2IEXA

Crystal structure of dihydroxynapthoic acid synthetase (gk2873) from geobacillus kaustophilus hta426
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
268
structure length
253
Chain Sequence
b'WVKQYDYEDIIYETYNGIAKITINRPEVHNAFRPKTVNEMIDAFTKARDDSNIGVIILTGAGGKAFCSGGDPRLNVLDLQRLIRVIPKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDGGYGAGYLARIVGHKKAREIWYLCRQYTAQEALEMGLVNKVVPLEQLEEETVKWAQEILEKSPTAIRFLKAAFNADSDGLAGIQQLAGDATLLFYTTEEAKEGMRAFKEKRKPDFSQFPRFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroxynapthoic acid synthetase
publication title Crystal structure of dihydroxynapthoic acid synthetase (GK2873) from Geobacillus kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Lyase
total genus 89
structure length 253
sequence length 268
chains with identical sequence B, C
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 2iexA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2iexA01
3PEAA 2UZFA 5KDRA 1WDLA 3Q7HA 2J5GD 3BPPA 3RSTA 1WZ8A 2CE3A 4HC8A 3ST9A 3IBBA 3QREA 5INFA 3R9SA 4OLQA 1OD2A 4RYFH 1RJNA 2PG8A 3K50A 5G1RA 4RYFA 1WDMA 3MYBA 2VSSA 3DORA 4JJTA 3GKBA 4ZU2A 3MT6A 3TVWA 4FN7A 4F47A 2NP9A 3PZKA 4G2RA 3RRVA 4QIJA 3BF0A 4Q0GA 5G1SA 3Q0JA 2C8TA 5C90A 3KTIA 3OC7A 4Z0MA 4DI1A 1K39A 2DEOA 1PIXA 4KNPA 5C9GA 4ZDFA 2ZL3A 1N6DA 4FN8A 4U19A 3ZW9A 3H0JA 2A7KA 3SWXA 2HW5A 4WYOB 2VREA 3FF6A 4IZBA 1EF9A 4ZDCA 2EJ5A 4WZ8B 3GMAA 1XNYA 1NZYB 3T8AA 5JBXA 4ASIA 1MJ3A 4L8KA 2QQ3A 2F9YA 3KTHA 1UYTA 1XX4A 3H02A 3K8XA 3T89A 4L6WA 2CBYA 3H0SA 4JCRA 1FC7A 2BZRA 1SG4A 2VSSF 3DJAA 1W2XA 2J5IB 2F9IA 3TV5A 4FZWC 2WTBA 3R9QA 5E0SH 3SLLA 2VX2A 3FDUA 4QIIA 3H0QA 4EMMA 5E0SA 4I4ZA 4NNQA 3PGQA 3R9TA 3KQFA 1FCFA 1O8UA 5G1QA 3T3WA 3TVUA 4OMRA 2J5SA 1FC9A 1XO6A 3GF7A 4ELWA 4FNDA 5DU4A 3NJDA 4U18A 1N6EA 4JOTA 2VSUC 3HP0A 1PJHA 4U0GH 4RCNA 2W3PA 4JYLA 2GTRA 3HRXA 3QKAA 4WCZA 1Q52A 2F6QA 4U0GA 4I42A 2FBMA 2J5GA 1XNWA 1SZOA 4JCTA 4MOUA 3Q0GA 2ZL0A 5INGA 1HNOA 4GM2A 5CTBA 3JU1A 4NEKA 3HLN1 3V5EA 1OD4A 5DTPA 4K2NA 3P2LA 2VSUE 4Q1IA 3M6MA 2X58A 1XNVA 4JVTA 3QYRA 5KDRB 3BEZA 4FB8A 4IZCA 1J7XA 3IAVA 3TLFA 1VRGA 3P85A 1UIYA 4K29A 4FZWA 2F6IA 5IKLB 1WDKA 4B3HA 5DUCA 5KJPA 4KD6A 1X0UA 4ZDEA 3QK8A 4ELSA 4QFEA 3U9RB 3OT6A 3U9SB 4JYJA 3P5MA 4GHNA 4ZDBA 3VIVA 3KTGA 4FJWD 2FZSA 2ZQRA 4KWBA 5DTWA 4B3JA 5DU8A 3R0OA 4JCSA 3ZWBA 1HZDA 5DKPA 5DU6A 4FNBA 2A81A 3QWDA 4HNKA 2VSUA 3WG5A 2PPYA 1EF8A 1FC6A 3T8BA 4JWVA 3GLMA 1N6FA 3LKEA 2Q34A 3QXZA 3OMEA 3TZ3A 1NZYA 4EMLA 1HNUA 5INIA 1UYRA 4JFCA 3STAA 5DZKH 2J5II 2F9YB 4ZDDA 5DL1A 2Q2XA 3I47A 3U9TB 4OG1A 4K3WA 5DZKA 3TT6A 3HINA 3KTJA 2J5IA 3KTKA 1K32A 2F9IB 5MGBA 4I52A 3NJBA 4JSBA 3T88A 4MI2A 1UYVA 4KPKA 5E0NX 3QMJA 3MOYA 3LAOA 5DUFA 4MXIA 3TT7A 1DUBA 3TRRA 3M6NA 5FIFA 4JCQA 3MFMA 3GF3A 2DUBA 1YG6A 5CTCA 3ZW8A 1RJMA 2VSUF 1TG6A 4LK5A 1Y7OA 2IEXA 4IZDA 3TDCA 3H81A 3ZWCA 2FW2A 4ELXA 1DCIA 1UYSA 1Q51A 2ZQQA 2ZL2A 5FUSA 3QXIA 3Q1TA 1TYFA 4B3IA 2VSSE 1ON9A 5JBWA 4U1AA 1EY3A 1ON3A 3G64A 4YLHA 3H0UA 3IB9A 4U0HA 3L3SA 1YG8A 3HE2A 3R6HA 4EMPA 2A7SA 3RSIA 2Q35A 2X24A 3V5IA 2ZL4A 3ISAA 2PBPA 3PE8A 3N6RB 3ZWAA 2D3TA 1JXZA
chains in the Genus database with same CATH superfamily
3PEAA 2UZFA 5KDRA 1WDLA 3Q7HA 2J5GD 3BPPA 3RSTA 1WZ8A 2CE3A 4HC8A 3ST9A 3IBBA 3QREA 5INFA 3R9SA 4OLQA 1OD2A 4RYFH 1RJNA 2PG8A 3K50A 3RQEA 5G1RA 4RYFA 1WDMA 3MYBA 2VSSA 3DORA 4JJTA 3GKBA 4ZU2A 3MT6A 3TVWA 2YJGA 4FN7A 4F47A 2NP9A 3PZKA 4G2RA 3AJMA 3RRVA 4QIJA 5HUQA 3BF0A 4Q0GA 3BPTA 5G1SA 3Q0JA 2C8TA 2P63A 5C90A 3KTIA 3OC7A 4Z0MA 4DI1A 1K39A 2DEOA 3AM1A 1PIXA 4KNPA 5C9GA 4ZDFA 2ZL3A 1N6DA 4FN8A 4U19A 3ZW9A 3H0JA 2A7KA 3SWXA 2HW5A 4WYOB 2VREA 3ADCA 3FF6A 4IZBA 1EF9A 4ZDCA 2EJ5A 3A4LA 4WZ8B 3GMAA 1XNYA 1NZYB 3T8AA 5JBXA 4ASIA 1MJ3A 4L8KA 2QQ3A 2F9YA 3KTHA 1UYTA 1XX4A 3H02A 3K8XA 3T89A 1Y64B 4L6WA 2CBYA 3H0SA 4JCRA 1FC7A 2BZRA 1SG4A 2VSSF 3DJAA 1W2XA 2J5IB 2F9IA 3TV5A 4FZWC 2WTBA 3R9QA 5E0SH 3SLLA 2VX2A 3FDUA 4QIIA 3H0QA 4EMMA 5E0SA 3IRBA 3W8IB 4I4ZA 4NNQA 3PGQA 3R9TA 3KQFA 1FCFA 1O8UA 5G1QA 3T3WA 3TVUA 4OMRA 2J5SA 1FC9A 1XO6A 3GF7A 4ELWA 4FNDA 5DU4A 3NJDA 4U18A 1N6EA 4JOTA 2VSUC 3HP0A 1PJHA 4U0GH 4RCNA 2W3PA 4JYLA 2GTRA 3HRXA 3QKAA 4WCZA 1Q52A 2F6QA 4U0GA 4I42A 2FBMA 2J5GA 1XNWA 1SZOA 4JCTA 4MOUA 3Q0GA 2ZL0A 5INGA 1HNOA 4GM2A 5CTBA 3JU1A 4NARA 4NEKA 3HLN1 3V5EA 1OD4A 5DTPA 4K2NA 3P2LA 2VSUE 4Q1IA 3M6MA 2X58A 1XNVA 4JVTA 3QYRA 5KDRB 3BEZA 4FB8A 4IZCA 1J7XA 3IAVA 3TLFA 1VRGA 3P85A 1UIYA 4K29A 4FZWA 2F6IA 4HDTA 5IKLB 1WDKA 4B3HA 5DUCA 5KJPA 4KD6A 1X0UA 4ZDEA 3QK8A 4ELSA 4QFEA 3U9RB 3OT6A 3U9SB 4JYJA 3O4XE 3P5MA 4GHNA 4ZDBA 3VIVA 3KTGA 4FJWD 2FZSA 2ZQRA 4KWBA 5DTWA 4B3JA 5DU8A 3R0OA 4JCSA 3ZWBA 1HZDA 5DKPA 5DU6A 4FNBA 3L8JA 2A81A 3QWDA 4HNKA 2VSUA 3WG5A 2PPYA 1EF8A 3RQGA 1FC6A 3T8BA 4JWVA 3GLMA 1N6FA 3LKEA 2Q34A 3QXZA 3OMEA 3TZ3A 1NZYA 4EMLA 1HNUA 5INIA 1UYRA 4JFCA 3STAA 3W8HB 5DZKH 2J5II 2F9YB 4ZDDA 4GEHB 5DL1A 2Q2XA 3I47A 3U9TB 4OG1A 4K3WA 5DZKA 3ADBA 3TT6A 3HINA 3KTJA 2J5IA 3KTKA 1K32A 2F9IB 5MGBA 4I52A 3RQFA 3NJBA 4JSBA 1UX5A 3T88A 3A4NA 4MI2A 1UYVA 4KPKA 5E0NX 3QMJA 3MOYA 3L8IA 3LAOA 5DUFA 4MXIA 3TT7A 1DUBA 3TRRA 3M6NA 5FIFA 4JCQA 3MFMA 3GF3A 2DUBA 1YG6A 5CTCA 3ZW8A 1RJMA 2VSUF 1TG6A 3A4MA 4LK5A 1Y7OA 3ADDA 2IEXA 4IZDA 3TDCA 3H81A 3ZWCA 2FW2A 4ELXA 1DCIA 1UYSA 1Q51A 2ZQQA 2ZL2A 5FUSA 3QXIA 3Q1TA 1TYFA 4B3IA 2VSSE 1ON9A 5JBWA 4U1AA 1EY3A 1ON3A 3G64A 4YLHA 3H0UA 3IB9A 4U0HA 3L3SA 1YG8A 3HE2A 3R6HA 4EMPA 2A7SA 3RSIA 2Q35A 1UX4A 2X24A 3V5IA 2ZL4A 3ISAA 2PBPA 3PE8A 3N6RB 3ZWAA 4J2UA 2D3TA 1JXZA
chains in the Genus database with same CATH topology
3PEAA 2UZFA 5KDRA 1WDLA 3Q7HA 2J5GD 3BPPA 3RSTA 1WZ8A 2CE3A 4HC8A 3ST9A 3IBBA 3QREA 5INFA 3R9SA 4OLQA 1OD2A 4RYFH 1RJNA 2PG8A 3K50A 5G1RA 4RYFA 1WDMA 3MYBA 2VSSA 3DORA 4JJTA 3GKBA 4ZU2A 3MT6A 3TVWA 2YJGA 4FN7A 4F47A 2NP9A 3PZKA 4G2RA 3RRVA 4QIJA 5HUQA 3BF0A 4Q0GA 3BPTA 5G1SA 3Q0JA 2C8TA 5C90A 3KTIA 3OC7A 4Z0MA 4DI1A 1K39A 2DEOA 1PIXA 4KNPA 5C9GA 4ZDFA 2ZL3A 1N6DA 4FN8A 4U19A 3ZW9A 3H0JA 2A7KA 3SWXA 2HW5A 4WYOB 2VREA 3FF6A 4IZBA 1EF9A 4ZDCA 2EJ5A 4WZ8B 3GMAA 1XNYA 1NZYB 3T8AA 5JBXA 4ASIA 1MJ3A 4L8KA 2QQ3A 2F9YA 3KTHA 1UYTA 1XX4A 3H02A 3K8XA 3T89A 4L6WA 2CBYA 3H0SA 4JCRA 1FC7A 2BZRA 1SG4A 2VSSF 3DJAA 1W2XA 2J5IB 2F9IA 3TV5A 4FZWC 2WTBA 3R9QA 5E0SH 3SLLA 2VX2A 3FDUA 4QIIA 3H0QA 4EMMA 5E0SA 4I4ZA 4NNQA 3PGQA 3R9TA 3KQFA 1FCFA 1O8UA 5G1QA 3T3WA 3TVUA 4OMRA 2J5SA 1FC9A 1XO6A 3GF7A 4ELWA 4FNDA 5DU4A 3NJDA 4U18A 1N6EA 4JOTA 2VSUC 3HP0A 1PJHA 4U0GH 4RCNA 2W3PA 4JYLA 2GTRA 3HRXA 3QKAA 4WCZA 1Q52A 2F6QA 4U0GA 4I42A 2FBMA 2J5GA 1XNWA 1SZOA 4JCTA 4MOUA 3Q0GA 2ZL0A 5INGA 1HNOA 4GM2A 5CTBA 3JU1A 4NARA 4NEKA 3HLN1 3V5EA 1OD4A 5DTPA 4K2NA 3P2LA 2VSUE 4Q1IA 3M6MA 2X58A 1XNVA 4JVTA 3QYRA 5KDRB 3BEZA 4FB8A 4IZCA 1J7XA 3IAVA 3TLFA 1VRGA 3P85A 1UIYA 4K29A 4FZWA 2F6IA 4HDTA 5IKLB 1WDKA 4B3HA 5DUCA 5KJPA 4KD6A 1X0UA 4ZDEA 3QK8A 4ELSA 4QFEA 3U9RB 3OT6A 3U9SB 4JYJA 3P5MA 4GHNA 4ZDBA 3VIVA 3KTGA 4FJWD 2FZSA 2ZQRA 4KWBA 5DTWA 4B3JA 5DU8A 3R0OA 4JCSA 3ZWBA 1HZDA 5DKPA 5DU6A 4FNBA 2A81A 3QWDA 4HNKA 2VSUA 3WG5A 2PPYA 1EF8A 1FC6A 3T8BA 4JWVA 3GLMA 1N6FA 3LKEA 2Q34A 3QXZA 3OMEA 3TZ3A 1NZYA 4EMLA 1HNUA 5INIA 1UYRA 4JFCA 3STAA 5DZKH 2J5II 2F9YB 4ZDDA 5DL1A 2Q2XA 3I47A 3U9TB 4OG1A 4K3WA 5DZKA 3TT6A 3HINA 3KTJA 2J5IA 3KTKA 1K32A 2F9IB 5MGBA 4I52A 3NJBA 4JSBA 3T88A 4MI2A 1UYVA 4KPKA 5E0NX 3QMJA 3MOYA 3LAOA 5DUFA 4MXIA 3TT7A 1DUBA 3TRRA 3M6NA 5FIFA 4JCQA 3MFMA 3GF3A 2DUBA 1YG6A 5CTCA 3ZW8A 1RJMA 2VSUF 1TG6A 4LK5A 1Y7OA 2IEXA 4IZDA 3TDCA 3H81A 3ZWCA 2FW2A 4ELXA 1DCIA 1UYSA 1Q51A 2ZQQA 2ZL2A 5FUSA 3QXIA 3Q1TA 1TYFA 4B3IA 2VSSE 1ON9A 5JBWA 4U1AA 1EY3A 1ON3A 3G64A 4YLHA 3H0UA 3IB9A 4U0HA 3L3SA 1YG8A 3HE2A 3R6HA 4EMPA 2A7SA 3RSIA 2Q35A 2X24A 3V5IA 2ZL4A 3ISAA 2PBPA 3PE8A 3N6RB 3ZWAA 4J2UA 2D3TA 1JXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEA A;  2UZF A;  5KDR A;  1WDL A;  3Q7H A;  2J5G D;  3BPP A;  3RST A;  1WZ8 A;  2CE3 A;  4HC8 A;  3ST9 A;  3IBB A;  3QRE A;  5INF A;  3R9S A;  4OLQ A;  1OD2 A;  4RYF H;  1RJN A;  2PG8 A;  3K50 A;  5G1R A;  4RYF A;  1WDM A;  3MYB A;  2VSS A;  3DOR A;  4JJT A;  3GKB A;  4ZU2 A;  3MT6 A;  3TVW A;  4FN7 A;  4F47 A;  2NP9 A;  3PZK A;  4G2R A;  3RRV A;  4QIJ A;  3BF0 A;  4Q0G A;  5G1S A;  3Q0J A;  2C8T A;  5C90 A;  3KTI A;  3OC7 A;  4Z0M A;  4DI1 A;  1K39 A;  2DEO A;  1PIX A;  4KNP A;  5C9G A;  4ZDF A;  2ZL3 A;  1N6D A;  4FN8 A;  4U19 A;  3ZW9 A;  3H0J A;  2A7K A;  3SWX A;  2HW5 A;  4WYO B;  2VRE A;  3FF6 A;  4IZB A;  1EF9 A;  4ZDC A;  2EJ5 A;  4WZ8 B;  3GMA A;  1XNY A;  1NZY B;  3T8A A;  5JBX A;  4ASI A;  1MJ3 A;  4L8K A;  2QQ3 A;  2F9Y A;  3KTH A;  1UYT A;  1XX4 A;  3H02 A;  3K8X A;  3T89 A;  4L6W A;  2CBY A;  3H0S A;  4JCR A;  1FC7 A;  2BZR A;  1SG4 A;  2VSS F;  3DJA A;  1W2X A;  2J5I B;  2F9I A;  3TV5 A;  4FZW C;  2WTB A;  3R9Q A;  5E0S H;  3SLL A;  2VX2 A;  3FDU A;  4QII A;  3H0Q A;  4EMM A;  5E0S A;  4I4Z A;  4NNQ A;  3PGQ A;  3R9T A;  3KQF A;  1FCF A;  1O8U A;  5G1Q A;  3T3W A;  3TVU A;  4OMR A;  2J5S A;  1FC9 A;  1XO6 A;  3GF7 A;  4ELW A;  4FND A;  5DU4 A;  3NJD A;  4U18 A;  1N6E A;  4JOT A;  2VSU C;  3HP0 A;  1PJH A;  4U0G H;  4RCN A;  2W3P A;  4JYL A;  2GTR A;  3HRX A;  3QKA A;  4WCZ A;  1Q52 A;  2F6Q A;  4U0G A;  4I42 A;  2FBM A;  2J5G A;  1XNW A;  1SZO A;  4JCT A;  4MOU A;  3Q0G A;  2ZL0 A;  5ING A;  1HNO A;  4GM2 A;  5CTB A;  3JU1 A;  4NEK A;  3HLN 1;  3V5E A;  1OD4 A;  5DTP A;  4K2N A;  3P2L A;  2VSU E;  4Q1I A;  3M6M A;  2X58 A;  1XNV A;  4JVT A;  3QYR A;  5KDR B;  3BEZ A;  4FB8 A;  4IZC A;  1J7X A;  3IAV A;  3TLF A;  1VRG A;  3P85 A;  1UIY A;  4K29 A;  4FZW A;  2F6I A;  5IKL B;  1WDK A;  4B3H A;  5DUC A;  5KJP A;  4KD6 A;  1X0U A;  4ZDE A;  3QK8 A;  4ELS A;  4QFE A;  3U9R B;  3OT6 A;  3U9S B;  4JYJ A;  3P5M A;  4GHN A;  4ZDB A;  3VIV A;  3KTG A;  4FJW D;  2FZS A;  2ZQR A;  4KWB A;  5DTW A;  4B3J A;  5DU8 A;  3R0O A;  4JCS A;  3ZWB A;  1HZD A;  5DKP A;  5DU6 A;  4FNB A;  2A81 A;  3QWD A;  4HNK A;  2VSU A;  3WG5 A;  2PPY A;  1EF8 A;  1FC6 A;  3T8B A;  4JWV A;  3GLM A;  1N6F A;  3LKE A;  2Q34 A;  3QXZ A;  3OME A;  3TZ3 A;  1NZY A;  4EML A;  1HNU A;  5INI A;  1UYR A;  4JFC A;  3STA A;  5DZK H;  2J5I I;  2F9Y B;  4ZDD A;  5DL1 A;  2Q2X A;  3I47 A;  3U9T B;  4OG1 A;  4K3W A;  5DZK A;  3TT6 A;  3HIN A;  3KTJ A;  2J5I A;  3KTK A;  1K32 A;  2F9I B;  5MGB A;  4I52 A;  3NJB A;  4JSB A;  3T88 A;  4MI2 A;  1UYV A;  4KPK A;  5E0N X;  3QMJ A;  3MOY A;  3LAO A;  5DUF A;  4MXI A;  3TT7 A;  1DUB A;  3TRR A;  3M6N A;  5FIF A;  4JCQ A;  3MFM A;  3GF3 A;  2DUB A;  1YG6 A;  5CTC A;  3ZW8 A;  1RJM A;  2VSU F;  1TG6 A;  4LK5 A;  1Y7O A;  2IEX A;  4IZD A;  3TDC A;  3H81 A;  3ZWC A;  2FW2 A;  4ELX A;  1DCI A;  1UYS A;  1Q51 A;  2ZQQ A;  2ZL2 A;  5FUS A;  3QXI A;  3Q1T A;  1TYF A;  4B3I A;  2VSS E;  1ON9 A;  5JBW A;  4U1A A;  1EY3 A;  1ON3 A;  3G64 A;  4YLH A;  3H0U A;  3IB9 A;  4U0H A;  3L3S A;  1YG8 A;  3HE2 A;  3R6H A;  4EMP A;  2A7S A;  3RSI A;  2Q35 A;  2X24 A;  3V5I A;  2ZL4 A;  3ISA A;  2PBP A;  3PE8 A;  3N6R B;  3ZWA A;  2D3T A;  1JXZ A; 
#chains in the Genus database with same CATH topology
 3PEA A;  2UZF A;  5KDR A;  1WDL A;  3Q7H A;  2J5G D;  3BPP A;  3RST A;  1WZ8 A;  2CE3 A;  4HC8 A;  3ST9 A;  3IBB A;  3QRE A;  5INF A;  3R9S A;  4OLQ A;  1OD2 A;  4RYF H;  1RJN A;  2PG8 A;  3K50 A;  3RQE A;  5G1R A;  4RYF A;  1WDM A;  3MYB A;  2VSS A;  3DOR A;  4JJT A;  3GKB A;  4ZU2 A;  3MT6 A;  3TVW A;  2YJG A;  4FN7 A;  4F47 A;  2NP9 A;  3PZK A;  4G2R A;  3AJM A;  3RRV A;  4QIJ A;  5HUQ A;  3BF0 A;  4Q0G A;  3BPT A;  5G1S A;  3Q0J A;  2C8T A;  2P63 A;  5C90 A;  3KTI A;  3OC7 A;  4Z0M A;  4DI1 A;  1K39 A;  2DEO A;  3AM1 A;  1PIX A;  4KNP A;  5C9G A;  4ZDF A;  2ZL3 A;  1N6D A;  4FN8 A;  4U19 A;  3ZW9 A;  3H0J A;  2A7K A;  3SWX A;  2HW5 A;  4WYO B;  2VRE A;  3ADC A;  3FF6 A;  4IZB A;  1EF9 A;  4ZDC A;  2EJ5 A;  3A4L A;  4WZ8 B;  3GMA A;  1XNY A;  1NZY B;  3T8A A;  5JBX A;  4ASI A;  1MJ3 A;  4L8K A;  2QQ3 A;  2F9Y A;  3KTH A;  1UYT A;  1XX4 A;  3H02 A;  3K8X A;  3T89 A;  1Y64 B;  4L6W A;  2CBY A;  3H0S A;  4JCR A;  1FC7 A;  2BZR A;  1SG4 A;  2VSS F;  3DJA A;  1W2X A;  2J5I B;  2F9I A;  3TV5 A;  4FZW C;  2WTB A;  3R9Q A;  5E0S H;  3SLL A;  2VX2 A;  3FDU A;  4QII A;  3H0Q A;  4EMM A;  5E0S A;  3IRB A;  3W8I B;  4I4Z A;  4NNQ A;  3PGQ A;  3R9T A;  3KQF A;  1FCF A;  1O8U A;  5G1Q A;  3T3W A;  3TVU A;  4OMR A;  2J5S A;  1FC9 A;  1XO6 A;  3GF7 A;  4ELW A;  4FND A;  5DU4 A;  3NJD A;  4U18 A;  1N6E A;  4JOT A;  2VSU C;  3HP0 A;  1PJH A;  4U0G H;  4RCN A;  2W3P A;  4JYL A;  2GTR A;  3HRX A;  3QKA A;  4WCZ A;  1Q52 A;  2F6Q A;  4U0G A;  4I42 A;  2FBM A;  2J5G A;  1XNW A;  1SZO A;  4JCT A;  4MOU A;  3Q0G A;  2ZL0 A;  5ING A;  1HNO A;  4GM2 A;  5CTB A;  3JU1 A;  4NAR A;  4NEK A;  3HLN 1;  3V5E A;  1OD4 A;  5DTP A;  4K2N A;  3P2L A;  2VSU E;  4Q1I A;  3M6M A;  2X58 A;  1XNV A;  4JVT A;  3QYR A;  5KDR B;  3BEZ A;  4FB8 A;  4IZC A;  1J7X A;  3IAV A;  3TLF A;  1VRG A;  3P85 A;  1UIY A;  4K29 A;  4FZW A;  2F6I A;  4HDT A;  5IKL B;  1WDK A;  4B3H A;  5DUC A;  5KJP A;  4KD6 A;  1X0U A;  4ZDE A;  3QK8 A;  4ELS A;  4QFE A;  3U9R B;  3OT6 A;  3U9S B;  4JYJ A;  3O4X E;  3P5M A;  4GHN A;  4ZDB A;  3VIV A;  3KTG A;  4FJW D;  2FZS A;  2ZQR A;  4KWB A;  5DTW A;  4B3J A;  5DU8 A;  3R0O A;  4JCS A;  3ZWB A;  1HZD A;  5DKP A;  5DU6 A;  4FNB A;  3L8J A;  2A81 A;  3QWD A;  4HNK A;  2VSU A;  3WG5 A;  2PPY A;  1EF8 A;  3RQG A;  1FC6 A;  3T8B A;  4JWV A;  3GLM A;  1N6F A;  3LKE A;  2Q34 A;  3QXZ A;  3OME A;  3TZ3 A;  1NZY A;  4EML A;  1HNU A;  5INI A;  1UYR A;  4JFC A;  3STA A;  3W8H B;  5DZK H;  2J5I I;  2F9Y B;  4ZDD A;  4GEH B;  5DL1 A;  2Q2X A;  3I47 A;  3U9T B;  4OG1 A;  4K3W A;  5DZK A;  3ADB A;  3TT6 A;  3HIN A;  3KTJ A;  2J5I A;  3KTK A;  1K32 A;  2F9I B;  5MGB A;  4I52 A;  3RQF A;  3NJB A;  4JSB A;  1UX5 A;  3T88 A;  3A4N A;  4MI2 A;  1UYV A;  4KPK A;  5E0N X;  3QMJ A;  3MOY A;  3L8I A;  3LAO A;  5DUF A;  4MXI A;  3TT7 A;  1DUB A;  3TRR A;  3M6N A;  5FIF A;  4JCQ A;  3MFM A;  3GF3 A;  2DUB A;  1YG6 A;  5CTC A;  3ZW8 A;  1RJM A;  2VSU F;  1TG6 A;  3A4M A;  4LK5 A;  1Y7O A;  3ADD A;  2IEX A;  4IZD A;  3TDC A;  3H81 A;  3ZWC A;  2FW2 A;  4ELX A;  1DCI A;  1UYS A;  1Q51 A;  2ZQQ A;  2ZL2 A;  5FUS A;  3QXI A;  3Q1T A;  1TYF A;  4B3I A;  2VSS E;  1ON9 A;  5JBW A;  4U1A A;  1EY3 A;  1ON3 A;  3G64 A;  4YLH A;  3H0U A;  3IB9 A;  4U0H A;  3L3S A;  1YG8 A;  3HE2 A;  3R6H A;  4EMP A;  2A7S A;  3RSI A;  2Q35 A;  1UX4 A;  2X24 A;  3V5I A;  2ZL4 A;  3ISA A;  2PBP A;  3PE8 A;  3N6R B;  3ZWA A;  4J2U A;  2D3T A;  1JXZ A; 
#chains in the Genus database with same CATH homology
 3PEA A;  2UZF A;  5KDR A;  1WDL A;  3Q7H A;  2J5G D;  3BPP A;  3RST A;  1WZ8 A;  2CE3 A;  4HC8 A;  3ST9 A;  3IBB A;  3QRE A;  5INF A;  3R9S A;  4OLQ A;  1OD2 A;  4RYF H;  1RJN A;  2PG8 A;  3K50 A;  5G1R A;  4RYF A;  1WDM A;  3MYB A;  2VSS A;  3DOR A;  4JJT A;  3GKB A;  4ZU2 A;  3MT6 A;  3TVW A;  2YJG A;  4FN7 A;  4F47 A;  2NP9 A;  3PZK A;  4G2R A;  3RRV A;  4QIJ A;  5HUQ A;  3BF0 A;  4Q0G A;  3BPT A;  5G1S A;  3Q0J A;  2C8T A;  5C90 A;  3KTI A;  3OC7 A;  4Z0M A;  4DI1 A;  1K39 A;  2DEO A;  1PIX A;  4KNP A;  5C9G A;  4ZDF A;  2ZL3 A;  1N6D A;  4FN8 A;  4U19 A;  3ZW9 A;  3H0J A;  2A7K A;  3SWX A;  2HW5 A;  4WYO B;  2VRE A;  3FF6 A;  4IZB A;  1EF9 A;  4ZDC A;  2EJ5 A;  4WZ8 B;  3GMA A;  1XNY A;  1NZY B;  3T8A A;  5JBX A;  4ASI A;  1MJ3 A;  4L8K A;  2QQ3 A;  2F9Y A;  3KTH A;  1UYT A;  1XX4 A;  3H02 A;  3K8X A;  3T89 A;  4L6W A;  2CBY A;  3H0S A;  4JCR A;  1FC7 A;  2BZR A;  1SG4 A;  2VSS F;  3DJA A;  1W2X A;  2J5I B;  2F9I A;  3TV5 A;  4FZW C;  2WTB A;  3R9Q A;  5E0S H;  3SLL A;  2VX2 A;  3FDU A;  4QII A;  3H0Q A;  4EMM A;  5E0S A;  4I4Z A;  4NNQ A;  3PGQ A;  3R9T A;  3KQF A;  1FCF A;  1O8U A;  5G1Q A;  3T3W A;  3TVU A;  4OMR A;  2J5S A;  1FC9 A;  1XO6 A;  3GF7 A;  4ELW A;  4FND A;  5DU4 A;  3NJD A;  4U18 A;  1N6E A;  4JOT A;  2VSU C;  3HP0 A;  1PJH A;  4U0G H;  4RCN A;  2W3P A;  4JYL A;  2GTR A;  3HRX A;  3QKA A;  4WCZ A;  1Q52 A;  2F6Q A;  4U0G A;  4I42 A;  2FBM A;  2J5G A;  1XNW A;  1SZO A;  4JCT A;  4MOU A;  3Q0G A;  2ZL0 A;  5ING A;  1HNO A;  4GM2 A;  5CTB A;  3JU1 A;  4NAR A;  4NEK A;  3HLN 1;  3V5E A;  1OD4 A;  5DTP A;  4K2N A;  3P2L A;  2VSU E;  4Q1I A;  3M6M A;  2X58 A;  1XNV A;  4JVT A;  3QYR A;  5KDR B;  3BEZ A;  4FB8 A;  4IZC A;  1J7X A;  3IAV A;  3TLF A;  1VRG A;  3P85 A;  1UIY A;  4K29 A;  4FZW A;  2F6I A;  4HDT A;  5IKL B;  1WDK A;  4B3H A;  5DUC A;  5KJP A;  4KD6 A;  1X0U A;  4ZDE A;  3QK8 A;  4ELS A;  4QFE A;  3U9R B;  3OT6 A;  3U9S B;  4JYJ A;  3P5M A;  4GHN A;  4ZDB A;  3VIV A;  3KTG A;  4FJW D;  2FZS A;  2ZQR A;  4KWB A;  5DTW A;  4B3J A;  5DU8 A;  3R0O A;  4JCS A;  3ZWB A;  1HZD A;  5DKP A;  5DU6 A;  4FNB A;  2A81 A;  3QWD A;  4HNK A;  2VSU A;  3WG5 A;  2PPY A;  1EF8 A;  1FC6 A;  3T8B A;  4JWV A;  3GLM A;  1N6F A;  3LKE A;  2Q34 A;  3QXZ A;  3OME A;  3TZ3 A;  1NZY A;  4EML A;  1HNU A;  5INI A;  1UYR A;  4JFC A;  3STA A;  5DZK H;  2J5I I;  2F9Y B;  4ZDD A;  5DL1 A;  2Q2X A;  3I47 A;  3U9T B;  4OG1 A;  4K3W A;  5DZK A;  3TT6 A;  3HIN A;  3KTJ A;  2J5I A;  3KTK A;  1K32 A;  2F9I B;  5MGB A;  4I52 A;  3NJB A;  4JSB A;  3T88 A;  4MI2 A;  1UYV A;  4KPK A;  5E0N X;  3QMJ A;  3MOY A;  3LAO A;  5DUF A;  4MXI A;  3TT7 A;  1DUB A;  3TRR A;  3M6N A;  5FIF A;  4JCQ A;  3MFM A;  3GF3 A;  2DUB A;  1YG6 A;  5CTC A;  3ZW8 A;  1RJM A;  2VSU F;  1TG6 A;  4LK5 A;  1Y7O A;  2IEX A;  4IZD A;  3TDC A;  3H81 A;  3ZWC A;  2FW2 A;  4ELX A;  1DCI A;  1UYS A;  1Q51 A;  2ZQQ A;  2ZL2 A;  5FUS A;  3QXI A;  3Q1T A;  1TYF A;  4B3I A;  2VSS E;  1ON9 A;  5JBW A;  4U1A A;  1EY3 A;  1ON3 A;  3G64 A;  4YLH A;  3H0U A;  3IB9 A;  4U0H A;  3L3S A;  1YG8 A;  3HE2 A;  3R6H A;  4EMP A;  2A7S A;  3RSI A;  2Q35 A;  2X24 A;  3V5I A;  2ZL4 A;  3ISA A;  2PBP A;  3PE8 A;  3N6R B;  3ZWA A;  4J2U A;  2D3T A;  1JXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...