2IEXA

Crystal structure of dihydroxynapthoic acid synthetase (gk2873) from geobacillus kaustophilus hta426
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
268
structure length
253
Chain Sequence
WVKQYDYEDIIYETYNGIAKITINRPEVHNAFRPKTVNEMIDAFTKARDDSNIGVIILTGAGGKAFCSGGDPRLNVLDLQRLIRVIPKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDGGYGAGYLARIVGHKKAREIWYLCRQYTAQEALEMGLVNKVVPLEQLEEETVKWAQEILEKSPTAIRFLKAAFNADSDGLAGIQQLAGDATLLFYTTEEAKEGMRAFKEKRKPDFSQFPRFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of dihydroxynapthoic acid synthetase (GK2873) from Geobacillus kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Lyase
molecule keywords Dihydroxynapthoic acid synthetase
total genus 89
structure length 253
sequence length 268
chains with identical sequence B, C
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 2iexA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2iexA01
4HC8A 3PE8A 4YLHA 4JWVA 2PBPA 2CE3A 4DI1A 4WZ8B 3TV5A 3QMJA 4U0HA 1FC7A 2D3TA 1YG6A 1DUBA 1O8UA 1N6EA 3KTGA 3TDCA 3R9TA 4U19A 3GLMA 3QK8A 3IB9A 4IZCA 5G1RA 3R0OA 3QYRA 1XNVA 2CBYA 2VSUA 4JYLA 4U1AA 3P5MA 4QIJA 4ZDBA 3T8AA 4I42A 2QQ3A 3Q0JA 4FZWA 2ZL2A 3BPPA 1N6FA 4QIIA 1VRGA 3IBBA 3RRVA 4FJWD 3NJBA 3TT6A 1WDMA 3DJAA 4JJTA 4ASIA 1FCFA 5DUFA 2Q2XA 4G2RA 1HZDA 4KNPA 5INGA 4FNDA 4GM2A 1W2XA 5IKLB 1FC6A 4ZDEA 2J5IB 2Q34A 4Z0MA 2J5SA 4Q1IA 2BZRA 4I52A 2Q35A 3KQFA 1TG6A 1EF8A 4JYJA 1PJHA 2F6QA 2UZFA 4ELSA 3BEZA 2VSUF 5KJPA 4IZDA 3T8BA 4JSBA 4JOTA 3KTKA 4L6WA 4KD6A 3QXIA 3N6RB 4MI2A 1YG8A 2ZL0A 3VIVA 1K39A 1FC9A 3R9QA 3RSTA 5DTWA 4HNKA 4OLQA 3Q7HA 3H0SA 3JU1A 2IEXA 3L3SA 4Q0GA 4JCRA 5DU6A 2J5IA 2PPYA 3V5EA 4JCSA 4FN7A 1JXZA 5DTPA 4KPKA 4K3WA 1XO6A 1XNYA 1DCIA 2X58A 3MOYA 4MXIA 5JBWA 4EMLA 4K29A 5CTCA 3R6HA 3TT7A 2J5GD 3WG5A 4GHNA 4FZWC 2J5II 4U0GH 4WYOB 1OD2A 4NNQA 4JFCA 5DZKH 3STAA 1EF9A 3KTHA 3TVWA 1K32A 1WZ8A 1OD4A 3QKAA 1UYRA 3GMAA 1WDKA 3HLN1 4RCNA 1EY3A 3TVUA 3K50A 5KDRB 1ON3A 5C90A 4QFEA 3K8XA 1J7XA 1UYSA 3MT6A 1SZOA 5DU4A 2C8TA 3LAOA 1RJMA 2ZQQA 3BF0A 3U9SB 1MJ3A 4ZDDA 1TYFA 2VX2A 2FW2A 4OG1A 5DKPA 2ZL3A 2VSSF 4ZDCA 4U0GA 1Y7OA 3V5IA 3H0UA 3SLLA 3HINA 2F9IB 5E0NX 2VSSE 4F47A 2DEOA 2X24A 3QXZA 3LKEA 2WTBA 5E0SA 3ZWBA 3KTIA 4ZU2A 3QWDA 3OT6A 4ZDFA 3FF6A 3G64A 3NJDA 2VSSA 3SWXA 3PGQA 4L8KA 4IZBA 2PG8A 3GKBA 3DORA 3TLFA 2VSUC 2ZL4A 2A81A 4KWBA 3TZ3A 5DL1A 4B3JA 3ISAA 4JCQA 2F9YB 1UIYA 1NZYB 3T88A 2J5GA 3QREA 4RYFH 2A7SA 5G1QA 3U9TB 3IAVA 3ZWAA 3R9SA 5C9GA 5G1SA 1Q52A 3TRRA 4OMRA 3MYBA 3KTJA 1N6DA 1ON9A 1UYVA 4I4ZA 3HE2A 3H81A 3PEAA 5CTBA 2VREA 2HW5A 4FN8A 3T3WA 1HNUA 4EMPA 3Q0GA 4U18A 3H0QA 3HRXA 3HP0A 2F9YA 2EJ5A 3P2LA 1XNWA 4JCTA 3RSIA 3GF3A 5E0SH 1RJNA 3P85A 3H0JA 3MFMA 1XX4A 2A7KA 3ZWCA 4K2NA 2FZSA 2NP9A 3ZW9A 4RYFA 3T89A 4JVTA 4ELWA 5MGBA 3PZKA 3I47A 4LK5A 1UYTA 5DUCA 1SG4A 4B3HA 5KDRA 2F9IA 5INIA 3OC7A 1PIXA 3ZW8A 5DU8A 4B3IA 3H02A 1NZYA 3GF7A 1Q51A 4WCZA 3OMEA 2GTRA 2FBMA 1X0UA 3Q1TA 2F6IA 3FDUA 2DUBA 4ELXA 3M6MA 4MOUA 5DZKA 3ST9A 5FIFA 5INFA 4FNBA 4EMMA 1HNOA 2VSUE 5FUSA 4NEKA 2ZQRA 5JBXA 2W3PA 3U9RB 1WDLA 4FB8A 3M6NA
chains in the Genus database with same CATH superfamily
4HC8A 3PE8A 4YLHA 4JWVA 2PBPA 2CE3A 4DI1A 4WZ8B 3TV5A 3QMJA 3W8IB 4U0HA 1FC7A 2D3TA 1YG6A 1DUBA 1O8UA 1N6EA 3KTGA 3L8JA 3TDCA 3R9TA 4U19A 3GLMA 3QK8A 3IB9A 4IZCA 5G1RA 3R0OA 3QYRA 1XNVA 2CBYA 2VSUA 3ADCA 4JYLA 4U1AA 3P5MA 4QIJA 4ZDBA 3T8AA 4I42A 2QQ3A 3Q0JA 4FZWA 3AM1A 2ZL2A 3BPPA 1N6FA 4QIIA 1VRGA 3IBBA 3RRVA 4FJWD 3NJBA 3TT6A 1WDMA 3DJAA 4JJTA 4ASIA 1FCFA 5DUFA 2Q2XA 4G2RA 1HZDA 4KNPA 5INGA 4FNDA 4GM2A 1W2XA 5IKLB 1FC6A 4ZDEA 2J5IB 2Q34A 4Z0MA 2J5SA 4Q1IA 2BZRA 4I52A 2Q35A 3KQFA 1TG6A 1EF8A 4JYJA 1PJHA 2F6QA 2UZFA 4ELSA 3BEZA 2VSUF 5KJPA 4IZDA 3T8BA 4JSBA 4JOTA 3KTKA 4L6WA 4KD6A 3QXIA 3A4LA 3N6RB 4MI2A 1YG8A 2ZL0A 3VIVA 1K39A 1FC9A 3R9QA 3RSTA 5DTWA 4HNKA 4OLQA 3Q7HA 3H0SA 3JU1A 2IEXA 3L3SA 4Q0GA 4JCRA 5DU6A 2J5IA 2PPYA 3V5EA 4JCSA 4FN7A 3O4XE 1JXZA 3BPTA 5DTPA 4KPKA 4K3WA 1XO6A 1XNYA 1DCIA 1Y64B 2X58A 3MOYA 4MXIA 5JBWA 4EMLA 1UX5A 4K29A 5CTCA 3R6HA 5HUQA 3A4NA 3TT7A 2J5GD 3W8HB 3WG5A 4GHNA 4FZWC 2J5II 4U0GH 4WYOB 4NNQA 1OD2A 4JFCA 5DZKH 3STAA 1EF9A 3KTHA 3TVWA 1K32A 1WZ8A 1OD4A 3QKAA 1UYRA 3GMAA 1WDKA 3HLN1 4RCNA 1EY3A 3TVUA 3K50A 5KDRB 1ON3A 5C90A 4QFEA 3K8XA 1J7XA 1UYSA 3MT6A 1SZOA 5DU4A 2C8TA 3LAOA 1RJMA 2ZQQA 3RQEA 3BF0A 3U9SB 1MJ3A 4ZDDA 1TYFA 2VX2A 2FW2A 4OG1A 5DKPA 2ZL3A 2VSSF 4ZDCA 4J2UA 4U0GA 1Y7OA 3V5IA 3H0UA 3SLLA 3HINA 2F9IB 5E0NX 2VSSE 4F47A 2DEOA 2X24A 3QXZA 3LKEA 2WTBA 5E0SA 3ZWBA 3QWDA 4ZU2A 3KTIA 3OT6A 3A4MA 4ZDFA 3FF6A 3G64A 3NJDA 2VSSA 3SWXA 3PGQA 4L8KA 4IZBA 2PG8A 3GKBA 3DORA 3TLFA 3ADDA 2VSUC 2ZL4A 2A81A 4KWBA 3TZ3A 5DL1A 4B3JA 3AJMA 3ISAA 4JCQA 2F9YB 4GEHB 3L8IA 1UIYA 1NZYB 3T88A 2J5GA 3QREA 4RYFH 2A7SA 5G1QA 3U9TB 3IAVA 3ZWAA 3R9SA 5C9GA 5G1SA 1Q52A 3TRRA 4OMRA 3MYBA 3KTJA 1N6DA 1ON9A 1UYVA 4I4ZA 3HE2A 3H81A 3PEAA 5CTBA 2VREA 2HW5A 4FN8A 3T3WA 1HNUA 4EMPA 3Q0GA 4U18A 3H0QA 3HRXA 3HP0A 2F9YA 2EJ5A 3P2LA 1XNWA 4JCTA 3RSIA 3GF3A 5E0SH 1RJNA 3P85A 3H0JA 3MFMA 4NARA 1XX4A 2A7KA 3ZWCA 2YJGA 4K2NA 3RQFA 2FZSA 2NP9A 3ZW9A 4RYFA 3T89A 4JVTA 4ELWA 5MGBA 3PZKA 3I47A 4LK5A 1UYTA 5DUCA 1SG4A 3RQGA 4B3HA 5KDRA 2F9IA 5INIA 3OC7A 4HDTA 1PIXA 3ZW8A 5DU8A 4B3IA 3H02A 1NZYA 3GF7A 1Q51A 4WCZA 3OMEA 2GTRA 2FBMA 1X0UA 3Q1TA 2F6IA 3FDUA 2DUBA 4ELXA 3M6MA 4MOUA 5DZKA 1UX4A 3ST9A 5FIFA 5INFA 4FNBA 4EMMA 1HNOA 2VSUE 5FUSA 4NEKA 2ZQRA 5JBXA 2W3PA 3U9RB 1WDLA 3IRBA 4FB8A 3ADBA 3M6NA 2P63A
chains in the Genus database with same CATH topology
4HC8A 3PE8A 4YLHA 4JWVA 2PBPA 2CE3A 4DI1A 4WZ8B 3TV5A 3QMJA 4U0HA 1FC7A 2D3TA 1YG6A 1DUBA 1O8UA 1N6EA 3KTGA 3TDCA 3R9TA 4U19A 3GLMA 3QK8A 3IB9A 4IZCA 5G1RA 3R0OA 3QYRA 1XNVA 2CBYA 2VSUA 4JYLA 4U1AA 3P5MA 4QIJA 4ZDBA 3T8AA 4I42A 2QQ3A 3Q0JA 4FZWA 2ZL2A 3BPPA 1N6FA 4QIIA 1VRGA 3IBBA 3RRVA 4FJWD 3NJBA 3TT6A 1WDMA 3DJAA 4JJTA 4ASIA 1FCFA 5DUFA 2Q2XA 4G2RA 1HZDA 4KNPA 5INGA 4FNDA 4GM2A 1W2XA 5IKLB 1FC6A 4ZDEA 2J5IB 2Q34A 4Z0MA 2J5SA 4Q1IA 2BZRA 4I52A 2Q35A 3KQFA 1TG6A 1EF8A 4JYJA 1PJHA 2F6QA 2UZFA 4ELSA 3BEZA 2VSUF 5KJPA 4IZDA 3T8BA 4JSBA 4JOTA 3KTKA 4L6WA 4KD6A 3QXIA 3N6RB 4MI2A 1YG8A 2ZL0A 3VIVA 1K39A 1FC9A 3R9QA 3RSTA 5DTWA 4HNKA 4OLQA 3Q7HA 3H0SA 3JU1A 2IEXA 3L3SA 4Q0GA 4JCRA 5DU6A 2J5IA 2PPYA 3V5EA 4JCSA 4FN7A 1JXZA 3BPTA 5DTPA 4KPKA 4K3WA 1XO6A 1XNYA 1DCIA 2X58A 3MOYA 4MXIA 5JBWA 4EMLA 4K29A 5CTCA 3R6HA 5HUQA 3TT7A 2J5GD 3WG5A 4GHNA 4FZWC 2J5II 4U0GH 4WYOB 1OD2A 4NNQA 4JFCA 5DZKH 3STAA 1EF9A 3KTHA 3TVWA 1K32A 1WZ8A 1OD4A 3QKAA 1UYRA 3GMAA 1WDKA 3HLN1 4RCNA 1EY3A 3TVUA 3K50A 5KDRB 1ON3A 5C90A 4QFEA 3K8XA 1J7XA 1UYSA 3MT6A 1SZOA 5DU4A 2C8TA 3LAOA 1RJMA 2ZQQA 3BF0A 3U9SB 1MJ3A 4ZDDA 1TYFA 2VX2A 2FW2A 4OG1A 5DKPA 2ZL3A 2VSSF 4ZDCA 4J2UA 4U0GA 1Y7OA 3V5IA 3H0UA 3SLLA 3HINA 2F9IB 5E0NX 2VSSE 4F47A 2DEOA 2X24A 3QXZA 3LKEA 2WTBA 5E0SA 3ZWBA 3KTIA 4ZU2A 3QWDA 3OT6A 4ZDFA 3FF6A 3G64A 3NJDA 2VSSA 3SWXA 3PGQA 4L8KA 4IZBA 2PG8A 3GKBA 3DORA 3TLFA 2VSUC 2ZL4A 2A81A 4KWBA 3TZ3A 5DL1A 4B3JA 3ISAA 4JCQA 2F9YB 1UIYA 1NZYB 3T88A 2J5GA 3QREA 4RYFH 2A7SA 5G1QA 3U9TB 3IAVA 3ZWAA 3R9SA 5C9GA 5G1SA 1Q52A 3TRRA 4OMRA 3MYBA 3KTJA 1N6DA 1ON9A 1UYVA 4I4ZA 3HE2A 3H81A 3PEAA 5CTBA 2VREA 2HW5A 4FN8A 3T3WA 1HNUA 4EMPA 3Q0GA 4U18A 3H0QA 3HRXA 3HP0A 2F9YA 2EJ5A 3P2LA 1XNWA 4JCTA 3RSIA 3GF3A 5E0SH 1RJNA 3P85A 3H0JA 3MFMA 4NARA 1XX4A 2A7KA 3ZWCA 2YJGA 4K2NA 2FZSA 2NP9A 3ZW9A 4RYFA 3T89A 4JVTA 4ELWA 5MGBA 3PZKA 3I47A 4LK5A 1UYTA 5DUCA 1SG4A 4B3HA 5KDRA 2F9IA 5INIA 3OC7A 4HDTA 1PIXA 3ZW8A 5DU8A 4B3IA 3H02A 1NZYA 3GF7A 1Q51A 4WCZA 3OMEA 2GTRA 2FBMA 1X0UA 3Q1TA 2F6IA 3FDUA 2DUBA 4ELXA 3M6MA 4MOUA 5DZKA 3ST9A 5FIFA 5INFA 4FNBA 4EMMA 1HNOA 2VSUE 5FUSA 4NEKA 2ZQRA 5JBXA 2W3PA 3U9RB 1WDLA 4FB8A 3M6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HC8 A;  3PE8 A;  4YLH A;  4JWV A;  2PBP A;  2CE3 A;  4DI1 A;  4WZ8 B;  3TV5 A;  3QMJ A;  4U0H A;  1FC7 A;  2D3T A;  1YG6 A;  1DUB A;  1O8U A;  1N6E A;  3KTG A;  3TDC A;  3R9T A;  4U19 A;  3GLM A;  3QK8 A;  3IB9 A;  4IZC A;  5G1R A;  3R0O A;  3QYR A;  1XNV A;  2CBY A;  2VSU A;  4JYL A;  4U1A A;  3P5M A;  4QIJ A;  4ZDB A;  3T8A A;  4I42 A;  2QQ3 A;  3Q0J A;  4FZW A;  2ZL2 A;  3BPP A;  1N6F A;  4QII A;  1VRG A;  3IBB A;  3RRV A;  4FJW D;  3NJB A;  3TT6 A;  1WDM A;  3DJA A;  4JJT A;  4ASI A;  1FCF A;  5DUF A;  2Q2X A;  4G2R A;  1HZD A;  4KNP A;  5ING A;  4FND A;  4GM2 A;  1W2X A;  5IKL B;  1FC6 A;  4ZDE A;  2J5I B;  2Q34 A;  4Z0M A;  2J5S A;  4Q1I A;  2BZR A;  4I52 A;  2Q35 A;  3KQF A;  1TG6 A;  1EF8 A;  4JYJ A;  1PJH A;  2F6Q A;  2UZF A;  4ELS A;  3BEZ A;  2VSU F;  5KJP A;  4IZD A;  3T8B A;  4JSB A;  4JOT A;  3KTK A;  4L6W A;  4KD6 A;  3QXI A;  3N6R B;  4MI2 A;  1YG8 A;  2ZL0 A;  3VIV A;  1K39 A;  1FC9 A;  3R9Q A;  3RST A;  5DTW A;  4HNK A;  4OLQ A;  3Q7H A;  3H0S A;  3JU1 A;  2IEX A;  3L3S A;  4Q0G A;  4JCR A;  5DU6 A;  2J5I A;  2PPY A;  3V5E A;  4JCS A;  4FN7 A;  1JXZ A;  5DTP A;  4KPK A;  4K3W A;  1XO6 A;  1XNY A;  1DCI A;  2X58 A;  3MOY A;  4MXI A;  5JBW A;  4EML A;  4K29 A;  5CTC A;  3R6H A;  3TT7 A;  2J5G D;  3WG5 A;  4GHN A;  4FZW C;  2J5I I;  4U0G H;  4WYO B;  1OD2 A;  4NNQ A;  4JFC A;  5DZK H;  3STA A;  1EF9 A;  3KTH A;  3TVW A;  1K32 A;  1WZ8 A;  1OD4 A;  3QKA A;  1UYR A;  3GMA A;  1WDK A;  3HLN 1;  4RCN A;  1EY3 A;  3TVU A;  3K50 A;  5KDR B;  1ON3 A;  5C90 A;  4QFE A;  3K8X A;  1J7X A;  1UYS A;  3MT6 A;  1SZO A;  5DU4 A;  2C8T A;  3LAO A;  1RJM A;  2ZQQ A;  3BF0 A;  3U9S B;  1MJ3 A;  4ZDD A;  1TYF A;  2VX2 A;  2FW2 A;  4OG1 A;  5DKP A;  2ZL3 A;  2VSS F;  4ZDC A;  4U0G A;  1Y7O A;  3V5I A;  3H0U A;  3SLL A;  3HIN A;  2F9I B;  5E0N X;  2VSS E;  4F47 A;  2DEO A;  2X24 A;  3QXZ A;  3LKE A;  2WTB A;  5E0S A;  3ZWB A;  3KTI A;  4ZU2 A;  3QWD A;  3OT6 A;  4ZDF A;  3FF6 A;  3G64 A;  3NJD A;  2VSS A;  3SWX A;  3PGQ A;  4L8K A;  4IZB A;  2PG8 A;  3GKB A;  3DOR A;  3TLF A;  2VSU C;  2ZL4 A;  2A81 A;  4KWB A;  3TZ3 A;  5DL1 A;  4B3J A;  3ISA A;  4JCQ A;  2F9Y B;  1UIY A;  1NZY B;  3T88 A;  2J5G A;  3QRE A;  4RYF H;  2A7S A;  5G1Q A;  3U9T B;  3IAV A;  3ZWA A;  3R9S A;  5C9G A;  5G1S A;  1Q52 A;  3TRR A;  4OMR A;  3MYB A;  3KTJ A;  1N6D A;  1ON9 A;  1UYV A;  4I4Z A;  3HE2 A;  3H81 A;  3PEA A;  5CTB A;  2VRE A;  2HW5 A;  4FN8 A;  3T3W A;  1HNU A;  4EMP A;  3Q0G A;  4U18 A;  3H0Q A;  3HRX A;  3HP0 A;  2F9Y A;  2EJ5 A;  3P2L A;  1XNW A;  4JCT A;  3RSI A;  3GF3 A;  5E0S H;  1RJN A;  3P85 A;  3H0J A;  3MFM A;  1XX4 A;  2A7K A;  3ZWC A;  4K2N A;  2FZS A;  2NP9 A;  3ZW9 A;  4RYF A;  3T89 A;  4JVT A;  4ELW A;  5MGB A;  3PZK A;  3I47 A;  4LK5 A;  1UYT A;  5DUC A;  1SG4 A;  4B3H A;  5KDR A;  2F9I A;  5INI A;  3OC7 A;  1PIX A;  3ZW8 A;  5DU8 A;  4B3I A;  3H02 A;  1NZY A;  3GF7 A;  1Q51 A;  4WCZ A;  3OME A;  2GTR A;  2FBM A;  1X0U A;  3Q1T A;  2F6I A;  3FDU A;  2DUB A;  4ELX A;  3M6M A;  4MOU A;  5DZK A;  3ST9 A;  5FIF A;  5INF A;  4FNB A;  4EMM A;  1HNO A;  2VSU E;  5FUS A;  4NEK A;  2ZQR A;  5JBX A;  2W3P A;  3U9R B;  1WDL A;  4FB8 A;  3M6N A; 
#chains in the Genus database with same CATH topology
 4HC8 A;  3PE8 A;  4YLH A;  4JWV A;  2PBP A;  2CE3 A;  4DI1 A;  4WZ8 B;  3TV5 A;  3QMJ A;  3W8I B;  4U0H A;  1FC7 A;  2D3T A;  1YG6 A;  1DUB A;  1O8U A;  1N6E A;  3KTG A;  3L8J A;  3TDC A;  3R9T A;  4U19 A;  3GLM A;  3QK8 A;  3IB9 A;  4IZC A;  5G1R A;  3R0O A;  3QYR A;  1XNV A;  2CBY A;  2VSU A;  3ADC A;  4JYL A;  4U1A A;  3P5M A;  4QIJ A;  4ZDB A;  3T8A A;  4I42 A;  2QQ3 A;  3Q0J A;  4FZW A;  3AM1 A;  2ZL2 A;  3BPP A;  1N6F A;  4QII A;  1VRG A;  3IBB A;  3RRV A;  4FJW D;  3NJB A;  3TT6 A;  1WDM A;  3DJA A;  4JJT A;  4ASI A;  1FCF A;  5DUF A;  2Q2X A;  4G2R A;  1HZD A;  4KNP A;  5ING A;  4FND A;  4GM2 A;  1W2X A;  5IKL B;  1FC6 A;  4ZDE A;  2J5I B;  2Q34 A;  4Z0M A;  2J5S A;  4Q1I A;  2BZR A;  4I52 A;  2Q35 A;  3KQF A;  1TG6 A;  1EF8 A;  4JYJ A;  1PJH A;  2F6Q A;  2UZF A;  4ELS A;  3BEZ A;  2VSU F;  5KJP A;  4IZD A;  3T8B A;  4JSB A;  4JOT A;  3KTK A;  4L6W A;  4KD6 A;  3QXI A;  3A4L A;  3N6R B;  4MI2 A;  1YG8 A;  2ZL0 A;  3VIV A;  1K39 A;  1FC9 A;  3R9Q A;  3RST A;  5DTW A;  4HNK A;  4OLQ A;  3Q7H A;  3H0S A;  3JU1 A;  2IEX A;  3L3S A;  4Q0G A;  4JCR A;  5DU6 A;  2J5I A;  2PPY A;  3V5E A;  4JCS A;  4FN7 A;  3O4X E;  1JXZ A;  3BPT A;  5DTP A;  4KPK A;  4K3W A;  1XO6 A;  1XNY A;  1DCI A;  1Y64 B;  2X58 A;  3MOY A;  4MXI A;  5JBW A;  4EML A;  1UX5 A;  4K29 A;  5CTC A;  3R6H A;  5HUQ A;  3A4N A;  3TT7 A;  2J5G D;  3W8H B;  3WG5 A;  4GHN A;  4FZW C;  2J5I I;  4U0G H;  4WYO B;  4NNQ A;  1OD2 A;  4JFC A;  5DZK H;  3STA A;  1EF9 A;  3KTH A;  3TVW A;  1K32 A;  1WZ8 A;  1OD4 A;  3QKA A;  1UYR A;  3GMA A;  1WDK A;  3HLN 1;  4RCN A;  1EY3 A;  3TVU A;  3K50 A;  5KDR B;  1ON3 A;  5C90 A;  4QFE A;  3K8X A;  1J7X A;  1UYS A;  3MT6 A;  1SZO A;  5DU4 A;  2C8T A;  3LAO A;  1RJM A;  2ZQQ A;  3RQE A;  3BF0 A;  3U9S B;  1MJ3 A;  4ZDD A;  1TYF A;  2VX2 A;  2FW2 A;  4OG1 A;  5DKP A;  2ZL3 A;  2VSS F;  4ZDC A;  4J2U A;  4U0G A;  1Y7O A;  3V5I A;  3H0U A;  3SLL A;  3HIN A;  2F9I B;  5E0N X;  2VSS E;  4F47 A;  2DEO A;  2X24 A;  3QXZ A;  3LKE A;  2WTB A;  5E0S A;  3ZWB A;  3QWD A;  4ZU2 A;  3KTI A;  3OT6 A;  3A4M A;  4ZDF A;  3FF6 A;  3G64 A;  3NJD A;  2VSS A;  3SWX A;  3PGQ A;  4L8K A;  4IZB A;  2PG8 A;  3GKB A;  3DOR A;  3TLF A;  3ADD A;  2VSU C;  2ZL4 A;  2A81 A;  4KWB A;  3TZ3 A;  5DL1 A;  4B3J A;  3AJM A;  3ISA A;  4JCQ A;  2F9Y B;  4GEH B;  3L8I A;  1UIY A;  1NZY B;  3T88 A;  2J5G A;  3QRE A;  4RYF H;  2A7S A;  5G1Q A;  3U9T B;  3IAV A;  3ZWA A;  3R9S A;  5C9G A;  5G1S A;  1Q52 A;  3TRR A;  4OMR A;  3MYB A;  3KTJ A;  1N6D A;  1ON9 A;  1UYV A;  4I4Z A;  3HE2 A;  3H81 A;  3PEA A;  5CTB A;  2VRE A;  2HW5 A;  4FN8 A;  3T3W A;  1HNU A;  4EMP A;  3Q0G A;  4U18 A;  3H0Q A;  3HRX A;  3HP0 A;  2F9Y A;  2EJ5 A;  3P2L A;  1XNW A;  4JCT A;  3RSI A;  3GF3 A;  5E0S H;  1RJN A;  3P85 A;  3H0J A;  3MFM A;  4NAR A;  1XX4 A;  2A7K A;  3ZWC A;  2YJG A;  4K2N A;  3RQF A;  2FZS A;  2NP9 A;  3ZW9 A;  4RYF A;  3T89 A;  4JVT A;  4ELW A;  5MGB A;  3PZK A;  3I47 A;  4LK5 A;  1UYT A;  5DUC A;  1SG4 A;  3RQG A;  4B3H A;  5KDR A;  2F9I A;  5INI A;  3OC7 A;  4HDT A;  1PIX A;  3ZW8 A;  5DU8 A;  4B3I A;  3H02 A;  1NZY A;  3GF7 A;  1Q51 A;  4WCZ A;  3OME A;  2GTR A;  2FBM A;  1X0U A;  3Q1T A;  2F6I A;  3FDU A;  2DUB A;  4ELX A;  3M6M A;  4MOU A;  5DZK A;  1UX4 A;  3ST9 A;  5FIF A;  5INF A;  4FNB A;  4EMM A;  1HNO A;  2VSU E;  5FUS A;  4NEK A;  2ZQR A;  5JBX A;  2W3P A;  3U9R B;  1WDL A;  3IRB A;  4FB8 A;  3ADB A;  3M6N A;  2P63 A; 
#chains in the Genus database with same CATH homology
 4HC8 A;  3PE8 A;  4YLH A;  4JWV A;  2PBP A;  2CE3 A;  4DI1 A;  4WZ8 B;  3TV5 A;  3QMJ A;  4U0H A;  1FC7 A;  2D3T A;  1YG6 A;  1DUB A;  1O8U A;  1N6E A;  3KTG A;  3TDC A;  3R9T A;  4U19 A;  3GLM A;  3QK8 A;  3IB9 A;  4IZC A;  5G1R A;  3R0O A;  3QYR A;  1XNV A;  2CBY A;  2VSU A;  4JYL A;  4U1A A;  3P5M A;  4QIJ A;  4ZDB A;  3T8A A;  4I42 A;  2QQ3 A;  3Q0J A;  4FZW A;  2ZL2 A;  3BPP A;  1N6F A;  4QII A;  1VRG A;  3IBB A;  3RRV A;  4FJW D;  3NJB A;  3TT6 A;  1WDM A;  3DJA A;  4JJT A;  4ASI A;  1FCF A;  5DUF A;  2Q2X A;  4G2R A;  1HZD A;  4KNP A;  5ING A;  4FND A;  4GM2 A;  1W2X A;  5IKL B;  1FC6 A;  4ZDE A;  2J5I B;  2Q34 A;  4Z0M A;  2J5S A;  4Q1I A;  2BZR A;  4I52 A;  2Q35 A;  3KQF A;  1TG6 A;  1EF8 A;  4JYJ A;  1PJH A;  2F6Q A;  2UZF A;  4ELS A;  3BEZ A;  2VSU F;  5KJP A;  4IZD A;  3T8B A;  4JSB A;  4JOT A;  3KTK A;  4L6W A;  4KD6 A;  3QXI A;  3N6R B;  4MI2 A;  1YG8 A;  2ZL0 A;  3VIV A;  1K39 A;  1FC9 A;  3R9Q A;  3RST A;  5DTW A;  4HNK A;  4OLQ A;  3Q7H A;  3H0S A;  3JU1 A;  2IEX A;  3L3S A;  4Q0G A;  4JCR A;  5DU6 A;  2J5I A;  2PPY A;  3V5E A;  4JCS A;  4FN7 A;  1JXZ A;  3BPT A;  5DTP A;  4KPK A;  4K3W A;  1XO6 A;  1XNY A;  1DCI A;  2X58 A;  3MOY A;  4MXI A;  5JBW A;  4EML A;  4K29 A;  5CTC A;  3R6H A;  5HUQ A;  3TT7 A;  2J5G D;  3WG5 A;  4GHN A;  4FZW C;  2J5I I;  4U0G H;  4WYO B;  1OD2 A;  4NNQ A;  4JFC A;  5DZK H;  3STA A;  1EF9 A;  3KTH A;  3TVW A;  1K32 A;  1WZ8 A;  1OD4 A;  3QKA A;  1UYR A;  3GMA A;  1WDK A;  3HLN 1;  4RCN A;  1EY3 A;  3TVU A;  3K50 A;  5KDR B;  1ON3 A;  5C90 A;  4QFE A;  3K8X A;  1J7X A;  1UYS A;  3MT6 A;  1SZO A;  5DU4 A;  2C8T A;  3LAO A;  1RJM A;  2ZQQ A;  3BF0 A;  3U9S B;  1MJ3 A;  4ZDD A;  1TYF A;  2VX2 A;  2FW2 A;  4OG1 A;  5DKP A;  2ZL3 A;  2VSS F;  4ZDC A;  4J2U A;  4U0G A;  1Y7O A;  3V5I A;  3H0U A;  3SLL A;  3HIN A;  2F9I B;  5E0N X;  2VSS E;  4F47 A;  2DEO A;  2X24 A;  3QXZ A;  3LKE A;  2WTB A;  5E0S A;  3ZWB A;  3KTI A;  4ZU2 A;  3QWD A;  3OT6 A;  4ZDF A;  3FF6 A;  3G64 A;  3NJD A;  2VSS A;  3SWX A;  3PGQ A;  4L8K A;  4IZB A;  2PG8 A;  3GKB A;  3DOR A;  3TLF A;  2VSU C;  2ZL4 A;  2A81 A;  4KWB A;  3TZ3 A;  5DL1 A;  4B3J A;  3ISA A;  4JCQ A;  2F9Y B;  1UIY A;  1NZY B;  3T88 A;  2J5G A;  3QRE A;  4RYF H;  2A7S A;  5G1Q A;  3U9T B;  3IAV A;  3ZWA A;  3R9S A;  5C9G A;  5G1S A;  1Q52 A;  3TRR A;  4OMR A;  3MYB A;  3KTJ A;  1N6D A;  1ON9 A;  1UYV A;  4I4Z A;  3HE2 A;  3H81 A;  3PEA A;  5CTB A;  2VRE A;  2HW5 A;  4FN8 A;  3T3W A;  1HNU A;  4EMP A;  3Q0G A;  4U18 A;  3H0Q A;  3HRX A;  3HP0 A;  2F9Y A;  2EJ5 A;  3P2L A;  1XNW A;  4JCT A;  3RSI A;  3GF3 A;  5E0S H;  1RJN A;  3P85 A;  3H0J A;  3MFM A;  4NAR A;  1XX4 A;  2A7K A;  3ZWC A;  2YJG A;  4K2N A;  2FZS A;  2NP9 A;  3ZW9 A;  4RYF A;  3T89 A;  4JVT A;  4ELW A;  5MGB A;  3PZK A;  3I47 A;  4LK5 A;  1UYT A;  5DUC A;  1SG4 A;  4B3H A;  5KDR A;  2F9I A;  5INI A;  3OC7 A;  4HDT A;  1PIX A;  3ZW8 A;  5DU8 A;  4B3I A;  3H02 A;  1NZY A;  3GF7 A;  1Q51 A;  4WCZ A;  3OME A;  2GTR A;  2FBM A;  1X0U A;  3Q1T A;  2F6I A;  3FDU A;  2DUB A;  4ELX A;  3M6M A;  4MOU A;  5DZK A;  3ST9 A;  5FIF A;  5INF A;  4FNB A;  4EMM A;  1HNO A;  2VSU E;  5FUS A;  4NEK A;  2ZQR A;  5JBX A;  2W3P A;  3U9R B;  1WDL A;  4FB8 A;  3M6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...