2IFMA

Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 angstroms resolution x-ray fibre diffraction data
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
46
structure length
46
Chain Sequence
b'GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF1 FILAMENTOUS BACTERIOPHAGE
publication title Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre diffraction data.
pubmed doi rcsb
molecule tags Virus
total genus 17
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1995-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ifmA00
4IFMA 1IFMA 1IFNA 1QL2A 2XKMA 2IFNA 2KLVA 2KSJA 2IFMA 3IFMA 1ZN5A 1QL1A 1PFIA
chains in the Genus database with same CATH superfamily
2QEXP 1PGOA 4D6TJ 5GTIH 1RQVA 4NPDA 1LT1A 4W7ZA 2FY8A 2OYIC 1HGZA 1URQC 3MUDA 3RK3C 2Q1KA 1KQSO 1SQQJ 1J1EB 4Y99B 1NU1K 1NTME 3HD7A 2ZT9D 2W27A 5AVYB 5KTBA 2J5UA 1YJWP 3I5CA 2H88C 2K9JA 1KILA 1LTSC 5DJUB 3R4YA 3FWLA 2HG5D 1LP1B 3H1HD 4RJTA 4BRYA 2YKPA 1L0NE 1NYHA 4K35A 3N4XA 2POHA 2WPQA 3E1IA 1Q86Q 3MGNA 1VQPP 2JWAA 1DD3A 1VQ8P 2KI7B 1JY3P 1ZRTD 3M0DA 3TGUD 1T8ZA 4IL6H 1ZOYC 4EIJA 2ZT9C 3S4RA 1S5LE 1KQLA 4JYBA 3G4SP 1EXIA 1M1JB 2KYVA 3CX5H 1NAYA 2R3SA 3S1KA 5EFWB 1H88A 1VQKP 4D6TD 5AVRB 3Q2YA 4AYCA 1VDFA 3B5ND 2YKQA 2M5AB 1QVGO 2YIUC 3CCUP 3KDPB 4N78D 4PD4I 3IFMA 1IC2A 1SQQD 1JCDA 1L4AD 2OYIB 1A02F 4GKGA 1N86A 2KSEA 5KLVE 5B5EH 1YQ3C 2L5GB 1JY3N 1KYOI 1LTAC 3L74J 3L75G 4XFJA 4DZOA 3MTUE 3KPEA 1PZQA 1Y9BA 4L75A 4W80A 1M90Q 2W6JH 3B5NC 4C7NB 1W2BO 2C0WA 1FC2C 2FYUE 3CXHI 5APTA 1JCCA 3H1JJ 1L4AC 2L91A 2R5DA 1LTTC 3NFQA 2IX7C 3RK2D 1G2CB 2WT7A 2ZVNB 1P84E 2Y9ZA 2WSFJ 4KHXA 1DEEG 5E79H 3H1KG 1EZVD 3PP5A 5CMZA 2IBZE 1NTKG 5AW2B 2ZT9B 3EFGA 1NU1E 4EOTA 1PPJE 3GW6A 1W5CE 4RO0A 2OYHC 1GZLA 3G6EP 1JMMA 3OA7A 4K3AA 3TSIA 5AVXB 1LJ2A 1IFPA 1KORA 3TNUA 4H0LB 2RH0A 1BGYG 1FZGA 1IFJA 3V2RA 4OGQC 2WVRA 3GF3A 2R44A 3AE9C 2GA1A 3M9BA 2NPSD 4ASWA 2D2CC 1BE3G 3O6QB 2QJPC 3L74D 3GHGB 1IZNB 3VMYA 3V6IA 3H1LG 3BATA 4YXDC 1N7SB 2XNXA 2WTYA 2IFNA 3WUVA 2R3CA 3M9HA 3Q5SA 2A06G 4H13D 3HE5A 2W90A 1TU3F 1JY2P 2ZXEB 3H1JD 4PD4H 1OVUA 3B5NB 2NPSC 3D6ZA 3A7OA 3V2NA 4UB8E 1L4AB 1KB9E 2UWJE 2FYNC 1KYOH 1LWUA 1L0LK 4KJMA 3TK1A 1MFTA 2Z4EA 1S9KD 1PP9E 5APWA 3H32A 2LKMA 3M9QA 1Q2NA 2CPBA 4KT0J 1NTMG 4PV1D 5M1BA 1LTJB 1FDIA 2CPSA 3CCQP 1LTGC 1AJYA 5CJ4A 1GU5A 3CXHH 1YHQP 1HF9A 1BCCE 5CCHD 2XV5A 2OYHA 4IL6X 1L0NG 2ZYDA 3E7KA 3H1KJ 2XZRA 2CK3H 3RK2B 3UIAA 1GL2B 3L37A 2PGDA 1RF0C 5APQA 3U59A 1FZCB 4PV1C 3D71A 3AEBC 3WUTA 1FAVA 2QJKC 2QVAA 2WZ7A 3L70J 4Y28J 5AW7B 5GTHH 2FXOA 2JP3A 1J1DB 1K73Q 3V2QA 4U7JA 1BGYJ 5DJTB 5CCHC 3GLMA 1EDIA 2IZ1A 4MN4C 1SQXJ 2K37A 1IK7A 4BWNA 5KAIE 2NZ2A 1BE3J 4CPGA 3L75D 2B87A 5KJ7A 1M56D 1SP4A 1OWAA 1EDKA 2HLOA 3H1LJ 2V7QH 2ZFCA 1ZN5A 1QEXA 2FYNB 1NHLA 2KUBA 2NPSA 1P84I 3AE2C 5KLVG 2WSEH 1JMBA 1FBMA 2IBZI 2B89A 1H8AA 3I55P 3HE4B 4H13B 1SFCD 2WITA 2BEZF 1JO5A 1E5WA 1J1EC 4Y99C 3CCMP 1NKZB 3A2AA 2PP6A 1D7MA 3T97A 1QLED 4L74A 1SQVK 1SS1A 3H1KD 3AE5C 1W2EA 2FYUG 1KYOD 2KSJA 3NXSA 3EWKA 2YXQB 2QM7A 5CCGD 3CWBJ 1Q90D 1Y8AA 3VP9A 4JPZB 3AECC 1S5LH 3CCVP 1NTZG 3L70D 4WY4A 3BCCJ 1L0LE 1M7LA 1A02J 1SFCC 2IBZG 4PV1B 3VOPA 1BGYD 1N73C 1RF0A 2KS1B 1PPJG 1SQQK 1PFIA 1FOSE 3U1CA 1RE3A 1AVOA 2ZXXA 1SQXD 2ITAA 1L0NJ 2FKWB 1SQPK 1BE3D 2MKVA 3AE6C 1M1JC 2HODA 1QX8A 1OVVA 4TLFA 3H1LD 5AW5B 2AEJA 5CCGC 3RK3E 3CMEP 5AVVB 3VMZA 3RL0g 2KLVA 3MZWB 1ZV8A 2A06D 2BASA 1OIPA 1KB9I 1USEA 4W7YA 2WMMA 5C39A 4B86A 1EDLA 1VQ9P 2ZJSE 3FWNA 1GMJA 4H44D 2YKOA 5CHXA 2E76B 2R5BA 3PH0A 2KP8A 3FXDA 3U1AA 1AV1A 2PFXA 5AW3B 1RF1A 3L72G 1HWTC 3CWBD 1SQBJ 1VQ6P 5AVQB 1P84H 2JEEA 1GD2E 3BCCD 3LW5J 1X0TA 2IZ0A 1FOSF 1X22A 1GK4A 1PP9G 4YTPC 4H0LD 4OH8B 1LP1A 1ZR4A 2K88A 3H1HE 1HTLC 4N6JA 1YITP 3G71P 1SFCB 2C0XA 1L0ND 1YJ9P 1N73B 2HYNA 3PTZA 2KLUA 3HUSB 3PRJA 1JNMA 1LTIC 2FYUJ 3AE7C 1GTWA 1BCCG 1RE4A 1ZRTE 3TGUE 1N7SD 2E5TA 2E74D 1FJPA 2LR2A 1SQVE 3M0AA 3V4WA 1NTZJ 5TJHA 1YI2P 3IR9A 3AEGC 3GMAA 3FX0A 1YJNP 2Q3IA 1PV3A 4H0LC 5APSA 3WU2E 4DJGA 2P7JA 4D6TE 3L36A 3PLNA 1PL5A 2QM8A 4IFMA 3GHGC 2YMKA 4N78E 1SQQE 2YO3A 2Z5HA 2JJLA 2N1TD 1N7SC 3RL0D 1SQBD 3SFDC 2E74C 3AE8C 2FBWC 1QGKB 2KB7P 2Y0EA 1SQPE 4UB8H 2OYIA 3CC7P 1JTHB 4HJGH 1URQA 1YYCA 5KLVD 1KB9H 2FXMA 4R4LA 3H1IG 1KV4A 5TISE 2WWWA 2KIKA 1OVRA 5BU8B 1MV8A 1PGQA 4H44B 3H6PA 1T3JA 2QSIA 2V4HA 4C7NA 2FYUD 1MFZA 1JEKA 3L72J 4U3FE 2FFDB 2JWDA 1GL2D 1EXJA 3D6YA 1OMIA 2KK7A 1NAFA 1SVFA 2WT7B 1NVOA 1AA0A 1G2CA 1K8AQ 1NTZD 4IFFA 1P84D 1LTJC 3MIWA 1FE6A 1SLQA 1S5LX 1EZVE 2IPPA 1NH4A 1OX3A 2IBZD 3S9OA 2ZYAA 1IFDA 4XA4A 3CCJP 1PP9J 2B9BA 3RBXA 3CPWO 1IK9A 1JY3O 3CMAP 2LXBA 1MUUA 3OW2O 3Q5RA 4WVZA 2OTKE 1VQ4P 1L0LG 3OJAB 5KLIC 2C9LY 3RK2C 1GL2C 1NGMB 1FDMA 4AUWA 2XKMA 1FZCC 2ZAEB 2M0BA 4LLHA 5KAIH 2OQQA 3V5BA 3CX5D 3L74E 3L73E 3O6QA 2E74B 5APUA 1J1DC 2P2UA 2AXTE 5AVSB 5B66E 2YMYA 2IYPA 3WMM0 1ZP0C 3A0HE 2VRSA 1OW6A 2DW3A 3WUUA 1OW7A 3C9IA 2JO1A 3B8EB 3L72D 2YO2A 3H1JE 5AW0B 1GW3A 5APVA 4ASVA 3I56P 3B5NA 3BRVB 3W68A 3CD6P 2YNYA 1CI6A 4JBZA 3L75J 3P8CD 1GK6A 2N1TB 3RL0B 3N7NA 1L4AA 1LWUB 1R5LA 3H1IJ 3EQ2A 4EI2A 1JUNA 3ITKA 2P67A 3JCUE 4H13C 3H32B 1S9KE 1PP9D 3IF4A 2WSSH 4GT1A 2KOGA 2W6BA 5APXA 1S72P 2PRRA 1LNQA 1SQXK 3L71E 2HPCB 1WRGA 1Q81Q 4GODA 1LTJA 2O01H 4PJ0E 4I1LA 1VQ5P 1T2KD 3F89A 4LC1A 1S2EA 1JY2N 4UB6E 1HJ0A 2Z5IA 3H1HG 3AEFC 1AVYA 5KLIB 3A5TA 2QIWA 5L8RJ 1S4XA 5AVZB 1NTKJ 3MHVA 4BXLA 1FDOA 1DH3A 3PJSK 4GDOA 4AQRD 1BSNA 4O9BA 4JYCA 1L2PA 2OTLP 2BCCE 1GL2A 3HRNA 3P7KA 3TGUG 3NTNA 2FXPA 2GM4A 1FZCA 1NWQA 2ZYGA 4HH2A 2OYOA 3C1LA 1XTCC 1SQVG 1KFMA 2P58A 4Z1MH 2AXCA 2E76D 5BU5A 1L0LJ 1T2KC 4IFDK 1KTMA 2GUVA 5KKZB 4D6TG 1ZW0A 1VQLP 3VP8A 3H1ID 1KD1Q 1KILD 4DCKA 2O01N 1JY2O 5KAFE 1Z56A 2IDBA 2Q5UA 1VQOP 1SQPG 1M1KQ 2E76C 1EZVI 4NPEA 4PD4D 2RN0A 2E43A 4OVNF 2WPRA 1OFCX 3VTPC 1FZFA 3MUDC 1VF5D 3HE4A 1M8OB 2PAJA 2G8YA 1IFIA 3OAKA 3O8ZA 3T97B 1NTKD 3SWKA 1KILC 1H0TB 2V7QJ 2E75D 3V2PA 4U3FG 1NTMJ 1T6AA 1HUCA 3SWYA 3JSVC 1QL1A 2O3JA 2WSEJ 1AQ5A 4EYYQ 5AVTB 2GUSA 3HTKB 4EDFA 4WY4B 3CXHD 3L70E 2KNCB 3G3ZA 4OWFA 5AVWB 1EZVG 1NU1G 1Q82Q 1L0LD 3HUSC 1AFOA 4LGDE 1HJBA 1RY3A 2K1AA 1BGYE 4N3YB 3IN6A 3WU2H 4HKZH 2KS1A 1LT9B 1SQBK 2YXRB 1HGVA 1SQXE 5BVZA 4DT0A 1KC8Q 3EFFK 1BE3E 3QH9A 2IFMA 3A3YB 2E75C 1NO4A 3BVHA 5CCHA 2LXCB 1RH5B 3H1LE 2KXPB 1FZBA 3RK3D 1GW4A 3CC2P 3VMAA 3K5BA 4I7ZC 2K9YA 4WBAA 2O1KA 3A0BH 3MP7B 1SQVJ 3L73G 4JF7A 1LTBC 2FYUK 5TISH 1YTZT 2P1JA 1VL2A 2C9NY 4WWIA 2W8ZA 1CZQA 1NTZK 1RF1B 3KZIE 1GU4A 1JB0J 3FGAD 2HFED 3H1JG 3HD7B 3BASA 3SWFA 2WPSA 1NTMD 2XNDH 3CWBE 5KLVJ 2K9JB 1BDCA 2Q6QA 1IO4A 1KILB 4HB1A 1SQPJ 4H44C 3BCCE 3Q1MA 1CW5A 2QE7H 3AE1C 1R8EA 4BRYB 1S1CX 3LIDA 3AEAC 2FFDC 2QJYB 1UIIA 2R32A 3VYIA 3BRTB 1VF5B 2I1JA 1SFCA 1M57D 1X79B 3L71G 2Y0DA 1N73A 3HUSA 4ZKUA 2WSCH 2Q3EA 4U3FJ 1G1JA 5CBNA 1KMIZ 2E75B 5H2FH 1M1JA 3LIEA 1SQVD 2M3BA 1PIXA 3VMXA 5CCGA 1NU1J 2JR8A 3QWOC 4I7ZB 2BCCG 2AXTH 5B66H 3TF5A 3AEEC 5AW1B 1KQGB 4IOIH 3A0HH 2M5AA 1DD4A 3FXEA 3KQGA 4A7PA 2XU6A 3ZDMA 1HVVA 2KZJA 3P8MC 3AE4C 3GG2A 2XDJA 1XTGB 2WSCJ 2W83C 3SFEC 1RHZB 3A0BE 1SQBE 2NRGA 3H25A 3KHUA 4GIFA 1URQB 1SQPD 3RK3B 2WSFH 1FU1A 1JTHA 1J2JB 3L73J 2IYOA 3JCUH 5GTIE 5AW8B 2WPVB 3KXDA 3V4QA 1OXZA 1BSHA 1MKMA 2RMZA 2N1TC 3RL0C 1MZ9A 5AW6B 3E1RA 1DEBA 2FYZA 4PJ0H 1LWUC 1IFMA 4U3FD 3R2PA 4UB6H 4JQ0D 2FFDA 4HYTB 1QVFO 4OGQD 1VQ7P 3AE3C 1NTZE 1CSBA 2D2CD 1NU1D 1PPJD 1YIJP 3B71A 1FZAA 3CL3D 4NPFX 4C7RA 1OZHA 3TNUB 3D70A 1G1IA 1DIPA 1FJKA 3CCEP 3L70G 3L71J 3USSA 4GOEA 1BCCJ 3L4FA 4ZNCA 5KJ7D 5H2FE 4IL6E 3L35A 1DX7A 1NJIQ 2YIUB 3GF7A 3IAOA 1SQXG 1Y47A 1T3UA 3GHGA 1K04A 1AQTA 3CCLP 3CX5E 3KYQA 3L73D 2Y0CA 1N7SA 1HH0A 3TYYA 2SPZA 2P10A 4DOJA 2BCCJ 5KAFH 5CJ0A 3HE5B 1IFNA 4XE5B 5KKZC 2OTJP 2RKLA 1X8YA 1NTKK 1ZMEC 5KJ7C 2ZVOB 3CI9A 3L72E 2E42A 1GDTA 2AEFA 1KB9D 1CI6B 5B5EE 1N7LA 4TT3H 3P8CE 3CLQA 2N1TA 1PGPA 4WY4D 3Q5PA 2J59M 5AVUB 5APYA 1S3JA 3CWBG 5K5GB 3SSUA 1Q7YQ 3G9RA 2Q7CA 3VN0A 3P32A 3L71D 2HR3A 3BCCG 2HPCA 1BCCD 1VQMP 2I1KA 2OYHB 2QRXA 2JKVA 2J58A 3RBZA 3F5HA 3CC4P 3C8VA 5E79E 1X9VA 4WB4A 3M91A 4C46A 5CBOA 2K3RA 4WY4C 4OGQB 2N9YB 3NMDA 1VQNP 2BCCD 1YQ4C 2D2CB 1RQUA 2QJPB 2H8PD 1RE3C 1LT9C 2O01J 2A45I 2BEQD 2M3EA 3Q3DA 1ZR2A 4R4MA 1BDDA 2I8DA 2M8RA 3HD7D 1NTMK 2B87B 3L75E 1U7JA 1NKNA 4I6MC 1U7MA 1JM0A 4I2LC 1SQQG 2O1JA 2JDIH 1HBWA 2OARA 3H1IE 3KZIH 1EDJA 2N9BA 1YBKA 1KILE 2AEMA 1JOCA 1PGJA 2QA4P 1ZLLA 2NPSB 1E79H 1WT6A 1LGHB 2H43A 1SQBG 1L0NK 4RESB 2QG4A 4RKUJ 3II6A 3W67A 4M3LA 1VPCA 4YPCA 4PD4E 2A45G 4QMAA 1K05A 1R5SA 3PHLA 1RF1C 3HD7C 3MD0A 2W6AA 1KQFB 3TDKA 1IJDB 1EQ7A 3JC22 3H1KE 3M06A 2MJZA 1KYOE 1NTKE 3B4SA 1KFNA 1OW8A 1U57A 2Y9YA 1EC5A 1H0TA 2KZIA 3AEDC 1FS0E 1WMKA 1UIXA 2QJYC 1USDA 4L73A 2OGUA 3CCRP 2H7HA 1VF5C 4GOFA 3RGUA 3CX5I 3CXHE 3HTKA 5AW9B 2Q9IA 1FZEA 2KNCA 3M0DC 1KN7A 3H1HJ 4L76A 1K9MQ 2QJKB 1NOHA 1KZUB 1RE4C 1QL2A 2G3AA 3ABVC 4ZKPA 5KLVK 2HODB 1H89A 1LT9A 1ZXGA 3CCSP 1URQD 1N2DC 4YXWH 2E5YA 3TGUJ 2WQYC 2A06E 1YTZI 1N8RQ 3L74G 5GTHE 3LW5H 2A45H 2B88A 5AW4B 4ZMDA 2H89C
chains in the Genus database with same CATH topology
1SP4A 1OWAA 2HLOA 4GIFA 2ZFCA 1URQB 3RK3B 3C9IA 1ZN5A 2WSFH 3B8EB 1FU1A 2YO2A 1JTHA 5AW0B 1J2JB 1GW3A 1NHLA 5APVA 4W7ZA 2NPSA 3B5NA 2OYIC 1HGZA 1URQC 3BRVB 3MUDA 3RK3C 2WSEH 2YNYA 1CI6A 1FBMA 5AW8B 1J1EB 3V4QA 1H8AA 3P8CD 1GK6A 4Y99B 3HE4B 1NU1K 2N1TB 3RL0B 1SFCD 1OXZA 2WITA 3N7NA 1L4AA 1JO5A 1LWUB 3HD7A 1E5WA 2W27A 1J1EC 3EQ2A 5AVYB 1JUNA 5KTBA 4Y99C 3I5CA 2P67A 1NKZB 3A2AA 2N1TC 3RL0C 1MZ9A 5AW6B 3H32B 2PP6A 1KILA 1S9KE 1DEBA 2FYZA 1LWUC 1LTSC 4GT1A 3T97A 1IFMA 2KOGA 2W6BA 5APXA 1SQVK 3R2PA 2HG5D 1W2EA 2FFDA 4HYTB 1SQXK 2KSJA 2HPCB 1WRGA 1LTJA 3NXSA 2O01H 2QM7A 2YKPA 5CCGD 4I1LA 3N4XA 2POHA 1T2KD 4LC1A 1JY2N 1CSBA 3VP9A 2WPQA 3E1IA 3MGNA 2Z5IA 1FZAA 4WY4A 3A5TA 3CL3D 1JY3P 1M7LA 1A02J 5AVZB 1SFCC 3M0DA 1T8ZA 4C7RA 3VOPA 4EIJA 1DH3A 3TNUB 1N73C 1RF0A 4AQRD 1G1IA 1KQLA 1SQQK 4JYBA 4O9BA 4JYCA 1PFIA 1FOSE 1FJKA 3U1CA 1RE3A 1GL2A 1M1JB 3HRNA 3P7KA 3L4FA 2FKWB 5KJ7D 1SQPK 3NTNA 2GM4A 2KYVA 1FZCA 1NWQA 3L35A 4HH2A 1M1JC 2HODA 1XTCC 1DX7A 1H88A 1KFMA 5AW5B 5AVRB 5CCGC 4AYCA 5BU5A 5AVVB 1T2KC 1T3UA 3GHGA 3VMZA 1VDFA 3B5ND 2YKQA 4IFDK 2KLVA 1ZV8A 3KYQA 2BASA 2GUVA 1N7SA 1HH0A 3TYYA 3KDPB 4N78D 4W7YA 4B86A 3IFMA 4DOJA 1IC2A 5CJ0A 1JCDA 3HE5B 1L4AD 3VP8A 1IFNA 2OYIB 4XE5B 1A02F 4GKGA 1N86A 1KILD 1X8YA 2YKOA 2L5GB 1NTKK 1JY3N 1JY2O 1LTAC 5CHXA 1Z56A 5KJ7C 4DZOA 2R5BA 2KP8A 2Q5UA 3CI9A 3KPEA 3MTUE 2E42A 3U1AA 1GDTA 5AW3B 1RF1A 1CI6B 4W80A 1N7LA 2E43A 1HWTC 2WPRA 3B5NC 3VTPC 1FZFA 3P8CE 3CLQA 4C7NB 3HE4A 2N1TA 2C0WA 4WY4D 5AVQB 2J59M 2PAJA 5APTA 2JEEA 5AVUB 1JCCA 1GD2E 1L4AC 1IFIA 2R5DA 5APYA 3OAKA 1LTTC 3NFQA 3O8ZA 2IX7C 1FOSF 1GK4A 3RK2D 1G2CB 1KILC 2Q7CA 3VN0A 2WT7A 3P32A 4OH8B 1ZR4A 3V2PA 4KHXA 1HTLC 4N6JA 3PP5A 1SFCB 2HPCA 2C0XA 1HUCA 5CMZA 3SWYA 2I1KA 5AW2B 2OYHB 1N73B 2HYNA 2J58A 1QL1A 3HUSB 3EFGA 1AQ5A 1JNMA 4EOTA 1LTIC 5AVTB 2GUSA 3HTKB 4WY4B 3G3ZA 2OYHC 1X9VA 1GTWA 5AVWB 4WB4A 1GZLA 3HUSC 1RE4A 3M91A 1AFOA 4C46A 1JMMA 4LGDE 3OA7A 1HJBA 1N7SD 3TSIA 4WY4C 1RY3A 5AVXB 3NMDA 1FJPA 4N3YB 3TNUA 1LT9B 3M0AA 3V4WA 1SQBK 1HGVA 1FZGA 1IFJA 3V2RA 5BVZA 3IR9A 2H8PD 1RE3C 1LT9C 2Q3IA 2IFMA 3A3YB 5APSA 1NO4A 3M9BA 3BVHA 5CCHA 2NPSD 2P7JA 2A45I 3L36A 1FZBA 3RK3D 3GHGB 1GW4A 3VMYA 1ZR2A 3BATA 1N7SB 4WBAA 2XNXA 2M8RA 3HD7D 2QM8A 2O1KA 1NTMK 3GHGC 4IFMA 2WTYA 4N78E 2IFNA 2R3CA 3M9HA 2YO3A 2Z5HA 2JJLA 4JF7A 2N1TD 1N7SC 1NKNA 4I6MC 3RL0D 3HE5A 4I2LC 1LTBC 2FYUK 1YTZT 2P1JA 2O1JA 1HBWA 2KB7P 2OARA 1JY2P 2OYIA 1JTHB 2N9BA 1URQA 2ZXEB 1YYCA 1JOCA 2C9NY 1ZLLA 2FXMA 2NPSB 3B5NB 1WT6A 1LGHB 2H43A 1L0NK 4RESB 1CZQA 1NTZK 2NPSC 3A7OA 1RF1B 3V2NA 2WWWA 1GU4A 1L4AB 3II6A 4M3LA 1VPCA 2HFED 5BU8B 3HD7B 3BASA 3SWFA 2WPSA 2A45G 1MV8A 1LWUA 3H6PA 1T3JA 1L0LK 1RF1C 1IO4A 1KILB 3TK1A 4C7NA 3HD7C 1S9KD 2Z4EA 3MD0A 2W6AA 5APWA 3H32A 2LKMA 3M9QA 1MFZA 1IJDB 1EQ7A 1CW5A 2CPBA 2FFDB 1GL2D 2MJZA 3M06A 1LTJB 1NAFA 1SVFA 2CPSA 3LIDA 1KFNA 1LTGC 2WT7B 2FFDC 5CJ4A 1GU5A 1G2CA 2R32A 3VYIA 4IFFA 1LTJC 3BRTB 3MIWA 1SLQA 2I1JA 2IPPA 1NH4A 1SFCA 1X79B 5CCHD 2XV5A 2OYHA 2H7HA 1IFDA 1N73A 4XA4A 3HUSA 4ZKUA 2WSCH 1IK9A 3HTKA 1JY3O 5AW9B 1G1JA 2Q9IA 1FZEA 3M0DC 2XZRA 3RK2B 3UIAA 1GL2B 1MUUA 3L37A 1RF0C 1NOHA 1M1JA 3OJAB 5APQA 1KZUB 1RE4C 3U59A 1QL2A 1FZCB 2C9LY 3RK2C 3LIEA 4ZKPA 1GL2C 2M3BA 5KLVK 3VMXA 2HODB 1H89A 5CCGA 1FDMA 1LT9A 4AUWA 1FAVA 2XKMA 1FZCC 2WZ7A 1URQD 1N2DC 5AW7B 4LLHA 1J1DB 5AW1B 3V2QA 3V5BA 1YTZI 5CCHC 3KQGA 5APUA 1J1DC 2P2UA 2XU6A 5AVSB 2YMYA 1HVVA 3P8MC 3LW5H 2XDJA 1XTGB 3WMM0 2A45H 5AW4B 2VRSA 5KJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFM A;  1IFM A;  1IFN A;  1QL2 A;  2XKM A;  2IFN A;  2KLV A;  2KSJ A;  2IFM A;  3IFM A;  1ZN5 A;  1QL1 A;  1PFI A; 
#chains in the Genus database with same CATH topology
 2QEX P;  1PGO A;  4D6T J;  5GTI H;  1RQV A;  4NPD A;  1LT1 A;  4W7Z A;  2FY8 A;  2OYI C;  1HGZ A;  1URQ C;  3MUD A;  3RK3 C;  2Q1K A;  1KQS O;  1SQQ J;  1J1E B;  4Y99 B;  1NU1 K;  1NTM E;  3HD7 A;  2ZT9 D;  2W27 A;  5AVY B;  5KTB A;  2J5U A;  1YJW P;  3I5C A;  2H88 C;  2K9J A;  1KIL A;  1LTS C;  5DJU B;  3R4Y A;  3FWL A;  2HG5 D;  1LP1 B;  3H1H D;  4RJT A;  4BRY A;  2YKP A;  1L0N E;  1NYH A;  4K35 A;  3N4X A;  2POH A;  2WPQ A;  3E1I A;  1Q86 Q;  3MGN A;  1VQP P;  2JWA A;  1DD3 A;  1VQ8 P;  2KI7 B;  1JY3 P;  1ZRT D;  3M0D A;  3TGU D;  1T8Z A;  4IL6 H;  1ZOY C;  4EIJ A;  2ZT9 C;  3S4R A;  1S5L E;  1KQL A;  4JYB A;  3G4S P;  1EXI A;  1M1J B;  2KYV A;  3CX5 H;  1NAY A;  2R3S A;  3S1K A;  5EFW B;  1H88 A;  1VQK P;  4D6T D;  5AVR B;  3Q2Y A;  4AYC A;  1VDF A;  3B5N D;  2YKQ A;  2M5A B;  1QVG O;  2YIU C;  3CCU P;  3KDP B;  4N78 D;  4PD4 I;  3IFM A;  1IC2 A;  1SQQ D;  1JCD A;  1L4A D;  2OYI B;  1A02 F;  4GKG A;  1N86 A;  2KSE A;  5KLV E;  5B5E H;  1YQ3 C;  2L5G B;  1JY3 N;  1KYO I;  1LTA C;  3L74 J;  3L75 G;  4XFJ A;  4DZO A;  3MTU E;  3KPE A;  1PZQ A;  1Y9B A;  4L75 A;  4W80 A;  1M90 Q;  2W6J H;  3B5N C;  4C7N B;  1W2B O;  2C0W A;  1FC2 C;  2FYU E;  3CXH I;  5APT A;  1JCC A;  3H1J J;  1L4A C;  2L91 A;  2R5D A;  1LTT C;  3NFQ A;  2IX7 C;  3RK2 D;  1G2C B;  2WT7 A;  2ZVN B;  1P84 E;  2Y9Z A;  2WSF J;  4KHX A;  1DEE G;  5E79 H;  3H1K G;  1EZV D;  3PP5 A;  5CMZ A;  2IBZ E;  1NTK G;  5AW2 B;  2ZT9 B;  3EFG A;  1NU1 E;  4EOT A;  1PPJ E;  3GW6 A;  1W5C E;  4RO0 A;  2OYH C;  1GZL A;  3G6E P;  1JMM A;  3OA7 A;  4K3A A;  3TSI A;  5AVX B;  1LJ2 A;  1IFP A;  1KOR A;  3TNU A;  4H0L B;  2RH0 A;  1BGY G;  1FZG A;  1IFJ A;  3V2R A;  4OGQ C;  2WVR A;  3GF3 A;  2R44 A;  3AE9 C;  2GA1 A;  3M9B A;  2NPS D;  4ASW A;  2D2C C;  1BE3 G;  3O6Q B;  2QJP C;  3L74 D;  3GHG B;  1IZN B;  3VMY A;  3V6I A;  3H1L G;  3BAT A;  4YXD C;  1N7S B;  2XNX A;  2WTY A;  2IFN A;  3WUV A;  2R3C A;  3M9H A;  3Q5S A;  2A06 G;  4H13 D;  3HE5 A;  2W90 A;  1TU3 F;  1JY2 P;  2ZXE B;  3H1J D;  4PD4 H;  1OVU A;  3B5N B;  2NPS C;  3D6Z A;  3A7O A;  3V2N A;  4UB8 E;  1L4A B;  1KB9 E;  2UWJ E;  2FYN C;  1KYO H;  1LWU A;  1L0L K;  4KJM A;  3TK1 A;  1MFT A;  2Z4E A;  1S9K D;  1PP9 E;  5APW A;  3H32 A;  2LKM A;  3M9Q A;  1Q2N A;  2CPB A;  4KT0 J;  1NTM G;  4PV1 D;  5M1B A;  1LTJ B;  1FDI A;  2CPS A;  3CCQ P;  1LTG C;  1AJY A;  5CJ4 A;  1GU5 A;  3CXH H;  1YHQ P;  1HF9 A;  1BCC E;  5CCH D;  2XV5 A;  2OYH A;  4IL6 X;  1L0N G;  2ZYD A;  3E7K A;  3H1K J;  2XZR A;  2CK3 H;  3RK2 B;  3UIA A;  1GL2 B;  3L37 A;  2PGD A;  1RF0 C;  5APQ A;  3U59 A;  1FZC B;  4PV1 C;  3D71 A;  3AEB C;  3WUT A;  1FAV A;  2QJK C;  2QVA A;  2WZ7 A;  3L70 J;  4Y28 J;  5AW7 B;  5GTH H;  2FXO A;  2JP3 A;  1J1D B;  1K73 Q;  3V2Q A;  4U7J A;  1BGY J;  5DJT B;  5CCH C;  3GLM A;  1EDI A;  2IZ1 A;  4MN4 C;  1SQX J;  2K37 A;  1IK7 A;  4BWN A;  5KAI E;  2NZ2 A;  1BE3 J;  4CPG A;  3L75 D;  2B87 A;  5KJ7 A;  1M56 D;  1SP4 A;  1OWA A;  1EDK A;  2HLO A;  3H1L J;  2V7Q H;  2ZFC A;  1ZN5 A;  1QEX A;  2FYN B;  1NHL A;  2KUB A;  2NPS A;  1P84 I;  3AE2 C;  5KLV G;  2WSE H;  1JMB A;  1FBM A;  2IBZ I;  2B89 A;  1H8A A;  3I55 P;  3HE4 B;  4H13 B;  1SFC D;  2WIT A;  2BEZ F;  1JO5 A;  1E5W A;  1J1E C;  4Y99 C;  3CCM P;  1NKZ B;  3A2A A;  2PP6 A;  1D7M A;  3T97 A;  1QLE D;  4L74 A;  1SQV K;  1SS1 A;  3H1K D;  3AE5 C;  1W2E A;  2FYU G;  1KYO D;  2KSJ A;  3NXS A;  3EWK A;  2YXQ B;  2QM7 A;  5CCG D;  3CWB J;  1Q90 D;  1Y8A A;  3VP9 A;  4JPZ B;  3AEC C;  1S5L H;  3CCV P;  1NTZ G;  3L70 D;  4WY4 A;  3BCC J;  1L0L E;  1M7L A;  1A02 J;  1SFC C;  2IBZ G;  4PV1 B;  3VOP A;  1BGY D;  1N73 C;  1RF0 A;  2KS1 B;  1PPJ G;  1SQQ K;  1PFI A;  1FOS E;  3U1C A;  1RE3 A;  1AVO A;  2ZXX A;  1SQX D;  2ITA A;  1L0N J;  2FKW B;  1SQP K;  1BE3 D;  2MKV A;  3AE6 C;  1M1J C;  2HOD A;  1QX8 A;  1OVV A;  4TLF A;  3H1L D;  5AW5 B;  2AEJ A;  5CCG C;  3RK3 E;  3CME P;  5AVV B;  3VMZ A;  3RL0 g;  2KLV A;  3MZW B;  1ZV8 A;  2A06 D;  2BAS A;  1OIP A;  1KB9 I;  1USE A;  4W7Y A;  2WMM A;  5C39 A;  4B86 A;  1EDL A;  1VQ9 P;  2ZJS E;  3FWN A;  1GMJ A;  4H44 D;  2YKO A;  5CHX A;  2E76 B;  2R5B A;  3PH0 A;  2KP8 A;  3FXD A;  3U1A A;  1AV1 A;  2PFX A;  5AW3 B;  1RF1 A;  3L72 G;  1HWT C;  3CWB D;  1SQB J;  1VQ6 P;  5AVQ B;  1P84 H;  2JEE A;  1GD2 E;  3BCC D;  3LW5 J;  1X0T A;  2IZ0 A;  1FOS F;  1X22 A;  1GK4 A;  1PP9 G;  4YTP C;  4H0L D;  4OH8 B;  1LP1 A;  1ZR4 A;  2K88 A;  3H1H E;  1HTL C;  4N6J A;  1YIT P;  3G71 P;  1SFC B;  2C0X A;  1L0N D;  1YJ9 P;  1N73 B;  2HYN A;  3PTZ A;  2KLU A;  3HUS B;  3PRJ A;  1JNM A;  1LTI C;  2FYU J;  3AE7 C;  1GTW A;  1BCC G;  1RE4 A;  1ZRT E;  3TGU E;  1N7S D;  2E5T A;  2E74 D;  1FJP A;  2LR2 A;  1SQV E;  3M0A A;  3V4W A;  1NTZ J;  5TJH A;  1YI2 P;  3IR9 A;  3AEG C;  3GMA A;  3FX0 A;  1YJN P;  2Q3I A;  1PV3 A;  4H0L C;  5APS A;  3WU2 E;  4DJG A;  2P7J A;  4D6T E;  3L36 A;  3PLN A;  1PL5 A;  2QM8 A;  4IFM A;  3GHG C;  2YMK A;  4N78 E;  1SQQ E;  2YO3 A;  2Z5H A;  2JJL A;  2N1T D;  1N7S C;  3RL0 D;  1SQB D;  3SFD C;  2E74 C;  3AE8 C;  2FBW C;  1QGK B;  2KB7 P;  2Y0E A;  1SQP E;  4UB8 H;  2OYI A;  3CC7 P;  1JTH B;  4HJG H;  1URQ A;  1YYC A;  5KLV D;  1KB9 H;  2FXM A;  4R4L A;  3H1I G;  1KV4 A;  5TIS E;  2WWW A;  2KIK A;  1OVR A;  5BU8 B;  1MV8 A;  1PGQ A;  4H44 B;  3H6P A;  1T3J A;  2QSI A;  2V4H A;  4C7N A;  2FYU D;  1MFZ A;  1JEK A;  3L72 J;  4U3F E;  2FFD B;  2JWD A;  1GL2 D;  1EXJ A;  3D6Y A;  1OMI A;  2KK7 A;  1NAF A;  1SVF A;  2WT7 B;  1NVO A;  1AA0 A;  1G2C A;  1K8A Q;  1NTZ D;  4IFF A;  1P84 D;  1LTJ C;  3MIW A;  1FE6 A;  1SLQ A;  1S5L X;  1EZV E;  2IPP A;  1NH4 A;  1OX3 A;  2IBZ D;  3S9O A;  2ZYA A;  1IFD A;  4XA4 A;  3CCJ P;  1PP9 J;  2B9B A;  3RBX A;  3CPW O;  1IK9 A;  1JY3 O;  3CMA P;  2LXB A;  1MUU A;  3OW2 O;  3Q5R A;  4WVZ A;  2OTK E;  1VQ4 P;  1L0L G;  3OJA B;  5KLI C;  2C9L Y;  3RK2 C;  1GL2 C;  1NGM B;  1FDM A;  4AUW A;  2XKM A;  1FZC C;  2ZAE B;  2M0B A;  4LLH A;  5KAI H;  2OQQ A;  3V5B A;  3CX5 D;  3L74 E;  3L73 E;  3O6Q A;  2E74 B;  5APU A;  1J1D C;  2P2U A;  2AXT E;  5AVS B;  5B66 E;  2YMY A;  2IYP A;  3WMM 0;  1ZP0 C;  3A0H E;  2VRS A;  1OW6 A;  2DW3 A;  3WUU A;  1OW7 A;  3C9I A;  2JO1 A;  3B8E B;  3L72 D;  2YO2 A;  3H1J E;  5AW0 B;  1GW3 A;  5APV A;  4ASV A;  3I56 P;  3B5N A;  3BRV B;  3W68 A;  3CD6 P;  2YNY A;  1CI6 A;  4JBZ A;  3L75 J;  3P8C D;  1GK6 A;  2N1T B;  3RL0 B;  3N7N A;  1L4A A;  1LWU B;  1R5L A;  3H1I J;  3EQ2 A;  4EI2 A;  1JUN A;  3ITK A;  2P67 A;  3JCU E;  4H13 C;  3H32 B;  1S9K E;  1PP9 D;  3IF4 A;  2WSS H;  4GT1 A;  2KOG A;  2W6B A;  5APX A;  1S72 P;  2PRR A;  1LNQ A;  1SQX K;  3L71 E;  2HPC B;  1WRG A;  1Q81 Q;  4GOD A;  1LTJ A;  2O01 H;  4PJ0 E;  4I1L A;  1VQ5 P;  1T2K D;  3F89 A;  4LC1 A;  1S2E A;  1JY2 N;  4UB6 E;  1HJ0 A;  2Z5I A;  3H1H G;  3AEF C;  1AVY A;  5KLI B;  3A5T A;  2QIW A;  5L8R J;  1S4X A;  5AVZ B;  1NTK J;  3MHV A;  4BXL A;  1FDO A;  1DH3 A;  3PJS K;  4GDO A;  4AQR D;  1BSN A;  4O9B A;  4JYC A;  1L2P A;  2OTL P;  2BCC E;  1GL2 A;  3HRN A;  3P7K A;  3TGU G;  3NTN A;  2FXP A;  2GM4 A;  1FZC A;  1NWQ A;  2ZYG A;  4HH2 A;  2OYO A;  3C1L A;  1XTC C;  1SQV G;  1KFM A;  2P58 A;  4Z1M H;  2AXC A;  2E76 D;  5BU5 A;  1L0L J;  1T2K C;  4IFD K;  1KTM A;  2GUV A;  5KKZ B;  4D6T G;  1ZW0 A;  1VQL P;  3VP8 A;  3H1I D;  1KD1 Q;  1KIL D;  4DCK A;  2O01 N;  1JY2 O;  5KAF E;  1Z56 A;  2IDB A;  2Q5U A;  1VQO P;  1SQP G;  1M1K Q;  2E76 C;  1EZV I;  4NPE A;  4PD4 D;  2RN0 A;  2E43 A;  4OVN F;  2WPR A;  1OFC X;  3VTP C;  1FZF A;  3MUD C;  1VF5 D;  3HE4 A;  1M8O B;  2PAJ A;  2G8Y A;  1IFI A;  3OAK A;  3O8Z A;  3T97 B;  1NTK D;  3SWK A;  1KIL C;  1H0T B;  2V7Q J;  2E75 D;  3V2P A;  4U3F G;  1NTM J;  1T6A A;  1HUC A;  3SWY A;  3JSV C;  1QL1 A;  2O3J A;  2WSE J;  1AQ5 A;  4EYY Q;  5AVT B;  2GUS A;  3HTK B;  4EDF A;  4WY4 B;  3CXH D;  3L70 E;  2KNC B;  3G3Z A;  4OWF A;  5AVW B;  1EZV G;  1NU1 G;  1Q82 Q;  1L0L D;  3HUS C;  1AFO A;  4LGD E;  1HJB A;  1RY3 A;  2K1A A;  1BGY E;  4N3Y B;  3IN6 A;  3WU2 H;  4HKZ H;  2KS1 A;  1LT9 B;  1SQB K;  2YXR B;  1HGV A;  1SQX E;  5BVZ A;  4DT0 A;  1KC8 Q;  3EFF K;  1BE3 E;  3QH9 A;  2IFM A;  3A3Y B;  2E75 C;  1NO4 A;  3BVH A;  5CCH A;  2LXC B;  1RH5 B;  3H1L E;  2KXP B;  1FZB A;  3RK3 D;  1GW4 A;  3CC2 P;  3VMA A;  3K5B A;  4I7Z C;  2K9Y A;  4WBA A;  2O1K A;  3A0B H;  3MP7 B;  1SQV J;  3L73 G;  4JF7 A;  1LTB C;  2FYU K;  5TIS H;  1YTZ T;  2P1J A;  1VL2 A;  2C9N Y;  4WWI A;  2W8Z A;  1CZQ A;  1NTZ K;  1RF1 B;  3KZI E;  1GU4 A;  1JB0 J;  3FGA D;  2HFE D;  3H1J G;  3HD7 B;  3BAS A;  3SWF A;  2WPS A;  1NTM D;  2XND H;  3CWB E;  5KLV J;  2K9J B;  1BDC A;  2Q6Q A;  1IO4 A;  1KIL B;  4HB1 A;  1SQP J;  4H44 C;  3BCC E;  3Q1M A;  1CW5 A;  2QE7 H;  3AE1 C;  1R8E A;  4BRY B;  1S1C X;  3LID A;  3AEA C;  2FFD C;  2QJY B;  1UII A;  2R32 A;  3VYI A;  3BRT B;  1VF5 B;  2I1J A;  1SFC A;  1M57 D;  1X79 B;  3L71 G;  2Y0D A;  1N73 A;  3HUS A;  4ZKU A;  2WSC H;  2Q3E A;  4U3F J;  1G1J A;  5CBN A;  1KMI Z;  2E75 B;  5H2F H;  1M1J A;  3LIE A;  1SQV D;  2M3B A;  1PIX A;  3VMX A;  5CCG A;  1NU1 J;  2JR8 A;  3QWO C;  4I7Z B;  2BCC G;  2AXT H;  5B66 H;  3TF5 A;  3AEE C;  5AW1 B;  1KQG B;  4IOI H;  3A0H H;  2M5A A;  1DD4 A;  3FXE A;  3KQG A;  4A7P A;  2XU6 A;  3ZDM A;  1HVV A;  2KZJ A;  3P8M C;  3AE4 C;  3GG2 A;  2XDJ A;  1XTG B;  2WSC J;  2W83 C;  3SFE C;  1RHZ B;  3A0B E;  1SQB E;  2NRG A;  3H25 A;  3KHU A;  4GIF A;  1URQ B;  1SQP D;  3RK3 B;  2WSF H;  1FU1 A;  1JTH A;  1J2J B;  3L73 J;  2IYO A;  3JCU H;  5GTI E;  5AW8 B;  2WPV B;  3KXD A;  3V4Q A;  1OXZ A;  1BSH A;  1MKM A;  2RMZ A;  2N1T C;  3RL0 C;  1MZ9 A;  5AW6 B;  3E1R A;  1DEB A;  2FYZ A;  4PJ0 H;  1LWU C;  1IFM A;  4U3F D;  3R2P A;  4UB6 H;  4JQ0 D;  2FFD A;  4HYT B;  1QVF O;  4OGQ D;  1VQ7 P;  3AE3 C;  1NTZ E;  1CSB A;  2D2C D;  1NU1 D;  1PPJ D;  1YIJ P;  3B71 A;  1FZA A;  3CL3 D;  4NPF X;  4C7R A;  1OZH A;  3TNU B;  3D70 A;  1G1I A;  1DIP A;  1FJK A;  3CCE P;  3L70 G;  3L71 J;  3USS A;  4GOE A;  1BCC J;  3L4F A;  4ZNC A;  5KJ7 D;  5H2F E;  4IL6 E;  3L35 A;  1DX7 A;  1NJI Q;  2YIU B;  3GF7 A;  3IAO A;  1SQX G;  1Y47 A;  1T3U A;  3GHG A;  1K04 A;  1AQT A;  3CCL P;  3CX5 E;  3KYQ A;  3L73 D;  2Y0C A;  1N7S A;  1HH0 A;  3TYY A;  2SPZ A;  2P10 A;  4DOJ A;  2BCC J;  5KAF H;  5CJ0 A;  3HE5 B;  1IFN A;  4XE5 B;  5KKZ C;  2OTJ P;  2RKL A;  1X8Y A;  1NTK K;  1ZME C;  5KJ7 C;  2ZVO B;  3CI9 A;  3L72 E;  2E42 A;  1GDT A;  2AEF A;  1KB9 D;  1CI6 B;  5B5E E;  1N7L A;  4TT3 H;  3P8C E;  3CLQ A;  2N1T A;  1PGP A;  4WY4 D;  3Q5P A;  2J59 M;  5AVU B;  5APY A;  1S3J A;  3CWB G;  5K5G B;  3SSU A;  1Q7Y Q;  3G9R A;  2Q7C A;  3VN0 A;  3P32 A;  3L71 D;  2HR3 A;  3BCC G;  2HPC A;  1BCC D;  1VQM P;  2I1K A;  2OYH B;  2QRX A;  2JKV A;  2J58 A;  3RBZ A;  3F5H A;  3CC4 P;  3C8V A;  5E79 E;  1X9V A;  4WB4 A;  3M91 A;  4C46 A;  5CBO A;  2K3R A;  4WY4 C;  4OGQ B;  2N9Y B;  3NMD A;  1VQN P;  2BCC D;  1YQ4 C;  2D2C B;  1RQU A;  2QJP B;  2H8P D;  1RE3 C;  1LT9 C;  2O01 J;  2A45 I;  2BEQ D;  2M3E A;  3Q3D A;  1ZR2 A;  4R4M A;  1BDD A;  2I8D A;  2M8R A;  3HD7 D;  1NTM K;  2B87 B;  3L75 E;  1U7J A;  1NKN A;  4I6M C;  1U7M A;  1JM0 A;  4I2L C;  1SQQ G;  2O1J A;  2JDI H;  1HBW A;  2OAR A;  3H1I E;  3KZI H;  1EDJ A;  2N9B A;  1YBK A;  1KIL E;  2AEM A;  1JOC A;  1PGJ A;  2QA4 P;  1ZLL A;  2NPS B;  1E79 H;  1WT6 A;  1LGH B;  2H43 A;  1SQB G;  1L0N K;  4RES B;  2QG4 A;  4RKU J;  3II6 A;  3W67 A;  4M3L A;  1VPC A;  4YPC A;  4PD4 E;  2A45 G;  4QMA A;  1K05 A;  1R5S A;  3PHL A;  1RF1 C;  3HD7 C;  3MD0 A;  2W6A A;  1KQF B;  3TDK A;  1IJD B;  1EQ7 A;  3JC2 2;  3H1K E;  3M06 A;  2MJZ A;  1KYO E;  1NTK E;  3B4S A;  1KFN A;  1OW8 A;  1U57 A;  2Y9Y A;  1EC5 A;  1H0T A;  2KZI A;  3AED C;  1FS0 E;  1WMK A;  1UIX A;  2QJY C;  1USD A;  4L73 A;  2OGU A;  3CCR P;  2H7H A;  1VF5 C;  4GOF A;  3RGU A;  3CX5 I;  3CXH E;  3HTK A;  5AW9 B;  2Q9I A;  1FZE A;  2KNC A;  3M0D C;  1KN7 A;  3H1H J;  4L76 A;  1K9M Q;  2QJK B;  1NOH A;  1KZU B;  1RE4 C;  1QL2 A;  2G3A A;  3ABV C;  4ZKP A;  5KLV K;  2HOD B;  1H89 A;  1LT9 A;  1ZXG A;  3CCS P;  1URQ D;  1N2D C;  4YXW H;  2E5Y A;  3TGU J;  2WQY C;  2A06 E;  1YTZ I;  1N8R Q;  3L74 G;  5GTH E;  3LW5 H;  2A45 H;  2B88 A;  5AW4 B;  4ZMD A;  2H89 C; 
#chains in the Genus database with same CATH homology
 1SP4 A;  1OWA A;  2HLO A;  4GIF A;  2ZFC A;  1URQ B;  3RK3 B;  3C9I A;  1ZN5 A;  2WSF H;  3B8E B;  1FU1 A;  2YO2 A;  1JTH A;  5AW0 B;  1J2J B;  1GW3 A;  1NHL A;  5APV A;  4W7Z A;  2NPS A;  3B5N A;  2OYI C;  1HGZ A;  1URQ C;  3BRV B;  3MUD A;  3RK3 C;  2WSE H;  2YNY A;  1CI6 A;  1FBM A;  5AW8 B;  1J1E B;  3V4Q A;  1H8A A;  3P8C D;  1GK6 A;  4Y99 B;  3HE4 B;  1NU1 K;  2N1T B;  3RL0 B;  1SFC D;  1OXZ A;  2WIT A;  3N7N A;  1L4A A;  1JO5 A;  1LWU B;  3HD7 A;  1E5W A;  2W27 A;  1J1E C;  3EQ2 A;  5AVY B;  1JUN A;  5KTB A;  4Y99 C;  3I5C A;  2P67 A;  1NKZ B;  3A2A A;  2N1T C;  3RL0 C;  1MZ9 A;  5AW6 B;  3H32 B;  2PP6 A;  1KIL A;  1S9K E;  1DEB A;  2FYZ A;  1LWU C;  1LTS C;  4GT1 A;  3T97 A;  1IFM A;  2KOG A;  2W6B A;  5APX A;  1SQV K;  3R2P A;  2HG5 D;  1W2E A;  2FFD A;  4HYT B;  1SQX K;  2KSJ A;  2HPC B;  1WRG A;  1LTJ A;  3NXS A;  2O01 H;  2QM7 A;  2YKP A;  5CCG D;  4I1L A;  3N4X A;  2POH A;  1T2K D;  4LC1 A;  1JY2 N;  1CSB A;  3VP9 A;  2WPQ A;  3E1I A;  3MGN A;  2Z5I A;  1FZA A;  4WY4 A;  3A5T A;  3CL3 D;  1JY3 P;  1M7L A;  1A02 J;  5AVZ B;  1SFC C;  3M0D A;  1T8Z A;  4C7R A;  3VOP A;  4EIJ A;  1DH3 A;  3TNU B;  1N73 C;  1RF0 A;  4AQR D;  1G1I A;  1KQL A;  1SQQ K;  4JYB A;  4O9B A;  4JYC A;  1PFI A;  1FOS E;  1FJK A;  3U1C A;  1RE3 A;  1GL2 A;  1M1J B;  3HRN A;  3P7K A;  3L4F A;  2FKW B;  5KJ7 D;  1SQP K;  3NTN A;  2GM4 A;  2KYV A;  1FZC A;  1NWQ A;  3L35 A;  4HH2 A;  1M1J C;  2HOD A;  1XTC C;  1DX7 A;  1H88 A;  1KFM A;  5AW5 B;  5AVR B;  5CCG C;  4AYC A;  5BU5 A;  5AVV B;  1T2K C;  1T3U A;  3GHG A;  3VMZ A;  1VDF A;  3B5N D;  2YKQ A;  4IFD K;  2KLV A;  1ZV8 A;  3KYQ A;  2BAS A;  2GUV A;  1N7S A;  1HH0 A;  3TYY A;  3KDP B;  4N78 D;  4W7Y A;  4B86 A;  3IFM A;  4DOJ A;  1IC2 A;  5CJ0 A;  1JCD A;  3HE5 B;  1L4A D;  3VP8 A;  1IFN A;  2OYI B;  4XE5 B;  1A02 F;  4GKG A;  1N86 A;  1KIL D;  1X8Y A;  2YKO A;  2L5G B;  1NTK K;  1JY3 N;  1JY2 O;  1LTA C;  5CHX A;  1Z56 A;  5KJ7 C;  4DZO A;  2R5B A;  2KP8 A;  2Q5U A;  3CI9 A;  3KPE A;  3MTU E;  2E42 A;  3U1A A;  1GDT A;  5AW3 B;  1RF1 A;  1CI6 B;  4W80 A;  1N7L A;  2E43 A;  1HWT C;  2WPR A;  3B5N C;  3VTP C;  1FZF A;  3P8C E;  3CLQ A;  4C7N B;  3HE4 A;  2N1T A;  2C0W A;  4WY4 D;  5AVQ B;  2J59 M;  2PAJ A;  5APT A;  2JEE A;  5AVU B;  1JCC A;  1GD2 E;  1L4A C;  1IFI A;  2R5D A;  5APY A;  3OAK A;  1LTT C;  3NFQ A;  3O8Z A;  2IX7 C;  1FOS F;  1GK4 A;  3RK2 D;  1G2C B;  1KIL C;  2Q7C A;  3VN0 A;  2WT7 A;  3P32 A;  4OH8 B;  1ZR4 A;  3V2P A;  4KHX A;  1HTL C;  4N6J A;  3PP5 A;  1SFC B;  2HPC A;  2C0X A;  1HUC A;  5CMZ A;  3SWY A;  2I1K A;  5AW2 B;  2OYH B;  1N73 B;  2HYN A;  2J58 A;  1QL1 A;  3HUS B;  3EFG A;  1AQ5 A;  1JNM A;  4EOT A;  1LTI C;  5AVT B;  2GUS A;  3HTK B;  4WY4 B;  3G3Z A;  2OYH C;  1X9V A;  1GTW A;  5AVW B;  4WB4 A;  1GZL A;  3HUS C;  1RE4 A;  3M91 A;  1AFO A;  4C46 A;  1JMM A;  4LGD E;  3OA7 A;  1HJB A;  1N7S D;  3TSI A;  4WY4 C;  1RY3 A;  5AVX B;  3NMD A;  1FJP A;  4N3Y B;  3TNU A;  1LT9 B;  3M0A A;  3V4W A;  1SQB K;  1HGV A;  1FZG A;  1IFJ A;  3V2R A;  5BVZ A;  3IR9 A;  2H8P D;  1RE3 C;  1LT9 C;  2Q3I A;  2IFM A;  3A3Y B;  5APS A;  1NO4 A;  3M9B A;  3BVH A;  5CCH A;  2NPS D;  2P7J A;  2A45 I;  3L36 A;  1FZB A;  3RK3 D;  3GHG B;  1GW4 A;  3VMY A;  1ZR2 A;  3BAT A;  1N7S B;  4WBA A;  2XNX A;  2M8R A;  3HD7 D;  2QM8 A;  2O1K A;  1NTM K;  3GHG C;  4IFM A;  2WTY A;  4N78 E;  2IFN A;  2R3C A;  3M9H A;  2YO3 A;  2Z5H A;  2JJL A;  4JF7 A;  2N1T D;  1N7S C;  1NKN A;  4I6M C;  3RL0 D;  3HE5 A;  4I2L C;  1LTB C;  2FYU K;  1YTZ T;  2P1J A;  2O1J A;  1HBW A;  2KB7 P;  2OAR A;  1JY2 P;  2OYI A;  1JTH B;  2N9B A;  1URQ A;  2ZXE B;  1YYC A;  1JOC A;  2C9N Y;  1ZLL A;  2FXM A;  2NPS B;  3B5N B;  1WT6 A;  1LGH B;  2H43 A;  1L0N K;  4RES B;  1CZQ A;  1NTZ K;  2NPS C;  3A7O A;  1RF1 B;  3V2N A;  2WWW A;  1GU4 A;  1L4A B;  3II6 A;  4M3L A;  1VPC A;  2HFE D;  5BU8 B;  3HD7 B;  3BAS A;  3SWF A;  2WPS A;  2A45 G;  1MV8 A;  1LWU A;  3H6P A;  1T3J A;  1L0L K;  1RF1 C;  1IO4 A;  1KIL B;  3TK1 A;  4C7N A;  3HD7 C;  1S9K D;  2Z4E A;  3MD0 A;  2W6A A;  5APW A;  3H32 A;  2LKM A;  3M9Q A;  1MFZ A;  1IJD B;  1EQ7 A;  1CW5 A;  2CPB A;  2FFD B;  1GL2 D;  2MJZ A;  3M06 A;  1LTJ B;  1NAF A;  1SVF A;  2CPS A;  3LID A;  1KFN A;  1LTG C;  2WT7 B;  2FFD C;  5CJ4 A;  1GU5 A;  1G2C A;  2R32 A;  3VYI A;  4IFF A;  1LTJ C;  3BRT B;  3MIW A;  1SLQ A;  2I1J A;  2IPP A;  1NH4 A;  1SFC A;  1X79 B;  5CCH D;  2XV5 A;  2OYH A;  2H7H A;  1IFD A;  1N73 A;  4XA4 A;  3HUS A;  4ZKU A;  2WSC H;  1IK9 A;  3HTK A;  1JY3 O;  5AW9 B;  1G1J A;  2Q9I A;  1FZE A;  3M0D C;  2XZR A;  3RK2 B;  3UIA A;  1GL2 B;  1MUU A;  3L37 A;  1RF0 C;  1NOH A;  1M1J A;  3OJA B;  5APQ A;  1KZU B;  1RE4 C;  3U59 A;  1QL2 A;  1FZC B;  2C9L Y;  3RK2 C;  3LIE A;  4ZKP A;  1GL2 C;  2M3B A;  5KLV K;  3VMX A;  2HOD B;  1H89 A;  5CCG A;  1FDM A;  1LT9 A;  4AUW A;  1FAV A;  2XKM A;  1FZC C;  2WZ7 A;  1URQ D;  1N2D C;  5AW7 B;  4LLH A;  1J1D B;  5AW1 B;  3V2Q A;  3V5B A;  1YTZ I;  5CCH C;  3KQG A;  5APU A;  1J1D C;  2P2U A;  2XU6 A;  5AVS B;  2YMY A;  1HVV A;  3P8M C;  3LW5 H;  2XDJ A;  1XTG B;  3WMM 0;  2A45 H;  5AW4 B;  2VRS A;  5KJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...