2IDQA

Structure of m98a mutant of amicyanin, cu(ii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFARGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Generation of Novel Copper Sites by Mutation of the Axial Ligand of Amicyanin. Atomic Resolution Structures and Spectroscopic Properties
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idqA00
2CJ3A 3WG7B 5F7AA 3T9WA 2XV0A 1KCBA 1BYOA 2MRYA 2YAFA 3QQXA 1VLXA 1OF0A 1BQKA 3D12B 3IE9A 3GXUB 4N8UA 2XV3A 4NAJA 3NSDA 3ZDWA 2GHZA 1L9RA 1PLAA 2FT8A 5D4IA 2PPDA 4YSTA 3X1BA 2A3TA 2H3XC 2PPAA 2VMJA 3MX0B 3UAAA 2QDWA 3FYEB 4Q8BA 2FQEA 2PPEA 1KDJA 5D4HA 2IDTA 3AG1B 2HX8A 4CSPA 3G5WA 4KNTA 1NDTA 4E9VA 3EH3B 2I85A 1NIAA 2JXMA 4F2FA 4EF3A 2IDUA 4BWWA 1SNRA 2EIKB 3QJUB 1NWPA 2VM3A 1AS8A 1ZDQA 3EH5B 1TEGA 5I6NA 1ADWA 1M57B 3OM3B 5EHFA 2PLTA 1I53A 3QPKA 1AOZA 1AANA 2XU9A 4E9QA 4A2HA 3SBRA 1A65A 2HX7A 2XVBA 4Q89A 5AFAA 1JERA 4KNUA 5I28A 3FQ1A 4BXSV 2YAQA 3WI9A 4HALA 1WA1X 1F56A 1L9SA 2OV0A 2CCWA 3FPYA 3ASOB 2JKWA 2GIMA 2YXWA 3CVBA 3AG3B 4HCIA 4N4YB 4GP5B 2FQDA 2IDSA 2J56A 4BK5C 3X1FA 3PPSA 3V9CA 2YAMA 4YSUA 4YSQA 1JVOA 2QDVA 3UABA 2MTAA 1L9QA 2E86A 2PCFA 3AY2A 3WIAA 2AZAA 2VN3A 3QJVB 4NERA 3SBPA 1SDDB 7PCYA 4L0PB 2HRGA 2VSMB 1R1CA 1AG6A 2B3IA 1MG3C 3NP4A 1PY0A 4P5RA 2R7EA 1AZCA 5B1AB 2ZOOA 1KV7A 1NIFA 2GI0A 3FU9A 3N2JA 3NJKA 1PZAA 1KYAA 2Q9OA 4W9ZA 1KDIA 4CSZA 1X9RA 2HRHA 2UXGA 3NP3A 1OCRB 2EILB 4F7KA 1BXVA 2YXVA 1BYPA 1AQ8A 3WNJA 3FQYA 2UX7A 1A3ZA 1ZV2A 1GY1A 2H47C 4KO6A 4E9RA 3OMIB 1HAUA 2R7EB 2TSAA 1PNCA 1MG2C 8PAZA 1E65A 4E9XA 2XXGA 4ENZA 2BW4A 5IY5B 2BW5A 3NJNA 1AZBA 3T6WA 1J5CA 2IH8A 4GY4A 3ASNB 4QKTA 2WO3B 3FSVA 1NICA 2ZONA 2FJSA 1GS7A 1NPNA 2NRDA 1J9SA 1JZHA 2WO2B 4X4KA 5B7EA 2BP0A 3OMAB 3V9EA 1A4CA 5A7EA 1FA4A 1XB3A 4JHVA 4UANA 2PP7A 1PAZA 1WAEA 2FNWA 3X1NA 1JXGA 1B3IA 2EIMB 4YVUA 2Y1AA 5B1BB 3AZUA 4YVNA 1N70A 3DTUB 1BEXA 1PCSA 3T6XA 1WS8A 3PLYA 3NJHA 1IBZA 1T5KA 1GYCA 2QPDB 3IBOA 4GP4B 3QJTB 1GR7A 4HZ1A 1ILUA 2BWDA 3CG8A 2BP0B 1BQRA 1URIA 1AZRA 4AZUA 3KW7A 1AZNA 1FWXA 4YSDA 1IBYA 1SHWA 1A4AA 2HX9A 3FU8A 1ET8A 4A68A 2DY2A 1BAWA 3WKQA 5F7BA 1OV8A 2GBAA 2P80A 4JHUA 1E5ZA 1PLBA 4GXFA 1CYXA 2PP9A 3NYKA 2FTAA 2X88A 3IN2A 1TEFA 5I5MA 1AZUA 4HHWA 2XX0A 2FWLB 4WTQA 2LLNA 3X1GA 2UXVA 2QT6A 2YAEA 2QPEB 1RKRA 4TXVB 5I5JA 4F2EA 1JZIA 1JXDA 1MDAA 3NJFA 1PF3A 4RH4A 2TSBA 4BWTA 4PCYA 3FU7A 3SQRA 3IN0A 1ZDSA 3CVDA 2IWFA 2CUAA 2HLEB 1OCCB 1SFHA 1EZLA 4FAAB 3NSFA 4HCGA 2PPFA 3TU6A 3PCYA 1NTDA 3WKPA 3HEIB 1GSKA 4HCFA 1QLEB 1RZQA 4AX3A 3ABMB 5LDUA 4P5SA 4ZK8A 3FU7B 4KO9A 4YSRA 3GYRA 4K9JA 2YQBA 1WA0X 2UX6A 1OE3A 3EHBB 1PZBA 2OCCB 5I5IA 1CURA 3UACA 3WNIA 5D4JA 2Q5BA 2Y69B 1J9TA 1W8EA 2FT6A 1KGYE 4G7RB 4G7SB 4DP0X 2VW7A 2FQFA 4UF7C 1ET5A 4M4RB 1ET7A 3DIVA 1ASOA 2XWZA 1SF3A 3RYMA 4KO7A 4G71B 3AG2B 3JTBA 3TA4D 5I6OA 2XXFA 5TK4A 3S8FB 3GDCA 4YSCA 1CYWA 3JT2A 5B3SB 4DPCX 3ZBMA 2BZ7A 1JZJA 2GC4C 3UADA 1L9PA 3CDZA 2YAPA 1W6WA 2CALA 3NT0A 1NPJA 1ETJA 3PAVA 3UGEA 1JXFA 1FFTB 1BXUA 3NJLA 3ABGA 3T6ZA 2YAOA 2OJ1A 2RACA 3FQ2A 3NSCA 2BWIA 2UXFA 1A4BA 3S3BB 2W88A 2H5UA 4DP9X 1JZEA 4AKPA 4DP6X 1QNIA 3FSAA 1ZPUA 2BP8A 3TASA 2HXAA 2JFCA 1AS7A 5AZUA 4E9TA 3QJSB 1M56B 3T71A 3X2QB 5PCYA 3CVCA 4G70B 1PLCA 2VM4A 2B08A 2CAKA 3DKHA 4MFHA 3EH4B 4YSSA 2AVFA 1J5DA 5B7MA 4JKNA 3NJMA 4YL4A 2UXTA 2WSDA 3AG4B 3UAEA 2BP8B 2XX1A 4A2EA 2XV2A 1QHQA 3NJIA 1OCOB 3H4HA 1W6LA 3HB3B 2IDQA 2J55A 3PXLA 2FT7A 3U25A 3T6VA 2W8CA 4DP2X 1KBVA 1L9TA 2BO0A 5B1JC 3N55A 4DP7X 3EF4A 3IEAA 1RCYA 4G7QB 3NSYA 4A2GA 4DP4X 2AANA 1JZFA 4YSPA 6PCYA 2DYRB 2YAHA 1GS6X 1N68A 4BDVA 1J9QA 1GY2A 1KBWA 2XUWA 1V55B 2GSMB 4KO5A 1NINA 1AS6A 3ZIYA 1UATA 2IH9A 4DPAX 5I26A 3QJQB 3TBBA 3OD3A 5I6LA 1ID2A 1V10A 3ABKB 2IDFA 4UAHA 4E9SA 4BDVB 5I6PA 1PNDA 1SHXA 2XYBA 5B1KA 4DPBX 1IKOP 4NB7A 1PZCA 1NIEA 4DP8X 2I7SA 4G72B 1JZGA 6PAZA 3S8GB 1IC0A 1NWOA 1XB8A 2YARA 1WA2X 3ERXA 2GB2A 4A2DA 4QLWA 1TU2A 1AG0A 1A8ZA 1IUZA 5B1JA 4AKQA 3C75A 4BXVA 2DWSA 1J9RA 4YSOA 2CBPA 4E9WA 1TKWA 3KW8A 5ANHA 1SFDA 2DYSB 1JVLA 1NIDA 3OMNB 1E67A 1SDDA 2P80D 4FA7B 2ZWNA 1NIBA 3TBCA 3L45A 1AR1B 3H56A 1M9WA 2VSKB 2GC7C 1BXAA 3NJGA 9PCYA 7PAZA 2IWEA 1GW0A 2XLLA 2I7OA 3CZUB 2AFNA 4PAZA 1OE2A 1EHKB 3FT0A 3BQVA 5AKRA 1ASQA 1PMYA 5B7FA 4M3HA 3NJJA 3FPXA 4A67A 4BWUA 3FSZA 4YSAA 2BHFA 4HAKA 3SBQA 3ZX1A 1V54B 1OCZB 1SF5A 2PCYA 1YLBB 2IWKA 1KCWA 2ZXWB 1XMEB 4HHGA 2PP8A 4HIPA 1BQ5A 4A66A 1MZZA 1E30A 4GYBA 5I6MA 1ASPA 4AKOA 2EIJB 1AIZA 3FSWA 5TK2A 3AW5A 2VW6A 2N0MA 3H4FA 4YSEA 1ZIBA 1CUOA 4WKXA 3S3DB 1XB6A 2J57A 2IAAC 1OOWA 1MZYA 1GS8A 2EINB 5E9NA 1AAJA 3FYIB 1L9OA 4DP5X 2PPCA 3OQRA 3CDZB 1ILSA 2VW4A 2X87A 4AI7A 2AZUA 1CC3A 4KNSA 3PAUA 1OE1A 2FQGA 1WS7A 3ABLB 3QJRB 1E5YA 1ZIAA 4DP1X 1SJMA 2DV6A 5FC9A 4KOCA 1AACA 3BVDB 1HFUA 5PAZA 3FS9A 1HAWA 3X1EA 5I6KA 4E9YA 4A2FA 1NZRA 2BZCA 2J5WA 1JOIA 1DYZA 4GP8B 2HZHA 2DWTA 3S3CB 1RZPA 3MBWB 1X9UA 1DZ0A 3PAZA 4KOBA 4W1TA
chains in the Genus database with same CATH superfamily
5HGGS 4P2CG 2D0HA 3ATDA 2IVFC 2A74B 3EYFB 3JVGC 4MNQB 3UBXA 4PJBE 1FZKA 1A6TA 1XCXA 2ED6A 4X5LA 2DQTH 2DMHA 2ATPB 5GS1A 4ZT1A 1EUUA 4AGPA 5D1ZI 4ZMTA 3BQUB 4ZOBA 5IESH 2JE8A 3APCA 3FNKA 2C1OB 1TMCB 2OQJB 4YBQD 4JJOA 5D7JD 4AW7A 1DEEB 1U3ZA 1ZGLA 3PIQA 4Y1AE 4AE0A 3ARDA 1J9CT 1FO0A 1XQ4A 2Y5EA 3LH9A 3IAPA 4DGIL 1T0NA 3IDJA 3BKJH 1S4IA 1PSKL 4UQ3B 3S3JA 4HJGB 5D4HA 3IJYB 2Q7YA 2ZAIA 1T0MA 2WINB 1UWXH 2NY3C 1K4CB 3GXMA 4NWUH 5IQMA 1FVEB 4XB8A 1J1OL 2OCFD 4YC2C 1JZDC 1G4MA 2A83A 4P46A 3EH5B 1HINL 2W95A 1HCVA 3DUHA 5BZDB 4MQXD 4WWKB 1IVTA 2JJTC 2K9FB 1EV2E 4PWFA 3QEQE 2N59A 1KXTA 5DR5L 1XVSA 3L3DB 5T33H 1R19A 2DIBA 2J1KA 1D7CA 7CGTA 5KBKA 3BVTA 4I88A 3BIAX 1DN0B 3DYMA 1YAZA 1QSFE 1BYNA 3R1GL 3D34A 4PWJA 3MYJA 4RMTA 3FPYA 3GZOA 1C9SA 1YEHL 4K71B 4U1JB 3LMJH 2VR3A 2FQDA 3ARXA 2X4PA 4HUKB 4AYFB 2VMFA 4CILA 3E7JA 3WD5L 2ISDA 4QHKJ 3N85L 1FNHA 4ELDA 4BSVA 4ACTA 3IFNH 3QJVB 3FRUB 3L7EA 1MHEA 4JGNA 7PCYA 3II1A 4WEBH 1R75A 1A1OB 2R39A 3G7TA 3LKSA 2E0PA 4W6YB 5CBAB 3TIDA 3N91A 4OCMC 1FRGL 2HRLA 3CFKA 4HC1L 1PCXA 4P5RA 3ZTJG 1N5AB 1GC1C 2E6PA 1JAEA 4DN3H 1XGRA 2X0UA 3NJKA 5IMMB 5GHWL 3DPBA 5AW1B 3HKFA 5A3ID 1UA6L 2Q9OA 4W9ZA 4ZW7A 2D0FA 2H4EA 3QB7C 4QAWA 3MMEA 3TEYA 1SY6L 2QV2A 3IDNA 2KI6A 5F71A 2ZXGA 4YK4C 2WXOA 5AUMB 1VFAA 1MFUA 1RMFL 2R0WH 4YC2B 3V0JA 4KO6A 4MJ6A 4NNPH 1D5ZB 3VXNA 1NUNB 4X6FA 5HYQB 1T6VN 3LYRA 1FNSL 3L4ZA 4EJ1C 1C5CH 1ZA3B 2X4TB 3TFKD 2W38A 2QPFA 1T3FB 1YEDB 5E5RB 3QUMA 2E8YA 4ETYA 4ZX4A 4JS7A 5KBLA 5DJ8A 3QNYB 1ZHKB 4N6RB 3N0AA 4OCXL 4QJ4B 4K3JL 1WC7B 1V3MA 4WUKL 2CMRL 2VL5B 2MOVA 3ME0B 4U1HA 5D71H 4YVUA 2EIMB 2BVTA 2W07A 4R4BB 3NQKA 3S36H 1U8IA 4KUZL 3DI2B 3PLYA 4ABUA 2WYHA 1IC5L 2FO1A 4JFXB 3CLWA 3ILQC 1PJWA 4GP4B 4YFLF 4I48A 1AGBB 4YLQT 4GUOA 1HHJB 2Z31A 1ILUA 5HHOE 3FB6A 5H2BB 4MJ4A 3N1MC 3U36B 3IE4A 2AJYH 1YMME 5LXGH 4GT7A 1JCKA 4A63A 2J12B 1Q9KA 3II2A 5B38B 2HX9A 2DDQL 5CEXB 5FYJD 1JN6B 3SE9L 3IGUA 1RSFA 2R0ZH 5JMRA 5C9JA 4YUEL 3G5XB 5CKGA 2FRGP 3UGUA 2ZYHA 4HZAA 5EO9B 1WFIA 1H6TA 1KCUH 3D9AH 4MCYA 3UJJH 4AM0A 4YK4B 1P5UC 1P7BA 5LBSL 2DWDB 1E0OB 1MCRA 2VMDA 3GMLA 1TEFA 5IB1B 2H32H 1BJ8A 4DVBB 3BCDA 3HC4H 4G6JH 3U7WL 1HCYA 1T21A 5C6TH 3VFMB 1PBYA 5DVNA 5J1AA 2K78A 4P5TA 1X5GA 1MCOL 4N3UA 1NGXA 2WMPB 4FZEH 1I7RB 2EDFA 3RZWA 2XG4B 5EUKA 2ZAGA 1WVZA 3D3VB 3EOTH 3HVNA 2QR0B 3QBTB 2Z8RA 1WT5A 1B4JL 3ZKMC 1VFMA 3B7RL 1OANA 1UJ3B 3BZDA 4L29A 5DWUL 2VJ0A 4PM1A 2JMRA 1IGJA 2MQGA 2IH1B 3BUBA 2OA9A 2MNUA 3HG2A 4LMQE 4X4XA 2BC4A 4MZ3A 4FAAB 1KBBA 2V2TB 3LKPA 3RL2A 2VDKH 3S4SG 1N6VA 2XIIA 3EZJB 4JJ5B 2X1QA 1HN1A 3O41A 2RCSH 1D2OA 3SGJA 1QI3A 1YRKA 4CKVX 3QXAA 1QLEB 4FQXC 4TNWF 4AX3A 4S2SA 2EO1A 2X38A 2X7LA 3RB7A 3TBYB 5E7FA 5FW8A 3CSYA 3LB6C 2ZUXA 1CB4A 3U6XS 4JANA 2XN9B 3L4WA 4AVIA 3RWDB 3WNIA 2IOOA 3FRPG 1KV3A 1X7QA 3DX9A 5F97E 4LLWB 5GS3A 4NN5C 4NRYA 5DZNA 3TWCH 2RHEA 1MWOA 2GIXA 4TVPE 5AAWC 4G71B 1D7BA 1P5UB 5D1XA 3UTTD 3HC0A 1QVOB 3C60A 3UCRA 3AXIA 3WNOA 3R8BB 1PVHA 4JFOA 5ITFB 3TFBA 2BZ7A 3DX0A 4KKNA 1GGTA 4OIBA 5SWZE 2RMNA 3BXNA 1FH5H 5DF0A 3RVTC 3FFCB 3O4LE 4J3OC 3WBDA 2OJ1A 3RVVD 3AQDA 1I85A 4XN5A 2ZOKB 4XPTL 1GYAA 1HXYB 5B8CB 4F58L 1CFBA 1RZGA 4APXB 3BFWA 1KYDA 4GAGH 5GXBB 1IKFH 3CMOL 2YRPA 2JIXB 2DPKA 3UMTA 5C2BH 1RAMA 2YD2A 1ZPUA 2E7LC 1NM4A 3B2XA 5EO0A 5GS1C 2X40A 1HSBA 4F7PB 1M56B 1NUFA 4WWNA 2NY5H 2FR4A 1COBA 3ZDZB 2KT6A 2QMKA 5D1ZD 5PCYA 3T0ED 1G6VK 5AW2B 3ZL4L 1K8IB 1S8DA 1UWFA 2O5YL 1T66C 4FJZA 5GRJL 3T65B 3KVQA 3U6RA 3LCYA 4P49A 2XBTA 3QWOB 4PGDB 4HZLA 5KYNA 3RFZA 2K45A 1UZ8A 4FQXB 3OKOA 4M6NL 2C7UB 5FIEA 3NJMA 1MRFL 2CHDA 3WJLC 3EOAB 3MXWH 1T03H 4AEFA 2XX1A 4LCWD 4A2EA 4KUCD 1Z9SB 2H0PA 2XV2A 4NUMA 4DKDC 3FQTA 5EU4A 4P4RB 1L6PA 5I16B 4L48A 1BAGA 1RFDH 2NXYC 1FV1B 4QOKB 5B1JC 3VD5A 1BGXH 3IEAA 4Y5VC 2DMBA 5JHDB 3ZL4H 3J27A 5FYKH 3HZMB 1GS6X 4WGVB 5HDLA 4B53A 1OB0A 2BNRE 4FG0A 1BBDL 1UXWA 4FTDA 5EFIA 1GZPB 5HHNB 2ZSWA 2JI1A 2P46B 3N43F 3ZIYA 5C0AB 4I3SL 4NZTH 3U2IA 3SDYL 1B4RA 3WE6B 1P4BH 3G08A 4UT7H 4I3RH 1CFVL 2YKLL 4G5AA 2RTTA 3PL6D 1BZ8A 4MZ2A 4ODSH 4UBDC 4CBPA 4EI6B 3RJDA 32C2A 4YHLH 4X5XA 5AYUH 1NUGA 3T8XB 1XIWC 2YWYA 3VB8A 1CDUA 2APFA 1M2VA 4PJ7E 4U3XA 3HE6D 4B3EA 4N0CC 2J1WA 3GEWB 1A3RH 2YARA 3ERXA 1AP2A 3OC8A 4NFDA 4F2MB 3G6DL 4HS8H 4Y19B 1YEKH 4ACPA 3HBQA 4Y4HC 1NC4B 1OZUA 5DQJA 3HAEG 1VGEL 3KPPB 3ZDXB 3ZE2F 1IEAA 3PHQA 1NCWH 3G6JB 1A25A 1JDAA 1JZ8A 4HWZA 1WRFA 4GINA 1NGWA 1NIBA 4HVBA 1YAIA 4JQIL 3FTWA 1WIUA 4B9FA 1A14H 2OJZL 1E6OH 1PZ3A 1N2RA 1RZKH 1EJOH 3Q2WA 4K5LA 3GUFA 4JPIA 5DD1L 3SDAC 1FIGL 2NXYB 3D33A 1OTSC 5L2JA 2A9NH 5HHPB 1EAPB 2V5MA 1D5BA 4Y5VB 5IWLC 3K6SB 1PEZA 1ZWIA 2VC2L 3ZJAA 3ZXAC 1MCSA 1NGYB 2F54E 4A67A 4GG8B 2D73A 3L3IB 1N3NB 3ARFA 4L3EB 4L8DA 4K5NA 5E23A 1G0YR 3RI5F 2M83A 3GMMA 4X6CE 4AGQA 1I1RA 3TT3L 4KU1A 4ZO6A 3SYPA 1FBIH 2OZ4L 5I75B 3L6FA 1P4LA 3KEDA 5DVOA 1BVKB 1WZLA 4NQDE 1NSNH 2Q20A 2AQ1A 1E40A 4MJHA 4A66A 3BAXA 3K71A 1SYVB 5FYLL 3ULVE 1LO2L 3FULA 3S6CA 4JZJA 1MFAL 1X4YA 4NZFA 4ZTPL 3PWJB 2UYLA 3EIFA 4AE1A 1DBKH 3SCMD 3C6SA 1LMKA 5I1AA 3WFHA 1GZHA 2EINB 1BBJA 2VDML 3B3BA 5CEYB 1GGCH 2DBJA 5GZOA 2O5NA 5D5MF 3WXVL 1CTMA 2MOQA 4NRZA 3CDZB 3W0WE 3EG9B 1H0DA 1UQSA 3FB7A 1I9RH 1KLUA 2AABL 4YHOL 3LXAA 1J1XH 3KPLB 2Q2EB 3W37A 4MLSA 1FC2D 1WS7A 4PCKA 3DVNA 2R4SH 2E5EA 1U93B 4NQXB 2ID5A 3DTDA 4ZUSB 3WLWC 4KKAD 1CK0L 2BOLA 2XQYG 4K8RD 2IANE 4ZS7H 4PRIE 3VXPB 4XMZA 3N50A 4WSJA 1I1FA 3O3BA 3OR6B 4ZTOH 1AGEA 4Q6IA 1R34A 5JOEA 1XH0A 3BW9A 5EF3A 4B9GA 2J20A 1RK1A 2H6PA 1BCIA 3D2UB 1QATA 1FVDB 4UI2A 4EZMA 4B7LA 3QQXA 1P7QA 3L5WA 1I1YB 2AXGB 4HEMA 3EO9L 4NO5A 1J5OH 4R7DB 2YD5A 2V7HB 1YVLA 4NAJA 4JO2L 4PJ5A 4HHAB 3VG0H 1IEHA 3QUZA 4LOVA 4MMYB 4Q0XH 4GH7B 1L9RA 3REVA 1JPSH 3H0TA 1TCRA 2UY6A 3Q2NA 3PREA 1KLGB 3TT1L 4DGVL 4R5XA 2Z35B 3SGJC 2EDLA 2H1XA 4CSPA 4HEPG 4UT6H 1DQLH 5BV7L 4JQVA 3HN8A 1JNLH 4UOZA 3A4EA 5JUEL 4HSCX 4X7TB 4YHIB 3GJFA 4Z7NF 3PWLB 2YUZA 2VOTA 1SUJA 5C07E 4JG1L 1A64A 2BDNL 1SLVA 3U1SH 3FO2A 4FMFA 3P3YA 3IMBA 4PJBF 2B1AL 4PGEA 4Z7VB 4ABQA 1CDGA 1G7QA 4OCRH 2X1PA 2XTJD 4I0PC 4P23C 5C09E 2FYYB 5CZXD 3VFWA 1VADA 1I9JL 2WZAA 1MFDL 3BPNC 1W80A 2ZCLL 2OTWA 4NENA 4PV8B 5D1XC 5D7SH 5F0PB 2A73A 1U8CB 2YN3A 4TULL 4X8GA 4YZFE 3TV3H 3O2DH 3UTZB 4WUUA 3QIUC 3QFJE 4HCIA 1IGMH 4LBEA 4B9CA 2N7SA 3EJSA 2VDQH 3DRTB 4X7SL 3CFEA 1JNJA 4C4UA 3A4DA 1I85C 1NBVH 1QLFB 3AM8A 1G87A 4ONHB 4LAQH 3V5KA 2E86A 3H7LA 3NZUA 4A7UA 3MODH 1AO7E 4XXCA 2UVEA 5F70A 2VITB 3GRWL 5D7KD 5C08D 1JMXA 4JO8A 5D5MA 1G94A 2B3IA 1SVBA 2FECL 3LIZH 4X0KB 1QSEE 2WNGA 5EBMA 5T8IA 4NM8H 1IGCH 35C8L 4NQCB 1X5MA 4FQ1L 4URTB 4ZZKA 2V2WB 5I5RA 2VZOA 4MS8D 4N90D 2VQ1B 1S7QB 2Y7SA 4DCQB 1A4KA 4JFPA 4KKCC 2DTMH 4OZ4B 3V0HA 2OP4L 2KUTA 4TRPH 1KDIA 5T1KB 4AQ8C 4CMMA 2V9RA 3KPRA 2EQDA 4G8GE 3KS0J 4X42A 2BVQA 3T1FA 3X13B 1LO5A 1OAQL 5EIIB 5D7LB 1A3ZA 4AQ1C 4Z3EA 1T2XA 4GUQA 1YC7A 2VKWA 3MAWA 1MQKH 3I6LE 4WSKA 1WZAA 4PS7A 1E65A 4KDWA 4MJ2A 4PJFE 4WHYG 2GJRA 4ECNA 1SM3L 1WYJA 2ICWI 3VRIA 4Z3IA 4I0PB 4P23B 4Z5RA 1VKXA 4IBVA 1O5DT 1ZT7A 1WWCA 3BPNB 4I3GA 4OUOA 2W9EH 4TUUA 5A16B 2WVVA 1CTOA 3T8VA 3HW7A 3ECQA 3QIUB 1BVOA 2A9BA 1G9ML 3MUHL 5F2FA 3NCYP 4HT1L 1J0IA 2K4AA 2OSYA 3B9AA 4L4VD 3GSWA 2MCAA 4YR6A 4QUOA 3B6SB 1KNOB 1TZIB 4Q58C 2P43B 4JN1L 3NJHA 5LKNA 1W9XA 4NKOA 1SMDA 3WHXB 1U8QA 3OAWA 1GR7A 1UD5A 1P84K 3LQMA 3CBKB 1TJMA 5C0FB 4AZUA 3EHBC 3EFFA 5IHUL 3O9WC 3MUGA 2PWHA 1SHWA 4HJEA 1CBJA 2NUPA 3MRGA 1OK8A 4JMXA 5IMKA 3BLKA 1E9OA 4PY7A 3GPSA 2P80A 2WPGA 1Q72H 4JDZB 2VDNB 1E9QA 4RMUA 3GIZH 4PUBH 4AEHH 5LNGA 1MH5A 3TH2T 2R8SL 4FNSA 2NY4D 4PJ9C 3DROB 4M6ML 1FHGA 2XZCL 5ALCL 2EZ0D 3K8KA 2DH3A 3P2TA 1AHWA 2V4LA 4XVSL 1OP3K 4BKLB 4MD0B 4MXVE 4AG4L 3V6ZB 4JCLA 4KZCA 5CD3A 4GIOA 5F0JB 4R7NB 3OXRA 1CGSL 5JR1L 2BM3A 1WZ1L 3COOA 2FHFA 2HT4C 1CLYL 4ORGB 4WWPA 5G4OA 3ARFC 3AADB 1SLWA 4JR9H 1E4WL 1RUQL 3V0DA 1WGOA 2A4ZA 3UZVB 4QHLB 1DR9A 1NDMA 1RIUL 1WD8A 4X5WB 3CFJA 3G04A 3AQXA 4QXWA 5GGSB 3TJHC 4XP4H 2YUXA 5KOVC 2QFRA 3RKPA 5LN4A 4MYPA 1H8OA 4HF5L 2BY2A 1QTSA 3CX5J 5AL8A 5F7DA 4PLNC 5I15H 5ETUA 3P4NB 5IGXL 2PW2B 2Q7AA 4FKEA 2HRPH 4QYOB 5EU6B 4JZJC 5CINH 5F7FA 4N2CA 2ZF8A 3FTZA 3RNQB 2JKJA 2OW7A 4UNIA 5HDWA 5F6HI 3UAJD 1DO6A 4ZK8A 2IGLA 1ODAA 1L0PA 4ZJ9A 3UPCA 1ZE3C 2XCMC 3EHBB 3LQAH 5A2CA 4ZS6C 1YYML 3O9WB 1BSIA 3Q0HA 4XHQA 5C0ND 3OBAA 5FHBL 4KKZA 5E7BA 2ILLA 3AREB 3MZGB 4UUJB 2NTFB 3TEZA 1R5VB 3NAAL 5BOPA 1CLOH 3QRFM 3VFOB 5CCKL 5E9AA 2AMUA 2OM5A 3OXSB 2A6KA 3AG2B 4Q9RH 1QYGL 4OLUH 1H6UA 3EJJX 2RFXA 3OGCA 3V0EA 3MRJB 4DKTA 4MJJA 5JYMA 1T2QL 4PJ9B 2Z7ZA 4B9ZA 2BNUB 1CI3M 1SOKA 3FCSB 3TIEB 2IMMA 2HT3C 3ARTA 4H13C 4LCCA 4MB1A 1NFIB 3GO1L 5F1IA 1JXFA 1LE5B 1CICA 5IHHA 1SZNA 2EKSB 4ZPTB 3KWWB 1IILE 5SWQB 5DS1A 5FYKD 2I9TB 4EEEA 5CZKA 5KZCD 1Y1UA 2X4NB 4DP6X 4ZW5A 3I3EA 4MJ5A 2VZ3A 1HHHA 1LO3L 1Z3GL 3HRZB 3TASA 2ZNWA 1G84A 4CW1B 1XBRA 4N85A 3B1TA 1RUKL 5F7WC 1F6LL 3ULUH 2DL2A 3B2VH 2XA8L 4KJYA 3HRPA 2BX5A 4UOJA 5E4IA 3QUZC 2F7QA 2AJVH 4O2EB 3G9AB 4Y2LA 1E5BA 2IPTH 3B34A 3KXFA 1KIPB 2NOYA 3KWTA 4QRRA 3DX3A 4GEIA 3WGUB 5IQ9A 1JHTA 2AKRB 5IW6B 3BEWB 4OF8A 4U1GC 2W80C 2NY2D 1FCGA 1TJHL 2B39A 4H8WL 4ILDA 5DJ0A 4JM2C 3EYSL 1QWNA 3LSOB 4P4KB 4HXAH 3KYMA 3QXWA 2X2JA 4Q6YA 3S0PA 3NCWA 3IPEA 4U4BA 4AIXA 1IBHA 3PWVA 4Z7UA 2FCBA 5AW7B 4J6RL 5HHOA 3K3QA 5D4QA 5ALBL 1PD0A 2ITEA 3MX0A 4R2GD 4YSPA 3QQNA 6PCYA 5ES4B 4U1MB 3CLEL 4LSUL 1H9VA 5TE4L 1N12A 3FUDA 1KCLA 1S5HB 1TVBA 3AUVA 6FABH 4JPVL 2UZPA 1OGAE 4NI3A 4HUVB 2I25N 5AENA 1P6WA 5EOCL 3DV6A 3AS0A 3KH4A 4JCMA 5D6DA 5IQ7H 3IF1A 2XIBA 4G1MA 5T3XL 4NIKB 4K7PY 3DDFA 5DLML 3AGWA 1J48A 5CCHE 4FFZL 5KSVA 4P9HH 5CHNB 1XF5A 4NHCH 3ABKB 2IDFA 4UDTA 1RZFH 2ARJQ 4BH8B 1VFBB 2ZKYA 4CC4A 4KX9A 25C8L 4GOSA 2DMKA 4BZ1H 2D4DA 1A1MB 2FWOA 3Q05A 2BRQA 1WTGT 5HDOA 1IC0A 5EN3A 1WA2X 4H88H 1KJ2H 1U4FA 3LVEA 4LRIA 5L4IA 3S2CA 3VA2C 4Y2DC 2XDHA 3VQ1C 2R27A 1KCRL 3FFOA 3MVSA 3DDGA 3T77A 5FF6A 1ZSHA 1J86A 2MQCA 1N0XH 3M1BA 5ANHA 1PYWB 4XWOD 2DYSB 1KLFB 5IB5B 4HJTA 1NL0L 2Y9RT 1L5GA 3BO8A 4U1GB 5JOPD 1OSEA 3MU3A 5E1AA 1J87A 2EEFA 1JGLL 5BQDA 3DBSA 1G6RL 3OZLA 4JM2B 4WW1B 5BS0D 3NJGA 4LVEA 4M8QB 2O5XL 1MAKA 3O11B 4HIHA 2HKAA 1TXKA 5FO9A 1DLHA 4BD4A 5FUCE 1J8HD 4GAYB 5I76B 4XP6L 4PJ7F 3L7FB 4OSUH 3QORC 1ADQL 1Q0YH 3FQNB 2HWZL 1BQLH 4NM4H 2Y0SA 3BP6A 1FN4B 2O4EA 4OLWH 4KRNA 3WUWB 3L5XL 5AB1A 1KJVA 5FUZL 3KPSB 1G9NH 1BA9A 1TJGL 2ORBH 4Z3HA 5C0IB 2UZIH 4JUSA 1CXHA 2CK0H 1MFEH 4WI5A 3H4FA 4XZUA 3SO3B 3HMXL 1KIUA 4I9XA 1KMGA 5KVGH 2ZICA 2ZCHH 1GS8A 2IAMD 2DQDH 4N2HA 2X42A 1AAJA 3ECVA 3VWJC 2I32A 1GTNA 1O9ZA 3E6HA 4LL1A 2UY7A 4Y2DB 3QNFA 2D31A 4AENB 3APDA 1TZGL 1LNUA 5BVPL 5E2VH 4KVNL 1DVQA 3BWSA 4X6CF 4IU3B 2PKDA 2EVJA 2B2XL 3RWEB 2ZCKH 1I3GL 4UV7H 4ZAKD 5J89A 4H2CA 2EDJA 3PFQA 2DLFL 1CL7H 4PREB 2OULB 4FFTA 4UZSA 2XZQH 1YN7A 4HK0B 4LU5H 2QSQA 1QFUL 1MW0A 3QXUA 4QT5A 1RP9A 1I7ZA 3ZMNA 1NJ9B 5I1HH 5ABDE 3ULVF 3WTUA 3RWJA 3L4XA 3AU1B 4JZOB 5IVXB 3FT3A 2OX5B 3STLA 4QYAA 5H37A 3EJRA 3H42H 4BUQA 4ABWA 4P57B 4QEGA 5I8EB 4E68A 2UZXA 5LAPA 1JL8A 4ZO9A 3HG1D 1CXKA 1TVDA 5JIQA 3UIZA 5CF3A 2O26U 3GJFK 4LIQE 5ACLA 5HYIA 3PP3H 4I2XA 1DQIA 2BNRA 3GXUB 3GTNA 5J4MA 4A7GF 2MHAB 3HB3D 4EVNB 4H0IA 2CA4A 5DHXB 1NCIA 2J21A 2P5PA 4HA1A 3UZQB 2XQ0A 4OKVA 3QJFA 4FC3E 3EJYD 2CO7A 3L9RB 2QDWA 2X4UB 3HI5L 4HLZG 4WK4B 4RNRA 5E6IA 5GGQL 5ILTL 1CGTA 1KDJA 1RZIB 4NOFA 4TNFA 5AD0A 4ANUA 5HGBA 4XPFH 2X0WA 2FBJH 3ZZSA 2JXMA 3MRRA 1IBFA 5AZ2L 1NFDB 12E8L 3T5WA 1I3RB 1VJSA 5LGHH 2IDUA 1IAIL 2Z6FA 2HLAA 3D69A 3VWJB 2OTUB 5IJDC 5JHLH 4KK8D 2J88L 1G7HA 2HSIA 2CR0A 3Q8FA 1HS6A 2R1WB 1KPUA 2EYSB 2QQQA 4LEEA 2GYSA 4JGMA 1DBAH 3IDIA 4KVCH 1OAYH 1SEBB 2C3XA 3HJ0A 4F8PA 3K91A 1JUFA 4OZFA 4YLBA 1AXTL 1NGPH 4P2AA 1L9SA 2DTSA 2NX5D 4OD1H 2C9PA 3IXAA 4D7BA 4GAAA 4H5SA 3TBWB 3CSBA 1KYUA 5BO1L 1XGPB 5MP6H 4PD4J 3NCXA 3CDGB 5F7EH 4K3DH 4ZNEE 1GC1H 2L04A 3OR7B 4J1UB 4JFEA 1RI8A 3UDWC 3U48A 3T0WA 3ZQ9A 1CICC 4QRPB 4ANVA 3BVNB 3JTSB 4FI8A 4GUPB 4RWYH 1DBBH 1ODUA 1VA9A 4TSAL 1MN4A 3WIAA 4DESA 3OJVC 5E08H 2DQFB 4WHCA 1ES0A 2GJ6B 2R1XB 4OZGB 5DQJB 1KOAA 1AC6A 1SDDB 4LPCA 3US9A 3GRWA 1KYOK 1ZEAL 2DQIH 4FHBD 3OJDB 3ZHNA 1UFUA 2AJZA 5DK2B 3MR9B 4U49A 2QQNH 5DSCA 4WIQA 4X6CA 1F3DJ 4BSJA 4LSTL 3FFDB 1D9KD 3CDFA 4RGNB 1A5FL 4PRHB 3MLZH 4PJDE 4PWGA 5LB1A 1UKQA 2B9AA 2BHUA 2K4WA 3PGCA 1KYAA 1QRNB 4OFYA 4YZFF 1WIOA 5DHYB 2H2SD 4NYLB 2ZKWA 3RAJL 1P7KB 3V52L 1LEGA 1KEGL 2FEEL 5DD3L 3B9KA 1OCRB 2EILB 1BXVA 4EBQH 3IS1X 1ITCA 5M7QA 4NO2A 1KGCD 4XXWA 4M1GH 5JOFA 3D85A 3RBSA 3QULB 4LNVA 3VXRA 4RMBA 2X3AA 3OMIB 3O8XC 1OXYA 4X98B 1KTRL 2X89A 3IMUA 1TVHA 2ZF9A 3T3PE 2WBJC 1FYTB 3HHSA 2E74C 4NPYB 5SX4H 1F2XK 3F7KA 5KJRH 1J5CA 5MEQA 1CL7I 3GM0A 4WI9A 2K3HA 1BIHA 5A2LH 3CAFA 4P2YA 1P1VA 4FFYH 4EQ2A 1QLEH 3BGFC 4M5YH 1JZHA 4PJ8B 3VXTA 4AQAB 5FYJE 4N24A 2YPLD 1FGNL 5BOZG 1BVLA 4U0RB 1A4CA 1MLBA 4N28A 3PQYA 4O9HL 4JB9L 4TYUA 5FM4A 1NCCL 2NW2A 4YHZL 1H8LA 1MLCA 1D5MB 4G9DB 2VABA 4UIKL 2Y1AA 1ZS8A 2IANA 3AZUA 4PRIA 1IC4L 4LHQB 2BVPB 5HY9B 2K6YA 1N0LA 4R26L 3QIBA 3O3EA 4K23H 1SBBA 5AVQB 1CQKA 5I1CL 3V6OE 3P11L 4M93C 3QZWG 1I8AA 5DI8A 2YSSB 4PJFF 4AYDC 2WQWA 1ICTA 1OP4A 2EE6A 3QUXD 2FL5B 3FONB 5HHVL 2E7HA 1IBYA 5EU7C 5AAMC 3DVIA 2WQUA 3UC0H 4QF1B 1YYCA 4TMPA 4AW4A 2NT1A 4Z7AA 1OV8A 2XVGA 1KENH 4IQHA 5I0DA 3JYBA 1JFQH 1G7MB 4GFXA 2JSFA 2YGQA 1AE6L 1G7PB 1CYXA 3HNSL 1DE4B 4IK6A 3AJ7A 4XCEA 3QFDB 4IKNA 3QA3B 1ETZB 4X8JB 1AD9B 2YA2A 4RIRB 3O8XB 4LLAA 1D7DA 2PWEA 5GGRB 4LLYB 3WIHL 4R83A 1F11B 4F9PA 1ZLWK 4EZJA 2VCOA 1ED3A 3EJPA 3B7SA 1M7DB 3HZKA 3POHA 5DQ9A 2YXFA 3V55A 3UEZA 3BGFB 1HHKB 4JFQA 3FOMB 2IFFH 4H20H 3Q8AA 2GK0A 4RMWA 3S5LA 3X3FH 4PJIB 1JZ2A 3NBNA 3NFSL 4GRWB 4R6UA 1FL6B 5C09A 2CA3A 2EUVA 2Q76A 5C92A 4LOEA 4ZMOA 3UTTE 4NI6A 1BFOB 2V5TA 4HCGA 4UILH 4ZFOA 1KELH 3BSZH 4LSPH 3WELA 5D2LE 3QFJA 1WHPA 4YHPA 2RQ8A 4U1SB 2GIYA 5CUSL 2ATKA 1OY3B 2H0EA 1T7ZA 1I9IL 2F2HA 1EO8H 4P5SA 4OLZH 2BIMA 4BZYA 4MXVF 2YQ3A 4TV3A 5AOIA 4C83A 4NAQA 4XNXH 3QEGH 1VFOA 1WA0X 3BZFA 4KJWC 1E8XA 1AO7A 4Z95H 4ES9A 5EWIH 4BA8A 1FNEB 4F7TB 4XBEL 5T1LA 3KWVA 3T04D 1URZA 1U91A 4AIEA 2YA0A 5ESVB 3GEFA 1AI1L 1OM9A 1QSEA 4J3OH 3UO1H 1XDTT 3PPEA 3RGBA 5J3HD 4U1LB 4YWGH 2RALA 2AJUH 2C8NA 2CZNA 3O4OB 4JO1L 4M9PA 4N8CH 1SF3A 2E59A 3C9NA 2V17L 3T0EE 4UTCA 4LSSH 3SDDD 1Q0XL 2F61A 4HKJA 1JPFB 2C3HA 4G8GA 4RSVA 2BSEA 1JK8B 1JHKL 2I27N 1O75A 2QGBA 4PJCB 4XN1A 4H8PA 3QI9A 4ODVL 1YEIH 2EXTA 5AVSB 5E9DB 4E9LA 1WFMA 4LCWE 3NESA 5CEZH 2XICA 4CAGA 3ESNA 4PVMA 3NTCH 2Y1VA 4YDVB 2H5UA 3DVGB 4FQQA 5JO5B 5CD5D 2J25A 1ZVNA 4AEEA 4TLKA 2GFBA 4OJFH 4GAJH 1DANT 2G5UA 4NJ9H 3CVCA 1S3KH 4JFVA 1MWAL 1PLCA 1YQVL 4ONGH 5FX3A 3IU3A 4L5FE 1WF5A 4PGBB 3TA3D 4CGUB 3OMZA 5F9DC 3DKHA 5KBMA 3RJQB 1TYRA 3V5HA 2AVFA 1M7UA 4AM0Q 5D70H 5BV7C 3GJEB 3MV9B 5EEXA 2WSDA 5F96L 3DJ9A 5KOMC 1R33A 1H8NA 4ENED 1DBJH 4F3FB 3R06B 3NJIA 4HYTB 3PXLA 4HUMB 3F6JA 4DAGL 5DRXB 4LLQA 3F05A 4MSWB 3EYUH 2AEWA 3QISA 3U0WL 3NZ8B 4PG9A 2ADIB 2EVFA 4XP1L 4JG0L 2XUWA 4M7ZC 2VXQA 2MIZA 2V7NA 2E6QA 3HNVL 4ALAC 2Z3FA 3DX4A 4K73A 2Q6WB 2A1WL 5DHVA 3HI1A 5DFVD 5T1DL 3CN1A 3RGVC 3FCTB 3GUTA 3OLIA 3DBXA 2Q0ZX 1XWVA 2WUCL 1HHGA 4MAUL 5LWYL 1DJYA 2EC9U 2V9QA 2Y5QA 3HR5A 5C0JA 5DVPA 3FOLA 1V10A 1F3JB 4HPYL 1M4KA 3LN4A 1MI5A 1WBYB 3MJ9A 1PNDA 3MOAL 2OXHB 5FM8A 5I6PA 3VGBA 1EEYA 4X9IA 2YHGA 5BMFH 1PZCA 3DUUA 3S3SA 4WTZA 1FG2A 4GPVA 4QLWA 5DUPH 3CWGA 3WGVB 1BAFL 8CGTA 3CCHA 1QFWL 3QNXB 3IAQA 4PI0A 4NQEB 1J9RA 1OIOA 4WU7B 3X11A 2Q8BH 4AJ0A 1V5JA 4PFEA 1WWAX 1EPFA 1RURH 4X9YA 1A0QL 1BF2A 2WXKA 1DQDL 5FPIA 2A9CA 3FH8A 4Y4KD 2VR5A 5E8DL 2DQUL 3TZVC 1KT2B 2VE6B 3CZUB 1KTLB 5AZEL 5DJAA 4IBWA 4OJYA 2E27L 3GNMH 1F00I 3AITA 5CCJA 2CGYA 3VXUB 5DYOB 4IGBC 5DU7A 3UBXI 2BHFA 1IAOB 2W1NA 1NMAL 4IBYA 5CMAB 43CAA 1AHKA 1OLLA 2YJLA 2OMXB 3OL2A 2IWKA 1KCWA 2HFGH 1P6FA 5HJ3A 2J4WL 3H3BC 3RGVB 3VACA 1GKOA 4MKTA 4WJKB 2BFVH 1SEQH 3FUFA 4G80B 4Y88A 5GS0L 2F08A 1DSFH 1QHOA 3E3QE 5CIPB 5DMKA 4WAFA 1KIQB 5TDOA 1F90H 2FJGB 5IB2B 4P2QD 1MHPH 2HN7A 1N18A 5K1NA 2NY3D 4NWTL 3U2SB 2ZX7A 4I4WB 2WO4A 3CSTA 4K7PX 4Z8FH 4UT9L 3ML8A 1JGIA 1SDYA 1HNFA 3FYIB 3WKYA 5JMOC 1RERA 1R17A 1P2CA 2R29L 3C2AH 3FQRA 3C12A 2OSXA 4QHMA 2X87A 3JYCA 1W0WA 2GEQA 2QMJA 4QPEA 3PAUA 1T04B 3OHMB 2AGJL 2VZSA 1MCWM 4ZMQA 3LRSB 5KEZA 5KVFH 1TNNA 3MNVB 3IFPB 3T4YB 3LTVA 4E0RB 1FLRH 2P49B 4OFKA 1RL1A 4U6XB 5KYXA 1QA9A 3UYRH 1HFUA 5EA0H 3FS9A 4E9YA 1S9YA 2K0RA 4FX5A 5EOTA 1VEPA 1XR9A 3SODB 2CKBL 2N1TE 1H5BC 4NLAA 2F7OA 3EUUA 5IBUB 4X99A 3RX7A 2MOGA 5LCVH 2FSEA 5EORL 3ARSA 4IGBB 1DQQA 2FX9L 5F7AA 4JM4H 5BW7A 4W4OA 1MREL 2MRYA 1KXQE 5MEPA 1MCCA 4GG6B 3L5IA 3V6BR 2XTJE 5F3HA 4Q2ZB 5EU3B 5EUOB 2ZOLA 1MRDL 2Z93B 2FT8A 1NM9A 4HKBB 5GJSL 3RDTD 3ATFA 3TCXA 4KDTA 1DEDA 4BSWB 5HYJB 2KYIA 1KBKA 3D4CA 1DQML 3K80A 4UQIM 4W9HC 3LKRA 1OF2A 5FFOA 3AG1B 4Q9CA 3LHAA 2WP3O 2BY1A 3IMWA 4K15A 2DF3A 2BSSA 4OGXH 3U7YH 2CU9A 3WXWL 2DYPD 3D0LB 4ZQKB 3VH8B 4L8CB 4DO4A 1MCJA 5F0LB 3KAAA 5I0YA 1U9KA 2PLTA 3LEVH 4TPRH 1CU4L 5D7KE 3AROA 5C08E 4XBPA 1AANA 5IG7B 3T2NH 2GITB 4JFWA 3DXAA 4QXUL 1I8LA 1MFVA 2DJSA 3EFOB 5CJOH 5T1MA 1IQDB 1OLZA 3S35L 3V4PB 4NUGH 4M5ZL 4JY6A 4F20A 4PVNA 3DMMD 4GQPH 4WO4C 4N90E 5CZVH 2WLYA 3WE1A 1MCIA 1LK2A 1Z2KA 3N3EA 3P9MB 4R4ND 2WWKO 3F7RA 3HZYA 4M6OL 4PV9A 5I0XA 3LXBA 1TU2B 5ENWB 5DD6B 4A38A 1GOGA 5D93C 5H4YA 1YEGH 1H3GA 4H7VA 1YNTB 2VXVH 4PBXA 3RG1C 3D7PA 4C57C 3QS3A 3MPCA 2J1YA 5H94A 2ITCA 1A1NA 2KHAA 4HS6B 4U31A 5IESL 3L3GA 1R4XA 4KXAA 3PGDA 5K9OB 3RWGA 1ZS2A 2R7EA 1MCPH 2P8LA 3LNFA 3KVPA 3H1ZA 3I9GL 2P28B 3BKJL 2Z7YA 1LDSA 2IPKA 2Z1PA 3GSVB 4RRPG 5FGSA 4Q6KA 4JRLA 3D1MC 1MHCA 4PJXE 5ICXB 2V37A 2IMNA 2LU3A 1QRKA 2HRHA 1WFOA 4FQ2L 1Q1JL 4AWJC 4NWUL 2PYFA 1JNHA 2GTZB 4K7PH 4KITB 4L4VE 2ODHA 4XPHH 2OYKA 2KLTA 3IFOA 5M95B 2XRAH 3H3PL 1EMTL 4JY5H 4EN3C 2BIPA 5IB4B 2FGWH 2WTOA 4HMEA 1MG2C 4OB5H 3JV4A 2CRIA 4ZOEA 5T33L 1BF8A 4LLMA 3PXHA 1BFVL 4JRYD 3GMRB 5IK3A 5DS2A 4QKTA 5IW1A 3QUYC 1CBVH 4LASL 2AJXL 1M42A 3KL0A 4AITA 1CF1A 1NC2A 3LV3A 4WO4B 2CUMA 4X9HA 5D1QC 4X4KA 5E8OA 1HEHC 3LMJL 4PJDF 3ZE0F 4IDJH 4AGOA 4M48H 3FCGA 1XB3A 2ZXEB 1LVEA 2HUHA 1RJLA 4PBWD 1G7IA 1AXIB 2AXJA 4OCWH 1XSIA 4YE4L 3IFNL 4LESA 2NTSP 2OMWB 4WEBL 3TLRA 2QPDB 2VLRD 4EOWL 2K1MA 3T3PF 1YZZA 3MNZA 2OMZB 3RFRA 3KLHD 1MIEH 3UYPA 4KFZC 3FZUC 4N6QA 4P5KA 4W6XB 5JPMA 1CTNA 3CVHB 3S4SA 4YSDA 1F13A 4OTXH 4UZUA 4W9IC 3TGXA 3Q01A 3RA7L 4ZUWB 1VGKA 4N86A 4XXDB 5DVKA 5HI4C 4A68A 1K5WA 1T4KA 3O2WH 3MCLH 3AS1A 4I9WD 4L4TD 3WV0A 3K8MA 4HG4K 3BFOA 4BEIA 3T08A 1FZKB 4NNPL 3LKOB 4ETQB 5LUMA 4KJQC 3MCG1 4EN3B 2X4RA 3FRPA 4KTDL 1T1ZA 3O3DA 1C5CL 3Q6GH 3WIHA 1EFXD 1AGDA 4PJGE 4YDIH 3TXAA 4Z7OB 4ZFFA 4JFFA 1GYVA 4UQ9A 3RVTD 3A24A 2YAEA 3NQIA 1QW9A 2AJSH 2P48B 1MDAA 2ZWSA 3ZKXB 3QUYB 4OUUB 3BPOC 3P30H 3WNNA 2MPVA 1I4FA 5D1QB 2L0DA 3VSVA 2MKLC 1A6UH 3OZ9H 3KZ8A 4Z7QB 3HPJB 3KDPB 5EC2A 5DQDL 4JLRA 5IOPA 3ZSSA 2YEZB 1MHHA 4P46B 1ZE3H 3S36L 3IFLH 3B3IA 4B3VA 4ZW8A 1MOEA 3TO2B 3UC2A 3CZSA 3EYQC 3FQXB 4NNYB 3UTOA 1T66D 4XMVA 1IC1A 2VISB 3GIVA 2AEOA 5B21A 3ARDD 1NGZA 3U82B 3VW3H 5HSFA 3O6MH 4JJHA 5LDUA 3SZKC 1S5IL 4N3TA 2AJYL 3W57A 3SJVB 2YS4A 4ELME 2V3FA 3GYRA 4AMKH 5FYKE 3W2DL 2BVOA 3CQPA 1CDHA 2XFXA 3WY2A 3DTXA 1K6QL 1W0VA 1BECA 1OGPA 1D6EA 2R0ZL 2Y69B 3THML 3TN0B 2VLJB 1MY7A 4ZOCA 3UJJL 5BVJB 3D9AL 2PXYA 2J8UE 1HOCB 1NAKL 4XPBH 3V95A 3NIFB 1KBPA 2X6AA 2C9UA 3CH8A 4ZBJA 3UTSB 4QR7A 4DPCX 3HC4L 5D2LF 4ZI8A 5JIDA 1TQBC 1QR4A 1PZ5A 1FFPB 2XKNA 5C6TL 5GZNC 1AKJB 2CE6A 3PAVA 1WD9A 3I50H 3NJLA 1R3JA 4DZBB 4ANXA 4PJAE 1SXAA 3HMWL 2UXFA 5JHBA 1JV5B 3BPOB 3MMEB 2YD1A 3BUQA 4X9FA 3CPLA 1Z6JT 3GDBA 4IRJC 5AZUA 1WTLA 1XIWD 1SMAA 1JS4A 3FN9A 3BP7A 3JT0A 4HOXA 2VDKL 1HSAA 4N0CD 3MBEC 1HINH 4G70B 3T4AC 4JMNA 1AFVH 2RCSL 3T2OA 5F72S 5CBEB 3FO9B 4Y4HD 2JCCE 1XGTA 5KSUA 5DR5H 1XXDC 2MCG1 2CIKB 3QUMB 3VFRB 1YEWA 1D5IH 2IPUK 4ZUVA 3LEXB 4S1SL 4KK9C 2GG1A 2P8MB 3QR0A 4KUCF 4B96A 3U25A 2FT7A 3F12A 3V6OA 4K07A 1ZD6A 1DFBH 4HUXA 4RSYA 3QNZA 3Q5OA 3SDAD 1HYSD 5KUKA 4YIQB 5MEOA 3KLLA 2HFFA 4LCIH 1U8IB 2AANA 1J12A 4V1DB 4XH2A 4V2CB 5DJDA 5C0CA 1B3JA 5KG9B 1E43A 4WFED 4WV1A 3DECA 1HILA 2HVKA 5E94A 1KBWA 1JNNH 3TP4A 4LP5A 2F74B 2X1OA 1NMBL 3Q6FB 1FH5L 1ZHBA 1T89C 3DOSA 2XVKA 3E8VA 2DS4A 4LLDA 4A39A 3KPOB 4N2LA 4HIJA 4HC1H 1K3ZA 1Q9KB 1UM4H 3EGSB 4KZEL 4N20A 2OR9L 4TSCL 4NC1E 2ZYSA 4PBDA 1IKFL 3QZOA 5BS0E 5GHWH 5C2BL 4XHJC 3MRFB 1H3TA 1X5JA 3FF8A 1CDJA 1JHLL 5EBLB 3LNDA 5SWSB 1SY6H 2NY5L 1J8HE 4IRJB 2Z91A 4NB7A 1Z5LB 2Z31D 1E8WA 4U3SA 4IDLA 5K39A 1CWVA 1RMFH 1ZT1A 2GB2A 4NFCA 1ITBB 1ML0A 2JKIS 3MBEB 3T4AB 3EJZC 1V3KA 2ICES 4OD3L 1YJDH 1C1EH 1FNSH 1IE4A 4M8UA 4Y4FC 1TKWA 4J3OG 3APMA 4FL4C 5JW5B 5FGCB 3VXQA 1T03L 3UTTA 3KNBA 3MXWL 3FT1A 4F8QA 5L2KA 2WXLA 5I1LB 5DRNB 2VR7A 3SKUD 3WLWD 3WN5A 1SYSA 1M6OA 1RFDL 1YEFH 3UBXG 2E3VA 2IWEA 4HOMA 2YD6A 1BGXL 2AFNA 3PWPB 1OAXL 2XY1A 4YBLB 4HKXA 3LKPB 1ZLEA 2HB0A 2NLJB 4M3HA 3SE4C 3WL9B 3GZKA 4PG2A 4P5TD 3P02A 1XF2B 3FSZA 1LO0H 1BIIA 1O6TA 4LVHC 4YSAA 2XQYA 1WFJA 2QHRH 1NH6A 4HAKA 4B7IA 2L7JA 4H25B 5D6CB 1GGBH 1NGQL 5H35A 3RUGE 3RRQA 5IROC 1TIUA 4HUUB 5C8JA 4JANB 3RHWK 2BSCA 2GSGA 3LZQA 4IOSD 1JTPA 4BFNA 5HHXL 1E7VA 5F9WC 3I3BA 3DX9B 4Z0XB 2CLRA 2VLKA 2IC2A 4AKOA 1I8MA 2DDQH 4YHLL 4L23A 3SE9H 1C5BL 1CLCA 3LEYL 3QQ3B 3QW9A 1PX4A 4YUEH 3HC2A 3KHOA 1A3RL 4Y9BA 3ET9F 3NPSC 4JAMA 5LBSH 4UT9A 4MDJB 4MNGE 5ISZB 1WICA 1S7VA 4HS8L 5FOBA 5ESAB 2DLGA 3HG1E 4PB9L 2BNQA 4F91B 1F1DA 3GBNH 3RKDC 4JFDA 4GQQA 4AGLA 4HEPA 4Y4FB 4L9LA 3F04A 4Y9GA 5EG6C 3CC5A 3CE1A 1FG9C 1ZIAA 1TQTA 3D18A 4ZXBC 1MFBL 4HU2A 1A9BB 2D7QA 2G2PA 1E6OL 2X4OA 1AACA 1OD9A 3ZTEA 4FTVA 2Z65C 5D1XD 4HH9B 4QTHA 4OLXH 1T0PB 5EO0B 3O6FC 5JW3L 1THCA 3C60D 1B4JH 1NEZG 1RIVH 3VD9A 1R24B 3LD8C 3OKNA 4N8VB 3EAKA 5IEKA 4WFFD 1BEYH 1O6VA 5JLZB 4XRCA 3PL6A 2OJEB 3JWNH 5BRZB 4U33A 4WI4A 5CWSB 2R1YB 4EDXA 1UENA 3OKMA 4R97C 5JNYB 3HUJE 3QIWA 1WWWX 3U6RB 5IB3A 2VQUA 2XHNA 3H3KA 4FE9A 3RFZB 5J6HB 2VR9A 3VFUB 1UZ8B 2XV0A 1TUPA 1YMHA 3GB7B 3LPWA 4Y89A 4ZFZB 3CHOA 3FT9A 2VAAA 3HE6A 1CJYA 3D12B 4G6AD 5F1NA 1KY7A 3Q1SH 4E41B 4N8UA 2Q8AL 4NT6B 3GSQB 3ZDWA 2WV3A 2AW2A 1PLAA 3WIFA 2HKFL 3HBPA 2NX5E 5F9WB 1Z9PA 4Y16A 3WJJA 4DZ8A 1P53A 4JDTL 3WS6A 3NDYE 1A02N 1NCNA 3F85A 1HWGB 2I85A 2Y2WA 2E56A 2WWKT 1XGQA 3OAYK 1RZ8B 1X5XA 2ZX5A 4MCNA 4YQXL 3RB5A 2GSIB 1ZDQA 4NRXA 3VGAB 5I6NA 1A6AB 1I9RL 4K55A 3DUSB 1J1XL 4X5PA 2X09A 1JWSA 4YGVB 5E5UB 4MJID 4P07A 3LRHA 1E3ZA 3GHEH 3OKKA 4N26A 3WHE0 5ID1A 5KVEE 1RHFA 1ZGLP 4LKCB 3IRZA 2YAQA 4ZXBB 1ZMYA 1DJZA 4Y2NA 1PD6A 4HKZA 4ERSL 4PMFA 3FBQA 4LDLB 3CMOH 5IUCA 2CCWA 2JKWA 2ESVD 1Y18A 3BVWA 2HTKC 4ZTOL 1RP8A 1M2VB 3WEXA 3LD8B 1QBLL 4IS6B 1UWGL 3X1FA 5D2NB 1KGCE 2OSLB 4AC4A 5KYWA 2NW3B 4GI8A 4R97B 4N0FB 2O5YH 2PCFA 2WVSA 2XWXA 2YPVH 3EO0B 4AYID 3SEPA 1D6VL 1DJWA 1WCBB 2AZAA 1IEAB 3S96B 4WI3A 2P7TB 1UT9A 5E8NB 3L1OL 5ERWB 3SBPA 3MLUL 1NGWB 4PRPB 3QCUL 1V7ML 3UZEA 1MRFH 3ARBC 3T0XA 4Q0XL 1U8JA 1N2RB 2D3JA 1AZCA 5E51A 4IRSC 3P3UA 3EHBD 4A7TA 2F53A 3R4RA 3QO0A 5FO8B 3OB0H 1H9DA 5DJXB 2YPLE 3FTYA 2VDOB 3I84A 5JXEA 1CXIA 1DQLL 5AL0A 1ZWIB 4Z76A 4E9VA 3NOIA 4NKDA 2VZ1A 3TPKA 3UIYA 1XT5A 2EXYC 2PN5A 2YD7A 3MV8A 1DJGA 1J05A 2DM4A 3U1SL 1BBDH 5EF0A 1IZKA 2H47C 1AQHA 4GRWH 1P4LB 4I3SH 1A4JB 4O02L 3S97C 4GO9A 4ENZA 3TO4C 1BXXA 4OCRL 4XNYH 2BW5A 4JN2A 1GJIA 4PRAA 3B4NA 1HEJC 1VRSA 4X6BB 4GS7B 4KXBA 2JKSA 1YECH 3TV3L 3K1KC 3QUKA 2BPBA 2W0FA 3O2DL 3ARFD 1IB5A 4PRNB 1IGML 4P3WA 1ZJBA 2APSA 2WWMD 4PJXF 4BFBD 2VDQL 3GQFA 4UANA 2PP7A 3O6KH 3X1NA 2H9GB 2JWYA 1MAJA 1B3IA 4HFWA 1OT1A 2X70A 3B7UX 3N9GH 4G59C 4LAQL 4D9RD 1MCBA 1KLUB 4WW2A 1UACH 3G6DH 4LGRB 1PY4A 4GIAA 3B2MA 3BSHA 4CBZA 3SDXE 3IBOA 3JWOL 2OYLA 3S5YA 3LIZL 3N43B 5F1KC 4M43L 5ICYB 5JORB 5IHBA 4NM8L 4YO0B 3ARBB 3JV6A 5T5FH 2DQJH 4LHUA 4JQIH 2YEQA 4IRSB 1YA5A 2OJZH 4M61A 5GZOD 4ZS6D 5TDNA 1M53A 5DD1H 4WGKA 1A4AA 2ADJB 2ROXA 3G9VA 1HDMB 4TRPL 4AGMA 1MWAB 1FIGH 4GBXC 5HGDB 1QEWB 4JK0D 5IHLB 4RZCB 4NQVA 3RTLA 1T4WA 2H6PB 1AQKH 3I02A 4QTIL 1A7OL 4X4YA 2WZPD 2FO8A 3L5WB 2NYYC 3F8UB 4NO5B 3ARZA 4XBMA 3TT3H 3QEHB 3ZTNH 2UV3A 2CO3A 5C0DA 2OZ4H 5AB2A 3UCQA 4MWFA 5CJQL 1XO8A 7FABH 3QQ4A 5D9SB 4G8IB 2VMEA 3M07A 3BWZA 3ECUA 3TO4B 4YHNB 3GK8H 3Q3GA 4MAYA 5HYFA 4JFZL 3V7AE 5HDQH 3ZE2B 1XF3A 1QI4A 2W9EL 5FYLH 1LO2H 3FF7A 4NQQA 4EXKA 1L7IH 5A7BA 1LILA 2AITA 1X4ZA 1EGJL 1I9EA 5CLXA 1I1AA 2RIKA 1Z0NA 1U92A 2H26B 3J7HA 5J13C 3V7MA 4PRBA 3STZB 2E75C 3EGDB 3MLWL 4AH2B 1CYGA 1EZLA 4J3BA 3KG5A 4PJ5D 5E03A 3WXVH 3SYOA 3M88A 3EYVA 3QUZD 3TC9A 2VLLA 4IIQC 5L9DL 5GS0C 1MSPA 3LKNA 5D8JH 5FLVA 2AABH 5DD0L 5KBPA 1G7QB 2N1KA 3N1GC 3ABMB 4LNRA 4TQ8A 4NHUB 4W9FC 5CGYC 4PJGF 3WJMA 1CDYA 4FA6A 3MV7B 5AG8A 2K7PA 3VI3E 4A6YA 3W1ZA 4EZLA 2R2BB 3ILPA 3VJ6B 1L7TH 2WXIA 3MOBL 1MCWW 3UACA 4LDOB 1Y0LB 1BG9A 1QR1A 1KB5L 1J8KA 3CX2A 4GBXB 1Q72L 4L9LC 3ZL2A 3JSSA 3VI4A 1ET7A 2VWEC 3GIZL 3P2BA 4ZSOB 4KTGA 3RIAK 1E2WA 2WBKA 2ZWKA 4PJEE 3QDJB 2H32A 2RB8A 4PJXA 1ND0A 5D5MB 1YY8B 1JZJA 3V4UL 5CAYB 3H9HB 2CALA 3NT0A 4KRPC 4L4VA 4TLSA 3UFIA 3VWKC 2PR4L 4AUYA 4JO2H 4J4PC 4AIZB 4LLVA 5J12C 2FX8L 2Y5TA 5D7IA 1CQYA 2BWIA 1A4KB 4JFPB 4ELMF 4F7CB 5CSBA 1UGKA 4DP9X 3QH3A 2Z7WA 2DIAA 3O45B 1SJXA 4W93A 5SX5H 5BV7H 1F58L 2AP2A 4IKLA 2JFCA 2ZKXA 5JUEH 3QXDA 4XP4L 3SGKA 1W8NA 3TX4A 5I30L 3X2QB 3MRDB 3FSOA 2PYEA 3VYOA 2J8UF 2ICEC 3GMQB 2LTQB 2P5EA 3L3KB 2AEPL 4MX7B 3D39A 1F8TH 2HRPL 2VM4A 3RY6A 1BPVA 1GA2A 2AVGA 5JIMA 1JGDB 3KYNA 3V0VB 2BINA 3VRIB 3GSXB 4DN4H 5FK9A 3ARGA 3KPRD 3DSFL 4OY9A 3D0VB 1K3IA 1KCVH 4ADIA 2BCMA 4JKMA 1QHQA 3QQDA 4PWKA 4ALAH 1TMQA 4TULH 3F83A 1C7TA 1MXGA 4HIIA 4PJAF 1XCQA 4ZQTA 5HYSB 4DF9A 5INDB 1CLOL 1UXSA 3NJXA 1MFNA 3LZPA 4G7QB 5FA3B 4DP4X 4BFIA 2DYRB 2Q3ZA 4TUKL 5TGBA 1RVFL 2ZG1A 3FMGL 4OLUL 5CIPH 1JV2B 4NKOB 1TZAA 3BZEB 4XZ4A 2NDFA 3QORD 3WTXA 1IARB 4Z7NB 5HHQB 1IAKA 3GKZA 1LD9A 2QTEA 4WLCA 1VDGA 4MD5B 4GRLC 2JCCF 2BSRA 5I26A 3EFFB 2WXGA 2ZXCA 4KRPB 5AOLA 3VWKB 5IJKC 4PJBB 5KVGE 2LU4A 1BJMA 35C8H 2CKBB 5TF0A 4FQ1H 4RLDA 5J12B 2WQAA 2I24N 5DA4A 5DC4B 1DN2A 5ESQB 1N6UA 4ODXA 2J43A 3BX7C 3HVDA 3ZHDA 4DPBX 4E9SA 2C1PA 3HPLA 5DK0A 1E9QB 1GZQA 4XGZA 4Y1AB 1E4HA 3L13A 3ULUL 1IQWL 3B2VL 1FPTH 3ZE1E 2VL4A 1FFOB 3M8OH 1GMIA 3NZSA 4ZX5A 2AJVL 2ICEB 4KDVA 4LVNC 4A2DA 4K7FA 2IPTL 4IKJA 5JZ7C 5FGBA 1AHWB 3NJVA 3UTQA 4CRPA 5F0MB 3W38A 2AJ3A 1E90A 3BAYA 3C75A 4QTFA 3TBTA 3OXRB 3U4BL 3QQ9C 1R5IB 3M1OA 3OX8A 4E42A 3FAWA 2P80D 3BT0A 4NZUH 3QEQB 1TSRA 3NRQA 1I7UA 5G5DA 5MERA 2B14A 4D9QD 1IM9D 2RA1A 1QSFB 2AK1H 4P2QE 4PAZA 3ZU8A 2HVJA 4CSTA 4POZC 2DEYX 4MLIA 2OZNA 2J7LA 3D25A 4TOYL 4HT1H 3RVWC 1XZ0B 3V0GA 3MRMA 6FABL 2HH0H 3RWHA 2E47A 4WFGD 4XODA 4HPOH 4XOBA 4JN1H 4RESB 3SGDI 1WFUA 2F6AA 4XCCH 4KK6C 3IDGA 2J8UA 2DEWX 4GRLB 2NY6C 3OG4B 3EDDA 4U2YA 1RZJL 5DURD 4HHGA 2CDEA 4FKHA 3T0VA 1T20B 2QADB 2UWEE 1RZFL 1KJMA 1ZHLB 2Y25A 5G2NA 2NSQA 3LZFL 1L6ZA 4WO0A 5ACMA 4QRBA 4G83A 3AW5A 2N0MA 5BNXD 4BZ1L 3QPXL 3RVXC 2ITDA 2VJ8A 3QS2A 1XGUA 4YLCA 1KJ2L 4GKNA 1DVSA 3GSUA 3KL3A 2R8SH 4LVNB 3WUWG 2FWSA 3MHZA 4H1LG 2IBGA 3LVTA 5ALCH 1B4LA 1DDHB 1ORQA 1S7TA 2DD8L 4AVJA 5E8EB 4EKXA 3I6GA 3RUGF 4GW1B 1EDHA 1S7SB 1BM3L 1XR8B 1XD0A 1MKFA 2UZYB 5HGAB 1CGSH 4DP1X 2QEJA 4UINL 2Y7QA 3K81A 1OW0A 2ADFH 3BP4A 5DS8A 4RZKA 1O9WA 1QHPA 3GMPA 4LKXA 4RAVA 4NP9A 5I0VA 1RIUH 3WFBH 3IETA 1SMOA 1RZPA 3SQBA 1CICD 5I1IH 4WZ9A 1Q0YL 1AD0B 2YGVA 3OAUH 1BQLL 2AI0H 1UB6A 2CJ3A 4A2MA 5KSAA 4D0BA 5IQ9B 1T7YA 2FJFB 3FB5B 3VU1A 4BUGA 5HD8C 2VRAA 2E4FA 2FECI 3VXMB 2A0LC 1NKOA 1VLXA 4LBAA 4LGSB 2NY6B 1G9NL 4OQTL 1DLFH 1N6QH 1ZVSB 2MNJB 3F00A 3FTSA 5DEGA 3KPQB 3DO7A 4JL1A 1CS6A 1UCBL 4XR8C 4OZIE 1YYMH 1MRCL 3EO1B 4YSTA 4EI0A 4RFEA 3PNWB 1YMMB 3MX0B 4M8RA 5FHBH 3QHTC 3KXFD 1A47A 3NAAH 4QRRD 1VEMA 4DETA 3DX1A 5CCKH 2DQDL 1GW6A 1YPZF 1MFCL 2R23B 4W81A 2PCPA 2WLJA 3ZE0E 4GW5A 1QYGH 1YNLL 3DV6B 4N87A 3HUJF 1AS8A 3BN9D 4XN4A 3OM3B 3IF1B 4NJAL 1T2QH 3TPUB 3VGEA 5LVEA 4IMLA 2BXZA 3MRKB 4UV7L 3VFVA 4CU8A 2WBJD 5FDWA 3E2HC 3GBML 3SBRA 2HX7A 3F5WB 1S2EA 2A9DA 3FQ1A 2XZQL 2P5WA 2FBOJ 2ICWA 4JFUA 3TVMA 2LFEA 2WLMA 1KULA 1EWHA 4HALA 1KCKA 3RNKB 1OD7A 2DQGH 3ECBB 3UXFA 4Q9QL 2EH8H 2FWOB 1BZDA 4H8QA 1LO3H 1Z3GH 3HHMA 3K0YA 3PHOA 5B22A 3H42L 1RUKH 1M3JA 3CVHH 1YUHB 4QHNB 4XO3A 3TH3T 4JHZA 4CVZB 3CX5K 3F7LA 1B9KA 2ZOUA 4XP5L 3GSOB 3RZCC 4HGWB 2M2DA 4CMHC 1B0GB 2F0CA 4ODHL 5H8DA 1LQBC 2EXWC 1O7VA 3BHBA 5K1JA 2VYRE 4NERA 5KYYA 1AGCB 4JRYE 5E1AB 2VZVA 3HLAA 3IRPX 1CD8A 3BAWA 1EZUA 1U42A 2V2XA 1TJHH 1BOGB 1QTPA 2EDQA 3EYSH 3AXLA 3DC0A 4HIHB 3RUGA 5FO9B 1LDPL 4N2NA 4KGJA 1JF1B 3RY6C 1ONQA 2BHZA 2OMBA 1D5XB 3M17A 2RJMA 4XCYA 4J6RH 1SHSA 2EIZB 4KROB 2WLNA 2CSPA 4UDUA 4UT6A 2FBJL 4FGMA 3RTQC 3CLEH 3CZEA 1AQ8A 3IGAA 4P3DA 1I8IB 4OJEH 1U3HC 5LGHL 5F6HJ 5TE4H 1M7XA 2WAQA 3LQZB 4HS3A 3U0PA 3TS8A 1AXSA 4WQOA 5A6IA 1FZJB 4DTGL 5IIEB 4LEXH 4PSRA 2JKNA 3CDYA 5HDRA 5EOCH 2B4CH 4EI5C 2VLRE 1DBAL 1E4KA 4KVCL 2ALWA 3IRCA 3B9EA 3WYRA 1EK3A 1R3LB 2OL3B 1WQVT 4RMSA 5T3XH 1LP9E 5CP7B 4HIEB 3SPHA 2O5ZH 1NGPL 2XG5A 3R8QA 4LDEB 4FFZH 1FC1A 4PW9A 5SWZB 4DFIA 4ELKA 3MYZA 3P4OB 4OD1L 2BS8A 3O4LB 2ZWZA 2NRDA 1K2DA 1KIUB 1Y1DA 2RD0A 3O2DA 3R0NA 3CGTA 4JKPH 2EO9A 1BDYA 4TNEA 3GSNB 4AEIL 3TF4A 1WZMA 1LWHA 5MP6L 2BP0A 3OMAB 4PV1C 5F7EL 4K3DL 1A7RH 2WN2A 5A7EA 3O0LA 3QDHA 4I9WE 4L4TE 3U46A 2JI3A 1N7MH 2WZ6A 2GUYA 1QFOA 1DJIA 2EABA 2OMUB 1DBBL 2EH7L 3ZQWA 3REWA 1PX3A 3ES6A 1XGYL 4JREC 3RZCB 5E08L 1YYLL 3GFUA 4CMHB 5FYLD 5GIRB 4G42B 4AEIH 2V5YA 3BI9X 3PRZA 3LIZA 5DJZA 4XE0A 4YDLC 2NY7H 2QQNL 3G5YA 1I7ZB 2XKSA 2CDGB 3P0VH 4A04A 4KJWD 1RJYB 2HMIC 3MRPA 3RWJB 1G6RH 4LVOC 2ZCZA 3QDGA 1IM3B 4K3EL 5KYUA 1TSHA 1E28B 3FB8A 2P52A 5FGBC 1IIKA 2O5XH 4HQQL 3EDKA 4KXZH 1ZT4A 3MLTB 3TJEH 4BH7B 3RTQB 3BH9B 4R0LA 4M1GL 2NX5A 1KIRA 4XP6H 1U3HB 2OMTB 2LABA 1JF5A 2VR6A 1TTCA 1HI6B 3LKQB 1KBGH 4I5BB 2XV6B 2ED8A 2HWZH 3TNNB 4Z78A 1IU1A 4FERA 4TUJA 1BF5A 2BVUA 3GSRB 4OIIL 2BNRB 5CGTA 4EI5B 1HC1A 2ALAA 2G60L 3EYOB 2X4SB 4PYGA 3VFTA 3SDXF 3NRFA 4LHJB 3C8KB 1S9KC 5ICUA 1EDYA 1A9EA 2XBDA 3DV4A 2H3KA 3C6LA 5I5JA 1JZIA 2O6FA 1CLVA 1JXDA 1QLEL 4FFYL 4JHAL 5E6IB 1J1PL 1W72L 5AD0B 5AW9B 2Y7OA 1J7VR 4HFUL 5BZXA 2AF2A 3WNPA 4PCYA 4WNQA 4CSSA 2XWJA 1BMGA 2H1LM 3SQRA 3QUMH 3HMXH 3ULVC 1CFTA 2OI9C 1CIDA 5CLZA 3D06A 1OCCB 1D9KA 4XMKH 3U4EA 1FIEA 2YGPA 4KY2A 4OAWB 4GKSA 4MRCA 3HNTH 3PCYA 4JREB 4K23L 1O6SA 1TZGH 4PJ7B 1YN6A 5BVPH 4PJHA 2C4XA 4BZ2L 1TTBA 4EUPB 4ZNCD 1O7SA 2WIMA 3KYOA 4YJZL 5CGMA 3DYOA 2NXZB 3PJLA 4P2RA 4YDLB 2G30A 3WHE1 4PYHA 4QRQA 2YQBA 3W81A 5JW4N 5HI3D 4FN0A 4JRXA 1Q90A 5K33A 3UC0L 4LSRL 4OJAA 5EBWB 4LVOB 1F45A 2AK4A 3F64A 1MIML 4RVBA 2DJUA 1JFQL 1MJJA 3O0RL 5FEBA 2FQFA 4X8XA 4UF7C 3UJIH 1ZK5A 3A47A 1A2YB 1ES0B 3JTBA 3BCFA 3SKOB 4OLYH 1QPPA 4F33A 3S8FB 1OW0C 2R69L 4WEUD 5J1SC 4HJ0D 2JB6B 2F54B 1H3WM 5CKAA 2YPKA 3OZKA 5JW4Q 1LL1A 3KPNA 4X6CB 2EEAA 1GPOH 3TNMB 1SOXA 2RBLA 3M1CA 4JFED 1N59A 1U2HA 2I9LA 3VI3F 3VGDA 1R3HB 5J5EA 1F2QA 2CXKA 2XI9A 2IFFL 4FI7A 4H20L 4NQDB 3X3FL 1CE6A 5GGQH 4DH2A 2W65A 5B39A 2EUWA 4NO2B 3CZFA 2OI9B 3VA6A 3D85B 4BK4A 3OF6A 5FECB 5AZ2H 12E8H 2XSKA 5J9PA 2R83A 4I1NB 5A43C 4UILL 4WFEE 4X6EA 4Y0GA 3BSZL 5LXVA 3PV6A 2J88H 4PJEF 1X9QA 2X4QA 2OMYA 5DVLA 2B08A 2H8PA 3EZ8A 4F5CA 4OFQA 3AB0C 4ZG1A 5MEQB 3PE9A 5K5YA 4APQD 4MFHA 4OLZL 4DW2H 5LNEA 1UVQA 3W0WB 2IDCA 4U6VH 4XNXL 1TQWA 3QEGL 3B9KD 4BQ9A 3DK2A 4Z95L 1AXTH 3L2NA 1S7UA 43C9A 4P5MA 3MJ8A 2O61A 2EYTA 3OAYH 1BVLB 4UTAA 3VXRD 4AK1A 2R56L 2XNAA 3Q9QA 3TOPA 3TZVD 3UO1L 1L9TA 5BO1H 4CADA 1XH3A 4F57L 1MLCB 4YWGL 2X89D 2VABB 2JKTM 4PRIB 3V0AC 1NQBA 1GTFA 4GLRH 1N0LB 1SJEA 1FI8C 2Y7NA 3V5DA 1AIFA 1TQVA 4LSSL 5F21B 4J39A 4PCTA 4TSAH 2WN3A 3LNHA 5BQ7A 2GSMB 4IRZL 1YEIL 1ZEAH 2GI7A 5ANMA 2YD0A 3WMSA 1KC5H 3W39B 3QJQB 3PQYD 1M9SA 2FYVA 4Y9EA 2WIIA 3EJQA 5CEZL 2K8QA 3OD3A 4Y5XC 3HN5A 3CUPA 1JD7A 5EZLA 5KVMC 4BFGA 1A5FH 2AV1A 3V52H 3RAJH 5G4MA 3TYGL 3MRLA 3QIBD 4GAJL 1IC7L 2ZUSA 1IAIM 3K1DA 4HCRH 4YHYB 4ZMPA 2EVHA 4NJ9L 4RFOL 2IXQA 3I85A 6PAZA 1HHIB 1AG0A 1G1CA 1KTJA 4NZDA 5DDHA 4ATTA 1HE8A 5IBLC 5C07B 3AB0B 4XO4A 3L5HA 5D70L 1IBDA 3QWQB 1NIDA 5H37G 2CHWA 2DZEA 3NFNA 1GOHA 4U1IA 3SDDA 3C5SB 3MRQB 4G9FA 3TBCA 1CIUA 3WDJA 3H56A 5DUJA 1VZGA 2D8KA 1CDIA 4IBSA 5J57B 3BZ4B 4XBGB 3TYFB 5C09B 1FGNH 3K72B 5E1QA 3MKKA 2JELH 4PD4K 2ETWA 1OE2A 1EHKB 1QLRA 4O9HH 4L8SA 5MENA 1JGEA 2FO4B 4YHZH 2LR4A 4Y8DC 5LGYA 4N22A 3QFJB 3ZE1F 2K7QA 1MJ7H 2YKKA 4CJ0A 4I77L 2ATKB 4ZRGA 3M45A 4OLVL 4LCVA 4JDVB 4MMZC 5TQ0L 3C5JA 1TQUA 3LN9A 1S9VB 1AO7B 4U1NB 4AYGA 4PJEA 4GEJA 4OI9A 4P3CL 5T1LB 4YHKL 3QYNA 2ZSVA 4C54A 3ZYZA 2YZ8A 2WXJA 5D1XE 5L8JB 5E00A 5E6YA 3FSWA 5TK2A 3JWDL 3DX7A 3L2MA 3NCJL 1JPGA 3TBVA 1T5XA 4CN6A 1DANU 3P9LB 4WFFE 3C9NB 4M02A 4BZ1A 4DO6A 3JWOC 3NPZB 1IAII 2OPCA 1KJ2A 3HHRB 5DUPL 5AW0B 2PTVA 1E9PB 3OQRA 4PH8A 4RFNC 3IXTA 1ILSA 1UFGA 2Q8BL 3D48R 4UIMB 3FXIC 4L3CB 1AGFA 3OVUB 1OE1A 5FKPA 1QSED 4HIXH 2R2CA 3CH1B 3HE7B 1HCZA 3EYFA 2A74A 4PJFB 4YL9A 1XCTB 4KOCA 2ATPA 3QZBA 2CG9X 3BQUA 2UWEF 3SOTA 5JW4M 4OQ1A 4A2FA 2Y2YA 1SBSL 2C1OA 2OQJA 1BV8A 3K6NA 4LCYB 1IE5A 3QPQC 3GNML 1DEEA 1OAKH 1RJCA 3CXFA 1JZ5A 3IS0X 5KVDE 3QI9D 4O02B 4UOQA 3VDCA 3DX2A 4X6DE 2HYMA 3C6LC 2ZP0T 5FYKU 5B1CA 4UQ3A 2VDOH 4HJGA 3SGEH 4WF7A 4W1TA 2WINA 4AJWA 1K4CA 1QQDB 2HFGL 1BYOA 4TUOB 1GVIA 4YDJB 5D55A 4MJIE 2XYCA 1FVEA 3BJ91 4P0DA 4MMZB 5EOQL 4GXVH 2W81C 1ZVYA 2B59B 1SEQL 3GWJA 4X4ZA 5AVXB 5BZDA 1BVNP 4WWKA 5GJTL 3UOAB 3AWEA 1DJSA 1WEJH 2FH8A 4XBEH 1PEWA 2DAVA 4B50A 3X1BA 3L3DA 2ESVE 2PPAA 1AI1H 2C9RA 2Y6TE 1FZOA 4PG9B 1DN0A 1J5IA 4UAOC 3TTSA 3P69A 1BLNB 2CPUA 4L2YA 3K6IA 2Y36L 3NCMA 4Z77B 3PJSA 1C5DB 2V17H 5C2UB 3C2AL 2XWTB 2BOCA 1QD0A 1SNRA 2CPCA 2EIKB 2XETA 1NWPA 2F8OA 3MRNB 4RRPA 4KY1L 4RFNB 5K59E 4AYFA 1HKLH 2MMXA 3BIKB 5DEFA 3SDCC 2XU9A 4FNQA 4QXTB 5KVFL 4ODVH 1IO4C 1FLRL 3FOLB 4J3VA 1CT8B 1JIBA 3FRUA 3UYRL 4D0CB 4MA1C 3ETBF 5EA0L 1U8KB 2DQCH 3JVGA 1A1OA 5CBAA 2OV0A 2BERA 1L9MA 1KPRB 2NMSA 1FL3B 4OZIF 2EC9T 4DSYA 1EVTC 2WXQA 3DUUB 4MXWH 4Z0BH 1N5AA 2VLMD 4G5ZH 4R5VA 3PV7A 3ZRFC 2QPUA 5BUAA 3VNYA 3PPSA 5IMMA 4UQAA 3C8DA 4UQ2B 3PXJA 4YAQB 1MWAH 1FAIL 4UB0H 1YQVH 4JM4L 1KTKE 1ROWA 2CGZA 3CHXA 4P2QA 2QBWA 2YD3A 3QGVA 4N2AA 1MI5D 4PTTB 5AUMA 2HRGA 2XIDA 4XNMB 3ZYJA 1MG3C 1NLDH 1D5ZA 5F96H 2CUHA 4I87A 4NS0A 1E8YA 2JJTA 5F9JA 1ZA3A 2X4TA 1B90A 1T83C 3BT2L 1OVZA 2KPWA 1PZAA 4CJ1A 4OGXL 4BV1A 1HH6B 4UV4H 5HI4D 1E2VA 2CM5A 4CSZA 1T3FA 4FP8L 1YEDA 4UAOB 3U0WH 3BUYB 4FNRA 4KXDA 5DRWB 3T6QC 1BYPA 3WNJA 5FO7B 4D9RE 3QNYA 43CAB 4XP1H 4KKPA 4N6RA 5A6MA 5JHLA 1BQUA 4TPRL 1EJ8A 3LEVL 3UTSD 5I1DB 5DRZB 4KJQD 4AJVA 3HNVH 4XO9A 2VL5A 1JGUH 2VUOA 3S5LG 3T2NL 3ME0A 4R4BA 3SDCB 5T1DH 5JIKA 1JWUA 1PG7W 2PO6B 4YNYB 1KB5B 5BPPA 4XVUD 3CFDA 4MAUH 3DHPA 4GY4A 1UOKA 5LWYH 4JFXA 4MA1B 2G0KA 5CZVL 5K9JH 2WJ5A 3CV5A 1AGBA 1I82A 2EADA 1HHJA 3ARPA 4KMTL 1UH4A 4HD9A 5H2BA 3U36A 5IREA 1ZV9A 3V9EA 2KDYA 3JZYA 1U33A 5I74C 5IM7B 1ESOA 1OWWA 4NSKB 2FEDC 4LARH 3NCYS 4IOFC 5CEXA 1YEGL 1JN6A 4U6TA 2VXVL 1N70A 3EYQD 3INUH 1PCSA 4OIAA 4XAWH 4NZJA 3ZMRA 3G5XA 2YBGA 2J72A 3QJHB 5A40E 2VDNL 2YOAA 4OVVA 4PRDA 3K7UA 5EO9A 4RGMC 1U58A 2X2IA 5HYEA 2DWDA 2PTTB 3CMGA 3DO3A 4BK8A 1MCPL 5IB1A 3ULUC 3HC3L 4P9MH 2XOTA 1LP9F 1A0QH 3LN5B 3S35X 4DVBA 2B20A 4L8BA 2VIRB 1S9YB 3P0GB 1PLGH 4YDZA 5E8DH 3VFMA 2D9CA 2ZXDA 3OLGA 4HEME 2WMPA 4M3JA 1I7RA 2GBAA 4NIYE 2E27H 4AZ8A 2XG4A 3IPBA 3D3VA 5AEAA 4ZX3A 2QR0A 4PJ5E 2XRAL 3F58L 3E9UA 4IBQA 4JY5L 5IMLB 4N0RA 2P8PB 2PCXA 5DGRA 1OGSA 1DO5A 3O2VH 4ZX6A 4TTDC 1NMAH 2IH1A 1IGYB 4ES8A 3L3OB 1EIBA 2V2TA 4PI2A 5GZND 1OGAB 4G8FB 2FD6L 4L8SC 4LK4A 2AQSA 3F62A 1R5WB 4JJ5A 1CBVL 4Q52A 2ZG2A 5KJ4A 2Y6SC 4JM0A 5GS0H 1IJNA 4FFYA 3V4VA 3K0WA 4XVTH 1WK0A