2IFEA

Translation initiation factor if3 from escherichia coli ribosome binding domain (residues 84-180)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
VIQVKEIKFRPGTDEGDYQVKLRSLIRFLEEGDKAKITLRFRGREMAHQQIGMEVLNRVKDDLQELAVVESFPTKIEGRQMIMVLAPKKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Interaction of E. Coli Translation Initiation Factor If3 with the Ribosome
rcsb
source organism Escherichia coli
molecule tags Gene regulation
molecule keywords PROTEIN (TRANSLATION INITIATION FACTOR IF3)
total genus 17
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 1998-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00707 IF3_C Translation initiation factor IF-3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.10 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation initiation factor 3 (IF-3), C-terminal domain 2ifeA00
2CRQA 2IFEA 2M71A 1TIGA
chains in the Genus database with same CATH superfamily
1JO0A 3IABB 1Y9XA 2IFEA 4HVZA 3DSDA 1Y2IA 1HC7A 4FBQA 4YDQA 1VM0A 2Q3VA 3LVJC 3LVKB 1RQ8A 4NCXA 1NJ6A 3TTDA 3HZ7A 1H4TA 4Z9EA 4HVCA 1VR4A 3VTHA 4K88A 3T1IA 4NZRM 4OLFA 3ZIGA 3TOEA 1NJ8A 4HD0A 1II7A 2EH1A 2Y1BA 1NJ2A 3P04A 4FCXA 1S8EA 3U6YA 3IABA 1PAVA 2A2YA 4FBWA 2M71A 2H9UA 4NZTM 3ZIIA 3TSPA 4TWAA 3ZIEA 2EK0A 1TIGA 1NJ1A 1XEZA 2Z7CA 1NH9A 3TTFA 3TTCA 4Q15A 2LN3A 3WBMA 2BKYX 4WI1A 2L8YA 1NFJA 3DSCA 1LN4A 4EO0A 3IALA 4FBKA 3ZIHA 1H4QA 1NFHA 3TSUA 4K87A 1NJ5A 2P9BA 1H0YA 2GTCA 1UDVA 2CRQA 2LXRA 3VTIA 1H0XA 1JDQA 3TSQA 1JE3A 1H4SA 4K86A 3QKBA 4YKEA 1DCJA
chains in the Genus database with same CATH topology
2CRQA 2IFEA 2M71A 1TIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRQ A;  2IFE A;  2M71 A;  1TIG A; 
#chains in the Genus database with same CATH topology
 1JO0 A;  3IAB B;  1Y9X A;  2IFE A;  4HVZ A;  3DSD A;  1Y2I A;  1HC7 A;  4FBQ A;  4YDQ A;  1VM0 A;  2Q3V A;  3LVJ C;  3LVK B;  1RQ8 A;  4NCX A;  1NJ6 A;  3TTD A;  3HZ7 A;  1H4T A;  4Z9E A;  4HVC A;  1VR4 A;  3VTH A;  4K88 A;  3T1I A;  4NZR M;  4OLF A;  3ZIG A;  3TOE A;  1NJ8 A;  4HD0 A;  1II7 A;  2EH1 A;  2Y1B A;  1NJ2 A;  3P04 A;  4FCX A;  1S8E A;  3U6Y A;  3IAB A;  1PAV A;  2A2Y A;  4FBW A;  2M71 A;  2H9U A;  4NZT M;  3ZII A;  3TSP A;  4TWA A;  3ZIE A;  2EK0 A;  1TIG A;  1NJ1 A;  1XEZ A;  2Z7C A;  1NH9 A;  3TTF A;  3TTC A;  4Q15 A;  2LN3 A;  3WBM A;  2BKY X;  4WI1 A;  2L8Y A;  1NFJ A;  3DSC A;  1LN4 A;  4EO0 A;  3IAL A;  4FBK A;  3ZIH A;  1H4Q A;  1NFH A;  3TSU A;  4K87 A;  1NJ5 A;  2P9B A;  1H0Y A;  2GTC A;  1UDV A;  2CRQ A;  2LXR A;  3VTI A;  1H0X A;  1JDQ A;  3TSQ A;  1JE3 A;  1H4S A;  4K86 A;  3QKB A;  4YKE A;  1DCJ A; 
#chains in the Genus database with same CATH homology
 2CRQ A;  2IFE A;  2M71 A;  1TIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...