2IELA

Crystal structure of tt0030 from thermus thermophilus
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
134
structure length
132
Chain Sequence
ARYLVVAHRTAKSPELAAKLKELLAQDPEARFVLLVPAVPPPGWVYNEVRRRAEEEAAAAKRALEAQGIPVEEAKAGDISPLLAIEEELLAHPGAYQGIVLSTLPPGLSRWLRLDVHTQAERFGLPVIHVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF TT0030 from Thermus Thermophilus AT 1.6 ANGSTROMS RESOLUTION
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical Protein TT0030
total genus 42
structure length 132
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2ielA00
1RQGA 5KHAA 4HK4A 4ZT7A 3PXUA 1N3LA 2CUZA 3RFFA 1G59A 1OBCA 4EG1A 1K4KA 3K9WA 1QU3A 4KPUA 2J07A 4PBSA 3TS1A 1QRTA 2D13A 3DV2A 3HV0A 2RE8A 1A8HA 3KFLA 1O96A 3UMVA 2E0IA 1VBNA 1T6ZA 1WKBA 3ZUGA 3D6UA 1MC1A 3ND5A 2PFSA 3NV7A 2DLCX 2AKEA 3COZA 1Q19A 4MLPA 3CA8A 3COYA 1KP2A 1N77A 1GAXA 2E89A 1IFXA 4XFDA 2BYTA 4ZCPA 4MW0A 5DB4A 3MMXA 4EG8A 3C8ZA 2DUMA 1NUSA 1JIKA 3FETA 1I6KA 1MB2A 3AIIA 4G5YA 1OWMA 1LI7A 3TQOA 4KR6A 3ZXSA 2V0CA 1NYLA 4KPUB 3SZ3A 4DE5A 3RHSA 1KKUA 3QTTA 4MUHA 3U1VA 4MVCA 4NATA 1MJHA 1O97C 4MQ6A 1GLNA 2QUHA 3ZJVA 4MVWA 1J1ZA 3AG6A 4DNXA 2I1LA 5TEWA 2H29A 1K92A 1TYDE 5KWVA 4U63A 1F7UA 4CDMA 3CVYA 1KQNA 2GKSA 2QUKA 1O94D 1Q15A 3LOQA 1O95D 2ZUEA 3IVCA 2QUIA 2O8VA 1VL2A 1N2EA 1S4MA 2VTBA 1EE1A 1IH8A 3N8HA 1ULHA 3MXTA 4ZT3A 4ZCSA 2CYCA 3KT6A 4EG4A 1WXIA 3FOCA 1FYDA 1N75A 1XNJA 3KT0A 1NZJA 2VXOA 4QBTA 4QRDA 2PZ8A 2VTBB 1COZA 1O95C 1IQRA 1I2DA 1YI8A 1G8HA 2DXIA 3QE4A 4CQNA 1EUYA 3IOEA 3KT8A 2QTNA 1T9GS 4MUJA 1P7PA 1J1UA 1O0BA 3IODA 1YIDA 3ZJUA 2RD2A 1N2IA 1IRXA 1VLHA 1XNGA 1N2JA 1O5TA 1TYBE 4ZT4A 1KQOA 4R2MA 3IUBA 1EFVB 3QTBA 1WJGA 3IMEA 2YXNA 4WNYA 4MVYA 1X6VA 1D2RA 3UC5A 1G8GA 2C5SA 3A05A 1QNFA 1R6TA 3UK2A 1KORA 4HPWA 2JANA 3CLUD 4MAFA 1GPMA 1OBHA 2Z08A 3JXEA 3L92A 4JFAA 1ZH0A 4G6ZA 1MOPA 2CYAA 4ZCRA 4MUKA 1IVSA 2A1UB 4X0EA 1TQ8A 4G5FA 4MW6A 1JEDA 2J4DA 5K0TA 3FY4A 4ZCTA 5DEOA 3ZJTA 4U7JA 3VRHA 1TFUA 1OWPA 2J5BA 2DR2A 2HMAA 4GU5A 1M8FA 1IQUA 5KCMA 4AQ7A 1JIJA 2YY5A 5J58A 2CYBA 2Z3VA 3HL4A 2DPLA 3OP1A 2GOYA 3P0HA 1U3DA 3M5WA 1K4MA 5J5AA 3ZGZA 1TEZA 3Q12A 1NUPA 1HYBA 1KAMA 2ZP1A 3G6KA 2WQ6A 4NDAA 4F4HA 2CV1A 4RUKA 4ARCA 4NX2A 2ZUFA 4ZT2A 2JA2A 2J08A 1NI5A 1PFWA 2H2AA 3INNA 3PNBA 1H3FA 4NZPA 1OWLA 2PZBA 3X1KA 3CLUC 3CVXA 5HUJA 5DK4A 1EFPB 3TZLA 4GRIA 2PG3A 1JECA 1H3NA 2AZXA 3KT3A 3CLRC 1MAWA 1MRZA 1WY5A 4YBRA 2A88A 4J75A 5FO0A 4MUIA 1PFVA 4MUFA 3CVVA 4EGAA 1WXEA 1VBKA 2E18A 1O97D 4Q93A 1JMVA 1F9AA 1Q11A 2A4MA 2AG6A 3DLAA 4RPIA 4JXZA 3FWKA 3NBAA 5TGTA 3S3TA 1M8PA 4QREA 2DERA 3FI0A 4XFJA 1J21A 1H3EA 2QTRA 3BL5A 2BTEA 2D5BA 4S1OA 1XJQA 1I6LA 2QTMA 1K97A 3GUZA 1V8FA 1NUQA 3IOBA 3SEZA 2IJGX 4KKVA 1TYCA 1KR2A 1OWNA 4L2IA 4J76A 1N1DA 2A86A 2R5WA 3H9CA 3F3MA 2DETA 3IMGA 4EF6A 1M8GA 2WSIA 1B6TA 3N9IA 2PZAA 3VGJA 1O94C 1GTSA 3RK1A 4DDHA 3CVWA 4OUDA 3ND6A 4ND6A 2XRYA 2NZ2A 2CFOA 3VU8A 3PRHA 3CR8A 3P0IA 1R6XA 3UY4A 1J70A 2WQ7A 3TZEA 1R6UA 2EL7A 3FIUA 2D54A 1PFYA 1TYAE 2QJTA 1WQ3A 3X1MA 4MW1A 5H7XA 4K0RA 4OUDB 1KAQA 1QQTA 3SZGA 5IHXA 4K03A 1NUTA 4UZEA 1F4LA 1EJ2A 3FHJA 1WXFA 5LLTA 1U7XA 4P2BA 1LI5A 4DDMA 1BS2A 2JAXA 3ZIUA 3ISJA 3Q4GA 2NSYA 4ZT6A 1J20A 4FZJA 1V47A 2CT8A 4MWEA 1G8FA 3A04A 1M8KA 2G36A 3PNYA 4YMIA 1FFYA 1J09A 3IUEA 1M83A 1N2GA 1MB9A 1X8XA 1JIIA 2X1MA 4PBRA 3AG5A 5IJXA 4I6GA 3H99A 1KP3A 4MW5A 3LE8A 1ZUNA 2XRZA 3G5AA 2QJOA 3SDBA 4A91A 4YP7A 1N78A 3IDFA 1ZH6A 4YP5A 1IHOA 2CV2A 1KH2A 1N2OA 1Y42X 3MUEA 3IMCA 4F3RA 1NUUA 1MBZA 2QUJA 3ILVA 2OQ2A 4ZCQA 3FG9A 1T6XA 2J09A 3IH5A 1WZ2A 4OJMX 2A1TS 4KR7A 2CV0A 4EG3A 1T6YA 3CLTD 3A2KA 3P52A 5F23A 3IOCA 3CLRD 4EG6A 1ZJWA 5LFAA 1WOYA 1PFUA 2X1LA 3D6VA 3FH0A 5BNZA 1OWOA 2A7XA 2IELA 3HZRA 1GTRA 1MAUA 4I6JA 4UZFA 4PBTA 5TEVA 3AFHA 4U8HA 4ZT5A 3CLTC 1QU2A 2PIDA 4NAHA 2EJCA 5TS2A 4WSOA 3P0JA 2QJFA 1M1ZA 3E27A 2A1TR 3RK0A 1NP7A 3PNVA 3N05A 4MULA 1NSYA 4MWCA 4NAUA 2X0KA 4E1AA 5JBNA 2V0GA 1NURA 5HUHA 4HJXA 1JZSA 4MW4A 4EG5A 3OTWA 4DJAA 3I05A 3H05A 3NBKA 5FO1A 1EFVA 3HFJA 5HG0A 1U0BB 4JXXA 3L93A 5AHWA 3TNJA 3COVA 4JYZA 1PG0A 1T9GR 1OD6A 2YWCA 2CSXA 4H3SA 1SURA 5DASA 3AKZA 3ELBA 4PY2A 3DO8A 1U7DA 4YP6A 3CLSD 5J59A 1I6MA 4I6EA 1KH1A 1O0CA 1WQ4A 3N2YA 4DLPA 1PG2A 1GN8A 4MWDA 1YUMA 1JGTA 1QJCA 4EFKA 1UFVA 1YULA 1VBMA 3CVUA 3MLAA 2E21A 1YIAA 2YWBA 2Z09A 3SYTA 1O6BA 3H97A 1EUQA 3G59A 2X3FA 4MW7A 1JHDA 3HMQA 4MUEA 2GM3A 4DDKA 3ND7A 3A4IA 1YUNA 1CT9A 2A1UA 3HGMA 3X1JA 5FNZA 3SEQA 4MUGA 4CDNA 4EG7A 2WB2A 4Q16A 2HGZA 4L2IB 1GZUA 1KH3A 1KQPA 3Q10A 1WXGA 1JEEA 4MW2A 1N2BA 4MWBA 2IP1A 3IVXA 4CT0A 3RJZA 1IQ0A 4BWVA 1ILEA 4MUNA 1QTQA 4R0NA 3IVGA 1XNHA 5H16A 2HZ7A 2OV4A 1DNPA 2A84A 4ARIA 4MW9A 1LW7A 3MLBA 3RBAA 1EXDA 2B7LA 5EKDA 3COWA 3AL0C 4ND7A 4MVXA 1M8JA 4JZYA 5K0SA 3GMIA 3LCJA 3SP1A 4KR9A 1H1TA 1F7VA 3UOWA 3DPIA 1QRUA 1U3CA 3GLVA 4TS1A 3K32A 4XSVA 1WXHA 2O5RA 3FNRA 1Q77A 2TS1A 3H9BA 4AS1A 3TQIA 3CLSC 1QRSA 1JZQA 1N2HA 3FDXA 1EFPA 5LM3A 4HJRA 1JILA 2DEUA 3ZXIA 2PXHA 1O96B 4R2LA
chains in the Genus database with same CATH superfamily
3GA0A 5CYGA 3BM5A 5B7PA 5FRDA 3RFFA 4RVFA 2VYVA 1G6Q1 2ZUBA 3FLEA 3OBBA 4ZGWA 3NFYA 5BOVA 3L9XA 2BPOA 4DIKA 1UF9A 5DM70 2FPXA 3R09A 3LPMA 4QXOA 3D2LA 3QMMA 3SC2B 2J07A 2X7XA 4ZIRB 1QRTA 1DFGA 1R4MA 4RK7A 3D4NA 4JX8A 3OJFA 1FSFA 1NBME 4NFLA 4O02B 4X3OA 5A4JA 1TM3E 2KBFA 3D3EA 1J24A 1VBNA 2BMAA 1EPUA 2OHOA 1KEUA 2EW2A 3QJGA 3IQWA 4CL2A 4E30A 3AZPA 4KFTA 4R2KA 9ATCA 2ACKA 3O84A 5LP6A 3R3UA 5DN9A 4C1NA 1U02A 1VDZA 2UZ1B 5CNKA 3JYQA 3KYDA 4KDEA 5K3FA 3HKCA 1L7EA 1XD2B 2DP4E 2PH1A 4RVCA 2BL4A 3K5PA 3MJHA 3NG1A 4IG9A 5FULA 3RVRA 2QQ5A 1WWKA 3TW4A 3FYDA 5FOVA 1T2FA 1V1MA 3HLYA 2QYHA 4WASA 3WL3A 4MVJA 1ZJ6A 4G25A 2DRIA 2ZIVB 1ACMA 2AFIB 3G02A 2FG7C 4FFNA 4EG8A 2DUMA 4KZPA 1RXIA 3FETA 4J2TA 3QW2A 4N1AA 5DX0A 4C0HA 2JCSA 4D45A 4LKOA 4TSFD 5FAXA 1OWMA 1F5SA 3BXXA 3IEXA 3WMEA 4LFAB 2FWRA 4E5VA 2BR5A 1OFIA 5TVGA 5B58C 4F92B 4ZOBA 5EP3A 2BD0A 3EHEA 1SEPA 1ZMOA 4JI5B 1ORHA 2VYFA 2PLRA 3L04A 1ZGHA 4JH0A 2RGYA 3NOXA 3W5UA 4B79A 4LOHA 5DGDA 2ZAIA 4ZHQA 3EGCA 4MQ6A 5EEHA 1OH5A 3EZYA 1E9EA 3DPSA 3MWDB 4EZBA 1DBQA 1FUYB 4QXPA 1DKMA 4ARSA 4LJ5A 1EX7A 3MRXA 4UUBA 5CYPA 1KKLA 2YIJA 2QRHA 3LXRA 5D3QA 3VZBA 4D0RA 3KWMA 3TSZA 1ZOOA 1USKA 1XTQA 3W7VA 1NQUA 2P6PA 3N0TA 2SBTA 3REQB 4C4PA 5FJJA 1UIRA 3T1NA 4DQLA 4LJKA 5LDDC 1PT7A 4V0ME 4R7GA 4GO1A 3O3CA 3DE1X 2ZK7A 4AKSA 3GP3A 4LYAA 1YRLA 4OAPA 1UDRA 4LZJA 1XEAA 1T24A 4ZCSA 2XUHA 4X66B 1NBMA 1VMEA 4J0QA 3FTEA 5JG7A 5FWXB 1R8XA 4I9FA 4KIFA 3DMTA 1L4BA 3OMLA 4PYLA 2O8EB 4Z8YA 1XT6A 5KSZA 4R3UC 3PZBA 5KKCA 2GD6A 4RF4A 3FOAA 3NAGA 4PHCA 3L7JA 4M36A 3UYLA 1H42A 4FC6A 3EZFA 4RADA 1L7OA 3IT3A 3LM8A 1P5FA 5KYUA 4N18A 5ECWA 2G9UA 3D54D 3WGQA 2FB9A 1FQWA 2CC2A 2CEKA 2P0YA 4XLZA 3IOEA 1EGAA 2Q5IA 2LZ0A 2Y2UA 5AHRA 4TLEA 4YI5A 4LTDA 2NNLD 3MGGA 1J1UA 3NBZC 1JDNA 2BFAA 5EKXA 3KPWA 1QSGA 3KP1A 3O4FA 5ENVA 3MGBA 1MABB 1IRXA 4BJ5A 4R68A 4Z1OA 3L5KA 2IYVA 3BOSA 2IZZA 3EPPA 3KQOA 4LE2A 4DW8A 4IDAA 4M2LA 5HF6A 5LYYA 3ZN2A 5JROA 2PGOA 1NG9A 4WN3A 2UUBB 4R1MA 3BRWA 2O6LA 2JRCA 4EHKA 4KE9A 5AI6A 3JQEA 4F04A 4WUVA 1NLYA 1J0DA 4WNYA 1G5RA 7REQB 5TPWB 4WY8A 2XT6A 3NU1A 1L4EA 4H0CA 4BLUA 2QNRA 1CUHA 4KO2S 2I67A 1ADBA 1KSFX 2W8BB 4G5SA 3MAGA 2I34A 1XD8A 2Z08A 4C0AC 1NNSA 4KV7A 5HM6A 4KFCA 1P81A 3NVAA 4RJTA 4KNYA 3HJBA 4EGCB 2JFNA 3R9IA 1TCAA 1OA0A 4FMDF 5DBIA 1XAIA 1IXZA 3EY9A 2C5EA 1C9YA 1CSEE 1IHYA 3RUFA 1GPKA 3ZJTA 1ICEA 2VEDA 5EP2A 2UDPA 4QBKA 3C16C 1TFUA 3Q11A 1FTQA 5G4KA 1U65A 2C00A 2CHGA 2XYRA 4C14A 5A4FS 1OH6A 3GO4A 2BEUA 4H1WA 4WBSA 4PG7A 2C57A 4J49A 5HOEA 1PWHA 3ROGA 2YY5A 1OJLA 1IXRC 1CHNA 1R9JA 2J0UB 2I71A 4PIPA 8MHTA 1FDOA 2P27A 3HADA 2MSLA 4WGGA 1A95A 4BLWA 4F2WA 2GYWA 2C8JA 1NQAO 4FYWA 1K6JA 1YOVA 1GU7A 3GLHA 1SG9A 3HCEA 2B6NA 3SEAA 1W2WB 3LUHA 4D42A 5FUWA 1A4UA 4DCUA 2NZYA 4E3ZA 5BRAA 1VE7A 1WUIS 2A9QA 2JI7A 4GZLA 4P3NA 2O0LA 1G4UR 1S6YA 1JDVA 1XAGA 3A9CA 3B3AA 2HBYA 1EFPB 4MGKR 2O2JA 1YB5A 1NDQA 1O9GA 3TZLA 5JI3E 1PL7A 3HUEA 1GZDA 2WSBA 3OQ6A 2F17A 1GCOA 2XQVA 4LMPA 2BKAA 5ER6A 4JJ8A 4Q1DA 1X7XB 1XMSA 3A7DA 2VDUE 1E3WA 5KX5B 1RWWA 3WRYA 2JJ1A 3H42B 3KAPA 2PZGA 1Z2NX 4L3VA 3I6QA 2D2XA 4OBBA 4PNHA 1HRDA 4RTSA 4YXWD 1R8YA 1EFDN 1M1NA 1XBTA 2A4MA 3DO5A 3HKBA 4QAQA 3JQGB 2PAFA 1EZZA 3QWIA 2IYXA 1CRLA 2JGJA 3E4DA 4K9KA 3PL1A 1RLIA 4NU0A 2AW3A 4XOUA 5TGTA 4BS9A 4CMEA 3RYCA 3AVTA 1P73A 2XUOA 3K6JA 4WKNA 5AKYA 1HTTA 3WLJA 4I0WB 3VPGA 1GQFA 3EFOB 4E46A 1NMZA 3WB2A 3WICA 2BGNA 2PWAA 2E87A 4KIUA 4BQSA 1DQRA 3GIWA 3ROQA 1C8LA 4JBYA 1BU8A 2X1VA 3TWOA 1A1SA 5G3ZA 3OZSA 1Q0RA 2O8DA 3ZVKA 4MCAA 4J76A 2PMKA 1R4NA 1J0XO 1Z5OA 1VSVA 4Q1VA 4FGWA 4XR4A 3KQMA 4FNAA 4LRQA 2QD4A 1VL5A 2CLMB 3PXEA 3TI7A 4MI9A 1SCAA 1NC3A 2R6ZA 3ND9A 1NAHA 4NEHB 2AGVA 4C3UA 3M6WA 3H9EO 4H6VA 3ACDA 4ND8A 1MOSA 4R6XA 1S1MA 3VNVA 3MZ0A 3RREA 1BWRA 2D54A 3GFPA 1MX5A 4L4YA 4PS1A 2OK7A 4KQEA 1RHUA 3NRCA 3O2SB 3QA9A 1OTYA 3CZAA 2IW1A 4M60A 4LF7B 5G0SA 4XD2A 5A3JA 1B0ZA 3AEQA 1ZICA 2GJSA 2HK7A 1UFRA 2GJ4A 2O2CA 2LVBA 3M6MD 4RVSA 1MO5A 8LDHA 2Q8PA 4A26A 4A2QA 4B3DA 4IMPA 3U9LA 1EJ2A 3F6PA 1I7QB 3D3JA 4LZAA 3GYGA 3K0CC 1MAAA 2ORWA 3P9NA 4OAOA 4RM3A 4B74A 1JNXX 2AOUA 5FOQA 3VO9A 3KRTA 3G8CA 1DRKA 3BHJA 5KU7A 4MB6A 2E4YA 1RKVA 4Q3NA 1RU3A 2FPPA 2AUMA 4FZJA 1NHGA 2R5FA 5JW6A 4UM5A 5HQJA 3M34A 4JWKA 3MMZA 2WWVD 2HMTA 3SG0A 2XBLA 2HX1A 3RCBA 2ON6A 5FFFA 4ZK6A 2XVMA 4UW9A 3MGKA 1IPFA 1GPNA 2GK6A 3GF4A 4ER3A 3R9XA 1BXZA 3DCNA 4L0DA 5ED0A 2COKA 3E3MA 3IUEA 3QXXA 4QUDA 3HA3A 3A1SA 4WA8A 3O4IA 3CUEF 3TTYA 2W6MA 5DP1A 4H1TA 5F4ZA 3WLHA 1FP4B 4MRRA 3T9DA 1PDVA 2WUWE 3BSYA 2ENWA 2YJ5A 3EXFB 3LE8A 1RQ7A 5IAEA 1X1BA 2ZSDA 4YP7A 3IDFA 1BOOA 1D1PA 5ECDA 2N3ZA 5AW4A 4KPGA 3MFYA 2F43B 1RWOA 3SIRA 2FR8A 1V7QA 2WU1A 2YWHA 3ANSA 3FCUB 3MUOA 3FPGA 4DIEA 4XD7D 3VR0A 2V7PA 3KB6A 3W05A 2YVKA 4U6QA 3U7QB 4B1FA 1YK1A 2J09A 3WRYC 3WIUA 4PZZA 4E1VA 3ZX5A 1LPOA 2HJSA 4O4JF 3T6KA 4CIWA 1HFWA 1IATA 3BSSA 3IA7A 4C7MA 3FPCA 1W581 3H7AA 3LZ6A 1QP8A 1M6HA 2FLKA 2DBQA 1RYHA 2QNBA 3Q72A 1OHHD 3FTQA 3RSZA 3AVWA 3M5PA 1TE2A 1RMQA 3PNPA 4M8LA 1QHNA 1R9MA 4ZA2A 2Z9BA 3PLAE 4ISCA 4QPCA 5PGMA 3IOCA 1L5NA 2WKQA 4FOOA 4TL6A 5E6UA 2FOLA 3VPDA 2QZSA 1OWOA 1L1RA 1JHAA 3QKIA 2CJXA 5K05A 1OI7A 3SM3A 2WU3A 1L9KA 3GNTA 2FRXA 2QZJA 1NYTA 2OLKA 4FNMA 2JPDA 1KI7A 3DO6A 4RY8A 1XTVA 2ZXFA 2DWQA 1DAHA 4ILKA 2ZFUA 4R9UC 3IR6A 1BDJA 2A5LA 2ETVA 4JI0B 1A5BB 4TLAA 4F45A 1C9JA 1ISPA 2OGSA 3SFZA 2Y2VA 4N0PA 4XM2A 4FFDA 4C29A 2VDWA 4X24A 3V1MA 2JIZD 1GP2A 1BD4A 3PNVA 1I2AA 2WDZA 1G9TA 4WKCA 3C7TA 2PU7A 3O95A 4KRFA 1NMQA 3GQVA 5FR2A 2X0EA 3K15A 5A05A 2G9QA 3ICEA 2QA5A 3IP1A 1Y4DE 1B3RA 4DDTA 4GG1A 2CZGA 4D9CA 1VJ0A 4LZOA 5JBNA 3QFSA 1RE0A 4UU7A 1OU0A 1U8CB 3QLVC 1OMOA 4MQFB 3O8RA 1JZSA 2V3CC 4WCFB 1X80B 5EIAA 3ZWNA 1KC3A 1YZFA 3TRHA 3HM9A 3LPLA 1UXJA 1Q50A 1EFVA 2GUGA 2NT3A 4GVLA 4J03A 4ZREA 3NVMB 3NV9A 4Q4JB 4N3BA 3DWEX 4EKNB 1VG9B 3L93A 1Y7PA 1AD2A 4Y1GA 1B15A 4KLRA 3DZJA 3T1VA 5EMKA 3N2LA 2X9NA 4YYEA 2DGDA 3DOCA 4HZUB 4CV3A 3FOEC 1TCVA 4G8DA 2W6QA 5K3EA 2RAVA 3AUUA 1W0KA 5JNRA 2XCTB 3A6JA 3CX3A 4HN2A 1JTFA 3I62A 3I32A 1W0KD 3QM1A 4PZPA 3CY6A 1JHYA 3N2YA 1KGDA 3G8AA 4QSHA 4ENVA 2OD2A 1VG0B 721PA 4MWDA 3AVOA 4BBJA 1SCUA 3VZCA 3ZWCA 1TKCA 4XWGA 1SHTX 1Y9AA 1RRCA 4IDQA 2ZITA 1UPAA 4KQ9A 1PUJA 4RIEA 3SOPA 1HNWB 5JZ9A 1NXWA 2FNAA 3NM4A 2BFFB 4YQZA 1ZNQO 4XGQA 3AEXA 5CIYA 3VDNB 3QYPA 4QLOA 4DWVA 4N5HX 4HATA 4L8GA 3IR7A 4ZYLA 1WTCA 1H0KA 1R27A 2EDCA 4ZRNA 3KLOA 5DW3A 1RQNA 4CDNA 2Z98A 2FEKA 4TUYA 5LSAA 1GXSA 2RGWA 3JQCA 3TAXA 2E6KA 1VKOA 3FUXA 2GPAA 4UVDA 5GV7A 1JLLA 4EJSB 1IB0A 4B31A 4AMUA 4JHLA 5TSDA 3Q10A 1YZUA 4M37A 1UBLS 5D3MB 2NIPA 1GAWA 4FN5A 5FUQA 4Z49A 3T8YA 1ECJA 3C3CA 4NBRA 1JU4A 1VKZA 3GGCA 4QGFA 3U0VA 4BNXA 1UFKA 4Q6BA 4U39A 3GLTA 3TQTA 1JLRA 4YONB 2P77A 3L6CA 5H16A 1IL0A 3D3WB 5DPMA 1KK3A 4ZEMA 5AVSA 4RLQA 1DEHA 2VFAA 4KCGA 1I5OA 3S2IA 1PR1A 1YZVA 1W2HA 2PJDA 4L27A 2VPQA 5C37A 1EXDA 1M7HA 4KUHA 3TM5A 3N0RA 1ZUIA 121PA 3K2EA 3KDPA 3WGUA 4EI9A 3D3KA 3KVNA 5IH7A 1ID8A 4OATA 2WV7A 3OHPA 1C9KA 3BRWD 4H9GA 2O8EA 3WGIA 1W73A 3KPVA 4TQUS 2BMEA 1DEAA 2CLEB 4HX5A 3FN4A 5JR3A 1BKYA 2IHYA 2GVZC 3NIWA 4D3DA 2O5RA 3HBNA 4ZYXA 1GUZA 2JBAB 4UEWA 3QFHA 5C7YA 1NM5A 1QRRA 3A27A 1IZZA 3A1WA 3FWHA 4MQEB 2JJYA 2R8PA 5FFNA 1KFKB 1E3QA 2EJTA 2GAFA 3AOEC 2OYSA 3IJEB 5HKKA 3PB3A 3GLGB 2VDJA 3CCBA 3TRKA 1PNTA 5A2GA 1XO1A 3WWCA 3PXUA 4XWOA 3T1HB 3BB3A 1E0JA 1YZ3A 2JBWA 4AYXA 1I4TD 3C48A 1V16B 2C1ZA 2F00A 4KLAA 4LBWA 4XQEA 1T8UA 2ZRLA 3BE4A 4TLCA 4UMVA 3OEHA 2DJIA 2O1XA 3BWMA 4M9ZA 2PYDA 5GADl 2B4TO 2H1WA 4O4IA 1J33A 2ZWAA 3GCXA 2C94A 4X8OA 3FTCA 3ZHBA 3C8HA 3G2NA 2CMHA 3T7TA 4EF4A 5A6SB 3OPYI 4ZVMA 2XKAA 5KPJA 3B2NA 3WNDA 4BNFA 3DUWA 4UPVA 4UDXX 1T4BA 4J2OA 4UHHA 3WIBA 4F4CA 2VHXA 2Y6VA 5D01A 2CNDA 2L82A 3KQWA 1CFZA 1LXCA 1ZEJA 2ZB3A 3C7AA 2NXWA 4Z2YA 1YZHA 1M10A 1E7RA 3D64A 3SR4A 1NQWA 3EH1A 4A03A 1GAXA 1WW8A 3KKQA 2JIMA 3T0IA 3KUDA 4JXXA 3B60A 5CCBA 4L85A 3G85A 3I8OA 4ZO6A 2FW0A 2ZWOA 3HZZA 3ISTA 4HAUA 4IS2A 1KYVA 3PKZA 1L7BA 4CM6A 3PUZA 5DNWA 1W19A 2R4QA 4XE5A 3KYDB 1W75A 3E5RA 3PS9A 4K8OA 4BRWA 5INTA 1IN5A 2A5YB 1QLHA 4EGQA 2BEVB 3CLHA 5JD6A 2QD5A 2W37A 1ML4A 1HI9A 4LGVA 4H18A 4WVLA 3NUZA 3K05A 1BKSB 1Z25A 2NO9A 5ALWA 4I4NA 2V4UA 2BMVA 5DNDA 1E1CB 5HF8A 4P3KA 2L42A 2XB6A 3BULA 3BIWA 1OX4B 4QQRA 3CUUA 3UCEA 1L2TA 4QDXA 4A92A 2O8CA 1G1AA 3ZVLA 1RM4A 5EJ7A 3OCXA 4HDSA 1ULSA 2PZEA 2WMYA 1Z17A 4Q39A 4BCCA 3GW8A 4RGYA 5KQRA 1QHHA 1ISFA 4A8PA 1NJ1A 3BJRA 1FQKA 4X5OA 3A9VA 1BMFD 5ALMA 1JEQA 1NPTO 2Z4SA 4IHJF 2KX7A 3B8HA 3R3YA 2B0JA 2C9BA 1H5UA 4NCNA 3LKZA 3KKPA 3K8QA 1FNNA 1S4MA 4M8IA 3BH7A 2JCBA 1CY8A 1CDZA 2EFJA 3OA0A 2GEBA 4IF6A 2GM9A 1LZLA 4X1IA 2J41A 3FVRA 2YRXA 2I29A 3IE0A 3G17A 3VDQA 3MT0A 2V65A 3NI2A 3FTPA 5AT1A 3ZH2A 1EFAA 5T8KC 4BQPA 2C07A 2G4LA 4DF3A 3T7AA 4LJ9A 2FEWB 4M7PA 4ZVTA 3OG9A 4BQEA 4PLVA 3OCVA 1XCLA 3L0YA 1PD1A 3B3GA 3GMTA 3PQDA 4HGOA 3UJNA 1JBEA 1F4VA 1XZFA 2JFVA 3X44A 4CR6A 3DMTC 2QZ9A 4XGKA 4MUJA 2YNMC 4EO9A 3V4PB 4OLBA 3DOHA 3JYPA 3PHBE 5KWSA 1E92A 1H8EA 4MYCA 4RE5A 3UWPA 1V25A 3PUHA 4G23A 5K6AA 2PZMA 4H7IA 3LHDA 3ZQKA 3BGIA 2DTXA 2GTPA 1L5ZA 1U2RA 2HRDA 4HG2A 1ETUA 1V9CA 2R86A 3F3SA 1SN7A 4JDPA 4RZXA 3AF6A 4MZXA 3IUBA 4OJNA 3LAWA 1A7AA 3W79A 4OM8A 1E3TA 4O4IB 4AAYA 2DAPA 2X13A 3OX4A 4DTCA 5C32A 1ZQ1A 3AW8A 2Q1SA 3MEQA 3WK8A 1DQZA 2FZCA 3EJWA 4WBNA 1DAFA 3ROMA 3RQIA 5I4BA 4KLCA 1FNCA 1MVOA 4NCJA 1G3RA 4AY5A 2O07A 4W8GA 1L5VA 3T0FA 2B30A 5BURA 3RLIA 2GILA 4GMGA 4ND8B 3VTKA 4P92A 3EZ2A 3WDSA 2QQEA 4Z3OA 5KYXB 4FFOA 3E1SA 2A1UB 4OOEA 3SGLA 3KPUA 3BMOA 3IBCA 4O25A 1KXJA 1T0PA 3GVHA 4IDPA 4MW6A 2A94A 2PU5A 2VQ3A 4ZXFA 1SZDA 4CQMB 2R1VB 4LF9B 3HN6A 3VRHA 3KXIA 3N86A 3W8NA 3Q7TA 3FYCA 4DREA 1NI4B 1LPBB 1YR1A 1FF9A 2J3EA 3D7RA 3EBPA 5K1ZA 3MHPA 4YAGA 4A0SA 2JCGA 1N34B 4QRIA 4M22A 3BL6A 2OM2A 4F1WA 5CXXA 1FTGA 1P0PA 2Q5FA 3H65A 2AIRA 2FUG6 1CJMA 1GTJ1 4J7XA 1IY8A 1E2FA 1NDHA 1QAOA 2C3OA 5JY6A 1IHXA 1XUOA 4CIVA 5ADWA 5I8PA 1GIAA 1X7DA 3UK6A 1NI3A 1SVIA 3PGKA 5T4FA 1W8IA 3ITNA 3N70A 4UMDA 2J4CA 1KEWA 1TC2A 2JA2A 4U7FA 2YBEA 2CB0A 5DTRA 3P0FA 1I4WA 2ZTUA 5CX1B 2UZ0A 3TM4A 4EPWA 4IIJA 4H59A 1H8HD 1C7JA 4F4JA 1H2YA 1X19A 1S3FA 4ITRC 4I55A 1Y89A 1YA8A 1A04A 3DTVB 5D51S 3ZOZA 5CA0F 2EFGA 2JGDB 2OCYC 2G7ZA 4W9NA 1SKMA 3OQPA 1JAIA 1IB6A 3UWMA 5C8XA 3CF4G 4DZTA 1RZVA 3PPVA 4QXQA 4E2YA 1YJCA 3GJSA 3KSZO 3RADC 2FOXA 2GQ0A 1YA6A 3A6KA 1ODFA 1HL3A 5C7LO 3RYIB 8OHMA 2B8NA 2AG6A 3ESQA 1ZGBA 4M1YA 3CG0A 2QVXX 4BFTA 2CD9A 1A8UA 4I5EA 3WP0A 1RWQA 3SI7A 3CKMA 3PP8A 3U4HA 4F5WA 2XTJA 1NNI1 2KW5A 2YASA 3K09A 4PYKA 5D1NA 3I5YA 3ULKA 1RC8A 3FNQA 4J4HA 3RFTA 2QLFA 1JEAA 3EZ6A 4R2HA 2HLDD 3PA6A 1U6JA 1NUQA 1V8FA 3IOBA 2H52A 1C1HA 4GXNA 1U2EA 3HO1A 3ORRA 1Y8QB 2Z5GA 5K8LA 4CM4A 4KKVA 5K3OA 4RF2A 3TSCA 3WX0A 3N3AC 5FH9A 2IHUA 3C0KA 2DPXA 3B13B 2EIHA 3W04A 3OU2A 5FLXA 5JO9A 3NDBB 3ENVA 3PHJA 5KNLA 4HS4A 1GARA 4L74A 4TQAA 1P4AA 1U7TA 3RU2A 1RLMA 5FNVA 3T3OA 3HUTA 4UTZA 3QI7A 3EPKA 4WPGA 3VNUA 1U5AA 4QYIB 4IINA 3FOZA 1DOHA 2O57A 3QVLA 1G291 4IILA 4W7SA 2JLZA 3EBLA 1XTZA 2C54A 3O38A 2G6TA 2AJBA 3C14C 4G4SP 5FBKA 3UENA 2FPGA 4W5NA 1YJ8A 4CKBA 2FCRA 1KDRA 3SE7A 1W96A 1KJZA 5DTIA 4JQSA 3V6MA 1DKOA 5KI6A 5M34A 5H7XA 2JFGA 3QVJA 4CMAA 6PFKA 2V4MA 4OUDB 1WW3A 5FA6A 4IG4A 2HL6A 2AR0A 1C80A 3WB1A 5KMGB 1PJQA 4B7CA 1V96A 3BFPA 1CEYA 2PQ0A 2Q5JA 3Q8XB 1CG6A 1T10A 2IKSA 3DMRA 1RTKA 3FHJA 3O8DA 3ML1A 4KE7A 3IELA 1DBVO 2P68A 2QSUA 4NY1A 4PG6A 1NBEA 1E9DA 2JFZA 1DDGA 3MSXA 1FMJA 4PC3A 1VSBA 4HXYA 3Q4GA 2NSYA 1QF9A 1PQUA 1Y48E 5JOQA 4DLYA 1PJLA 5C7OO 2P2CA 1U2SA 1UJ2A 3D6AA 3A6EA 4MWEA 3WIDA 3H2IA 5K4HA 4D82A 5B6JA 1E32A 1OVMA 4Z86A 1JT2A 3FE2A 2C5HA 1KE2A 4P3YA 1VPVA 1D8TA 3MPOA 3VU1A 2CNKA 2EJUA 2I1WA 2SHKA 2VAWA 3GAZA 4RPCA 1ISSA 1Q3KA 1OFTA 5GVSA 3AM1A 3AU8A 3GG2A 1S7CA 5BSEA 4RTLA 1F0YA 4L7QA 3TLJA 2R1UA 3GH3A 4WIAA 4KKXB 3T7KA 3B5EA 2KLBA 1KY2A 3WYNA 3PIDA 4ZDKA 2Y6UA 2AB0A 1YU9A 2B8TA 2QJOA 4BFXA 1YV9A 1MFZA 2W2LA 4B4WA 3D8RA 4P4NA 3BXEA 3Q88A 2IV7A 5KYWA 4FB5A 4TLLB 1FSPA 3L8YA 2W6PA 1Y1TA 4JBXA 4J7UA 4CF5A 2FWNA 1J90A 4OHFA 4X94A 1T1IA 3MJ4A 1U1FA 2I2WA 4DIDA 3H3FA 2EZTA 4KXWA 2HXYA 4EQ6B 2IUFA 2QQFA 2V3VA 2HU8A 1GNQA 1E1KA 3HDTA 4NEGA 1Q83A 4IAOA 2BSAA 5K8JB 4DADA 1KGSA 3BMCB 5KYGA 4KR7A 1AUPA 3EXFA 3HA5A 1N8NA 4HHEA 2PQMA 1US8A 3KEGA 4NCIA 4OV6B 1M7BA 2J9FB 4XDGA 3SJCA 1L8LA 2CHUA 2H3HA 4EG3A 5KAPA 4M1MA 1AQ6A 1YZGA 1EX6A 2OAGA 2NUTA 3SSMA 3VISA 3FHCB 2QUAA 3ZK9A 1GG5A 3K9GA 3N6VA 1XRNA 3P9KA 1B8VA 2XHZA 4X64B 3NHYA 1XCPA 2IYSA 3EEFA 4QTZA 4Y9RA 2C42A 4KIWA 2Y27A 1RRPA 2X1LA 3CR3C 1Q44A 5LZ5A 4MWSA 1A8PA 3A4YA 2UU9B 1YASA 3CE6A 3DEFA 3TBFA 3SCZA 1U4OA 5BY2A 1IOZA 2HHCA 4AZTA 2FH5B 2GPBA 2QV0A 3OLVA 4K26A 3QX8A 4KBFA 5JNTA 5DCLA 3NEPX 4OFZA 4Y6OA 4BQNA 1ULTA 2HN9A 1ODJA 5G0UA 5T3UA 4EG0A 4BPBA 3LFUA 5IYZB 4PPNA 2WUDA 1UCFA 2GA8A 3H2ZA 4DPKA 2WHXA 4PZLA 4L4ZA 1U7OA 3REGA 3E27A 2PUAA 1JPNA 2V7GA 4EY5A 1SKYE 1XYGA 1X1CA 3DEIA 5I8ZA 1Q7CA 3RUDA 2CLFB 2FJUA 1HA3A 1KJNA 3K96A 2F8TA 1FXWF 2OCKA 1ZCBA 4HS9A 1UT8A 1D0IA 4AUKA 1QHSA 4U5XA 3JTEA 4E2XA 4C2TA 5AW5A 2ZJ6A 4LNUA 2ZTSA 1YTUA 1QRDA 1Z26A 4Z0TA 2ZPAA 3OVMA 4OI4A 1TEHA 3PJFA 2OO7A 2XGGA 2JIQA 3TR5A 1YR2A 3E61A 3EODA 2INGX 1MX3A 4KYUA 4EMTA 2G9VA 1VMIA 3GZNB 1JEQB 3JALA 4M1ZA 4NENB 4NU5A 3D3NA 3WTBA 4JL8A 3S68A 2W11A 3DD5A 3GLRA 4UHEA 2XZLA 3I61A 1ZWKA 1CUSA 2CE7A 2J8ZA 3GFFA 3OBIA 3D0QA 3OT5A 1NF3A 4KGXA 1FMTA 2NADA 2D5CA 2QB5A 3UV6A 2Q28A 3IV7A 2IWRA 2GBLC 2C9DA 2C3MA 1T5HX 3FJYA 4R9RA 5DP2A 5AKZA 1OOEA 1AA6A 5BSHA 2QN8A 4OX9B 4G5OA 4QXMA 1SCIA 1R0KA 3NLLA 2NQ8A 4Y2SA 3ANTA 4LJAA 1TJNA 1OZHA 3PXBA 3PNLA 3WLKX 1HDYA 4BE7B 3HKBB 2QAJA 4YCMA 3K31A 5B7QA 1PJCA 1WMSA 1L3BA 3TOSA 2XUGA 4RTKA 3KC2A 2WU8A 3LYLA 4FDMA 1UM9A 1NQVA 3L43A 3LUJA 2Q6OA 5C4GB 1NTRA 4AB1A 3C4QA 5CCDA 1TAHA 2B94A 3ZHUA 3MBKA 1CUWA 2Y05A 4N9QA 2PH5A 1C0KA 3LQFA 4I1SA 3G7UA 2CHEA 4PR3A 1Y8ZA 1RBYA 2BFDA 2ZDGA 1Z5ZA 3JW8A 1Y5RA 1P5JA 5FI3A 2FFBA 3M6VA 1DAIA 2IP4A 1EU1A 2WPDA 2XSZD 2GO7A 1P2UA 3HVHA 4I5GA 3OPQA 4MR9A 3OFVA 1LFAA 4KDRA 1PLJA 3VR6A 4EW3A 1R4AA 3MJFA 4CLHA 1ZO8A 1KQPA 2ZRKA 5JHGB 1IK6A 2IEYA 3BDIA 5M7EA 1ZBDA 3KOYA 4ZZ0A 1VYVA 2RGGA 3K94A 5L3QB 5JNVA 3P9QA 2K5UA 2PKWA 1EYZA 4LS3A 2C1XA 2WJJA 1PV2A 5A71A 5EWMB 3IVGA 5KYNA 5J3JA 1ZIOA 2A0UA 3X3HA 4E4YA 2GVNA 1R6DA 1WMBA 2AOWA 3PFKA 2X9VA 3QF4B 4H35A 4HP8A 2PX8A 2ZU0C 2V7EA 3PGVA 2RHTA 1QOQB 2AS0A 2D4HA 5EJ2A 4A0GA 5CD1A 2WE8A 4AZ0A 4B8YA 4IYJA 1CY6A 2RKBA 5IABA 4DEYA 5EESA 2H1IA 1JHPA 1F14A 1X1DA 3T5PA 1WZIA 4RSGA 5IAJA 3I4CA 5SZHB 4IUDS 4YDRA 1N1EA 4UJ5A 4N3NA 5JRZA 1A8QA 4FFRA 4XSVA 2OV3A 1ZK4A 2UZIR 4MH0R 1Z7WA 2YHSA 3ROZA 4YCCA 1G2PA 1XVIA 2EV9A 2HJGA 3H9BA 3CLSC 3JQRA 4GUDA 1HM5A 1QCCA 1PZXA 4AFNA 2DUUA 4AY3A 4UM9B 5K01A 1NRWA 2B20A 3I45A 4Q7JB 1M66A 1IM2A 1XRJA 2GXQA 3RB8A 4L1KA 5A9SB 4D4IA 5D8DA 4XYLA 4CW7A 2WMNB 3U9TA 1M34E 1K8XB 3HDVA 1DBSA 4AXBA 1IHPA 4M86A 2Q4EA 1P39A 1DKLA 2LKDA 1SVLA 1AN0A 1JI0A 1HQCA 3IUQA 4CIAA 5KJCA 3U1BA 1JVBA 3AB8A 4EKYA 4YA6A 2AJDA 5BWOA 3W6PA 3WYAA 3ZZUA 2BEVA 1Q7TA 4L4RA 4RD1A 1QP0A 4HRXA 4Z9AA 1E0AA 1MT3A 1F5NA 4F6CA 2VI5A 3R3JA 4Q7EA 1PFGA 1XF9A 3H6KA 1T6ZA 3O2NA 1FDIA 4IIDA 1D5WA 3E3OA 3NHMA 3EZGA 3IUSA 5DHAA 1X87A 2EHJA 4CN9A 2JGDA 4DQDA 4ZGBA 2BBTA 3E3NA 1ENOA 1FSZA 3MTEA 1GQRA 3EVGA 3NHRA 3USZA 1VA4A 2GPJA 4B6OA 3B7WA 4CMIA 3CPHA 5ETJA 1KZ6A 1C2TA 1ZXBA 5BT8A 1T8SA 1HSOA 2IPXA 1EUDA 3H3JA 4JOCA 3T06B 4E5MA 2HJHA 4E5UA 2FKAA 3N2KA 1D3AA 3AJ8A 1IFXA 1CUZA 4PRLA 1FRNA 3PC6A 3D81A 3MJVA 4CFSA 2C2YA 4UUMA 2DCUA 2H5EA 5ER9A 3UW3A 1G5HA 5DHUA 2OZVA 3A4TA 2R2GA 4YXFA 1WO8A 2GCOA 1KYIA 5FWXA 3GRZA 3L4EA 3MXOA 5D00A 1U7PA 1QE0A 4IDHA 3SX0A 3TQOA 3WSTA 2JH3A 5KNBA 2XVZA 3W8FA 1EQAA 2WM2A 4NE2A 4ZQHA 3SQXA 1A97A 4FCVA 4FKMA 2BDTA 1A9PA 5GJBA 3CT6A 4AJNA 1A5SB 1WTAA 2CXOA 3ABZA 4X1OA 1BGWA 3F78A 4JI8B 3C45A 4DLUA 2Q2OA 3FB1A 1FS4A 3DR3A 1UJ6A 2I1LA 2WVJA 5CAEB 5DBEX 1OZFA 1K27A 2XE6A 5AW9A 4IIHA 5AQ1A 4KQXA 5ELXA 1QVWA 2JF0A 2AEEA 5EJEA 4H77A 1GPJA 3P9IA 3KQYA 1EP1B 1UJMA 2B3TA 1TM5E 5IEBA 4NNPA 1YQGA 2ZRDA 4B82A 2VBFA 1TAUA 4HGYA 3LIPA 4FDTA 1MU0A 3PD0A 4LVCA 3A1TA 1LI4A 1SUIA 2P3OA 2QRNA 3MS4A 3K9CA 3B1XA 2FSPA 1N1GA 3FI9A 1NV9A 4L8LA 3E7DA 4NP6A 2NOAA 1XZJA 3ZU3A 1P4JA 2IX3A 5JS8A 1JKXA 1RAFA 3UAGA 3V32A 1AF7A 2Z2JA 3D4IA 3JRWA 1R64A 3QKUA 2EP8A 1XIVA 2GTIA 1XNJA 1VL8A 1ATIA 2YX1A 5BSMA 3WGYA 4BECA 3WADA 1DEKA 3QH4A 2VDWB 1COZA 2ID9A 3IEMA 3GGPA 5KTNA 1EXVA 2V54A 4G97A 5BWCA 3AR9A 4FNOA 4FCTA 2JFQA 1GZ3A 3P5BA 4LTMA 1DXYA 5JTUA 1G5TA 1P7PA 3EA5A 4R98A 1D2MA 1V1MB 3LQ1A 1DC7A 2FPMA 1N9ZA 1XB2A 1NXSA 2HFKA 5TMBA 1S02A 2WHPA 1PGNA 3R76A 1JIXA 3ILXA 3Q2OA 3RKUA 2BR4A 3LJKA 4NESA 1HE8B 5IF9A 2VF8A 5BWBA 1OX6A 1KQOA 2BM0A 5DGIA 3HVKA 4V3CA 4Y2QA 2J9ZB 3MINA 3NUQA 5FP0A 1TXGA 5T57A 2WA1A 3IHLA 4ZIRA 1N5RA 1MC4A 4F8EA 3M4XA 3H04A 4DG9A 4DA4A 1BROA 1QIKA 1IN1A 2JIRA 5K0JA 4C0QC 2SKCA 5IHPA 1GNPA 1FMLA 1TK2A 3OLZA 4GE3A 3HCPA 2HIHA 3PL5A 1DINA 1EA5A 1PEAA 2Z3WA 4A1OA 4B8ZA 1WBDA 4OHPA 3HDGA 2WKSA 2X19A 3K16A 4MUGA 4PPQA 3E81A 1UJ4A 3RSOA 1KZYC 1E3EA 4A16A 3AI7A 1SKAA 3FDJA 4O1HA 3L7LA 1TYEB 1XP5A 1HSZA 3GBVA 1MGOA 4KLNA 1OU4A 3S2SA 4ZO8A 4E5PA 1RXVA 3E35A 3F4BA 3O4RA 4JLWA 4C03A 1F06A 1FP1D 3GVIA 3NWOA 5LBUA 1DWUA 1CNMA 4NULA 4GP9A 3ZY5A 3UV7A 1GZ7A 3KTFA 2GN9A 1PLKA 1DOAA 4HL6A 1HKUA 1QFZA 2E1RA 3DXXA 4HZGA 5I7AA 3W9UA 4PGHA 3CW9A 3VAAA 5AVYA 4BWFB 4AQ7A 2ZRIA 2A5GA 2CYBA 4XIGS 3DA8A 4B3JA 5TS3A 4N3AA 2C99A 2EKZA 2OFFA 1E1MA 1S89A 3AUXA 1K4MA 1JYSA 4DVJA 3HRHA 4NCAA 2F62A 2GEJA 4ZOLA 5HCNA 1DBPA 1YC2A 1QIEA 2JIDA 2ZP1A 1E5LA 3G79A 1PQYA 4ZVUA 1LSSA 1AB6A 4C7JA 1PR4A 3L7AA 4RLSA 2G6BA 4MS4B 2VPZA 3N2NA 1FPQA 5KAMA 3AY6A 6NULA 4IM7A 2VBGA 3CZPA 2PX2A 2XODA 3ETJA 1JE0A 2CVPA 1D09A 4DR2B 1H3FA 1BMTA 2PZBA 3P26A 4TQGA 1X1TA 3CIOA 5BV0A 1HX7A 3L7YA 5IS2A 3G7NA 1RPZA 2Z1MA 2ZJ4A 4D4MA 4LECA 2CKMA 1ZRMA 2PD6A 3OZDA 1FUKA 5MN4A 1QP4A 3G2MA 3JWIA 1J2UA 1H1LB 1LRLA 1I3CA 3KT3A 1V48A 4V0OA 3VR4D 2HNBA 4QEZA 1PF7E 2ZZMA 1WY5A 4CM7A 4N5LA 3QXGA 1HMPA 4OK5A 3HXMA 4CFZA 2CXRA 5UKDA 1JSZA 2OHGA 1C41A 3JWGA 4Y2UA 5J2TF 2HMUA 3L6EA 4KWCA 3NWJA 5A7HA 2WWIA 2DHDA 3FNHA 4RFLA 3DWGA 1QKIA 4BQRA 4F8JA 1BYIA 2AFHB 1Q11A 1M7GA 3K09C 3WA6A 4BKOA 5LVAA 4FE4A 5U4QA 4FN4A 4EO7A 1HUQA 3I1YA 4M6WB 3P1JA 4UHBA 3NBXX 2EQ5A 1SA0B 2DERA 2FVYA 1L5SA 3AHGA 1IZ8A 4S1OA 4JGGA 1JIQA 2NUTB 2QTMA 3M8KA 1GSIA 1G2OA 3C43A 4IQ4A 2DJ5A 1NW9B 1E3JA 2FQQA 2PX5A 2X2FA 3FKSD 4KXQA 2RC6A 2XZTA 1Z0IA 2OD9A 5C5CA 5AHXA 4CEJA 4IHKA 3U7GA 4TWJA 5H4HA 4QJIA 2PGJA 3RFUA 4EF6A 221PA 1X7YA 2H2GA 5ITZA 5A0VA 1SUSA 4RD0A 1DKUA 3CSSA 3ITDA 3AM4A 2C97A 3OWHA 5IZ4A 2GJAA 3PQ3A 3BYZA 3G2LA 3AU9A 3OMXA 1CJCA 3BS4A 3EQ6A 2CNWD 1N2XA 1PJZA 4KAXA 5DNVA 4PC1A 2P6RA 1CYEA 3ZWYA 3CZCA 3SIPA 3TJZA 3WNCA 5CBKA 1Z12A 2ATXA 4G1BA 1EIWA 3PVSA 4FFMA 3HB1A 4KQMA 4CL3A 3SVTA 4DDWA 1CZLA 3KSMA 2ZRQA 3WR5A 3W3AD 1RRMA 1GV1A 2GKOA 4MPJA 2EL7A 4C6TB 4F4UA 2ST1A 4LRYA 3TLAA 5BW4A 1D4FA 3G2KA 4JVMA 4MV9A 5GVRA 2IEIA 3QOYA 3W2TA 1SCDA 2F1OA 1V6SA 3PKJA 4JJ7A 3RVDA 4XKJA 4B43A 4LZZA 2FPPB 3L7NA 2IOFK 1EHIA 2GBFA 3I9LA 4XIJA 2H1SA 2FLWA 4ZP1A 2AG0A 1L7AA 4Y30A 1B8PA 1SUPA 3ZY2A 2QIPA 2FOIA 2ZM6B 2YFYA 2CW5A 3K20A 3B1KA 3ZJ5A 3T5DA 3UB4A 2ZAYA 1SJ9A 4MVJP 2XCUA 3JQ8A 4C9BA 1JYFA 2JHFA 4ZGGA 2W6CX 3A2MA 3C5EA 4LRXA 1WZNA 3MT7A 4BNHA 3PWKA 4TUYF 1U0GA 2NAFA 3BFXA 4OQEA 4TVBA 3A8TA 2J9FA 3AFMA 5FOWA 5TT1A 4X91A 1WW2A 2Q41A 2WD8A 3EWAA 4YI3A 5DT2A 1CZKA 1YFKA 3OZRA 1WHSB 4LXUA 4B45A 3VNRA 5C80A 3H19A 5KTMA 4QODA 3QV1A 2X4DA 3M2PA 4GVXA 3HU3A 3WGZA 1N5IA 3EF3A 4QT0A 2I9KA 2FE1A 3SMQA 4MV3A 1Z22A 5T67A 3SHQA 2R8ZA 3G5AA 3WIVA 6Q21A 2QXTA 5JCXA 5LIRA 1Y8RA 2JD1A 2JEYA 3H5WA 4PRYA 1M6VB 3AVXA 1D2GA 4UTRA 2HSJA 4M88A 2W2OA 5B6PA 5C46F 1II9A 1MOZA 4PN7A 1Z16A 4OGWA 1ZVJA 3DC2A 4MYSA 2G63A 3HJFA 3AX6A 1PS8A 2ZUTA 1OBVA 5FT9A 5ITVA 3PF9A 2JLXA 5F3WB 4DY6A 5ED4A 4IZIA 3KXLA 2OQ2A 2JCYA 4MI1A 4U9IS 2V9CA 4AKIA 2OXFA 2ZOSA 3PSHA 5EUMA 5J4YA 5KTTA 3GPLA 4GOXA 3SKYA 1T1GA 1ETHA 1YJAA 3EQ7A 1SUAA 3LNCA 5IWCA 5ESWA 5BUCA 2AMVA 1WUTA 3VU0A 2LIPA 3MVEA 5KTOA 5TPWA 2XB9A 3I9JA 2VQDA 1R1DA 5F7OA 1OQAA 1I6WA 1R5BA 4FR5A 2Q6VA 2EX4A 4QUGA 4EABA 2HW8A 5IVKA 3T5BA 2ESRA 5AUPB 1P33A 3GT3A 4ODIA 2VF2A 4BNMA 1CZUA 3INRA 2NNWB 2OHHA 4W5HA 2XMSA 4F97A 3R6LA 3MCUA 4S1WA 4UULA 5EFOA 4DMKA 4CGZA 4UZFA 1Z62A 1E3SA 5I4IA 1EESA 5KYVA 1KJWA 3JD3A 1JJIA 1D6NA 4CUKA 1CD5A 3F6CA 2GD1O 1KXZA 1ZN7A 4Y7CA 5TJ9A 2O2EA 1M1YA 4QQNA 4KV9A 4QOEA 5I3CA 2IYLD 4LDNA 1UXIA 3MS2A 4EENA 3C5HA 1GNSA 5AWFC 4BNNA 4DR5B 3EWNA 4HH4A 4Z7NB 1VQ1A 3CNNA 3UYKA 1M33A 3VZSA 5FA5A 1TJ3A 1JS1X 4X7PA 1TKRA 4CKBB 4E5DA 1FTWA 2XZPA 4JJAA 4UAGA 5AOBA 4BQOA 1KI1A 4CLDA 2XXAA 4A6DA 1XZLA 3B6IA 5T64A 1C1DB 3OWXA 1TMGE 5JDIC 3IP9A 1P7CA 2YZNA 3ZV4A 5BQPA 5FUMA 5J2TB 3WK6A 1B2LA 1JT9A 4L8VA 3OHMA 4JCCA 4K0KB 1B23P 3I05A 3AVQA 1VLLA 2NPIA 1UPFA 4BGEA 5AM2A 3U5ZB 3CX4A 1JYEA 3EXHC 2QVZX 4UU8A 5JNWA 2D62A 2CBGA 3D1LA 3A7EA 1FA9A 1U1DA 4G9GA 3REQA 3OAAA 2DT5A 3AVPA 3HSSA 1SVKA 4WOPA 1VFPA 3K8ZA 2WJHA 4LJ8A 2OXTA 2R7LA 2WTNA 3F1LA 4F2DA 3ETGA 1HDZA 2LE0A 2XDYA 4GSYA 2WG0A 4HNHA 1W5EA 3B82A 4TLBA 4EX7A 3M6XA 6AT1A 2OO3A 2ASEA 1KIAA 2J9RA 2Z1DA 4IDGA 4IMIB 4HV4A 4YJHB 3TKYA 1TF7A 3ETCA 3ZGLA 4EY7A 3HJAA 1P2DA 3C7KA 3YASA 5JSHA 5LIPA 1W1WA 4RPKA 1YUMA 4DLRA 1SCBA 5KSOA 2JLYA 2GRUA 2J3KA 3QLUA 1KZ7B 3B2EA 3R5XA 1W1UA 1E3IA 2EGHA 1ZUD1 1Q0PA 1SC4A 3X2FA 3LCVB 2E5WA 1DJNA 5EJAA 4RHEA 3ONDA 2XLCA 3QWHA 5GP1A 4BO3A 3K0AA 1X9GA 1NF8A 3UOGA 1QRAA 1XDWA 1MQAA 2CLHB 2YQ4A 3DZCA 1XZPA 3AM3A 2ZWPA 4R2IA 1JJFA 2QN1A 3IX7A 3V2UA 3ZEIA 4EOGA 4F7DA 2O48X 4NU8X 1F0PA 2HCTA 3DJYA 2QE7A 3G89A 2FCAA 4KR0A 2FW6A 4NFHA 1E2KA 3LWDA 4ITUA 2XTZA 2NU8B 5K0ZA 4A36A 3M0EA 2HD4A 4M83A 1L1FA 3HBFA 2MOKA 5DXFA 4MITA 4OU4A 1W36B 2IP1A 1Z0DA 3VSEA 4BKPA 3D6TB 3DGFC 1MH1A 5KREA 1VKHA 3KHUA 1PNVA 5JCOC 4QE3A 3PX7A 2VJAA 2RKOA 2FX2A 4A2WA 1G18A 4LHEA 1ENPA 1QIGA 1XJCA 1A82A 2IGTA 2C0QA 5K99A 4PGGA 4PZEA 3W5SA 2FQXA 4KIGA 4Q7KA 3H0EA 1B1AA 3BWBA 2H4HA 4MQLA 2AXPA 3SE0A 2WYVA 3BXHA 3COJA 1Z5UA 2WFAA 3SP1A 4DCCA 2AG5A 3HYSA 2C4KA 1X2EA 2WD9A 5DMHA 2RONA 2FWAA 4DIUA 5DTMA 4BMZA 3GELA 3EZXA 3IP5A 4P53A 2XWQA 4Y0VA 3BH0A 5ES3A 1XZQA 1YKFA 2Q1UA 4E0BA 3GLVA 3HEBA 3VVLA 1KVQA 5E2AA 1V8PA 3IMFA 4IJWA 2ACVA 2WR8A 3ORQA 1JG1A 2TS1A 3NHWA 2J5XA 4DMFA 4L16A 3QKRA 1NRIA 2R8XA 4QDOA 2D0DA 2QM0A 3B6ZA 1NX6A 2V7TA 1O96B 5FPSA 5DBHX 1RJWA 5KHAA 1G55A 1MRSA 3AF5A 4WBNB 5IU6A 3ZGNA 3O5AA 5EXTA 4OL0A 4LV8B 4MVJH 3LGSA 3I6ZA 1HWYA 3GUCA 4BVKA 1X7WA 4MWGA 2I7XA 4O4JB 1MJNA 4CTOA 1WRBA 3IVAA 3Q8MA 3ZDEA 4RHCA 3REFA 5JYDA 3ZHYA 4U1RA 1E3WB 2F90A 3W77A 2IYEA 4Y0NA 1E1CA 4N3GA 1T2NA 3HV0A 3KS9A 4ARZA 4JJFA 5MDHA 2R97A 4B7AA 4E4RA 5EPUA 4WX2B 3OPYB 4E4TA 5AYVA 1X7WB 1V6CA 1A27A 1HE1C 3HO6A 3P2MA 3DBLA 3EISA 2ZVPX 4UATA 5IVDA 5AUQA 2YDXA 3B38A 3QBJA 4IIGA 2B1IA 3OLWA 4RX1A 3DR5A 1QGOA 4XWTA 1VIYA 3CN7A 5TX7A 3B1JA 1GD1O 4MR8B 2VHCA 4RFSB 1GQQA 2G9ZA 5A0FA 4CKEA 2JHPA 4ERNA 3DHNA 4YV1A 4CG0A 3E7WA 2ZBQA 3IGFA 4KN5A 4OKIA 5JDCA 3DZIA 5BSTA 5FI0B 3NO4A 1KWKA 1PEDA 2QKYA 2SNIE 3AI1A 5KNDA 3SC3A 1YMQA 4FJ1A 3RIXA 1NBIA 1C1XA 4OY3A 3JARA 5IBPA 1KDVA 3RUIA 3AOEA 1TTHA 1FYWA 1OI4A 2UZAA 3THXB 3E1GA 1E60A 1EA7A 4EHNA 1W93A 2O8NA 2TRSB 4U9HS 4XYBA 4HDMB 1PNRA 4HRAA 1XROA 1SD2A 3NKVA 1W9MA 4QFBA 4RMGA 3SR3A 3I8SA 1CYDA 1RJFA 3FTDA 3LUCA 1QHGA 1T2VA 4R8LA 3IQEA 4ZVRA 5THXA 4ENUA 5KSWB 4YRJA 1RZRD 4K9DA 5HIIA 5BPFA 4JBGA 4HGZA 4KNWA 1P9RA 2I7DA 5TQ2B 4ASUD 1Y6ZA 3Q7EA 4IQFA 1U2ZA 4ML3A 1YKSA 1KRHA 1B8UA 1BQEA 5L95A 1LS1A 3FLMA 2X76A 3IDOA 4FR0A 4TWBA 1NIPA 2DUJA 2BGKA 4ZRMA 1LQTA 1VMKA 4MPDA 1YD7A 1BCSB 4G5QA 4IQGA 1R5JA 2HZBA 3C41J 3TTUA 4DIBA 4BB5A 1VLMA 3TMKA 1T2UA 3STWA 4UXHA 2VNIA 1VJGA 1JFVA 2J7PD 4HAWA 2ZBDA 1M3SA 4BMCA 1NN3A 5ADUS 5U9CA 1XPRA 3VAYA 3LZCA 4HXFB 1UEXC 3UV3A 5C81A 3NBMA 1SVWA 5CFZA 5HBRA 1ULHA 4TRMA 1KQ3A 1WU8A 4B33A 1L9XA 1IUNA 3MWKA 3I01M 1GQ2A 5CDSA 4TLDA 3U48A 1ZSYA 1D1SA 4IWXA 3ASUA 1UP7A 3OD1A 2GZ2A 2ZTLA 3IV6A 2BH2A 1GGFA 1G8PA 2XCQA 2IHKA 1SIWA 2P6OA 1QGAA 4QRDA 3AY3A 2RJOA 3SJAA 3QEAZ 1GWNA 4JYPA 1O95C 4NCXA 1ZAKA 5FHRA 3H9QA 2NYVA 5AJXA 3MF4A 5JSZB 5M04A 5CIWA 4MOWA 4GX2A 5LN1A 2QTNA 4LPKA 1T9GS 2RI6A 3ZC3A 4OBXA 5J9FA 3LW7A 3I1FA 3IODA 4EEKA 5D5QA 5FOSA 2TMGA 5JMWA 5F9FA 4Q3EA 1S9DA 2EYQA 1YUBA 2H16A 4NJMA 1GKIA 4UUAA 4RTOA 1O5TA 3WYDA 1HQKA 3UXEA 3G2QA 3NYRA 5EIEA 1NVBA 3L7MA 4TKVB 1E1YA 4AN4A 2IHTA 1GNRA 2WHEA 3EEQA 4Q4HB 3KAJA 1P9LA 2P0EA 3C6YA 4EW2A 5JCJD 1E2LA 1ZI6A 3QITA 1KYWA 3H0KA 4NYIQ 4MVYA 2PWBA 4O0MA 1JALA 4XUDA 4CKZA 3E05A 3ASYA 4YH1A 3TLXA 4D0NA 3U7HB 5CH3A 1QH1A 4TV9B 5EIBD 5FDFA 4BLVA 2OORA 4XJSA 3TLMA 1OIVA 4BX2A 3NX4A 4C0LA 2C7PA 3QPUA 3JXEA 1GVHA 3GDOA 4GP6A 5CLHA 5GAJA 1YWGO 4QQ8A 1ZPDA 4PZ0A 3KSUA 2AD1A 1DQYA 4PLYA 2F9LA 4BZPA 1IVSA 4OF4A 3CX7A 3AY7A 1N2SA 3GRRA 4L50A 3PFNA 1MPTA 5EOVA 4AU1A 1SUFA 2YOFA 2E5FA 2ZJAA 3AF0A 3LFHA 2YHBA 3DFFA 1JXQA 4N6NA 1KTIA 3ICPA 2QD2A 1T4CB 2HCRA 2P5YA 3P2OA 3MTGA 5JADA 5EXDA 3DE6X 2WKWA 1CR2A 2F9MA 2J5BA 4G0OA 1JBKA 4C4OA 1GYPA 3HJGA 3SQWA 1XC7A 3OO1A 1SVMA 5J58A 4BU1A 3MYRA 3GZJA 3K2QA 3W5CA 1DRUA 2AWOA 2J87A 1CJBA 3DDZX 4AJ1A 3F6RA 2IZ1A 1L6RA 2P0AA 2HDNB 4KXFB 5F9MA 5J5VA 2QX6A 3O9MA 4N5MA 4XQGA 3V9PA 1ZNXA 2P9CA 2F8MA 5E7IA 2FDRA 2ISQA 4A73A 2NZUG 2OV8A 2G83A 3ZBQA 4KO8A 4Z0HO 2H63A 2YCLA 1VBFA 1EX1A 1INLA 1RHQA 5IN5A 3T94A 4U0KA 3DVLA 4MROA 3SHTA 2MHCA 1EH5A 2XUPA 5AM0A 1XP8A 3FSGD 1RBQA 2X1HA 3UMCA 4QG3A 5A03A 2PUFA 2CVFA 4I55F 5HUJA 1GFWA 1OYYA 3AR6A 1KDPA 3ETEA 2R1TB 3HCCA 3IE1A 2EZ4A 4A5OA 3DMGA 4GL4A 4LY6A 5ALNA 4OPMA 1E4YA 3I2FA 2IZ5A 1JHZA 1UQRA 2WJGA 4IV8A 1CB0A 1JPJA 2JI6A 3AF2A 1GPBA 2AHRA 5AI0A 3TZ6A 3NW9A 4DCPA 3SBEA 2J4FA 4NOJA 3UGQA 1EGQA 1M6VA 1PZEA 4GGPA 1VE9A 2BFWA 3H1AA 2BFOA 1ZJ4A 2EEZA 2YWRA 3N7AA 3QPVA 2YXPX 4ETNA 3L2OB 5F5NA 3NVDA 4TVKA 2AV6A 2W2KB 3NKLA 1G8YA 3MTIA 4Y1FA 4Z4GA 2R7MA 2ZUDA 3HB4X 1TVEA 1ST3A 2ZGVA 1K66A 2MTBA 4UPEA 4C7BA 2PFKA 4DMHA 4PPYA 4LHVA 4OXNA 4PSVA 2BW0A 1LS6A 1RP1A 1TKBA 4W1PA 4LY0A 4O2BB 1UINA 3ECAA 2OCGA 1YMUA 1ML3A 1WOMA 2JDID 4E13A 3GUZA 1RQLA 3ICQB 3GFSA 4XDHA 4XVHA 1DUIA 4B48A 5F2NA 2B3DA 3BK2A 2ODTX 1C7EA 2XYQA 2ZIUB 1NMYA 1MG0A 2ZI4A 3GT0A 2VATA 2PD4A 2OC4A 1UAYA 3N8NA 5ALYA 4NJOA 3R6GA 1BXRA 1ISHA 3LCUA 4X6UA 2Q0HA 1FLDA 1Y98A 2H4XA 3U2QA 4QYTA 4UTPA 1ADFA 3CVWA 1O03A 2CB9A 3S55A 5JV5A 3DEAA 2AKYA 2I4NA 3PE3A 1HETA 3I9FA 1M2OB 4RACA 1OIXA 4FQ7A 1Z6YA 1K3FA 1T6NA 2W7TA 3QKSB 1QHXA 3PA8A 1IWPB 4NZZA 3BZUA 4Q1AA 1BTOA 4REQA 2XE7A 1DV1A 2XNDA 1QE3A 2G09A 3PCTA 4ZALA 4F5DA 2GNAA 1PZMA 1TYAE 2EFCB 1Y9DA 1I8TA 1Z4OA 2J30A 2R8EA 1JAYA 2RIPA 2W58A 4R31A 4HAXA 3ODPA 3E3LA 2HNKA 1JXMA 1KAQA 4NV0A 4J0JA 1FW8A 1LLCA 4Q24A 3STVA 3VR2A 5CA1B 5HHTA 4HGNA 2HTFA 3RE1A 2P4SA 5KNBH 2VF7A 2J5QA 4EAAA 3M5CA 5DX8A 3I5UA 3WDMA 1Q74A 3UA4A 3NDPA 4WCFC 1IUPA 2FPIB 5IUNC 4IIFA 5JNSA 1LW6E 3KU4A 4RD6A 2IP2A 5FR1A 5L3VA 3W6ZA 3DVAB 2CLLB 5CBPB 2Y3IA 4GX1A 3ZIUA 1S3IA 3I3OA 5H82A 1DOZA 3PFHA 1LVUA 3MMPA 4GR5A 5F1KA 2Z2YA 3A6FA 3N28A 2IS1A 3JV7A 1QDUA 5LDHA 2L17A 2Q6TA 3UH1A 4PTLA 5AKKA 1GPLA 2H5JA 3WJ7A 1TLLA 4OMCA 3CPEA 1I10A 2DOKA 3F46A 4RZIA 4EYOA 3TRFA 1EUCA 2EX0A 4X97A 4EY3A 5B30A 2IQIA 2R6GA 1Q1ZA 2Y1CA 2FX3A 3AQ4A 1J09A 1J6UA 2AOVA 5FADA 2A9RA 2WOOA 2V7QA 3CWZA 1V7ZA 3IUMA 3NM5A 1M1UA 2ACEA 2YIDA 4JB0A 4PAGA 4Q3DA 4YRZA 4I81A 2CJWA 1U8EA 1VC2A 1ZYUA 2OVFA 3EOBI 3HCWA 3FGNA 4QGBA 5I5EA 4GX5A 3QWFA 5BW5A 3PC2A 3R3VA 5F5XA 2OHJA 2AFIE 4D96A 4Q05A 1TM7E 1SXJB 4GOOD 4HLQB 4OHOA 3LHKA 5JRDS 3WKCA 4G63A 3P9XA 4KWHA 1Q57A 5A06A 2I4TA 4UPDA 3GJ6A 1PG5A 3ID6C 1WABA 2Q5QA 3KJZA 3HVRA 3AINA 2BAGA 3A1FA 4MPRA 1H4QA 2GAAA 2Y1OA 4PAOA 4YB8A 1H1LA 3S99A 3EUWA 1P2SA 2Q5LA 1JDTA 4NV3A 4EARA 3GQBA 4XR9A 3RRXA 3OA2A 3TKLA 2NZJA 1X70A 2VJLA 3SZMA 1G9XA 2GMWA 1E2JA 4P0PB 1XQYA 2ZULA 3CEJA 1F60A 1MJ5A 4HQLA 2C5GA 3E18A 1YH3A 3GCWA 4C76A 2HADA 3WHIA 3AETB 3LRXA 2NSDA 2NXJA 4RANA 4NV1A 5CURA 4YWJA 5K8UA 4K9SA 4BB6A 5EQDA 2AN4A 2GZSA 3KUUA 5TB5A 5LMUB 2H7VA 3RYCB 4UNSA 1CERA 1RRFA 3Q15C 4FYVA 3G5MA 4L5AA 1RYMA 4S2UA 3FRHA 1FZTA 2IELA 4ECEA 4PBTA 1TQHA 4P4SA 3WL8A 3EMKA 2IS4A 1NVFA 3TJRA 5K8TA 3V1YA 5CGZA 2D6FA 3AFHA 3JQAD 3H11B 3QFTA 3BD9A 4U8HA 1NXVA 3U4AA 5HW0A 2ZYHA 5LP6F 1AXRA 4B47A 2D3TA 4TZKA 1WX1A 2OFPA 2QWXA 4MGHA 1Y80A 4B9EA 4HO1X 5BUSA 2R6CA 2ZIZA 4D8TA 3DONA 4QUJA 4W8OA 5HR5A 1P62B 4K81B 4NBLA 3A9WA 1D2EA 1P9NA 3JAKB 5TDHA 3IKVA 4HGRA 4OJQA 3RFXA 5JDIA 2VDNB 2PBRA 1GPDG 4W5QA 2GBIA 1UK8A 1T8YA 3EEBA 1CJTC 1CUVA 1ZY2A 1TEZA 1GCAA 2IBSA 3O31A 4ON9A 4F5YA 5B2EA 4JSYA 1WCYA 5AJWA 3OTWA 1KEEB 4LEIA 4YNBA 1XLVA 2FUKA 4M7OA 5KOHB 2WAXA 3G68A 1R00A 1PRYA 1T0UA 2CMFA 3WIEA 4YMHA 5AHWA 3MRVA 5B1SA 3T4PA 2WIGA 3O3MB 2KLHA 4Z4FA 1TMYA 5DM2A 2WIDA 2XCRB 2ZJZA 1PG0A 3O8LA 2PV0A 4MI6A 1JWAB 1SCJA 2ERXA 2W90A 2R7KA 5IW8A 4COKA 1SURA 3RUEA 2I6GA 3MOGA 3UIEA 4CT5A 2D0PB 4FE7A 2CLKB 4KGVA 4X1YB 2VNSA 4LCEA 4W6ZA 5CK5A 5LP6C 2PLAA 5H0IA 2J32A 4QOFA 3WZ2A 2O59A 1KAOA 2D1SA 2Y1XA 1RAEA 2C5LA 2BI8A 3R6TA 4BEVA 5JVDB 5AVXA 1P80A 2PR2A 3FSEA 2VDLB 1JJVA 3TCNA 3QEBZ 3AKDA 1JGTA 1PIWA 3HMKA 3JQFC 1YIAA 3N2GA 4ANFA 3I1JA 1TKAA 2Q1YA 1JA9A 1ULBA 4RU1A 2Z09A 2YQ5A 2VKTA 4LCJA 4XQCA 5SYMA 4G5GA 4HEQA 1U3VA 1UPUA 1P19A 13PKA 4H0NA 2OKCA 1NATA 1STOA 1GOTA 3BSWA 4DDKA 1DTWA 1KE1A 4PO3X 1BEEA 3LVBA 5COBA 4RZ2A 3HCBA 3DVSX 4QU8A 1RWKA 1V2HE 3WXBA 3ER6A 3SNHA 3WL4A 1L8AA 1ZD5A 4YPFA 5ICFA 1Y9JA 1RJDA 2YS7A 3FCOA 4L2IB 2IDZA 4IOKA 2QZ4A 2BGLA 3RDPA 3KXDA 5HM8A 1GA1A 2NTEA 4UEKA 4FONA 5E4JA 2XNDD 4LYJA 2PGDA 1ES9A 2A0KA 2C96A 1UMBA 4TTQA 5IBQA 1WP4A 4CL8A 1II8A 1PJ8A 1GHTA 1HPLA 2FWPA 1UP4A 2WJWA 4EHHA 1FXSA 1LBQA 4DA8A 2Z4RA 3GCGA 3IHKA 3RKSA 2O8FA 3TZKA 1X1EA 2RAUA 1M67A 4WQMA 1DCKA 3LYHA 4NR0A 1ZK0A 4XDZA 1N32B 1ZI9A 1PR3A 2G88A 2PMFA 1UJ5A 3IQIX 4TKLA 4WFIA 2A58A 1A98A 1TUGA 1V4NA 3COWA 4LK2A 2QUBA 4NC9A 1K6IA 1M8JA 2ZRNA 3AUJB 1QYRA 2LRHA 5BQXA 2E9SA 2FR0A 4HH3C 4HYYA 4ZPJA 5AW8A 3M7IA 4Z6KA 1K6MA 4EFNA 5AKGA 1TEVA 2PWPA 3DPIA 3P45A 3I9V6 4MP3A 3RFVA 1BGVA 3KTOA 4P54A 3L41A 4I50A 4WW0A 1JG3A 2RH5A 1A7UA 2YYYA 2UYOA 1W4BA 3HXLA 4C0WA 3GAFA 2HH9A 3IV9A 3N2KB 2QRKA 2Y1FA 3E23A 2QN7A 1BE6A 1CIVA 4L95C 1X39A 1Z3CA 1T8RA 3EGVA 1KI3A 5T4HA 4JUAA 4QEDA 3ESXA 3IOMA 3BMOB 1NA5A 1QH1B 1MLDA 1ONNA 3X1DA 4AI6A 4BP9A 2PY6A 4MVJD 5CG2A 5DCYA 2O7RA 4Z4QA 2IH2A 1UZLA 4NU6A 5K0FA 2VNAA 2YZMA 3FCSB 1JW9B 1GU1A 2AFVA 7ADHA 4KXMA 2Y0EA 1KSHA 3PWSA 2FW8A 3KKOA 3FTFA 4DCTA 1UR5A 3UMVA 1A9XA 2B35A 2Y1WA 3ZWVA 1XX6A 4EYSA 2XI4A 5BMVF 4NVRA 3AERB 3K53A 2BELA 3T15A 1ZGZA 4M9CA 5FUYA 3VNBA 3KDSE 2A5DA 3D9QX 3PITA 4CKCA 1FK8A 2EKQA 3VJMA 4WL0A 2IY7A 3Q0EA 2XCOA 5CT8A 1XKLA 1X77A 4LQ4A 4KPYA 2IKQA 1T9AA 2VF4X 2VQFB 2FMTA 4Z4EA 1H22A 3UAWA 1JSRA 1Y8CA 2IW3A 1I36A 1GM5A 2HIMA 4X20B 4F85A 2PE5A 4IJKA 5AJVB 3TLZA 4AO6A 4ACAA 1JIKA 3OEHD 4TZ6A 2BFEA 1E5VA 4CE6A 4YDHB 3OCJA 1I6KA 2HHAA 1FLVA 4ZXPA 1XXLA 4OB8A 1WXQA 4P08A 3ZJYA 4CTJA 3FZEA 1BJKA 4GWKA 1OYOA 1CLUA 3PIIA 3RHSA 3K1AA 3Q7IA 1WM1A 3STTA 4DYDA 2DMRA 3PX3A 3TRDA 5JQGB 3H7IA 2C0CA 1MJHA 4ZJUA 1GGEA 3A6ZA 5JYCA 1E9CA 2HWYA 1H93A 1Z68A 4I8IA 5CLQA 3D8SA 4OMUA 4URFA 2QW0X 3E22A 2WDPA 4EQZA 3CJQA 1LSUA 4PSAA 2VHQA 1MEJA 4MV8A 2F3SA 3SR0A 4M7RA 5HOQA 4URHA 5LA6F 1LPSA 4MR8A 2PN1A 1E9FA 1HEUA 3M5DA 1PGQA 3IKLA 2GERA 2H2IA 3VH3A 1C3LA 3AESB 4WLVA 4V0SA 1AKWA 2J6IA 2JAHA 4CRWB 3GX1A 4L5IA 3F6SA 3HXPA 4N03A 4JB3A 2ONZA 1IH8A 1AZWA 1ATZA 3IILA 3KJXA 3DCJA 3KT6A 3WWEA 5AXCA 3LT5A 3OFND 2IT1A 1FTNA 3BB1A 5BW6B 4DUGD 2HT6A 4TSRA 1NKTA 1N75A 2B1QA 4JYMA 1Z2OX 1LD3A 2ATEA 3FDZB 4FCWA 4F3KA 4S24A 2CK3A 4RCVA 5IX8A 4HB2A 5GONA 4BNVA 3JR3A 3PFBA 3PNSA 5ALJA 3RABA 5B1HA 3W5HA 1MDFA 2YHAA 4J0IA 2P79A 4JUBA 5HJ2A 1SK9A 4EB3A 4KSYA 5AJZA 2IXEA 5TT0A 2XE4A 2FPLA 2QTVA 2TMYA 3Q7SA 4IR7A 4U02A 2XA1A 5EZYB 4IW3B 3F6BX 1B26A 5IAAA 4DCVA 4TRRA 1TVCA 3EXAA 1ESDA 2ZVQX 4ZU6X 3ZJUA 4RVGA 2B7BA 4ZJZA 4DR3B 3OQOA 1M76A 3TI9A 2FEXA 2ODEA 3ZW8A 1AKUA 4AZVA 1C9MA 1Z0KA 4W5WA 3TXXA 2R8BA 5CCEA 2VH5R 3VR4A 1GZVA 4LRUA 3RVMA 3ELUA 3L0PA 4CLOA 3SX4A 1N5LA 4Q3LA 1NMSA 2IV2X 3OPMA 2X77A 1X6VA 3NORA 3L5OA 5DX1A 3GDGA 5CB4A 3B6EA 4OSOA 4OTZA 4E03A 3GN2A 3RHZA 2V97A 3RASA 1E18A 1F1JA 1V2GA 3USES 4BATA 4RYDA 4N49A 3ZVNA 1VLQA 1K6EA 2ODQA 4ZAVA 2OQIA 1WU7A 3DYIA 4PQYA 4Y2PA 4NTZA 3OQMA 1PJ2A 2KMLA 1JDUA 3RIEA 2BMJA 3KPYA 1TMKA 3DTYA 5T5QA 1ZXLA 1H2WA 4R0VA 1OA1A 1XF1A 3QGMA 5HF9A 2JKVA 3FY4A 4Z3KA 5LLDA 3NHSA 2JG3A 3VR2D 1E3DA 2OHXA 3GHHA 3HBAA 1KYYA 2Q3CA 3I92A 4H1VA 4MVJF 3PQ7A 3KIPA 2PUBA 4PNEA 4O59O 1GL3A 2PRKA 3IVRA 5KB3A 3W5AA 1WSBA 3Q3VA 3LXXA 2MSEB 2XOKD 1IQUA 1QYXA 4RGBA 4DCMA 2O0HA 3LC1O 3PD1A 3DKVA 1VE3A 2DPLA 4MKZA 1NVAA 2BISA 2OAEA 1O3YA 3P0HA 2HRQA 3PTZA 1BQ4A 4NPCA 3R74A 3W0LB 3Q7QA 5A5FA 3P8ZA 3U44A 4FIZA 1RFLA 3MWFA 4FOPA 2VN8A 1ORTA 3G6KA 4A6XA 3WNVA 4G2NA 1I4DD 2WQ6A 1MDBA 5ILOA 1FRZA 2RGNC 1L6IA 1QCDA 2HA4A 3DQZA 4QTXA 4TMZA 4ND3A 3M70A 1Q3HA 4X41A 5FTKA 5I47A 1L7DA 2J08A 1CR0A 2PVSA 4C7OB 4DCGA 2H2AA 3PNBA 4RK6A 2A92A 1U2DC 2B78A 3BILA 1OI2A 1Z8DA 1V11B 4Q9AA 4D99A 1HFJA 4Q5IA 1Y5IA 3PICA 4W9RA 1JECA 4WMLA 1H3NA 2IOYA 2FW1A 4K6FA 1ONBA 3EDOA 5BR1A 5AW2A 5CXSA 3JVIA 3FAZA 4GWGA 4BZQA 4J75A 5EYPA 2UVPB 5EMLA 3WL5A 4TWRA 5K7SA 4OOFA 2Z43A 1MR3F 1NVXQ 1IOLA 4OKSA 5NLLA 2VT2A 1GCUA 2P5UA 2P3SA 5HEKA 4G56A 2I2CA 4ZQBA 3LP6A 3NHZA 3CKYA 3V4VB 1P6UA 3UMFA 4BVJA 2CCGA 1ZL0A 3DP9A 5LA6A 3IFSA 4R5HA 4B4DA 2IZ0A 1M5TA 2V8OA 1OCEA 1P7VA 3HACA 5DF1A 4L3OA 4ZEXA 2HT1A 4CQLB 2WF7A 4BNDB 4NE9A 2MINA 3VPSA 4BVHA 4C0JA 3SDSA 1U8XX 3PC3A 3D4OA 1DHRA 3THRA 2RGCA 1T25A 5KDOA 3IIMA 2QR3A 1HE3A 1Q0UA 1XWFA 2I6FA 3OM8A 3PF8A 4CNBA 1CUAA 2EL9A 2G7MC 3BE5A 4MP6A 2BTEA 1XEWY 3DE5X 1CP2A 1NKSA 1KOJA 3JQ7B 3DBOB 2ZT8A 2AZMA 4MHOA 2PL9A 2QROA 1QVAA 3PDCA 2QDKA 4L28A 5CHYA 2FN4A 2WT9A 2FPIA 4R7ZA 4Y18A 4ECAA 2C2KA 8AT1A 4PXYA 4XLTA 1KMQA 1A5ZA 1PL0A 4LDPA 1W2GA 3TR6A 1QFYA 5KYWB 2B25A 4D79A 3OETA 4L5YA 4K86A 3THYB 1NN0A 5JD3A 4DRZA 2QRGA 1CR4A 1R8JA 2XRYA 3IEIA 2FK8A 1U9IC 1WMDA 2A5FA 3O7WA 1VOTA 3AXSA 4FGSA 4WWHA 2G5TA 1DWQA 3NETA 1X14A 2DR0A 4NKRA 5FTWA 1G98A 2Y4NA 2VHUA 1R6XA 1X0VA 3NANA 3QU2A 4UUQA 3AJRA 4I5IA 1C7QA 3UY4A 2AEMA 4PHGA 5E6RA 2IEBA 1FMCA 3CB2A 4DXAA 1PSDA 4I3GA 2EAUA 2ZU6A 3WA7A 1WQ3A 2XUDA 5KTYA 3ZWXA 3FYSA 2CY0A 1SBQA 3WV4A 2AK2A 1RYDA 1PQ4A 3BWCA 3PFFA 4QYIA 4XTRA 4YTEA 3X1XA 3V42A 4XB2A 4QFDA 2NVUB 1UBTS 1RTTA 3ETHA 1FYVA 1WNFA 2VDMB 4MV0A 3QKTA 2PS9A 3AC0A 3ZWOA 2A67A 2O52A 3DOFA 1Z4JA 1CR1A 2QRZA 1C29B 2FP3A 4PX3A 1THMA 2WNHA 3E9CA 3DBHA 1NJFA 3RWMB 2WD7B 4Y67A 3NC0C 4MNTA 3PJRA 2W2NA 2RB5A 3V33A 4G0XA 5E1MA 1HYGA 2Q1XA 4YDSA 4HTAA 3DT6A 4KNVA 3LRPA 2AF3C 3EZ9A 4JHXA 1T8WA 1Z56C 2CL7X 3V4FA 5CP8A 2IV3A 2PDAA 3IXQA 3U3ZA 1DX9A 1Y3BE 2AZDA 4R01A 2MU1A 3K9HA 1HORA 2Q49A 5LZ2A 2WC1A 4OL9A 1M0EA 3GI1A 1N2GA 3RIYA 1DE0A 1J5PA 1SCQA 2NSHA 2F9FA 1L5LA 1HLGA 5KNCH 1YTLA 2N75A 3EGIA 2F8SA 1YK0A 5HP4A 1Z0SA 1SQFA 2P2DA 4KGZA 4R05A 3W8DA 1B7GO 1QMGA 2H06A 5KVVA 3PC7A 2XVAA 3TGPA 1RLOA 3JPYA 4HD8A 4AECA 3IP6A 4W6QA 2CSUA 5IVHA 4LE0A 3VYUB 2XYVA 4PLCA 3UT5B 2I6QA 5EWLB 3EFBA 1XLTA 3FKQA 1N0IA 1VL6A 2E4UA 2IYTA 1L4LA 3MTBA 4E6PA 3ACBA 3HH8A 4Q48A 3CUSA 1D2NA 1B14A 1QYVA 4DR6B 2VK2A 1DT5A 3ED5A 5BWMA 5I7UA 3T4UA 3QLEA 3T3MB 1X7ZA 2W22A 4LOKA 1XCGB 1LWOA 2H4FA 2C77A 5IJZA 2RC5A 3OZXA 1XJ0A 4W1QA 4OI0A 3OT4A 2QY6A 4Q4AB 4NZNA 4QVKA 2EU8A 1JLHA 3GFGA 5EI5A 2II6A 2RHOA 2B0CA 3KQVA 1NL3A 3K2BA 1N0HA 3AM5A 4BNTA 3AB3A 2PBLA 1WD7A 2R6DA 4LMRA 3KTAA 1FDTA 3RBZA 4CCSA 4HVLA 4FR2A 3UCXA 1QWSA 3ES9A 4OXYA 4B3CA 2BP7A 2FYTA 4B6EA 1N5KA 3ADKA 2IX9A 4EHAA 2XKJE 3GD7A 2A7XA 1P3DA 2GYVA 4IJ5A 5BNIA 4R3WA 3WQSB 3HZHA 1D4ZA 2GA9A 2XUQA 3KYCB 5A3QA 3QYAA 2HA5A 3ZLTA 4EPYA 4WZBA 3WZMA 2VTDA 1TK3A 2FZLA 1D2AA 1UEJA 4JBIA 4WXPA 1L8XA 4HQ6A