2IEXA

Crystal structure of dihydroxynapthoic acid synthetase (gk2873) from geobacillus kaustophilus hta426
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
268
structure length
253
Chain Sequence
WVKQYDYEDIIYETYNGIAKITINRPEVHNAFRPKTVNEMIDAFTKARDDSNIGVIILTGAGGKAFCSGGDPRLNVLDLQRLIRVIPKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDGGYGAGYLARIVGHKKAREIWYLCRQYTAQEALEMGLVNKVVPLEQLEEETVKWAQEILEKSPTAIRFLKAAFNADSDGLAGIQQLAGDATLLFYTTEEAKEGMRAFKEKRKPDFSQFPRFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of dihydroxynapthoic acid synthetase (GK2873) from Geobacillus kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Lyase
molecule keywords Dihydroxynapthoic acid synthetase
total genus 89
structure length 253
sequence length 268
chains with identical sequence B, C
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 2iexA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2iexA01
3QWDA 3WG5A 3Q0GA 3V5IA 3Q0JA 4EMLA 2X24A 2ZL2A 5DU8A 3R0OA 3T8AA 3RRVA 4L6WA 3QKAA 4RCNA 1FC6A 5DZKH 4ZDBA 3V5EA 1NZYB 4NEKA 3GF3A 3ZW8A 4ELWA 1YG6A 1N6FA 5E0SA 4JYJA 1MJ3A 2A81A 4FJWD 3N6RB 4JYLA 3ST9A 1HNOA 2EJ5A 3TV5A 5KDRA 1UYSA 4F47A 3P2LA 4WZ8B 3TT6A 1XNYA 1X0UA 4IZBA 5INFA 1WZ8A 3QK8A 3GMAA 1YG8A 5G1SA 4Q0GA 1UYVA 3IAVA 3G64A 4JFCA 4QIJA 3H0JA 5INIA 5DL1A 4B3HA 2F6QA 4K2NA 3OC7A 3BEZA 2QQ3A 1DUBA 3RSIA 3T89A 4FB8A 4WCZA 4OMRA 4JJTA 2PBPA 2F6IA 3PGQA 4U0GH 4FN8A 1XX4A 3I47A 2DEOA 4U0GA 2FZSA 2CBYA 3TT7A 1XNVA 2F9YB 3R6HA 3U9SB 5DUCA 3KQFA 4FNBA 4GM2A 3VIVA 3KTKA 1EY3A 4FZWC 3H81A 2X58A 5JBWA 4IZDA 3NJDA 1UYTA 3TRRA 1Q52A 2UZFA 2Q34A 5E0NX 3QXZA 2VSUF 5DTWA 4JCSA 3LAOA 4U19A 2VSSE 3H0SA 4OLQA 2J5GD 4JSBA 4RYFH 1DCIA 4MI2A 4Q1IA 1N6EA 4U0HA 4JCTA 2F9IB 3GKBA 3R9TA 4ZDEA 4I42A 3TZ3A 4B3IA 4KNPA 2J5IA 1Y7OA 3PEAA 4KPKA 1WDLA 4EMMA 1K32A 1FCFA 3OMEA 2VSUE 3SLLA 4RYFA 2Q2XA 3H0QA 2ZL4A 3MT6A 5FUSA 3QMJA 1HZDA 1OD2A 2A7SA 3LKEA 4MOUA 3TVUA 2FBMA 5DTPA 4B3JA 2J5GA 4NNQA 2VSUA 3Q1TA 3H02A 2CE3A 5G1QA 3R9QA 3P5MA 1K39A 4K3WA 3NJBA 4KD6A 4JOTA 5E0SH 1J7XA 3HP0A 2Q35A 5FIFA 2J5SA 3GLMA 3Q7HA 1Q51A 2ZL3A 3SWXA 1RJNA 5DZKA 2ZL0A 2PG8A 3ZWAA 4JCRA 3TLFA 3R9SA 1WDKA 4HC8A 3P85A 3ZWCA 3K50A 4ELXA 4QFEA 1FC7A 1RJMA 2VSSF 3BPPA 1XO6A 3K8XA 4OG1A 3L3SA 2ZQRA 3HINA 3ISAA 3FF6A 2J5IB 1WDMA 3U9RB 2ZQQA 4GHNA 5C9GA 1TG6A 2GTRA 4FZWA 3T88A 3DJAA 4YLHA 5C90A 1O8UA 1EF9A 3KTHA 4L8KA 1NZYA 1HNUA 2VREA 3HE2A 2BZRA 3M6NA 3TVWA 4ZDCA 3DORA 3T3WA 5DU6A 3M6MA 5CTCA 4LK5A 4JVTA 5INGA 5KDRB 1PIXA 3MYBA 4ASIA 5KJPA 4FNDA 3RSTA 3PZKA 4ZDDA 4KWBA 2IEXA 1FC9A 3TDCA 3KTGA 2FW2A 3MFMA 4IZCA 5MGBA 4WYOB 4Z0MA 2J5II 4I4ZA 2D3TA 3OT6A 1UYRA 5CTBA 3FDUA 2DUBA 1VRGA 3BF0A 5G1RA 3QXIA 3PE8A 3ZW9A 2A7KA 3QYRA 3MOYA 3IB9A 2VSSA 4ZU2A 4ELSA 3GF7A 2HW5A 3KTJA 1W2XA 4MXIA 2WTBA 2F9IA 1UIYA 4FN7A 3T8BA 3HRXA 4U18A 4DI1A 4QIIA 1N6DA 1SG4A 3HLN1 3KTIA 2VX2A 4G2RA 1TYFA 4I52A 2PPYA 1PJHA 5IKLB 3U9TB 3ZWBA 2NP9A 4JWVA 1XNWA 5DU4A 1ON3A 4EMPA 4JCQA 5JBXA 5DUFA 1ON9A 1JXZA 2C8TA 1OD4A 1EF8A 4U1AA 4HNKA 2F9YA 3H0UA 4K29A 1SZOA 2W3PA 3QREA 5DKPA 3IBBA 3JU1A 4ZDFA 3STAA 2VSUC
chains in the Genus database with same CATH superfamily
3QWDA 3WG5A 3Q0GA 3V5IA 3Q0JA 4EMLA 2X24A 2ZL2A 5DU8A 3R0OA 3T8AA 3RRVA 4L6WA 3QKAA 4RCNA 1FC6A 5DZKH 4ZDBA 3V5EA 2P63A 1NZYB 4NEKA 3GF3A 3ZW8A 4ELWA 3AM1A 1YG6A 3L8JA 1N6FA 5E0SA 4JYJA 1MJ3A 2A81A 4FJWD 3N6RB 4JYLA 3ST9A 1HNOA 2EJ5A 3TV5A 5KDRA 1UYSA 4F47A 3P2LA 4WZ8B 3TT6A 1XNYA 1X0UA 4IZBA 5INFA 1WZ8A 3QK8A 3GMAA 1YG8A 5G1SA 4Q0GA 1UYVA 3IAVA 3G64A 3O4XE 4JFCA 4QIJA 3H0JA 5INIA 5DL1A 4B3HA 2F6QA 4K2NA 3OC7A 3BEZA 2QQ3A 1DUBA 3RSIA 3T89A 4FB8A 4WCZA 4OMRA 4JJTA 2PBPA 2F6IA 3PGQA 4U0GH 4FN8A 1XX4A 3RQFA 3I47A 2DEOA 4U0GA 2FZSA 2CBYA 3TT7A 1XNVA 2F9YB 3R6HA 3A4LA 3U9SB 5DUCA 4HDTA 3KQFA 4FNBA 4GM2A 3VIVA 3KTKA 1EY3A 4FZWC 3H81A 2X58A 5JBWA 4IZDA 3NJDA 1UYTA 3TRRA 1Q52A 2UZFA 2Q34A 5E0NX 3QXZA 2VSUF 5DTWA 4JCSA 3LAOA 4U19A 2VSSE 3H0SA 4OLQA 3A4NA 4JSBA 2J5GD 4RYFH 1DCIA 4MI2A 4Q1IA 1N6EA 4U0HA 4JCTA 2F9IB 3GKBA 1Y64B 3R9TA 4ZDEA 4I42A 3TZ3A 4B3IA 4KNPA 2J5IA 1Y7OA 3PEAA 4KPKA 1WDLA 4EMMA 1K32A 1FCFA 3OMEA 2VSUE 3SLLA 4RYFA 2Q2XA 3H0QA 3W8HB 2ZL4A 3MT6A 5FUSA 3QMJA 1HZDA 3ADDA 1OD2A 2A7SA 3LKEA 4MOUA 3TVUA 2FBMA 5DTPA 4B3JA 4NNQA 2J5GA 2VSUA 3Q1TA 3H02A 2CE3A 5G1QA 3R9QA 3P5MA 1K39A 4K3WA 3NJBA 4KD6A 4JOTA 2YJGA 5E0SH 1J7XA 3HP0A 2Q35A 5FIFA 2J5SA 3GLMA 5HUQA 3ADCA 3IRBA 3Q7HA 1Q51A 2ZL3A 3SWXA 1RJNA 5DZKA 2ZL0A 4NARA 2PG8A 3ZWAA 4JCRA 3TLFA 3R9SA 1WDKA 4HC8A 3P85A 3ZWCA 3K50A 4GEHB 4ELXA 4QFEA 1FC7A 1RJMA 2VSSF 3BPPA 1XO6A 3K8XA 4OG1A 3L3SA 2ZQRA 3HINA 3ISAA 3FF6A 1UX5A 2J5IB 1WDMA 3U9RB 2ZQQA 4GHNA 5C9GA 1TG6A 2GTRA 4FZWA 3T88A 3DJAA 4YLHA 5C90A 1O8UA 1EF9A 3KTHA 4L8KA 1NZYA 1HNUA 2VREA 3HE2A 2BZRA 3M6NA 3TVWA 4ZDCA 3DORA 3T3WA 5DU6A 3M6MA 3W8IB 5CTCA 3RQGA 4LK5A 4JVTA 5INGA 5KDRB 1PIXA 3MYBA 4ASIA 5KJPA 4FNDA 3RSTA 3PZKA 4ZDDA 4KWBA 2IEXA 1FC9A 3TDCA 3KTGA 2FW2A 3MFMA 4IZCA 5MGBA 4WYOB 4Z0MA 2J5II 4I4ZA 2D3TA 3OT6A 1UYRA 5CTBA 3FDUA 2DUBA 1VRGA 3BF0A 5G1RA 3QXIA 3PE8A 3ZW9A 3ADBA 1UX4A 2A7KA 3QYRA 3MOYA 3IB9A 2VSSA 4ZU2A 4J2UA 4ELSA 3GF7A 2HW5A 3KTJA 1W2XA 4MXIA 2WTBA 2F9IA 1UIYA 3RQEA 4FN7A 3T8BA 3HRXA 4U18A 4DI1A 4QIIA 1N6DA 1SG4A 3HLN1 3KTIA 2VX2A 4G2RA 1TYFA 4I52A 2PPYA 1PJHA 5IKLB 3U9TB 3BPTA 3ZWBA 2NP9A 4JWVA 1XNWA 5DU4A 1ON3A 4EMPA 4JCQA 5JBXA 3A4MA 5DUFA 1ON9A 1JXZA 2C8TA 1OD4A 3L8IA 1EF8A 4U1AA 4HNKA 2F9YA 3H0UA 4K29A 1SZOA 2W3PA 3QREA 5DKPA 3IBBA 3JU1A 4ZDFA 3AJMA 3STAA 2VSUC
chains in the Genus database with same CATH topology
3QWDA 3WG5A 3Q0GA 3V5IA 3Q0JA 4EMLA 2X24A 2ZL2A 5DU8A 3R0OA 3T8AA 3RRVA 4L6WA 3QKAA 4RCNA 1FC6A 5DZKH 4ZDBA 3V5EA 1NZYB 4NEKA 3GF3A 3ZW8A 4ELWA 1YG6A 1N6FA 5E0SA 4JYJA 1MJ3A 2A81A 4FJWD 3N6RB 4JYLA 3ST9A 1HNOA 2EJ5A 3TV5A 5KDRA 1UYSA 4F47A 3P2LA 4WZ8B 3TT6A 1XNYA 1X0UA 4IZBA 5INFA 1WZ8A 3QK8A 3GMAA 1YG8A 5G1SA 4Q0GA 1UYVA 3IAVA 3G64A 4JFCA 4QIJA 3H0JA 5INIA 5DL1A 4B3HA 2F6QA 4K2NA 3OC7A 3BEZA 2QQ3A 1DUBA 3RSIA 3T89A 4FB8A 4WCZA 4OMRA 4JJTA 2PBPA 2F6IA 3PGQA 4U0GH 4FN8A 1XX4A 3I47A 2DEOA 4U0GA 2FZSA 2CBYA 3TT7A 1XNVA 2F9YB 3R6HA 3U9SB 5DUCA 4HDTA 3KQFA 4FNBA 4GM2A 3VIVA 3KTKA 1EY3A 4FZWC 3H81A 2X58A 5JBWA 4IZDA 3NJDA 1UYTA 3TRRA 1Q52A 2UZFA 2Q34A 5E0NX 3QXZA 2VSUF 5DTWA 4JCSA 3LAOA 4U19A 2VSSE 3H0SA 4OLQA 2J5GD 4JSBA 4RYFH 1DCIA 4MI2A 4Q1IA 1N6EA 4U0HA 4JCTA 2F9IB 3GKBA 3R9TA 4ZDEA 4I42A 3TZ3A 4B3IA 4KNPA 2J5IA 1Y7OA 3PEAA 4KPKA 1WDLA 4EMMA 1K32A 1FCFA 3OMEA 2VSUE 3SLLA 4RYFA 2Q2XA 3H0QA 2ZL4A 3MT6A 5FUSA 3QMJA 1HZDA 1OD2A 2A7SA 3LKEA 4MOUA 3TVUA 2FBMA 5DTPA 4B3JA 2J5GA 4NNQA 2VSUA 3Q1TA 3H02A 2CE3A 5G1QA 3R9QA 3P5MA 1K39A 4K3WA 3NJBA 4KD6A 4JOTA 2YJGA 5E0SH 1J7XA 3HP0A 2Q35A 5FIFA 2J5SA 3GLMA 5HUQA 3Q7HA 1Q51A 2ZL3A 3SWXA 1RJNA 5DZKA 2ZL0A 4NARA 2PG8A 3ZWAA 4JCRA 3TLFA 3R9SA 1WDKA 4HC8A 3P85A 3ZWCA 3K50A 4ELXA 4QFEA 1FC7A 1RJMA 2VSSF 3BPPA 1XO6A 3K8XA 4OG1A 3L3SA 2ZQRA 3HINA 3ISAA 3FF6A 2J5IB 1WDMA 3U9RB 2ZQQA 4GHNA 5C9GA 1TG6A 2GTRA 4FZWA 3T88A 3DJAA 4YLHA 5C90A 1O8UA 1EF9A 3KTHA 4L8KA 1NZYA 1HNUA 2VREA 3HE2A 2BZRA 3M6NA 3TVWA 4ZDCA 3DORA 3T3WA 5DU6A 3M6MA 5CTCA 4LK5A 4JVTA 5INGA 5KDRB 1PIXA 3MYBA 4ASIA 5KJPA 4FNDA 3RSTA 3PZKA 4ZDDA 4KWBA 2IEXA 1FC9A 3TDCA 3KTGA 2FW2A 3MFMA 4IZCA 5MGBA 4WYOB 4Z0MA 2J5II 4I4ZA 2D3TA 3OT6A 1UYRA 5CTBA 3FDUA 2DUBA 1VRGA 3BF0A 5G1RA 3QXIA 3PE8A 3ZW9A 2A7KA 3QYRA 3MOYA 3IB9A 2VSSA 4ZU2A 4J2UA 4ELSA 3GF7A 2HW5A 3KTJA 1W2XA 4MXIA 2WTBA 2F9IA 1UIYA 4FN7A 3T8BA 3HRXA 4U18A 4DI1A 4QIIA 1N6DA 1SG4A 3HLN1 3KTIA 2VX2A 4G2RA 1TYFA 4I52A 2PPYA 1PJHA 5IKLB 3U9TB 3BPTA 3ZWBA 2NP9A 4JWVA 1XNWA 5DU4A 1ON3A 4EMPA 4JCQA 5JBXA 5DUFA 1ON9A 1JXZA 2C8TA 1OD4A 1EF8A 4U1AA 4HNKA 2F9YA 3H0UA 4K29A 1SZOA 2W3PA 3QREA 5DKPA 3IBBA 3JU1A 4ZDFA 3STAA 2VSUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWD A;  3WG5 A;  3Q0G A;  3V5I A;  3Q0J A;  4EML A;  2X24 A;  2ZL2 A;  5DU8 A;  3R0O A;  3T8A A;  3RRV A;  4L6W A;  3QKA A;  4RCN A;  1FC6 A;  5DZK H;  4ZDB A;  3V5E A;  1NZY B;  4NEK A;  3GF3 A;  3ZW8 A;  4ELW A;  1YG6 A;  1N6F A;  5E0S A;  4JYJ A;  1MJ3 A;  2A81 A;  4FJW D;  3N6R B;  4JYL A;  3ST9 A;  1HNO A;  2EJ5 A;  3TV5 A;  5KDR A;  1UYS A;  4F47 A;  3P2L A;  4WZ8 B;  3TT6 A;  1XNY A;  1X0U A;  4IZB A;  5INF A;  1WZ8 A;  3QK8 A;  3GMA A;  1YG8 A;  5G1S A;  4Q0G A;  1UYV A;  3IAV A;  3G64 A;  4JFC A;  4QIJ A;  3H0J A;  5INI A;  5DL1 A;  4B3H A;  2F6Q A;  4K2N A;  3OC7 A;  3BEZ A;  2QQ3 A;  1DUB A;  3RSI A;  3T89 A;  4FB8 A;  4WCZ A;  4OMR A;  4JJT A;  2PBP A;  2F6I A;  3PGQ A;  4U0G H;  4FN8 A;  1XX4 A;  3I47 A;  2DEO A;  4U0G A;  2FZS A;  2CBY A;  3TT7 A;  1XNV A;  2F9Y B;  3R6H A;  3U9S B;  5DUC A;  3KQF A;  4FNB A;  4GM2 A;  3VIV A;  3KTK A;  1EY3 A;  4FZW C;  3H81 A;  2X58 A;  5JBW A;  4IZD A;  3NJD A;  1UYT A;  3TRR A;  1Q52 A;  2UZF A;  2Q34 A;  5E0N X;  3QXZ A;  2VSU F;  5DTW A;  4JCS A;  3LAO A;  4U19 A;  2VSS E;  3H0S A;  4OLQ A;  2J5G D;  4JSB A;  4RYF H;  1DCI A;  4MI2 A;  4Q1I A;  1N6E A;  4U0H A;  4JCT A;  2F9I B;  3GKB A;  3R9T A;  4ZDE A;  4I42 A;  3TZ3 A;  4B3I A;  4KNP A;  2J5I A;  1Y7O A;  3PEA A;  4KPK A;  1WDL A;  4EMM A;  1K32 A;  1FCF A;  3OME A;  2VSU E;  3SLL A;  4RYF A;  2Q2X A;  3H0Q A;  2ZL4 A;  3MT6 A;  5FUS A;  3QMJ A;  1HZD A;  1OD2 A;  2A7S A;  3LKE A;  4MOU A;  3TVU A;  2FBM A;  5DTP A;  4B3J A;  2J5G A;  4NNQ A;  2VSU A;  3Q1T A;  3H02 A;  2CE3 A;  5G1Q A;  3R9Q A;  3P5M A;  1K39 A;  4K3W A;  3NJB A;  4KD6 A;  4JOT A;  5E0S H;  1J7X A;  3HP0 A;  2Q35 A;  5FIF A;  2J5S A;  3GLM A;  3Q7H A;  1Q51 A;  2ZL3 A;  3SWX A;  1RJN A;  5DZK A;  2ZL0 A;  2PG8 A;  3ZWA A;  4JCR A;  3TLF A;  3R9S A;  1WDK A;  4HC8 A;  3P85 A;  3ZWC A;  3K50 A;  4ELX A;  4QFE A;  1FC7 A;  1RJM A;  2VSS F;  3BPP A;  1XO6 A;  3K8X A;  4OG1 A;  3L3S A;  2ZQR A;  3HIN A;  3ISA A;  3FF6 A;  2J5I B;  1WDM A;  3U9R B;  2ZQQ A;  4GHN A;  5C9G A;  1TG6 A;  2GTR A;  4FZW A;  3T88 A;  3DJA A;  4YLH A;  5C90 A;  1O8U A;  1EF9 A;  3KTH A;  4L8K A;  1NZY A;  1HNU A;  2VRE A;  3HE2 A;  2BZR A;  3M6N A;  3TVW A;  4ZDC A;  3DOR A;  3T3W A;  5DU6 A;  3M6M A;  5CTC A;  4LK5 A;  4JVT A;  5ING A;  5KDR B;  1PIX A;  3MYB A;  4ASI A;  5KJP A;  4FND A;  3RST A;  3PZK A;  4ZDD A;  4KWB A;  2IEX A;  1FC9 A;  3TDC A;  3KTG A;  2FW2 A;  3MFM A;  4IZC A;  5MGB A;  4WYO B;  4Z0M A;  2J5I I;  4I4Z A;  2D3T A;  3OT6 A;  1UYR A;  5CTB A;  3FDU A;  2DUB A;  1VRG A;  3BF0 A;  5G1R A;  3QXI A;  3PE8 A;  3ZW9 A;  2A7K A;  3QYR A;  3MOY A;  3IB9 A;  2VSS A;  4ZU2 A;  4ELS A;  3GF7 A;  2HW5 A;  3KTJ A;  1W2X A;  4MXI A;  2WTB A;  2F9I A;  1UIY A;  4FN7 A;  3T8B A;  3HRX A;  4U18 A;  4DI1 A;  4QII A;  1N6D A;  1SG4 A;  3HLN 1;  3KTI A;  2VX2 A;  4G2R A;  1TYF A;  4I52 A;  2PPY A;  1PJH A;  5IKL B;  3U9T B;  3ZWB A;  2NP9 A;  4JWV A;  1XNW A;  5DU4 A;  1ON3 A;  4EMP A;  4JCQ A;  5JBX A;  5DUF A;  1ON9 A;  1JXZ A;  2C8T A;  1OD4 A;  1EF8 A;  4U1A A;  4HNK A;  2F9Y A;  3H0U A;  4K29 A;  1SZO A;  2W3P A;  3QRE A;  5DKP A;  3IBB A;  3JU1 A;  4ZDF A;  3STA A;  2VSU C; 
#chains in the Genus database with same CATH topology
 3QWD A;  3WG5 A;  3Q0G A;  3V5I A;  3Q0J A;  4EML A;  2X24 A;  2ZL2 A;  5DU8 A;  3R0O A;  3T8A A;  3RRV A;  4L6W A;  3QKA A;  4RCN A;  1FC6 A;  5DZK H;  4ZDB A;  3V5E A;  2P63 A;  1NZY B;  4NEK A;  3GF3 A;  3ZW8 A;  4ELW A;  3AM1 A;  1YG6 A;  3L8J A;  1N6F A;  5E0S A;  4JYJ A;  1MJ3 A;  2A81 A;  4FJW D;  3N6R B;  4JYL A;  3ST9 A;  1HNO A;  2EJ5 A;  3TV5 A;  5KDR A;  1UYS A;  4F47 A;  3P2L A;  4WZ8 B;  3TT6 A;  1XNY A;  1X0U A;  4IZB A;  5INF A;  1WZ8 A;  3QK8 A;  3GMA A;  1YG8 A;  5G1S A;  4Q0G A;  1UYV A;  3IAV A;  3G64 A;  3O4X E;  4JFC A;  4QIJ A;  3H0J A;  5INI A;  5DL1 A;  4B3H A;  2F6Q A;  4K2N A;  3OC7 A;  3BEZ A;  2QQ3 A;  1DUB A;  3RSI A;  3T89 A;  4FB8 A;  4WCZ A;  4OMR A;  4JJT A;  2PBP A;  2F6I A;  3PGQ A;  4U0G H;  4FN8 A;  1XX4 A;  3RQF A;  3I47 A;  2DEO A;  4U0G A;  2FZS A;  2CBY A;  3TT7 A;  1XNV A;  2F9Y B;  3R6H A;  3A4L A;  3U9S B;  5DUC A;  4HDT A;  3KQF A;  4FNB A;  4GM2 A;  3VIV A;  3KTK A;  1EY3 A;  4FZW C;  3H81 A;  2X58 A;  5JBW A;  4IZD A;  3NJD A;  1UYT A;  3TRR A;  1Q52 A;  2UZF A;  2Q34 A;  5E0N X;  3QXZ A;  2VSU F;  5DTW A;  4JCS A;  3LAO A;  4U19 A;  2VSS E;  3H0S A;  4OLQ A;  3A4N A;  4JSB A;  2J5G D;  4RYF H;  1DCI A;  4MI2 A;  4Q1I A;  1N6E A;  4U0H A;  4JCT A;  2F9I B;  3GKB A;  1Y64 B;  3R9T A;  4ZDE A;  4I42 A;  3TZ3 A;  4B3I A;  4KNP A;  2J5I A;  1Y7O A;  3PEA A;  4KPK A;  1WDL A;  4EMM A;  1K32 A;  1FCF A;  3OME A;  2VSU E;  3SLL A;  4RYF A;  2Q2X A;  3H0Q A;  3W8H B;  2ZL4 A;  3MT6 A;  5FUS A;  3QMJ A;  1HZD A;  3ADD A;  1OD2 A;  2A7S A;  3LKE A;  4MOU A;  3TVU A;  2FBM A;  5DTP A;  4B3J A;  4NNQ A;  2J5G A;  2VSU A;  3Q1T A;  3H02 A;  2CE3 A;  5G1Q A;  3R9Q A;  3P5M A;  1K39 A;  4K3W A;  3NJB A;  4KD6 A;  4JOT A;  2YJG A;  5E0S H;  1J7X A;  3HP0 A;  2Q35 A;  5FIF A;  2J5S A;  3GLM A;  5HUQ A;  3ADC A;  3IRB A;  3Q7H A;  1Q51 A;  2ZL3 A;  3SWX A;  1RJN A;  5DZK A;  2ZL0 A;  4NAR A;  2PG8 A;  3ZWA A;  4JCR A;  3TLF A;  3R9S A;  1WDK A;  4HC8 A;  3P85 A;  3ZWC A;  3K50 A;  4GEH B;  4ELX A;  4QFE A;  1FC7 A;  1RJM A;  2VSS F;  3BPP A;  1XO6 A;  3K8X A;  4OG1 A;  3L3S A;  2ZQR A;  3HIN A;  3ISA A;  3FF6 A;  1UX5 A;  2J5I B;  1WDM A;  3U9R B;  2ZQQ A;  4GHN A;  5C9G A;  1TG6 A;  2GTR A;  4FZW A;  3T88 A;  3DJA A;  4YLH A;  5C90 A;  1O8U A;  1EF9 A;  3KTH A;  4L8K A;  1NZY A;  1HNU A;  2VRE A;  3HE2 A;  2BZR A;  3M6N A;  3TVW A;  4ZDC A;  3DOR A;  3T3W A;  5DU6 A;  3M6M A;  3W8I B;  5CTC A;  3RQG A;  4LK5 A;  4JVT A;  5ING A;  5KDR B;  1PIX A;  3MYB A;  4ASI A;  5KJP A;  4FND A;  3RST A;  3PZK A;  4ZDD A;  4KWB A;  2IEX A;  1FC9 A;  3TDC A;  3KTG A;  2FW2 A;  3MFM A;  4IZC A;  5MGB A;  4WYO B;  4Z0M A;  2J5I I;  4I4Z A;  2D3T A;  3OT6 A;  1UYR A;  5CTB A;  3FDU A;  2DUB A;  1VRG A;  3BF0 A;  5G1R A;  3QXI A;  3PE8 A;  3ZW9 A;  3ADB A;  1UX4 A;  2A7K A;  3QYR A;  3MOY A;  3IB9 A;  2VSS A;  4ZU2 A;  4J2U A;  4ELS A;  3GF7 A;  2HW5 A;  3KTJ A;  1W2X A;  4MXI A;  2WTB A;  2F9I A;  1UIY A;  3RQE A;  4FN7 A;  3T8B A;  3HRX A;  4U18 A;  4DI1 A;  4QII A;  1N6D A;  1SG4 A;  3HLN 1;  3KTI A;  2VX2 A;  4G2R A;  1TYF A;  4I52 A;  2PPY A;  1PJH A;  5IKL B;  3U9T B;  3BPT A;  3ZWB A;  2NP9 A;  4JWV A;  1XNW A;  5DU4 A;  1ON3 A;  4EMP A;  4JCQ A;  5JBX A;  3A4M A;  5DUF A;  1ON9 A;  1JXZ A;  2C8T A;  1OD4 A;  3L8I A;  1EF8 A;  4U1A A;  4HNK A;  2F9Y A;  3H0U A;  4K29 A;  1SZO A;  2W3P A;  3QRE A;  5DKP A;  3IBB A;  3JU1 A;  4ZDF A;  3AJM A;  3STA A;  2VSU C; 
#chains in the Genus database with same CATH homology
 3QWD A;  3WG5 A;  3Q0G A;  3V5I A;  3Q0J A;  4EML A;  2X24 A;  2ZL2 A;  5DU8 A;  3R0O A;  3T8A A;  3RRV A;  4L6W A;  3QKA A;  4RCN A;  1FC6 A;  5DZK H;  4ZDB A;  3V5E A;  1NZY B;  4NEK A;  3GF3 A;  3ZW8 A;  4ELW A;  1YG6 A;  1N6F A;  5E0S A;  4JYJ A;  1MJ3 A;  2A81 A;  4FJW D;  3N6R B;  4JYL A;  3ST9 A;  1HNO A;  2EJ5 A;  3TV5 A;  5KDR A;  1UYS A;  4F47 A;  3P2L A;  4WZ8 B;  3TT6 A;  1XNY A;  1X0U A;  4IZB A;  5INF A;  1WZ8 A;  3QK8 A;  3GMA A;  1YG8 A;  5G1S A;  4Q0G A;  1UYV A;  3IAV A;  3G64 A;  4JFC A;  4QIJ A;  3H0J A;  5INI A;  5DL1 A;  4B3H A;  2F6Q A;  4K2N A;  3OC7 A;  3BEZ A;  2QQ3 A;  1DUB A;  3RSI A;  3T89 A;  4FB8 A;  4WCZ A;  4OMR A;  4JJT A;  2PBP A;  2F6I A;  3PGQ A;  4U0G H;  4FN8 A;  1XX4 A;  3I47 A;  2DEO A;  4U0G A;  2FZS A;  2CBY A;  3TT7 A;  1XNV A;  2F9Y B;  3R6H A;  3U9S B;  5DUC A;  4HDT A;  3KQF A;  4FNB A;  4GM2 A;  3VIV A;  3KTK A;  1EY3 A;  4FZW C;  3H81 A;  2X58 A;  5JBW A;  4IZD A;  3NJD A;  1UYT A;  3TRR A;  1Q52 A;  2UZF A;  2Q34 A;  5E0N X;  3QXZ A;  2VSU F;  5DTW A;  4JCS A;  3LAO A;  4U19 A;  2VSS E;  3H0S A;  4OLQ A;  2J5G D;  4JSB A;  4RYF H;  1DCI A;  4MI2 A;  4Q1I A;  1N6E A;  4U0H A;  4JCT A;  2F9I B;  3GKB A;  3R9T A;  4ZDE A;  4I42 A;  3TZ3 A;  4B3I A;  4KNP A;  2J5I A;  1Y7O A;  3PEA A;  4KPK A;  1WDL A;  4EMM A;  1K32 A;  1FCF A;  3OME A;  2VSU E;  3SLL A;  4RYF A;  2Q2X A;  3H0Q A;  2ZL4 A;  3MT6 A;  5FUS A;  3QMJ A;  1HZD A;  1OD2 A;  2A7S A;  3LKE A;  4MOU A;  3TVU A;  2FBM A;  5DTP A;  4B3J A;  2J5G A;  4NNQ A;  2VSU A;  3Q1T A;  3H02 A;  2CE3 A;  5G1Q A;  3R9Q A;  3P5M A;  1K39 A;  4K3W A;  3NJB A;  4KD6 A;  4JOT A;  2YJG A;  5E0S H;  1J7X A;  3HP0 A;  2Q35 A;  5FIF A;  2J5S A;  3GLM A;  5HUQ A;  3Q7H A;  1Q51 A;  2ZL3 A;  3SWX A;  1RJN A;  5DZK A;  2ZL0 A;  4NAR A;  2PG8 A;  3ZWA A;  4JCR A;  3TLF A;  3R9S A;  1WDK A;  4HC8 A;  3P85 A;  3ZWC A;  3K50 A;  4ELX A;  4QFE A;  1FC7 A;  1RJM A;  2VSS F;  3BPP A;  1XO6 A;  3K8X A;  4OG1 A;  3L3S A;  2ZQR A;  3HIN A;  3ISA A;  3FF6 A;  2J5I B;  1WDM A;  3U9R B;  2ZQQ A;  4GHN A;  5C9G A;  1TG6 A;  2GTR A;  4FZW A;  3T88 A;  3DJA A;  4YLH A;  5C90 A;  1O8U A;  1EF9 A;  3KTH A;  4L8K A;  1NZY A;  1HNU A;  2VRE A;  3HE2 A;  2BZR A;  3M6N A;  3TVW A;  4ZDC A;  3DOR A;  3T3W A;  5DU6 A;  3M6M A;  5CTC A;  4LK5 A;  4JVT A;  5ING A;  5KDR B;  1PIX A;  3MYB A;  4ASI A;  5KJP A;  4FND A;  3RST A;  3PZK A;  4ZDD A;  4KWB A;  2IEX A;  1FC9 A;  3TDC A;  3KTG A;  2FW2 A;  3MFM A;  4IZC A;  5MGB A;  4WYO B;  4Z0M A;  2J5I I;  4I4Z A;  2D3T A;  3OT6 A;  1UYR A;  5CTB A;  3FDU A;  2DUB A;  1VRG A;  3BF0 A;  5G1R A;  3QXI A;  3PE8 A;  3ZW9 A;  2A7K A;  3QYR A;  3MOY A;  3IB9 A;  2VSS A;  4ZU2 A;  4J2U A;  4ELS A;  3GF7 A;  2HW5 A;  3KTJ A;  1W2X A;  4MXI A;  2WTB A;  2F9I A;  1UIY A;  4FN7 A;  3T8B A;  3HRX A;  4U18 A;  4DI1 A;  4QII A;  1N6D A;  1SG4 A;  3HLN 1;  3KTI A;  2VX2 A;  4G2R A;  1TYF A;  4I52 A;  2PPY A;  1PJH A;  5IKL B;  3U9T B;  3BPT A;  3ZWB A;  2NP9 A;  4JWV A;  1XNW A;  5DU4 A;  1ON3 A;  4EMP A;  4JCQ A;  5JBX A;  5DUF A;  1ON9 A;  1JXZ A;  2C8T A;  1OD4 A;  1EF8 A;  4U1A A;  4HNK A;  2F9Y A;  3H0U A;  4K29 A;  1SZO A;  2W3P A;  3QRE A;  5DKP A;  3IBB A;  3JU1 A;  4ZDF A;  3STA A;  2VSU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...