWA 1JERA 2UXGA 1SFDA 1SDDB 1M9WA 2QPEB 2UXTA 3IN0A 1JVLA 1M57B 5IY5B 2HRHA 1JZHA 4KNUA 2ZOOA 1PMYA 2WSDA 1IUZA 3PAZA 1ZIBA 2FTAA 2H5UA 1J9RA 4CSZA 4DP9X 3KW8A 1A4BA 1AAJA 1MDAA 3NYKA 3ERXA 1NTDA 1E67A 1VLXA 3S3DB 3UACA 2TSAA 2IWFA 4HHWA 3OQRA 2YARA 4BXVA 5TK2A 1J9TA 4AI7A 1N68A 1N70A 4A68A 2PP9A 1KGYE 1ASPA 5I28A 2FNWA 2GIMA 2VSKB 1YLBB 2JKWA 3NP4A 1WA1X 1L9SA 4GY4A 1GY2A 1NIBA 3DKHA 5F7AA 2H47C 4YSQA 1TEFA 1XB3A 2AVFA 1T5KA 2DV6A 4G70B 3WNIA 1AZUA 1M56B 4YVUA 3TASA 1EZLA 4YSTA 3SBRA 1L9TA 4GXFA 1WS8A 2XV3A 1F56A 2IDTA 1KCBA 3FU7B 1ILSA 4YSCA 3V9CA 3N2JA 4BDVB 1A65A 5ANHA 2DWTA 1QLEB 3AG3B 3NJJA 2BP0A 1ET5A 2N0MA 2EINB 1MG2C 2QDVA 3SBPA 2YAEA 1SF5A 3NJIA 3KW7A 1RKRA 1IBYA 2PLTA 1URIA 5I5JA 2MRYA 1JOIA 1MG3C 2IH9A 1AG0A 1I53A 1E65A 3GXUB 3OMIB 3QJRB 4M4RB 2YAPA 3QQXA 1ZV2A 4YL4A 1ASOA 1PY0A 2J57A 2BHFA 1GR7A 3AG2B 1AS6A 1AR1B 2CUAA 4YSSA 2AANA 2QPDB 3FU8A 4EF3A 1MZZA 1KDJA 1V55B 3ABMB 1UATA 4NB7A 1OV8A 1SFHA 2GHZA 3ABLB 1RCYA 7PAZA 1PNDA 5I5IA 1BYPA
chains in the Genus database with same CATH superfamily
1KT2A 4PRBA 3WGUB 3VMPA 2X7LA 3EOBB 3BRFA 3QDMB 5ERWA 1AHKA 4MA8L 1S7VB 4U1MA 5HP5A 3NN8A 4MJ5A 4XXDA 1MI5A 5T5NF 3DV6A 4B9KC 2EXYC 4BCXA 1IMHC 1U8NB 4K5LA 4LKCB 2IH8A 5KYWB 1YRKA 4JREB 4XMLH 1BXXA 3HRZC 2H3NA 1I8LC 1C12B 5GRUH 3QWQB 3G08A 3TT3L 3OB0K 4IHOA 3ELAT 3QUYB 3SYPA 4RETB 2W9LA 5TH2A 1IGFH 3LZFL 2E9JA 1DBKH 3P73A 1W16A 4I18A 4JDTH 5D7IB 3K81A 1UB6A 1HWHB 2UY6B 3MX0A 5HYIA 2ED8A 5AW7B 2HRPL 1EEYB 2YUXA 2DDQH 3MTRA 3UAJC 3JWOH 1G7PA 3IKKA 2W0KA 1K72A 3PXLA 4FOMA 2ZUTA 5KVFL 4AM0Q 1U8MB 4NBXB 5EB9A 4FJ6A 4XI5C 3MROB 4PW9A 4E0RB 2CBMA 3AB0B 4G6AD 4UU9B 1W6WA 3MV8A 2M2DA 2Y7MA 4Q6IA 1FCCA 3Q13A 2WLJA 2AV7A 3VCLB 9PCYA 2ATPA 1OHZA 3D0VB 2C4FT 4QEGA 4JFXA 4QCIA 2NUTA 2XX1A 3C5JA 3GB7B 3N5AA 3D39E 2K7PA 5I1EH 2CAKA 1IJ9A 4M5YH 3RA7H 4MDRA 1A6UH 3FB5B 3N1GC 3DTXA 3ALWA 3O2VH 4XMLL 1N8ZA 3QFDA 5GRUL 1M1SA 2BRQA 2WZ0A 1G6VK 3ALPA 5JLZB 4I2XB 1PZ5A 3HTLX 4E68A 5SV3A 4FQ1H 3RP1A 2CHWA 5K59E 3OKKA 1Q9LB 5DUBB 1I8KB 1IGFL 2HFEB 3NFNB 1TQWA 1AI1H 3DGGB 2XTJC 4B7IA 3Q43A 4K71C 4JDTL 1RFDH 2VABA 2IWKA 4W9KC 3PP4H 4MDJA 4Y2DA 4Z3TA 2H45A 3QFJB 4MCNA 4OAWA 5CFHA 3MFFB 2DDQL 4DGVH 3QEUA 3JWOL 4PJ9A 4UUJA 3V0IA 4UT7H 3EGDA 3T0AA 3VFPB 5GS1B 5IOKA 3QS3A 3GSQA 1IFRA 1SY6A 2X89A 2NXZD 2X12A 5M94B 4JY5H 4HMEA 2UZPA 5DHEA 2WNXA 7TAAA 2NR6D 1AD9A 1FJ1A 4JL2A 1UH3A 1I9EA 4KKNA 5AD0A 4HS3B 4F2MA 4DJMA 3H9SB 3ZUCA 5DMKB 2KZWA 3ENEA 3GSNH 1Z5HA 3H4FA 3N40P 4PJIF 3BIKA 4YXKL 1LQBC 5I1EL 3V5DA 3KPRE 3C5SB 3T8XB 1A6UL 4P5TD 3O2VL 4UT6H 5DR5L 1ZA3B 1LO5A 3KLLA 1PFCA 2B20A 1P5UC 4PRIB 3FRUB 1SDYA 3SDAC 1R1CA 3FH8A 4FQ1L 4ZFZB 1PKQE 4ICXA 2J1KA 3TO4A 3UP1A 3V4PA 1VDGA 1AI1L 4IMKC 4J12A 2QQNH 1HOEA 4M1CC 4G71B 2NMSA 3SY0B 3V0VB 4BK5C 1RFDL 5BMFH 3PP4L 1MRFH 4GLRH 1I7TA 5DJXA 3O9WA 4DGVL 2F7PA 5IHZA 1AE6H 1FH2A 1TPXB 4U6YA 4UT7L 1BVLA 5DFTA 2UYLA 4AEHH 3GLAA 1SLVA 5JIMA 1FN4B 4YSAA 5FW8A 3H9ZA 4FJZA 2MCG1 3M88A 5ICYA 2PWFA 4KNQA 1E42A 1FNGA 4CDHA 1E9PA 4JY5L 5D2LE 3CVBA 3B7SA 3STZB 2D3NA 5GRVK 4F5CA 5CGYC 5DQDH 2I9TA 3EJSA 3SZ6A 5ES4B 2BP8B 4N6RA 3RIAF 1RK1A 3V8CA 2JSFA 1QABA 3KLAB 3HKZA 1SMDA 2Y6TE 3QH3A 4R97C 2YBRB 1UURA 1ZTMA 4ZNEA 2A9BA 1YEDA 1ZT1A 1NDTA 3GSNL 4JM2D 1OT1A 4LF3A 3US9A 1H3TA 4KVCH 1QTSA 4Y1AA 1QRKA 1JZ5A 3LNEA 3E38A 5E9AA 3CN3A 3FSVA 3GS7A 3PCYA 4UT6L 3KGTA 1TTFA 2NZ9C 2E47A 4U1NA 4OU3A 3H3PH 3HPJA 1Q9KA 4OFKA 1NDMB 4ODVH 3MBWA 5DMJB 2XXGA 5CGBA 1FFOB 3NFSH 4S2SB 2ZG1A 4C4BA 1AMXA 2J73A 3TYFB 1I75A 3H9YA 4BELD 3WHE0 4WI8A 2ICES 3LAFA 2ZWSA 4NRYB 4ZUWA 3ZHDA 1JZ3A 2QQNL 3IXTA 3OTTA 1LK3L 2FT8A 1E9QA 4WI0B 5BMFL 4PB0H 2QVTA 1YNKH 3DPDA 5EDXA 1OD7A 2R27A 3H2WA 1SN5A 2JIXA 1AE6L 2X2UA 4HS8L 4M8UA 3EJZD 4WSJA 5EU4A 3KL0A 4Y2DC 4AEHL 1MAMH 1QSFD 2NLJB 1HSAB 3ARWA 3HHMA 2DKUA 3O3UN 3VI4A 3HNSH 3LKOA 5TD4A 4XWOD 5JQ6H 3EXJA 1MH5B 1SUHA 1IJNA 3PWPD 1DN0A 4HU2A 5C0EB 3EW3B 5EBWB 3W82A 1CXKA 1K4DB 1ILUA 4XN8A 3QEGL 3ROLA 1KELL 2EE6A 1WIOA 1KJ2A 3FPYA 4PPTA 3BCFA 4FFTA 1RI8A 3IT8D 3VRJA 1B0GB 5F89B 1U8PA 3QORA 1Z6JT 1J9SA 2GJZB 4KVCL 1MCJA 3KWXA 1KFGA 4PJ6A 4Z18A 1LP9A 3PQYD 4XTRD 3BVWA 1JVOA 4BD4A 4POUB 4QTHB 4Z1PA 3F7VB 2R0WH 5DC4B 3GJFH 1VKXA 1SXCA 3ILDA 5DFVC 4F2ME 2KPNA 4UIMB 2FYYA 3G5YB 4ODVL 4X6BA 2BZDA 1YPZB 1FVDB 5M95B 1XR9B 3FXIC 2I69A 3T0EC 1F4YH 1JTTA 4FYRA 3S3BB 4NP9A 5FUCC 3NDYE 3TO4C 4PB0L 1Y7VA 1AKJA 1K8DB 1YNKL 3CZJA 3Q3GA 2VZVA 3LZQA 4M48L 1TTUA 1HEZA 1U2YA 3GSNB 1WO2A 4B9CA 5KSAA 3EFDH 3RVWC 4KTDH 4L05A 1TZHB 2ZXAA 5AVWB 1S5HB 3HNSL 3TYGL 3UH8A 4QRRE 1CU4H 5JQ6L 5KZCD 1M6UA 1PFOA 4JMNA 1DJZA 1ETZB 2VITA 3VXUA 3O41A 2OMVB 1P7BA 4NQVB 5DMIH 4OZHE 2HN7B 1IAKA 2UX7A 1I7ZA 5H2BA 3S0PA 3VXSB 1S7TB 4R2GB 4UAOB 1NANI 3KMDA 1Y1UA 3SDDB 2E56A 2I24N 2QV2A 4ADJA 2WYZA 1HILA 4FMVA 1MREH 1WCBB 4AXWB 2YD9A 5IROD 4YEEA 5JTWA 4JY6A 5CIPB 2WBXA 3NCFB 1E2VA 1A6TA 2Q7NA 4S1SL 5HDBF 3K1KC 3U4BL 5C0BD 2R0WL 2HJKB 2WUBH 5LHDA 2WP3T 2ZNWA 2K1MA 2BJML 5DRWB 5HYJB 5IHBA 3RGHA 1ZPUA 2BVPA 5ICUA 3N44F 4F20A 2CRMA 1BA9A 4H0IA 1WITA 2Z1PA 5BUPA 4Y1AE 4I4WA 1F4YL 2VAAB 1INQA 1X9RA 4ZXBB 4RFEB 4MX7B 3T6WA 3DMMB 4DVRL 1BXVA 2ZX9A 3CZNA 4P2CG 5I6PA 1PG7H 2PWDA 1OAJA 4EO5A 4F15C 1OGAD 3ULVF 2NT0A 5LLIC 1SHXA 4HCRA 4Z7QB 3EFDL 2A4ZA 3RYMA 4FD0A 4KTDL 1YO4A 2GIYA 1NCCL 2YAHA 1H8LA 2I9LA 1CU4L 1IZKA 1YY8A 4UTAA 3SJVE 2KLTA 1QNIA 1B0RA 3GC3A 4HKBA 5D7EA 3D52A 4PJBA 1SDDB 2V33A 4GXUM 5KVMC 3L3JA 3NRPA 1ZHNA 3RKDC 2YFNA 4PRDA 1JNHA 1AY1H 4DEPC 4JPQA 3VI4E 4GI8A 2WXOA 2CK2A 2OTWA 4WK0B 4DVBA 1U92B 2AVGA 2N1TE 1NMAH 1GIGL 4MQ7B 1MREL 2FEJA 3OQRA 2BY2A 4BXVA 1J9TA 1T04A 4F9LC 2J8UE 3QORC 3JZ7A 5E00A 1XF2A 2PP9A 4WI9A 3T3PB 5J56B 2EDTA 4ZBJA 3HRPA 1XFPA 5AVRB 2AQTA 4NCC2 1EJFA 5ACMA 5KS9A 3LS4H 4PM1A 3LB6C 4MNGE 2OMZA 3CLEL 2Y5TB 2ZQKA 5FWQA 4NO5A 2J1XA 2B0SH 4R96A 2XTLA 5KUKA 4ODUA 5EZIL 3P30H 1JPFB 1PG7L 4Y88A 2ZX7A 5DVLA 3SBRA 4HMDA 5CWSB 3TASA 2FWOB 3Q7JA 2BY0A 5D7KE 1LILA 2WLHA 3WN6A 3V9CA 4GRLB 4N8PA 3GRWH 4KJWC 3AY4A 3B7UX 4IW4C 3GJFB 3MNWA 4I13B 4BHUI 4H1LH 4PJ5A 3AG3B 3ZT6A 4EDWH 4IK6A 1RZ7H 4X6DF 5F7DB 3UTSD 3RTQB 4QXGL 2QDVA 5B3NA 5IB1B 1PCXA 2X2HA 3I50H 4J3OH 1E9OA 4X7CC 1AD0B 4M4RB 3R06B 5K9JH 3VD9A 3ULVD 1WT5C 3IDIB 5GGUB 4DO4A 4ETYA 3B6SA 3CJJA 4H8PA 4JPVH 4ZDHA 4ZAKA 4KRPB 4YIQB 2VDQB 3G5VB 4X6CA 5D1XB 3JV0A 2UZYA 4LKXB 4L3ED 1P4LB 3RX8A 1HQ4B 1VJSA 3UZEC 3ABMB 4OR1A 3QIWC 5HJGA 1I1AB 5BOJA 3MNVA 2NNCA 1CYGA 3KEHA 1FFNB 4ORGB 4QHUB 4TVSa 2N7BA 4BZ2L 4YC2C 1NC2B 1WWWX 4QTFA 4NT6B 2X53A 4U3SA 5J1AA 4FG4A 1B9KA 4W9IC 5I24A 1GS7A 3V6FA 3ROOA 2X4SB 1EJ6A 2H7WA 5ESAA 5HDLA 2B0SL 3MRCB 1ED3A 4QYOA 5HHOB 3TPKA 1HINH 1OSZB 1OAKL 2VDOB 1CGSL 3P30L 4V1DB 2H1LM 2DQIL 3S7GA 4X7TA 1QBBA 5ESVB 4OBRA 1WFUA 4E9TA 3V0DA 4DH2A 3GRWL 2XPGA 3HG3A 2WQRA 2P5WA 1R9FA 4NPKA 1SXNA 2IEPA 1NGZA 1TTAA 1QW8A 4XVJH 1T0NA 2WLYA 3QRLA 1JMZA 2GEQA 1RZ7L 2ITEA 3FRPB 3KYNA 4LSQH 3I50L 3K6OA 1GA2A 2QGDA 4X0KB 5HYEA 4FA7B 4JPVL 2MPAH 4ZSOE 1KACB 4XCEB 3V0GA 1IGJB 4AGPA 3VXPA 2GBAA 1HHGA 3T8VA 3B2PA 3WLWC 5JHDE 3HR5B 1M6OA 1JD9A 3KPSE 4D9LH 2BOBB 4XZUA 5EBLA 4EXPX 3FAWA 2Z35A 4PJBE 4PGEA 3WJMA 5IVOA 1KC5H 1OP3K 4IRJB 1KY7A 5JOFB 5FECA 3JV6B 4N9OB 1QUPA 2AXWA 1PS3A 3BEVA 2G2RA 4LVOB 4AX3A 3D0AA 4LIQL 3T1FA 3AT0A 1PZCA 2WAHA 3U9UA 3WLBA 2X3AA 5E1GA 3DJ9A 3MO1A 5FDYA 1CDUA 2C1PA 3CGTA 2Y3NA 5A2KH 3BKYH 4JKPH 3WHE1 5HHMB 3B3BA 3IJYB 2X9WA 2O5XL 1VGKB 2DOCA 5KS9E 4ALAC 4M93B 1ZS2A 1UA6L 2KZ1B 2ZCHH 4Y8AA 3UO1H 3CFIC 4KJPC 2EDBA 3ILQD 5FC9A 4TKWA 2H26A 5HYQA 3HC0B 2HXAA 1JPGA 3AY4C 1OO2A 2QGBA 1USQA 1IC0A 4YHYB 3ARBC 4MS6A 5KVDE 3FT4B 3QC6X 4QRTA 2JJVA 1N6UA 1ET8A 2FJHA 1NPNA 3B9KC 1KJVB 3VI3B 4LSQL 4P23A 2X2JA 1A5FH 2ZSWB 5EEVA 3V6ZB 1CI3M 1HFUA 2ZSVA 1ID5I 1MW2A 4JDVA 4KQ4H 3BCDA 1I31A 1FRGL 2MPAL 3ZPDA 3H0TA 4PJ5E 4KITB 3CC5A 5H37H 1PVHA 4OFYA 1CFNB 4D9LL 1DSWA 3FB7B 4QTIH 2VOTA 1DEEA 3UIYA 4GUOA 4AKOA 4RNRA 3LKRB 4TSCL 4LRIC 2XYBA 1DHKA 5CFAA 2SODB 3U4EA 4GSDL 3CDGA 2VRQA 3BKMH 1LE9B 1S3RA 3PAUA 1JFQH 2H2PC 1I85C 2DBLL 3HVDA 4TSBH 5L2JA 2V2TB 5KYYA 5E08L 2D7QA 3BKYL 4JKPL 5TDOA 1LHZA 4LCCC 1CICA 1S7WA 1E0OB 2KPWA 3QULB 1CWVA 4RAUB 2IAMB 3DGCR 3F65A 1HNFA 4PHZA 4L4TB 2KL6A 1FVEB 1PBYA 3QIBA 3UO1L 4WK4B 2GY7B 3EGSB 2XV6B 4JFFD 4LE8A 3MLUL 3GMPB 4HKXA 43CAA 2R2EA 4F58H 4N0UA 4U6XB 4AZ8A 3RVUD 4GIAA 1ND0B 1Z5LA 1A7QL 1J0HA 1PZDA 1YJDH 1T4KB 1EHLH 1DVQA 1X5MA 1A5FL 3QHTC 3FCUB 1BLIA 1XF5B 4KQ4L 4QMEA 1N12A 3RURA 1XF3A 5IHUH 1QSVA 1NINA 5DJDA 4AK2A 3TVMD 4NN7B 1DO6A 5ENWB 3PGCB 2AJXH 3OKLA 2IPKA 5DSCB 2IDFA 1JF5A 1KCSH 5L0QB 4D8OA 5JO5A 4QTIL 3P4OB 4QO1B 2F53A 2BW5A 4WFHD 1S8DA 4FQHA 1QBMH 4MD5A 5K9OB 4UILL 5IWLC 4BZ1H 1FA4A 5DK0B 5DEGB 5E6UB 4YDKH 1ZVSA 3BMWA 2X2YA 3QUKA 4P2OD 1BYOA 1AO7B 4PAZA 3TBSA 3WE6A 1M7IA 5C2BL 3BKML 1G7QA 4HUKB 4HGKC 3BRDA 1BBJB 1JFQL 3BZFA 5T3XE 1GW6A 4TSBL 1SJMA 3UYPA 4AYGA 4DFIA 4XOAA 3RGVA 3WTSA 4U7SA 4ZX3A 2VAJA 1AZRA 1TKWB 1N19A 4FYQA 1MJ7H 4P46D 4P48A 4L8SA 1KYFA 4G5ZH 4NKMB 1KXTB 4QYAA 2AMGA 5DEJA 3DX4A 5B8CC 3IJHA 2VSCA 4ESKA 2A83A 3ULUC 5FM5O 2DI7A 4HUVB 2BS8A 3CH1A 2ED9A 4N0CC 1FZKA 2MQ0A 1YN6B 4XNDA 3EO1B 4F58L 5F7HA 2XFXB 4Y19B 4DP0X 5B1AB 3BAYA 4YUEH 1X5XA 3RHWK 3VFNB 1M53A 3T08A 3VRLF 5C7ZA 1FV1B 2R1XB 4PJ7A 5E99H 5KG9B 1EHLL 4LSSH 4L2YA 4JNXA 2WXGA 4CN6A 3VXNB 3X14A 2D7PA 2F54D 5LBVA 1K9TA 2XQYA 1NGWB 2BSDA 5IHUL 3E3QC 4XN5A 1YY9D 1A7NH 3PWJB 5BPPA 2AC0A 1QHQA 5DD6B 3U36B 3F12A 1UZ6F 1MFDH 3TJPA 3MRHB 2YJLA 1XCXA 3ZTDC 3ZMRA 4GKOA 3KAAA 2X05A 4Q9RH 4NQCB 4WO4C 3BH9B 3P02A 1R3IH 1QBML 4I1RA 3VX1A 8FABB 4NDMA 2AABL 3EGXB 5ECJE 5MEQB 5IMLB 3A6CH 3BFWA 3VFUB 4PP1D 1VFMA 4PMEA 3CK0L 1FORH 4MMXA 3SGJC 4PWJA 4YBHA 2QSTA 3BP6B 3ECBB 3EJYD 3UL4A 4KKAC 4XMWA 4R4BB 1C5CH 1CC3A 4LLYB 1MNUH 1NCWL 4LCUA 3MRGB 3MRFA 4WLCA 3HCVB 4FLHA 2PW2B 4JRFA 4WW1B 4G5ZL 2EICA 1KUMA 3QWRD 3ZL2A 1AP2B 3BWUF 4ZFOL 3N43B 2NTFB 3PIQA 3B3IB 2CDFB 3ME0B 3MMEA 3SGEI 5F1NA 4YHIA 1GTNA 2DQTL 3A6BH 1CYWA 2BCMA 4KJYB 2I07A 2JQAA 4ODSL 2OL3H 3ZRSA 4YUEL 2DW5A 4QXUL 4XVTH 3D1MC 2AJZA 3MV7D 4UM8A 3T3MB 5EPMB 3C5ZC 5E99L 3FQNA 4LSSL 1R3JA 1WE5A 4ZUVB 3ZJAA 1KLGA 3M1CA 1F58H 5ABZA 1A7NL 3LKQA 1AS7A 1U8OA 4FL4C 1ANUA 3FB8B 4ZD3L 4NUGH 3SKOB 2BNRB 3BH4A 1MFDL 3FAXA 2NPLX 2P8LA 4DZ8A 1RQ5A 4K7PL 4YDLC 1AJ7H 1LEGB 1AR1D 1R3IL 4GO9A 1N0XH 3ZDZF 1XIWC 3VTAA 3NBNA 3FCGA 3NH7H 4CU7A 3U0PA 2F8OA 3CAFA 1EBPA 4XCYB 3WNOA 2RA1A 3JYBA 3HUJF 4G6FB 5D7JA 1FORL 2Q10A 5BZZA 2DQUH 2YS4A 1XMEB 1CF8H 2XG4A 1OB1A 4G80A 1FG2B 1BVKB 1QWHA 4A6YA 2X6AA 3REVA 4CN1A 4AJ0A 1MNUL 3OJDA 4KFMA 4XN7A 4PWFA 5GGRA 4LXFA 3UFIA 2CA3A 3RNKA 5JHLH 3H54A 3QRGH 4HWNA 2L7EA 4ANUA 3DECA 3V79C 2B77A 4HK3N 4CADB 1OCWL 3KYMB 4F2FA 3TF4A 1ZJAA 4XNUH 1CD8A 3A6BL 1Q0EA 3GI8H 5C0CE 5F9JB 2VR4A 4JM4H 2CR3A 2OL3L 5A16B 1OCRB 2IO5A 3PREA 3V0EA 4MLSA 1SEQL 3RGBA 2XWCA 3TWCH 2AEQL 4OLVL 1D5RA 1EO8H 1XBRA 2RCSL 2IFGA 3NCYP 1CFMA 4YHNB 5TF1H 5IFAH 3UJIH 4OFIA 1F58L 4N20A 1JV5B 5D6CB 1LEKB 1MF2H 1WFIA 3AAZA 4NUGL 3L16A 1FFPA 2CHNA 4U3HA 1ZCRA 1OE1A 4JQIA 2YPVA 3UTTE 3BUPA 5AZ2H 2EXWD 2DTMH 1AJ7L 2VLMD 5B38B 1Q9OB 4PJ7E 4XX1G 1W72A 2VZTA 5EA0H 3UZQA 2QTEA 3CFJB 4FI7A 3PJNA 4GBXB 5EU3B 3CVIH 3UG3A 1GGIL 3DBSA 2DQUL 1OTUC 4L8BB 4PB9H 5T5FA 1CF8L 3R7RA 5JIHA 4HIIB 1K5NB 4X8JB 3BAWA 4ZMWA 3MV9A 2BFVH 3ASWA 4WJG3 3ZSSA 3L17A 4FQQB 5DVPA 5JHLL 1N68A 3QRGL 4KXDA 1XSKA 2Z93A 1CIUA 5INDB 3BIAX 4PVLA 5AW5B 3BN9D 4D94A 4EZKA 1CL7H 1OEZW 4XNUL 3VD4A 2PXYA 1IC4H 5A2LH 5DJCB 1NDGB 3MJ7B 4UQ3A 3F5WB 1JJUA 2BVQA 4PBWD 4KROC 4MNQA 4PJDE 3QA3B 5DYOA 4OCMC 4HQQH 1EO8L 1AZUA 2X4TB 4OGYH 4YVUA 4IEFB 2D03H 3VXMB 5EO0B 3MDJA 5ICZA 1MQKH 3QO1A 2XV3A 5TF1L 5IFAL 3UJIL 2IDTA 2WVVA 1OD9A 2X4NA 1MF2L 3OQ3B 4W9LC 2A9AA 3HVNA 4H40A 2NY5L 5TGBB 3R0NA 4FG6C 1QO3B 3GO1H 5FPIA 1HK6A 3JBG7 5I1AB 4TVPE 5AZ2L 2DTML 1JN6A 2N0KA 3RHWF 1KGUA 1T7YA 2D73A 4Z7VB 5EA0L 2D31A 5CZVL 3ZQXA 3LZOA 2B59A 2JCCB 5L2KA 3TEXA 2MRYA 3K5SA 5D8JL 3MN8A 3CVIL 1E65A 1MJ8H 5TE4H 4PB9L 4PQXA 1F18A 5D93C 1G1OA 4N0RA 4O02L 5FA4B 3SKUD 1ZV5A 2CGZA 2EAEA 1FO0A 4HPYH 2BFVL 2QKIA 3UC0H 3T2NH 3U7YH 2CUAA 4TTGA 3JWNG 4J8RB 4MA3A 3OG4B 3T0DA 4J3SA 3MODH 1HNYA 4GAYA 3ABLB 3ARYA 4ZUUA 4KQ0A 3HG5A 1FIEA 2OR7A 3L4WA 3RWGB 4PRPA 1IC4L 1MCBA 1PLCA 5DDHA 4U0RB 5J12B 4WUUA 2DJMA 1AS8A 1B3JA 1Q38A 5F8RC 4IGBA 3KGUA 2R51A 1ZE3H 4EUPB 1BQ5A 4HQQL 1NBQA 2HTKD 1G4RA 3G6JB 1UJ3A 1MQKL 2YSTA 4OV5A 2RTTA 4R0LA 2LABA 3IJSB 3CV5A 1NC4A 5I1LB 2FT7A 2X88A 3KH4A 4J3VA 2J44A 3GO1L 3OAUL 2ZX8A 1L7TL 3I6GA 4O4YH 1XCTA 2PYEE 4XO8A 1RMFH 1X9UA 2ZE0A 5D4HA 4F7MA 2YD1A 1EAPB 2E8ZA 3OV6A 4XMUA 1IGMH 2XDHA 4YR6B 4OW6A 1CFSB 4R6UA 4KXAA 2DH3A 5LGYA 1GOFA 3GI9L 1A6VH 1MJ8L 5TE4L 2G0KA 4MMYB 5L9DH 4KKZA 1L0YA 5LG1A 2HLFD 5E9DB 2R69A 3HN8A 2GJPA 4NQEA 1UZ8A 3U0TB 3BDXA 3KGRA 5FEBA 4PJGF 5DURD 4GQZA 4HPYL 3HE6B 4R83A 1EHXA 3UC0L 4JPIB 5KSBF 3T2NL 3ZW3A 4F7TB 1BBDH 2WWKO 3FO2A 1U58A 1W0WA 1TEGA 1NGYA 5F2FA 2O93L 4XNZC 1W9XA 3MODL 1WA0X 1WZAA 2AEOA 1RZKH 4PRHA 5DJZB 3TTSA 1NOLA 2E75C 1I7UA 5CSBA 4CL7A 3F7PC 3MLZH 3H3BC 5HHQA 3RDTA 5F88B 4ZQTA 1NCNA 2NX5B 3MV9E 3HC3H 1PZSA 4L3FA 4U2ZA 4FGMA 1DSFL 5MEPA 2WLKA 1BJ1H 3DI3B 5IVZA 1F4AA 2DMKA 2GJJA 2J56A 4JJHA 5CSZA 3TFKC 1G7HA 1F2XK 3O4OC 4O02B 4N2BA 2V5TA 5FO9B 4TF4A 2P8MB 3OHXB 2K3TA 1E4WH 4MYPA 1CVSC 3OXRA 3SHSA 1KJMA 5SX5K 3CN1A 4O4YL 1CCZA 2EKJA 2YD3A 1S7UB 4Q52A 2OJEA 1L9RA 1VIWA 2CDEA 4HC1A 3VFOA 4EI0A 1IGML 2OTUA 3N41F 4Y16D 3TZVB 3ARED 3WIIH 4MLIA 5EF0A 1A6VL 2ESVA 2DQGH 3C2AL 5L9DL 2XN9A 2CUIA 3T65A 2PTTB 1YNLH 2C9VA 2DM4A 4CBZA 2B15A 4NJ9H 3EH4B 1QRND 2TRHA 2FBJH 3TA4D 2BMKA 1KIUA 1R3HB 2KDYA 2O30A 2BM3A 4YSPA 2VDLH 1BBDL 4GLRI 4P3DA 4X6EB 2EE2A 3DK2A 3D0LA 1RZGA 4OLYH 3QYCA 1RZPA 4LCVA 2BNQA 2P5ED 2GJ6B 1RZKL 4AE1A 4DETA 4P07A 2ZG3A 4L1DA 3MLZL 1F3JA 4ZOBA 3VFWA 1J8KA 3HC3L 3PDGA 2C9PA 3RWIB 4F8TA 1EH9A 1T66D 1BZ7A 4O58L 2C3WA 3QUXB 4L3AA 3BPLB 5MEOB 3HB3B 2W0PA 2XKNA 3SKJL 3HE7D 3V9EA 4ABWA 5I6NA 4LFHG 4XVUC 3Q5TA 4JQXA 5DD0L 4DPCX 1UHVA 4KX7A 1I3GH 2BSEA 3SPVA 4PRPE 4PJEF 5CD3A 5IEHA 4O5LL 5GIRA 4FKKA 1FUNA 4IIQB 5FOBB 2Z4QA 4WUUE 2OZ4A 3VXTA 4HISA 3BPCA 5CXPA 5D1QB 4M6AA 4Y4KD 4IBYA 3FUIA 4U05A 3PV6A 5C09D 2YQGA 5DMYA 1BZQK 4N85A 2FK9A 4MD0B 1SOQA 3K72A 4KRMB 4WHTA 4GSRA 3IU3A 3WIIL 3KPPA 5DJ8B 4NRZB 2X42A 4EN2A 5J4MA 1OW0C 4XBMA 1YNLL 1EDHA 4NJ9L 2DKMA 4DEUA 2FBJL 5L88H 1UXSA 1VFAB 5DHVH 5CM1A 1INEH 4LBEB 4B6ZA 4EPSA 4L5FE 4XO4A 2X4UB 3O3BB 1RL1A 2NW2B 4OLYL 1DO5A 2DI9A 4X5PA 1WLHA 4LARH 4MS8C 4JGUA 5K39B 4X9HA 1LXMA 4NQEE 4N2DA 3EKCA 4TNEA 3O2DA 1JK8A 3FYIB 1AQDA 2VB5A 2E7LA 4G42B 1HN1A 4HJSA 2F1BA 1XZWA 2J55A 1J1XL 5TDPA 6PAZA 3OMAB 4ODWB 5I6LA 2TSBA 4NI3A 3FQUA 1T83C 3KM1A 4UNUA 1HI6B 3SDCD 1NMCC 4C56B 3K6SB 4UBDD 1S78D 3CFBB 3H42H 1T6VN 4U4BA 5A2FA 3TX4A 5KAQF 3A3YB 1E27B 3QCTH 3R19A 2V7NB 2W0FA 1A8ZA 4I77H 2LE9A 2Y1ZA 3IU4H 2EYTB 4JZOA 1JI1A 1SBSL 4HIEB 1JPTH 1DQMH 3D5OF 4J3OF 5FHAL 3EXLA 1MVUA 2C1OA 3L4UA 4BCYA 3MBEC 1GC1C 4PGJA 3ES6A 3MCG1 4NRXA 1QSEA 5DZNA 1YNTF 1BFOA 3OD3A 3VVWA 5L88L 3WV0A 2VUOA 1XDTT 2XG5B 2J12B 4J4PD 3O4LA 4BWWA 4DKTA 2MQGA 2IDUA 1VERA 1HAWA 1Z0NA 2QLYA 1WPCA 1CDYA 4BIKA 1SY6H 1XGTA 2G3NA 5FYLE 1G7IA 1BREA 1ZWIA 3EAKA 5GS0H 1SMOA 1KPVA 1A4KA 3X12A 5FV1L 2KLRA 1HH6A 4IBTA 4M7JL 3UGUA 5D5MA 2WBJA 1LD9B 4JG5A 3WKQA 3CSYA 1TVBB 4I9XA 4QRQB 3D33A 4K71B 1KGJA 5AOZA 1YEJH 2UWEA 3TBVB 2AK1L 3DXAA 4KDTA 4NQDA 4QR7A 1TQTA 5DK2A 4D0BA 5I1DA 4GG8A 1GJWA 1KTRL 2BNQE 3HG1B 1BQLL 3OAYH 3FQ1A 1FNSH 1E6OL 3TPUA 1J48A 1ASQA 1MFEH 4G9DA 4PJHF 4OKDA 3K71A 2RFXB 4I77L 2J1WA 3FF8A 4FXKC 2MSPA 1JPTL 4QHLB 4NAJA 2CHDA 4KK8D 4WDIA 4BE5A 3HBZA 3JWNC 2H4EA 5F9AC 2PPEA 3HS8A 1XT5A 3LRKA 1CLVA 1SQ2N 4J3XA 3V4PH 1VFBB 4E9VA 1TTCA 4BSWA 1DBAH 4WU7B 1Z2KA 3GSXB 3L6FA 4WW2C 1KT2B 5GZOC 4KY2A 5EU6D 2OJ1A 3AWGA 4AYDC 1I8MA 2FWSA 5ERWB 3QQ9D 4ZQKA 4L29A 3KVDD 2FNBA 3FO9A 4MJ5B 1A6AA 1MI5B 1ML0A 3VYNA 3RY5A 4RGNB 4KO5A 3DV6B 1TF4A 4I3SH 1SY6L 4MZRA 4JN2B 4J3OD 3SDAB 1S7SA 3WFDL 1KEMH 1KCVH 5E5RB 2H3NB 5BVPH 4RDQF 4YDNA 5FYKU 2C7UA 4OZIA 4LOUD 4WTQA 2J5LC 2C26A 3PU7A 2G5RA 4IHOB 4K7PX 3V4UH 5EBMB 4ANWA 1BXUA 4H8WH 3SOTA 1RURL 4HUUA 1PX4A 5TH2B 5I71B 2E7LC 1DQJA 5IV2A 3AU1A 3O8XC 1GS6X 3LXBA 1UEYA 1TSHA 3P73B 4B9YA 1G6RA 4W9EC 1NSNL 1XHHA 2RGSA 1XVSA 2JV6A 1UB6B 3JT0A 3PLYA 4UYPA 3MX0B 5FYKD 4OJEH 5C8JA 1BVNP 3L1FA 5IT2H 2J21A 1QPXA 3N3EA 1CIDA 2VN4A 1OIOA 1OVZA 3NJKA 3FQ4A 4Q7DA 2D0FA 5BRQA 1KXQA 4ELMA 3DIDA 1G84A 2WN2A 2RJMA 3LH2L 3DRTA 5DVKA 3D4CA 2K78A 1I9RH 4Z7OF 4G72B 5HJ3A 3MV8B 2GUOB 3L4VA 2WNWA 3V4PL 4RBPH 4WWID 5HVGB 3VTMA 1WUNT 2ATPB 1JYVA 4XMZA 4HH9B 3QJOA 1T1YA 3DX2A 4JFXB 2QGCA 4QCIB 3EBGA 5C0AB 3CG8A 4S1QH 5FM5M 3K2MC 1WICA 4PSPA 3EJUA 1MFCH 4XT1C 3BI9X 4I3SL 4BKSC 4TQ8A 2EDNA 1VRSA 3WNLA 1IGYA 2Y25A 2NY0C 1KEML 1N8ZB 1U33A 5BVPL 3QFDB 32C2A 4PVNA 3MV01 1M57B 2H2SC 4PJFA 1UOWA 3BAIA 1Z9OA 3V4UL 2CZNA 4H8WL 3BN3B 2EDJA 2TSAA 2R2HB 4PCSA 3TTYA 1DN2A 1KJ2H 1U3HD 2JKIS 3KEDA 4Z7UA 4FHKA 4DN3H 3SPGA 4AI7A 3WBDA 2VABB 1FFRA 4MDJB 4Y2DB 1E2WA 1N70A 1QMUA 1Q1JH 3NZUA 5DJ6A 1AGEA 3UMTA 4X4YB 2VSKB 3DHJA 1I7RA 3QEUB 4UUJB 5BZWA 3VH8A 5IT2L 3EGDB 3NP4A 3WUWG 4QXWA 3SKNB 2XTJE 4XC1L 5JIDA 2AJ3A 2M8XA 3QWNA 2Y07H 1TZGH 3GSQB 4L2LA 4K15A 4WSKA 4X5QA 3CZLA 4ZPVA 4BV1A 3DXAE 4NQDE 1T5XA 1I9RL 1UWXK 2H32A 2VLJD 3TN0D 1BLNA 5AWNH 5JOPE 1HCVA 5J6HA 1AD9B 1J05A 3NOIA 2F58H 4BQCA 5AD0B 2EDMA 4G8AC 5K9QI 2YWZA 4HBQA 4MXWH 2K6YA 1N59B 3DO7A 4YQXH 3B5TA 3VAEA 1MFCL 1U8JA 4JRXD 3V5DB 4GT7A 1T5WA 2NR6A 3AU0A 4XWGH 4QRPD 2N0MA 4NJAL 3F2LA 3SBPA 1LO5B 3ZYZA 4D8PA 4AWJC 2GSGB 4HIQA 2IG2L 1R5VA 1R0AH 4YDMA 3UDWA 2DZEA 5IQ9A 2BHFA 5CCKL 3TO4B 4HK3J 3V4PB 4FA6A 1KJ2L 1WQVT 4M62H 3ARXA 5FF6A 4DN3L 4P05A 2OP4H 2YUWA 4P5TA 2BVUA 5A2IH 4HXAH 1I7TB 5DJXB 4OZIE 4XN2A 5IHZB 4Z8FH 1UXLA 4U6YB 2FAUA 3EOTH 4E5XA 1BVLB 2UYLB 2D3LA 1MY5A 3CMOL 1BJMA 2Y07L 1NZRA 1TZGL 5B39G 4JHVA 4JFOB 2ED6A 5ICYB 4ZT1A 2YC1A 1FNGB 3PE9A 1E9PB 2NDFA 1F86A 2BZ7A 3IFOA 4Y4FD 3V55A 2I9TB 5GRZA 3D06A 2AK4D 2IDQA 4M9PA 1P7KA 3IN2A 4N6RB 3OKEA 2MCPH 5LDUA 1RK1B 2D8KA 4LPUA 5CCKH 3K6NA 2VM9A 2ZUQC 3P0VH 3QH3B 1NCUA 4OQTA 2X2IA 1ZT1B 4YQXL 1KOAA 3CVDA 1BW8A 2VLKD 4LF3B 4HCRH 2R15A 3X1NA 2E9BA 5EF2A 2E9GA 2QSCH 3RZCC 3TEWA 1TMCB 4P2RD 4G6AC 1A3ZA 4XWGL 4FEIA 3U30C 4BUQA 2RBLA 4PS4L 4U1NB 5J11C 4JGMA 3HPJB 1Q9KB 1X7QB 1QATA 1S7RA 2VSDA 2YLHA 3DPBB 3MBWB 1R0AL 3FYEB 5TQ0L 2RQ8A 3THMH 1KTDB 4CU8A 4RRPG 2FECL 1QLRB 3U4KA 4OKVB 2P8PA 3P2TA 2F15A 4ZUWB 3IXTB 1FVCB 1F3RB 2OP4L 3LPPA 2OZNA 1JYXA 1E9QB 2FQDA 3WY3A 1M2VB 3MUUA 4KO6A 2JE8A 2JIXB 1B6DA 3EH2A 1XD0A 3EOTL 5EU4B 1QHOA 3S9DB 5EUOF 2G0LA 1PD0A 2W0LA 1MNNA 1XL4A 1B88A 3LKOB 2XV0A 1EEQA 4E42A 3VGHA 1DN0B 3PAYA 1LJMA 4PJIA 3WOVA 4AQEA 4K23L 4DEPB 3POHA 1YMMD 1MFVA 4APQC 4JFDE 2BWDA 2DWDB 3KM2A 4GKSA 4P0DA 1MVFA 1VZGA 3DOHA 3L3OC 1PX8A 3QJXA 4ZFGL 3P0VL 1QSFA 3SO3C 5KVDH 5HYSA 2MTPA 3VRJB 3CVHH 4UT9A 3QORB 4HCRL 3U2JA 4KRNA 3IE4A 4BCZA 2QSCL 3PWPA 3P11H 1LP9B 1ZK9A 5F3HB 4K8RD 1IBGH 4QIRA 5IQLA 1VKXB 4UTAL 2D7TL 1GS8A 4PS8A 3WFBL 4RSYA 3ZN6A 4X6BB 4N28A 4JFWA 1OTTC 2YRLA 3JTSA 3JUZA 2WWMC 4QWWD 1KDIA 3THML 4X7SH 4XP9L 4XXCA 4Z3IA 1E50A 3C6LD 1KCUL 1W8NA 4GMTH 1OK8A 2GTWA 3EH5B 3PQYA 3UTQA 3GIVA 3Q3GB 2J2ZB 4HLZH 4DP7X 5L6YH 4QGTA 3T0EE 3BDYH 5KN5A 3JVFC 5KSAB 4UQIM 5D7LD 5FUCE 1I82A 2HX7A 3RWDA 1KV7A 3L95A 5CGMA 4G8GD 4DK5A 4NIYE 4UI2A 2G3ZA 3KVQA 1TO5A 3EF7A 4KGJA 3VXUB 5LNDA 4UZUA 1L4IA 2CLZA 4OD1L 5F0PB 3P77A 1JI2A 5F1SA 1I7ZB 4KKBD 3DUSA 4FQXC 3BGMA 5KVDL 5K9KA 2NUPA 1KCRH 1AOZA 2FWUA 3FTSA 4KKLD 2DLTA 3BQUA 4JY6B 3IRCA 5LAPA 1A6TB 3CSGA 4UAHA 1IBGL 3LH9A 4YLQT 4G8IA 4D3CH 3AADB 1WD9A 2CDGB 2KHAA 5GJTL 2XBZA 2DQMA 3SE9H 3KYAA 1YG9A 4LL4A 1T20A 2BVPB 2WXJA 4X7SL 4CSPA 3CFEA 2VYRE 4I4WB 3W37A 3BFOA 2MFNA 1INQB 1J0ZA 1HXKA 1UASA 5IROA 3UO8B 2ENPA 4JM2C 1JGUH 3BAXA 3WEOA 2WIMA 1CFQA 5C0BA 1OOWA 1R6VA 2WXHA 2M26A 2QTVA 3TA3D 5T3XH 4ATTA 2H6OA 5F97E 3DX1A 4YL9A 5L6YL 3U6RA 4ZFFA 3HAEA 2YEQA 2C9QA 3T6XA 2UUDH 4IKKA 4MTMA 3MFGB 1TLMA 2K7QA 3ARRA 3OKOA 4MAYD 2IGLA 1F41A 1P9MC 2I9LB 5BOZG 1YY8B 3FQTA 3HPLA 4D0DA 5HDRA 1B0RB 4HKBB 1QLFA 1X5JA 3LQZA 1IILE 2ATKA 1OGTB 1GYCA 3EDJA 4A2HA 1PF3A 4WTZA 2IPUK 1L6PA 2I32A 1OGAA 1PAMA 1ZHNB 3L3JB 4PRDB 1JNHB 4LU5H 4WTWA 3U1SH 4LDEB 3R1GL 2YEVB 4OI9A 2OTWB 4DVBB 1KCRL 5AALA 3ESPA 5DMGD 1HIMH 2ZKXA 3QUMH 3ZHFA 4QNPE 2D2OA 1ZLUH 1ZDQA 1T04B 4ZODA 3WS3A 3QG6A 4HAKA 4XWOC 1H3VA 1KYOK 3KPQA 3CVCA 1FNEA 4X4ZA 3DBXA 3OJMB 1AANA 2PABA 4FTVD 1QSFE 3SIKA 5CCGE 3HS0C 1JSYA 4HVBA 1BHGA 1MAJA 3KL5A 5LJYH 4G43A 2AEPH 2OMZB 3ARQA 2VR6A 4JRYA 3BGAA 4U1HA 4NO5B 3U83A 1JGUL 4R96B 2P26A 3X13A 4ODUB 4E9YA 1RZJL 4LL1A 3S36L 4AEIH 4IBUA 1DVFC 2GW5A 2IMNA 5AOLA 1CTMA 1X5LA 2PP8A 3ZBMA 5GZND 2YHGA 5E2WH 4WIQA 5AL8A 3IMVA 3ARBB 4PP2A 3C9NA 1IZJA 1X5FA 3MNWB 2WO3B 4TM9A 3BESR 3ZTNL 2ZXCA 3B9KB 3QEHA 4ODXA 1H6UA 1A7PH 2CUHA 1JWMA 4F8PA 5HGBA 1FZMB 3CWGA 4YHPA 1JPSL 5F72S 3SE4A 3QEQE 4HG4K 1F1AA 2FWLB 2IF7A 1CXIA 2HTLC 1N6QH 1TDQA 3U1SL 5JHAA 2X40A 4UDUA 4ODHH 1HCYA 3QXAA 2DYPD 1T2QH 4AV4A 4MD4A 3ULUL 4JZJA 1HIML 1CYXA 2XV2A 3HIZA 4X6CB 1LNUA 4CILA 4B50A 2E7HA 2UZYB 1JHLH 3BWAA 4FNRA 3ZE0B 2EC9T 3TIEA 2HT4D 4BFNA 4LSDA 3UTSA 4BA0A 2AV1A 4XB8A 3TXAA 4ES9A 1KB9K 4UDTA 2YEZA 4WI3A 1J9CT 3QXVA 4U3SB 5HVFB 4N8UA 4LHJB 1B4JH 2A38A 2AEPL 3ROOB 3V6FB 1F3DJ 5MERB 4K0OA 1IT9H 5ESAB 3VB8A 4RAVA 4YXLH 3CDFA 1MIML 2YPLD 4L3EA 1CR9H 5EZLA 4QYOB 5C0ND 3S34L 3LSOB 5IROC 2EDOA 5I15H 4MCZB 1H6TA 4QRUA 4IOIB 1V7NH 4PGBA 3NABH 4H20L 4PJAB 5AAWC 2Q87A 2R8SH 1RJYA 1JVKA 1GZQA 3IJ8A 2XPGB 2Z0UA 5E2WL 3PHQA 2P5WB 4LASH 3LRGA 1ICTA 4Z5RA 5K59F 1NGZB 2ZYHA 4P57A 4LEEA 5FGBA 3PWUA 4GG6E 2VDKH 1IGTA 2EVJA 5BQDA 3LRHA 3IDNB 2CR0A 1EXGA 4WUKH 2DQJH 3MOBH 4ODHL 1QTYT 4YX2H 3WKPA 1T2QL 3M46A 4P59H 3C5XA 4M8QA 3ATBA 3VD2A 1SQMA 3VXPB 1MRDH 1HHGB 3FK3A 4S0HA 2QHLA 4Q4EA 2PO6C 1M6OB 5EBLB 1O75A 4PGEB 3U46A 3WJMB 5CJOH 3FU3A 2Y1VA 2BVEA 2MWCA 4WWPA 5FECB 1I1CA 5FB8A 2GBUA 4WV1A 1FCGA 4CVUA 3C60C 3R7QA 3BEVB 2G2RB 4X4KA 1B4JL 4J2XA 3C75A 1CDCA 3T1FB 3OC8A 1UCTA 4K55A 3U9UB 3WLBB 5E8DH 1IT9L 3MRIA 1E3ZA 1N67A 3MO1B 3NEXA 2WXIA 4X7DC 4RISH 5CLWA 5FAAA 2ZUUA 5I0XA 1CR9L 3G5WA 4LPYA 2NY3D 4DP5X 2AJSH 3P40A 4K4KA 2DL2A 2HZHA 5I15L 1V7NL 3NABL 5IW6A 2UXTA 4X6DA 1HKLH 1JVLA 3G5ZA 2R8SL 3ARGD 1U0QA 4NQQA 5I74C 3MLRH 1LM8V 1TZIB 5FLUA 2ERJB 2VZ3A 3FCBA 4JRYE 4LASL 3ERXA 3WENA 1JPGB 2VDKL 3DX8A 2FBOJ 2ICCA 4QRTB 1EPFA 2P52A 2X4PA 1TQSA 2FJHB 4F8LA 3TV8A 2YZ8A 3D39D 1EEUA 4P23B 1BOGA 4WUKL 3FO1A 4JFPB 1JPST 2DQJL 2ZSVB 3MOBL 3EBAA 3MV11 4JDVB 4MDIA 3MLSL 4NENA 4YX2L 5HI3D 1HZLA 1E28A 3ARDC 4P59L 1FZJA 1X5GA 3H0TB 3MRLA 1MRDL 2G5UA 3K0WA 2P5PA 3CC5B 4WO4B 4FG2A 5E95B 1JDCA 4N0FA 2X6VA 2C3XA 2VLRB 3Q8CA 5D2LF 1DEEB 1DUYA 4Z9KB 4U1LA 4RNRB 4BKTC 3PFQA 1LVEA 4EKXA 4TVPH 1M71A 4N8CH 2DMGA 3U4EB 1EIBA 2OMWA 3CDGB 4OGAC 1MCKA 3B9VA 1FG9C 1FGNL 2EUWA 2X9ZA 5E8DL 5L2JB 1ZGLM 5KYYB 4JO4H 3UTSE 4LSPL 4XAKE 2O5ZH 5TDOB 4MWFA 1CICB 4RQQA 1QBAA 2YAEA 3CFTA 3T8MA 4PWHA 1EDYA 1HKLL 2VXVH 3OR7A 1KYOJ 3MLRL 4IBQA 3QQXA 4OF8A 1E40A 2W1NA 4HKXB 1MUJA 2R2EB 4W4NA 2E7DA 3C5ZB 4N0UB 4AZ8B 3J8F7 3MCKA 3BAKA 3QQNA 1EGJA 1Z5LB 4XNMA 2CJUH 3FHEA 5FGBC 1V55B 3EYSL 4DESA 3W56A 3FT3A 2ZXBA 1XCWA 3LQAH 4FL4B 1JGDB 3ISRA 3KPRD 3UTPD 1XF3B 5ACZA 5LWYH 2V3DA 1A0QH 1GPOH 4Z95H 4MA7H 4YDLB 1OAXH 4JFFA 3OKLB 2IPKB 3BSGA 3D3VE 3EYOB 2FYVA 4L9LA 5LXVA 3PYCA 1EUUA 4XBEH 5E8EA 5I1IH 2F53B 1HZKA 1S8DB 1XEDA 2WD0A 4FQHB 3LKNA 4MD5B 5JNYA 2IAAC 3KNBA 3CSPA 1DQQA 3S48A 1MHEA 4TVPL 4C4KO 1K3IA 4RMSA 3TBSB 4N8CL 1M7IB 2DQDH 4U6VH 2CJ3A 4K5OA 2PW1A 4XP5H 2VDKB 1G7QB 3BZFB 1R5WA 1UOVA 4WV1C 2IMMA 1WBXA 2BW4A 3UYPB 4JO4L 1HTYA 4M43H 2AKRA 2W91A 4E9XA 3CHSA 2JLPA 3SY6A 2J6EA 1OCCB 3ECWA 4L8SB 4NLHA 4AENB 3P9LA 4BWTA 4MVBC 4P2OA 3IJHB 2A83B 3KDMB 1TQBC 4HZ1A 3AY2A 1O7VA 4MMZA 1YEEH 1XSOA 4AMWA 4XX5A 2A0LC 4IRSD 4L37A 5HYFA 4Y9FA 2EIZA 4JR9H 2NY2D 3FL7A 2CRIA 2MNUA 4AZUA 2CJUL 2QV4A 4A6YL 3Q1SL 3IBOA 3CDZA 3LQAL 4KI5C 4P46A 4X6DE 4YZFF 3RWEA 1QPPA 3TWYA 2ITCA 3V6OC 5I19H 4B0MM 5LWYL 4OM1H 4OTXH 3UMNA 1A0QL 1GPOL 1Y18B 4MA7L 4Z95L 4QJ4B 3WFCL 1RD6A 3RY4A 2BSRA 2FJFA 5TK4A 3ILQC 4ZMZA 4XBEL 4Y1TA 4FQLL 5I1IL 2ZWKA 2WTRA 4NN5C 3ML9A 4P3WA 3E3QE 3QRBA 2X6CA 1P1ZA 1E6JH 1Z3GL 5HD8D 5ISZD 4PLKD 3ESMA 1LO2L 2DH2A 1DVTA 2H41A 1QI4A 5DWUH 4N24A 2X1OA 3V7AG 4OZHF 2WQVA 2F54A 2DQDL 4U6VL 1YQVH 3MA9L 2WSKA 3DX7A 5D72H 5BV7H 2PWGA 1S9YA 3QZWG 1W15A 4D9RD 4QRFA 4M43L 4ERSH 2YRZA 3MRFB 4K9EH 2CO3A 4ZZKA 4ILDA 4G3YH 2IGFH 2OI9B 1DQTA 1QEWA 2YPVL 4JQIL 3S2AA 4PV1C 4FLQA 4LCWB 2X41A 4J27A 5EU5A 1W72L 3MMEB 2OBGA 3OAZH 5F1NB 4MXQD 5EULV 4YHIB 4KROB 2QPFA 3ZHLA 4PJ9D 1YEEL 2IGTA 4QXVA 4YN3A 2I07B 3RI5K 4UF7C 2HJFA 5B1KA 5T5FL 2HT2D 4FLSA 4JR9L 2FBRA 1DJGA 5CJBA 2AGJH 2PCYA 4AYBA 2AJZB 2IV8A 4UM8B 1IFGA 2BFGA 2KS0A 3FQNB 1OE3A 1R3JB 5GS0D 2GSIA 3QWRA 3VNZA 4E9WA 4AYID 1UD2A 4FYTA 2LR4A 3LKQB 1FLTX 1JCKA 1U8OB 2ADGA 4HF5H 1T22A 3H9SD 1SLWA 2P8LB 1P4IH 1MFMA 2NY6D 4XCNB 3T71A 4DZ8B 3B7TA 1E6JL 2NY4D 3MV7A 4HUXA 1OZUA 3RVUC 4JS7A 5DWUL 2WP3O 4I0PD 2QJDA 5D93B 2WWOA 3W39A 4ZMTA 4TUJA 3IEAA 2K4AA 4Q6KA 4WHCA 4N2EA 2XG4B 1AIZA 1OB1B 4FXGA 1RPQA 4A6YB 1K2DB 3DUUA 3REVB 3TVMC 2EDYA 4ERSL 3OJDB 4K9EL 4HXBH 4M29A 1K85A 3CPUA 4GPVA 4NBYB 4JCLA 2J8UF 3RNKB 5I17A 1NKOA 2V9RA 4QRRD 3RFZA 1U42A 2LLNA 2EH7H 2PNDA 3FUKA 2BWIA 2QADB 4NM8L 2LQRA 2NY7H 4EAEA 4L5FH 3IFLH 3MKGA 3DSNA 4XZ4A 1CDIA 1KBKA 1VHPA 4HGWA 4JREC 4NAQA 3H4HA 1ODUA 2WJ7A 2KQNA 4J8QA 2NY1D 4G1EA 2AGJL 2CO1A 5GGSA 6FABH 1P1VA 3QUYC 4KKQA 5I0VA 1THAA 1FO0L 3B8YA 4P2YA 2IWEA 1U4FA 1HESA 3VXRE 1CURA 2XI9A 3EHBB 3AAZB 2DM3A 3QUZC 2P80D 1FFPB 3BLPX 4QKTA 2OYLA 1ZGLP 5BQ7A 5FO2A 3QO0A 3AQZA 5ICXB 3RWJA 1EAQA 3QJTB 4LT7A 1W72B 3L4ZA 4WI4A 3UYOD 4FNLL 3UZQB 1JF6A 4PREA 3L5XH 4DKFH 1QFWM 3LRSB 1PJWA 3AB0C 4FQCH 1VAHA 2M83A 1K6QL 3W0WE 5FK9A 4AL8C 2Z1KA 1WBZA 1U93B 4UM9A 1YY9C 2OMTA 3X1BA 3E6FA 4NQTA 2I7SA 1BG1A 3L54A 5HDQH 3LPGA 4HXBL 2ZOWA 2C9XA 3DOSB 5EZOH 4HD5A 1H6FA 2Z93B 4K3JH 3CHRA 3NZSA 4LSTL 2H1PL 2VDML 3SJVD 1UT2A 2EH7L 4BGLA 1JZ8A 3W81A 2NY7L 3WTYA 1Q9WB 4X7EC 1VFOA 3IFLL 3KJ6H 1UGKA 4UQ3B 4MNQB 4TYUA 5DYOB 1J7VR 3EJYC 5C08A 6FABL 2K6ZA 4YSEA 5ICZB 3JUYA 3QO1B 3WJLC 3D4YA 5KBPA 4KH2A 2WVVB 2WQSA 2X4NB 3QZWA 4MAUH 5DVNA 4XPTH 1Z9NA 1ZLUK 4JKNA 2VKWA 3HUJA 3AS1A 4DW2L 4BSVA 4RFOH 3S36X 3N9GH 1JN6B 3ZDWA 3TEYA 5GS1C 4HSQA 3L5XL 5SWZE 4JMXA 3E2HC 2VERA 3HZMB 4K9JA 4FQCL 2B59B 2F68X 2V0AA 4LDOB 5L2KB 1JWSA 2AEIT 4KKCD 2WPGA 2XVKA 1N8OE 4HWZA 2ZKHH 5IGXH 4AUJA 4QOKB 3D2UD 5D7KD 3IDUA 5AW8B 3C09C 1FO0B 3ZGHA 3D7PA 2OZ4H 5HHNA 4GAGH 5EZOL 3MJ6A 1D2PA 3F05A 5G4MA 4K3JL 1X5HA 4XO3A 3QAZB 4GAYB 1AR1C 4BA8A 1T0OA 4ZUUB 2FQFA 4P04A 4RVBA 5GGRY 1U8HA 4XPHH 3DGDA 3P9MA 3KJ6L 4PGCA 3SQOH 4WUUB 4XP6H 4M7KH 1HHJA 4NZUH 5C0DB 4F7EA 4PG2A 1OPGH 3Q01A 1IQWH 1JXJA 1WFMA 1YAIA 3PS6A 4G1MA 1UJ3B 3ML8A 4DWHA 4OV5B 4C4UA 4EI5D 1ZA6A 3LEVH 5E8OA 1G9NC 2PPAA 1NC4B 4MAUL 2XA8H 3ZL1A 4A66A 4GXVH 4XPTL 1Y0LA 4C47A 4KFZC 3M7OA 3VXSD 1MCCA 3I6GB 4RFOL 3RI5F 2GEEA 3N9GL 1RUQH 2VDMB 3NIFE 5E4IA 4PS3A 4HW6A 2MOVA 4F7MB 4ZI8A 4A67A 4UT6A 4Q9QH 2IPTH 2QMKA 1JE6A 1P84K 4OGZA 2PTUA 1E4XI 4EIGB 3RILA 3CXDH 5F7KC 1IBZA 1MPAH 3OMNB 3QI9D 2ENSA 2ZKHL 4U1IA 2BOCA 2D9QB 5IGXL 5IR1A 1UZ8B 5EF1A 2Q3AA 2V17H 4NUQA 1KYDA 3BWUC 3BUIA 4CC0A 3ETSA 2OZ4L 4GAGL 1HXMB 1U58B 3FO2B 1REIA 1NGYB 4Z0BH 3U2SA 1SLUA 1F97A 1OT2A 2Y7QA 2XWXA 3QS2A 1N5AB 4PRHB 3FFCE 4RWYH 1I7UB 4XPHL 3KPMA 3JWOC 1CT8A 4FLRA 3FRPG 2R59A 7FABL 1B9ZA 2FX9H 1N5YL 4NZUL 5DS1A 5MEPB 3IDGA 2YD8A 2G9KA 1AIFA 1ZLVK 3M1BA 3MRDA 2FJUB 1CB4A 3MREA 5IVZB 1OPGL 3WSQH 5A2JH 1IQWL 5CSZB 2KDGA 3ILPA 3CFDA 5JHDD 3KPSD 1XZ0A 2WN3A 2X0UA 3EFOA 3PL6A 1M9WA 1G9MH 2XA8L 4GXVL 1AFVL 2BSBA 2F7RA 2BXZA 1IUZA 4PG9A 3OXRB 1QSZA 1KJMB 4M3KB 3BWSA 2V3FA 2VRAA 3R8BB 4GRWB 5E24E 1RUQL 2Z6FA 3MBEB 3O2DL 4HHWA 4TV3A 3UTOA 2CDEB 5C08E 3QBTB 3VFOB 1P7QD 2OTUB 4Q9QL 5GHWH 3VWKD 3VWJD 3GEFA 1Q4NX 1YN7A 1MOEA 3CXDL 2ESVB 4P99A 2X09A 4AYSA 2J71A 4B9PA 1MPAL 2XN9B 3IF1B 2FECI 3P4MA 4YE0A 3T65B 3LNIA 2VMFA 3F84A 3HUJE 3KPNA 5LNEA 5H35B 3IXAA 3FCSA 3UJTL 4PRNA 2X1PA 4X80H 1O0VA 2V17L 1JHTB 2WXMA 2BMKB 1KIUB 1ZTXE 2C3VA 1HOCA 4K3EH 1IEBA 4IHBA 4MQTB 4NYLA 5D2NA 4P3DB 3LKSA 4RZCA 4TL5A 4Z0BL 4LOEA 5IM7A 3D0LB 3CZGA 4Y16A 2B7DT 4QT5A 3AREA 3T4YB 1I1FA 4I7ZC 1DBJH 4EOWL 2BNQB 5EOQH 4CMHB 2AS5M 1WFJA 3CE1A 1ZLWK 3L2MA 4RWYL 1KCBA 4JKWA 3VFWB 3QIUD 2IDCA 2J8OA 1BDYA 1DVZA 1E43A 1QRNA 2FX9L 3DYPA 2CMRH 4GRLD 4F9PC 1FL5A 1RSYA 1BZ7B 5EF3A 1A65A 3H6AA 3WSQL 3RL2A 1BM3H 2CRZA 2EDXA 2XKNB 4OUOA 4PJ5D 1CDHA 2EXSA 4JJOA 4ENED 3IAGC 1NBVL 1AXSA 1MHHB 2Y2TA 3EZ8A 4EDXA 1PG7W 1G9ML 4X9BA 2HVJB 5CD3B 5IEHB 5GIRB 2OK0H 2Z4QB 3OKDA 5DVOA 3V0HA 3BPCB 3VXTB 1OAUH 4NHCH 4QF1A 3U4AA 2E46A 4XO9A 1U9KA 2NYYD 2DIBA 3AG2B 4ZAKD 4YLBA 3HE7A 2DLIA 5GHWL 4PJGA 2AANA 4HJJH 3FU8A 4WHTB 3LZRA 3IU3B 3L2LA 4JUTA 5KSBA 4GJTB 3KPPB 5K93A 4NZRH 2H9GB 1G6RH 2KQMA 2GIXA 3V4VA 4JFEE 4OCYH 2IV9A 3ARFD 2EEDA 2ZKWA 3IPEA 4I48A 1QFOA 5EIIG 3Q6FA 1UXSB 4Y4KA 5AENA 2AITA 5C09A 1SVCP 4K3EL 1W0YT 1IIIA 5BS0A 4WAFA 2BO0A 5C1MB 3SDDC 1DBJL 1UWEL 2XVLA 4YO0A 2J5LB 5EOQL 3LS5H 5HHOD 3S37H 2XVGA 2JJTA 2VXQH 1JK8B 4UNVA 3CN2A 4MZIA 1T03H 3O8XB 5TDPB 4HETA 4O51A 2R4RH 1RZQA 2J88L 4YAQA 1SN2A 3C8KA 2VZ1A 4XN1A 2CO7A 2DEXX 1ITBB 1BM3L 4WFFD 2Q7YB 5K9QG 5LUMA 1F02I 1LDPH 3APCA 1Z0MA 4XRCA 4JRLA 4DHLA 1VA9A 1NBCA 4PI2A 4ZXBC 2HWZH 2OK0L 3DMMC 3ISWA 4YGVB 4Q2ZB 2OYMA 3TS8A 2WM0A 1VADA 3O6MH 1OAUL 2LVEA 1RVFH 4JZOB 2YMTA 2YAFA 3AGWA 2DLHA 1A2YA 3G5XA 1UM5H 1MVUB 5T3XD 4HJJL 4N3UA 3SDCA 3ESOA 3JWDL 5I6OA 3ES6B 4FHBD 4NRXB 2APFA 1QSEB 4NZRL 1ZRUA 1BFOB 1G6RL 1OLZA 1MHCA 5DHXB 3DTUB 4OCYL 1KWGA 4NZ8A 2R0LH 4ETQA 1IBHA 3O4LB 1E2ZA 3S5LA 2I7OA 1BIIA 2APXA 4TPRL 2VIRA 5IVXE 2JVUA 1WCQA 5K1VA 3TJHD 2O6PA 2YMXH 3NQKA 2AAVA 4ZUSA 1CFVL 1XGTB 1OXYA 1JGLH 1G7IB 3LS5L 3S37L 2H32H 1ZWIB 1NPJA 4AM0A 1KPVB 1P84J 2CR6A 1D7DA 1HH6B 4FNTA 5D5MB 3JTTA 4DOHE 1T03L 3CSYB 3UBGA 3L4TA 4JW3A 3VFVA 2R4RL 4PJEA 4J4PA 1PKOA 4MB1A 1J87A 2UWEB 2WKGA 4U33A 3SBWA 5I1DB 2QVFB 5DK2B 5H8DA 1DANU 4D0BB 4GG8B 1NGQH 2J43A 4HEPA 2WMPA 3T2LA 4H8QA 2VGLM 4IKIA 3TPUB 5IMMA 2HWZL 3PABA 5F44A 4L1BA 4G9DB 3K71B 1W91A 2AI0H 1SZNA 4P4KA 3O6ML 2A77H 1BQSA 5B1JA 2UZXA 3S96A 4XMKH 2NSQA 5DRXA 43C9A 4PWEA 4P3CH 3FBQA 1EZVX 3CQPA 4WDIB 4XMVA 4RGOH 5EUKA 3GXNA 2HB0A 5CZXD 2VW4A 3UBXA 4OFYD 1I1RA 2EDEA 3T6ZA 1L0QA 2MOGA 1K8IA 3L6FB 1T89A 4PV8B 5B3JF 4KZEH 5DQJB 2N7AA 2FIKA 3JVGA 2JMRA 3RTQC 1SVZA 4FI8A 3VDAA 4K3GA 1A6AB 5H37G 4F91B 2OW6A 6PCYA 2YMXL 3BSZA 3BT2H 1P4BL 5DU7A 1DZBA 1JGLL 3SQBB 3DJZA 1S7SB 3K2UH 2ZF9A 2XWEA 5D1XC 3I6KA 4OZIB 3D6GA 3FTYA 3GRWA 1OP4A 5TE7H 4UQCA 5BJTA 5CEXB 2VKXA 4NZTL 5EU6A 4CSSA 3NK4A 5IIEA 5CP3A 4H1LA 1K5WA 2XU9A 3QIBD 5HJBA 1DQJB 1AC0A 5BS0E 3K4ZA 1CBVL 4LNRA 3AU1B 3BAJA 4DAGL 4Y8DC 1NGQL 4L0PB 3HC4H 3BZ5A 4PU2A 3O3AA 5C8JB 5CJXC 5DD3H 3E1ZA 2P1YA 2AI0L 2A77L 2BS71 3LVTA 2Q9OA 2XXCB 3E9TA 1YNTA 4XMKL 1FNLA 2MH4A 4UOW1 4ELMB 1DVSA 3DRTB 1J8HB 3ZQ9A 4P3CL 4RGOL 2VTFA 5HJ3B 4PJDF 5KVGE 4JKKA 5T1KA 4NUMA 3DVNA 4OF6A 1MWAA 2ADJA 3RTLA 2ZUQB 3BXNA 4NOBA 1ZVHA 4ATWA 2WINB 2JKJA 3GS0A 1A1OB 3QCVH 4DUVA 4OFDA 1T1YB 3MKKA 4NUPA 4HJEA 4HULB 4XCCH 2NDGA 2C5DC 3AROA 4OT1H 1URLA 2XWZA 2ZOLA 3NA9H 5EEUA 4G9FE 4AW7A 3U30B 1ACXA 3BT2L 5J11B 4IOSD 4XNXH 4Y2NA 1TNNA 3L1OH 1IGYB 5C0CD 3HBGA 3KYOA 5T3ZE 3MXWH 2ICEA 3QQDA 3RGVD 4L8DA 4KAQL 5C0FA 4Y2OA 1J10A 1TJMA 1IKNA 4PJFB 4OJCA 1H3WM 2G5BA 1VEPA 1GZPA 2VW6A 3R0MA 4M02A 5C3LD 1WUZA 2A6IA 2XZQH 4IRJC 4IU2A 1BX2A 1I9JH 4PJHA 2G3MA 4OIAA 4Z7UB 2OCJA 5PCYA 1MCEA 3MU3A 2HVKB 3ARUA 4J4PC 4UT9H 1RPKA 3ZE2B 3ABZA 3UTTD 4Q97A 3WIAA 2LVCA 1AGEB 1D9KD 4NZDA 1I7RB 3QHZL 2YUVA 3DVGA 5B38G 1A9BA 4PJEE 2AJ3B 3S3CB 1BMWA 3P69A 1QASA 2L8AA 1U8LA 3DURA 1T5XB 1RLBA 1G0DA 4R7DA 2H32B 4R7LA 1IVTA 1U3HA 1BLNB 4YEFA 1OM3H 3D08A 3FUJA 2PUQT 4M93C 5J6HB 2YK1L 4QLRA 4X8CA 3U7WH 1J05B 3VW3H 1B2YA 2XHNA 4F7KA 1OALA 2Z65C 2B5IC 3BC9A 5AYQA 3C08H 5EO1A 5I2IA 3QCVL 3BW9A 4U3XA 4NNYA 3H2QA 4U1GC 4XCCL 5MP6H 4OT1L 4XNBA 5AB2A 5FFLA 1T89C 2FX8H 4WI5A 2NXZB 2BC4A 3NSJA 3HLKA 1Y6MR 1U8JB 1J5OH 3TN0A 4X6FA 2VLJA 3VM7A 4BINA 2K9UA 1LWJA 3L1OL 1AYOA 1E5ZA 2NSXA 3MPCA 3MXWL 4H8UA 4L0YA 1XMWA 3GSUA 4MGXA 1SJEB 4AGOA 1R5VB 2MIZA 3HN5A 3ZU8A 4YSUA 1QUNA 1F4XH 2P3YA 1UWGL 5IQ9B 4M5SA 3A22A 1IBFA 1D7FA 4KY1H 4OI7A 1ACZA 2L7JA 4EVNA 5ETUB 2W8CA 4JRXA 2Z4TA 5FF6B 1RULL 3VM5A 4UT9L 4P5TB 5FO7A 4QRPA 1MCQA 3HI5L 1SHWA 4XP1H 5AKSA 5LXGL 1TJHH 3ZDYB 4YPJA 2FO4A 1FIGH 3ZLQC 1KJ3L 3CU1A 5EU6E 5CLTA 4J3OC 4QHPA 4W4OC 2EEBA 1ETJA 3U1QA 4CUCA 1MFAL 4ZOCA 1UM4H 3N0PB 4LOUC 2YC1B 1XX9C 3IFOB 4HUMB 2WV3A 5I23A 1NCOA 1OM3L 4ACPA 2GTZA 4AY0A 3U7WL 4OZ4B 3VW3L 1GGYA 1DBML 2UV3A 2IQAB 3DVIA 3N1QC 4A04A 3OKEB 1UKSA 4HUWB 3LQMA 3C08L 3F64A 2IBZY 4M61A 3MOAH 4DFHA 3WU1A 1L6XA 2LU4A 4I85A 5MP6L 1CGVA 2ZXWB 3MRMA 4NP4H 4ZW8A 3GXIA 2FX8L 5D7JD 3ZE1B 3SPIA 1AQHA 1E90A 2XPZA 1RP9A 3QR0A 1SYSA 3ZL4H 1G7MA 1MELA 5GGTA 5I1CH 1J5OL 4Y4FA 1WFNA 4BSJA 2VMEA 2AK4A 5FYKE 3SSGA 4HZLA 4NN7C 2WZPD 1YC7A 1PPIA 1BGXH 4NC0B 5L0QC 1S7RB 2YXVA 2YKKA 2ICEC 3GSOA 3RX9A 3CQQA 1F4XL 5BRZD 2IANA 1V3KA 1IKNC 4JQVC 1AZNA 4JM2B 4KZDL 2VLKA 1J18A 4KJQD 2P8PB 5JDJA 4BZYA 3O0LA 4JPSA 2L0DA 5C3TA 4O9HH 3I2CH 1W0VB 4P2RA 1FHGA 2PYED 1TJHL 3TBYA 1FIGL 1O9WA 3NIDB 1DJSA 1FZOA 4X9YA 4KC3B 5T33H 2Q0ZX 2R39A 3HFML 4PJHE 3KXFB 4XPFH 4BFEA 1BFVH 1HL8A 1E3XA 3CNKA 5DTFA 1W6LA 3CFUA 1EANA 4OJYA 2LU7A 4MSWB 5IB5A 1MLBA 5FCSH 2YD4A 3QXWA 4NERA 4PJIB 4KTGA 4AQEB 4BZ1A 4OLUH 3AT9A 5ITBL 3SCMD 1C16A 4LHUD 3LXAA 1MKFA 3MOAL 4GKSB 1FYTE 4QXTA 3CFKB 2Q6WB 1N3NA 1T7VA 1R17A 4NP4L 4W70A 5HYSB 2FRGP 4DP9X 3ZL4L 5I1CL 3PWPB 2BK8A 2ENJA 2BSSA 4IBSA 1PSKH 4TNWK 3FFOA 3HS0B 1BGXL 3GBNH 3W9DA 1YMMA 4JO1H 2FSEA 2VE6A 1H8OA 4OB5H 5HTSA 1MY7A 1D7BA 1RZFL 1A14H 4LO9A 4F3FA 1FGVH 1T7XA 2VN5A 1IAIL 2VLJE 5C6WH 5CEYA 1VACA 3TO2B 4O9HL 1PZ3A 1T5KA 3I2CL 3PQYB 3MNDA 5FGCE 1SEBA 3UTQB 4TULL 2CGRH 4AIZB 2DV6A 3NGBB 4U1KB 1RPUA 5K69A 2IC2A 5KN5B 1L9TA 4GXFA 2H0PA 5DJ2B 1TYEB 1MCHA 2GITB 4XPFL 3RWDB 3LHPH 3FFDA 3FU6A 3IFPA 3L95B 1PD6A 3C6LA 4JRXE 3MLTA 3SE3A 3TIDA 2VQTA 3ULVH 2ZPKL 5KANI 5JIPA 5JUEL 4Z7OE 2BP0A 2CLZB 1BYNA 5C07E 4ANXA 3P77B 4KTEH 3PWLA 3GRGA 3OLIA 1W2KT 3DUSB 3BGMB 4N26A 5E6ID 4OZGE 5D7LA 4OCLC 2XWRA 3NACH 5KZCB 3P0YH 2VMDA 3GD1C 4G8GA 4TNVK 1NFDE 1AGFA 2YQ2A 1KSRA 3MLYH 2EDFA 1FBIH 1PSKL 3QXDA 5BZXA 2IOMA 1SJHB 2NT1A 4G8IB 4X7FC 2YMOA 3BVTA 5JZ7D 4JO1L 1T4WA 5B39B 5F7YC 3GIZH 3KBFA 4Z7NB 1T20B 1TXKA 4OB5L 1XEUA 1A14L 3CFEB 2LT9A 2OL3A 2YGNA 1HHIB 2E9WA 2KERA 1XF1A 5EUOA 3ZKMD 1NPUA 3FSZA 1S9XB 3TNNA 5FA3B 1JYNA 2A2QT 3OX8A 3QNFA 1X5AA 2CGRL 3AW5A 4IGBD 5C0BB 2OSWA 3TURA 3ZIYA 3QJQB 1SHSA 4CGUB 3U6RB 1A3LH 4ZFFB 1YJDC 3HI1A 2A6JA 3HAEB 2IANE 5I6KA 2HAZA 3SB3A 4TNGA 2V7HA 3OKOB 3LHPL 4G5AA 4MCYA 3FQTB 3SODB 1S7XB 2C9SA 3BVDB 3HPLB 3UZVB 4D0DB 3BHBA 4AC4A 3ULVL 2AXGA 4E36A 3AFLA 3RU8H 2F5BH 2EUVA 5LKNA 2ATKB 2CBPA 3MLXH 3AM8A 3MUY1 1OGAB 2B9BA 4KTEL 3PNRB 3OGCA 1ZVYA 5TFSH 1L0PA 2DMCA 4L4VE 4MZ3A 4ZFQA 1A25A 4MAYA 4JJ5A 4UQAA 3NACL 5GSVB 4HJ0C 5E9DD 2PYFA 5E8PA 1OWWA 1HH9A 5SWSB 3WS3B 3QG6B 1JTPA 2AJUL 1FBIL 3U9PH 5CAYB 1GRWA 3PF2A 1FNEB 3QT2A 3C60B 3DBXB 3RUGE 1YQ2A 4JVPA 3GIZL 4FFWD 2QVIA 3IB4A 1YVLA 3GINA 3O6LH 3HZVA 3B9DA 1JGVH 5GRVL 5INCA 4B5ZA 4G43B 2HFFA 2MKWA 2DJUA 4PTTA 4N2CA 4BH7A 1ES0A 2Y2YA 3FSWA 4U1HB 1TVDA 2GI0A 3I02A 2NX5D 4GBXC 4X98A 4WJ5A 3X13B 1T3FB 1EFQA 4GW1A 5AYUH 1A3LL 4L3CA 5CUSH 4FTVA 2GBTA 4IOFD 4FLOA 1UD3A 5I8EA 3I3DA 1OAZL 3RY6C 3V52L 4ABUA 3C9NB 2QBWA 2DMBA 2CCWA 4LLDA 2EDRA 4AH2B 1F90H 3QEHB 4H13C 3S37X 1F45A 4ODXB 3RU8L 5HGBB 1JWMB 4YBLC 4YHPB 2UY7A 5EMYA 4F27A 1KWKA 3MLXL 4WI7A 4HIJA 3ARDB 3PHOA 5HDBB 3TZVD 2OCCB 2BZCA 1IU1A 5TFSL 4MQXD 3UERA 1NGXA 4UDUB 3QXAB 4F8QA 3AABA 3HN3A 5FYLD 5A3IC 4MD4B 4IMLA 4JZJB 1QTPA 4YXHH 3AWFA 4ZTOH 2DWEA 3A23A 1IM3D 3N44B 1A6WH 1LNUB 2VQUA 3BWAB 2W60B 3II1A 3SZKC 3U9PL 1SGKA 2AV1B 2BSTA 3FTGA 3ETBF 4TQPA 1JK9A 4PGDA 5AAMA 1EZSA 4UDTB 3SYCA 4N2HA 2YEZB 5D7LE 2F61A 1EGJH 2A9NL 3O6LL 2W9EH 2DYPA 1JGVL 4IDJL 2IXQA 4XAWH 5ANMA 3UTZB 4F8OA 5IB4A 4KKBC 5I30H 2VL5A 3FU7A 4XB3A 2GSMB 5CINL 4OCNC 1QNZL 4RAVB 5EZLB 4L3EB 4CVZA 1FAIH 4KKLC 2BSCA 3CC1A 2ILLA 5AYUL 4TNWF 1BEXA 1FE8H 3KS0J 5CUSL 4PGBB 3CHQA 1OF0A 3O11A 3PJSB 1RJYB 3EUDA 1GZQB 4Q8BA 2EH8L 1NCIA 3PHQB 3LY6A 1QQDB 3FNKA 3GK8H 4Z7IA 1F8TL 4PLJD 4Z5RB 2CCVA 2R4SH 2CIKA 3NSDA 5C0JA 1IGTB 5DCCA 1JZEA 2YPLA 4Y4HD 1N26A 5JIIA 3MRPA 5J12C 4B27A 1FH5H 3APMA 2D7MA 3OF6D 3TA3C 3DX6A 4HJGA 3RPBA 3CBJB 4S10A 5JORA 2G2PA 1AGCA 5JPNA 1NFKA 2F0CA 1IQDA 2YXMA 1L9QA 1MHPH