2IFMA

Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 angstroms resolution x-ray fibre diffraction data
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF1 FILAMENTOUS BACTERIOPHAGE
publication title Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre diffraction data.
pubmed doi rcsb
molecule tags Virus
total genus 17
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1995-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ifmA00
1QL2A 2IFMA 1IFNA 3IFMA 2KLVA 2IFNA 1PFIA 1IFMA 2XKMA 1ZN5A 2KSJA 4IFMA 1QL1A
chains in the Genus database with same CATH superfamily
2YKPA 1NTMD 2W6BA 1JTHB 2V4HA 3L74J 3HD7D 5KJ7C 2FY8A 1H0TB 4H13C 3L74G 3V5BA 1W2EA 4H44B 4ZNCA 2KLUA 3L36A 1LTIC 1KFMA 4N6JA 1PIXA 1MV8A 1L0NK 2XZRA 1N8RQ 4L74A 2OYHC 5KTBA 3AE2C 3BASA 2B87A 1EC5A 2YMYA 2RH0A 1EZVD 1ZR2A 2IZ1A 1FBMA 1FJPA 1Y47A 5GTHE 2E76D 2WPSA 1VDFA 2WPVB 3V2PA 3H1ID 5CMZA 2R5DA 3TF5A 1DH3A 1FDIA 4KHXA 1DD3A 3MD0A 1LTJA 1HWTC 2QM7A 1KILB 3IR9A 1NU1D 2CPSA 1W5CE 3TDKA 1BSNA 1QVGO 1H8AA 3KHUA 5KJ7A 4GOFA 3GF7A 4IFDK 2R3CA 1OWAA 3MTUE 2WPQA 2IBZE 2OYHA 1CW5A 1EQ7A 5CBNA 1BDDA 2JKVA 2FYUK 3CX5D 2A06G 2R32A 1PL5A 3AE9C 2QG4A 1NTZE 5E79E 3A0BE 1JB0J 1K73Q 2VRSA 3LW5H 2L5GB 1KYOI 1L0LJ 2NZ2A 3RK3E 2E74B 2W90A 1SQBK 2YIUC 2M3BA 3KPEA 1GL2C 2K88A 1L0LG 1FE6A 2YXQB 2BASA 3MHVA 2QJKC 1OX3A 3FX0A 2ZT9B 2XDJA 3CXHD 3GF3A 1DEBA 2YMKA 4WWIA 1ZN5A 5CCGD 1KB9D 2MJZA 1S9KE 4N3YB 4GDOA 1K9MQ 3A0HH 1L4AD 1QVFO 4LGDE 3FWNA 3CXHE 4H0LD 3H32B 4XA4A 3O6QB 4IL6X 3V4QA 1RY3A 1X0TA 2N9BA 2P2UA 1URQC 4PD4E 2M5AB 1M7LA 3AEFC 2M3EA 3TYYA 3C1LA 1NYHA 3PHLA 1HVVA 4OGQD 4C7NB 1S72P 3MGNA 5DJUB 1JCCA 2JP3A 2Q6QA 5APXA 1GL2A 1OFCX 1G2CA 1SQQG 3I55P 4OH8B 3NMDA 2O01N 2SPZA 5CJ0A 1AQ5A 2AEJA 3CCSP 3BCCJ 1Q82Q 4EYYQ 1HTLC 3IN6A 3BCCG 5B66E 3HD7C 4I1LA 1T3JA 3T97A 1GW3A 1YI2P 3RBXA 1JUNA 1NTKK 1NGMB 1MUUA 3B5ND 2J59M 5L8RJ 2XNXA 3PJSK 1L0LE 2FYUJ 2NPSB 2QE7H 1S5LX 1KYOH 1MZ9A 5TJHA 3FGAD 1SQXD 3KXDA 2JR8A 3LW5J 3PP5A 2K9JB 5AVQB 2C9LY 1SQBJ 2QJPB 1FAVA 4C7RA 2WSFH 2IBZI 1SQBG 1VQNP 3CWBJ 4H44D 1VQ5P 1OMIA 1L0NE 3TGUD 1J1DB 2ZVOB 2HPCB 3H1JD 1HJ0A 3HD7A 4YPCA 4R4MA 3S1KA 1FOSF 2QSIA 1USEA 1RF0C 1XTCC 5GTIH 3IF4A 1QEXA 1R8EA 2J5UA 3D6ZA 1LT9C 1J1EB 1SQPJ 2H7HA 2OQQA 1LTSC 1SQPG 1IFMA 3B4SA 3UIAA 3OA7A 3BCCE 1KILD 3G3ZA 3SSUA 1SVFA 2UWJE 3C8VA 1LTAC 1LTTC 1FDOA 4PD4I 2IYPA 2GUVA 3M06A 1KILE 5KLVD 5CCGC 1JY3N 1UIXA 3RBZA 3AECC 1IJDB 2FYUE 3JSVC 5AVWB 4QMAA 3HE4A 1KORA 1GD2E 1H88A 2JJLA 2KP8A 3IFMA 4UB8H 5AVRB 4PV1B 1PPJG 2ZFCA 4H0LC 3AE6C 1WRGA 5KLVE 1SLQA 2KI7B 2XU6A 2LXBA 5APVA 1SQBE 1LT9A 1BGYG 2HODA 2E74D 2P58A 3CLQA 3CCMP 1IFDA 1AA0A 4OGQC 3CWBE 1VQMP 2ZT9D 1X79B 2AEFA 3AEDC 1UIIA 5E79H 2KXPB 3A0BH 3N7NA 3FWLA 3A0HE 4D6TJ 2H43A 1HUCA 4U3FG 4D6TG 1JY2N 2M8RA 2P7JA 3HE5A 5CCGA 2WT7A 3RK2B 3L70D 3SWKA 1YJ9P 4TT3H 4Y28J 2WITA 1CI6B 1L4AA 2WTYA 1XTGB 3D70A 1VQKP 2Y0DA 3EWKA 1BE3D 1E79H 3H1KD 2QJYC 3B5NC 3CCEP 4PJ0H 4JBZA 2I1KA 1HGVA 4AYCA 3HRNA 5H2FH 3U59A 3A3YB 1MFTA 1EDIA 1AQTA 1NKNA 3P8CD 4HYTB 1JM0A 1K05A 1NKZB 5AW5B 1BE3E 4IFFA 1P84H 1MFZA 1Z56A 4UB6H 3PRJA 3L72D 2N1TB 2W6JH 3CMEP 4I6MC 3A7OA 3MP7B 3CL3D 1KYOD 2WSCH 3L71E 3MZWB 4JQ0D 1LTBC 2H88C 4H44C 3P8MC 3H1HJ 1NTMG 3N4XA 1NTKE 2YKOA 5B5EE 3RL0g 4GOEA 1YTZI 1PGPA 1KN7A 1YIJP 1HBWA 3H1HG 3WUUA 4Y99B 3WUTA 1NAYA 1KQSO 1KYOE 2NPSD 3QWOC 3LIEA 1FZGA 2QVAA 2KB7P 3B5NA 4LC1A 1AVYA 2LXCB 2YNYA 1T3UA 5KKZB 5AVSB 4D6TE 1EZVG 1LGHB 3H6PA 4NPEA 3G71P 1KILC 1NO4A 1A02J 4B86A 1SFCB 1JOCA 1KV4A 2O3JA 3TNUB 1JTHA 1Y9BA 2E5TA 2AXCA 2O1KA 3GMAA 1H0TA 3A5TA 1NU1G 5GTIE 3CC4P 1N73B 2JEEA 1PP9E 2CPBA 4XFJA 2E75B 1ZP0C 4JYCA 5APYA 2AXTH 3HTKB 3L75E 1N7SB 3AE7C 2KZIA 2I1JA 3M0DC 1T6AA 3SFEC 1ZMEC 4BWNA 1DD4A 2E74C 1YITP 1RHZB 1NAFA 3PTZA 2P67A 4DT0A 4JYBA 1MKMA 4DCKA 1NH4A 2ZT9C 3LIDA 1KILA 4A7PA 1CSBA 1SQQK 2HG5D 2WSCJ 4UB8E 2LR2A 2FXPA 2WVRA 1GZLA 1KQLA 2IBZD 2RMZA 4PV1D 3U1AA 4TLFA 1ZW0A 3OW2O 2QEXP 1Q90D 1NTZD 2FYNB 1X9VA 2D2CB 3L73J 1Y8AA 2W8ZA 1FZEA 1LTJB 3CPWO 3L73G 3EQ2A 2ZXEB 3RK3D 3M0DA 1OXZA 1DEEG 1LNQA 5AW8B 1ZRTD 1OIPA 1YTZT 4W80A 1TU3F 3F5HA 1JCDA 1M1KQ 4I2LC 4GKGA 2ZVNB 5CBOA 3RGUA 1S9KD 3L74E 1Q86Q 2OYHB 1ZRTE 2M0BA 2G3AA 3CCVP 5APUA 1W2BO 1M1JB 1S2EA 1NVOA 3GW6A 3G9RA 4PD4D 3BATA 3H32A 4PJ0E 2KS1A 2KLVA 3O6QA 2R3SA 3L35A 5H2FE 2M5AA 4ASWA 2NPSC 1X8YA 3G6EP 1NHLA 3I5CA 2FXOA 2K3RA 1P84E 2R5BA 4UB6E 4C7NA 2RKLA 4L73A 2IDBA 2N1TD 1SQPK 2QJPC 1QL2A 1D7MA 5AW7B 1KQGB 5AW3B 4GIFA 1RQUA 2WSEJ 1VF5B 1EDLA 3CCUP 1SQQJ 3F89A 1FJKA 1J1DC 4K35A 2H89C 1FZBA 1G1IA 3TGUJ 3AEBC 1RF1B 3TGUG 2OYIB 1VQ6P 3H1LJ 2ZAEB 1L0LD 2A06E 3H1LG 3H1JG 1FOSE 3KZIH 1N86A 3CCLP 2YIUB 1KTMA 2NPSA 1J1EC 1G2CB 2K37A 5B5EH 1OVRA 1SQVK 1S4XA 2WZ7A 2K9JA 5AVTB 1JY3O 1L0ND 1HGZA 3USSA 1VQPP 1K04A 1OVVA 2E76C 5BU8B 2IFMA 3E1RA 5CJ4A 1URQB 1FDMA 2AXTE 2HPCA 2HYNA 1BCCJ 1HJBA 1ZR4A 2JDIH 5APTA 1BCCG 4PV1C 1N7SD 4GODA 3Q5SA 1JEKA 1QLED 1T2KD 2KYVA 3NTNA 4RESB 2JWAA 3S4RA 5APSA 3BCCD 3RK3C 2Q3EA 1SQQE 1LWUB 4M3LA 4EDFA 1JY2O 2WPRA 3SWFA 3D6YA 3B71A 1IK9A 1PZQA 3GHGB 4KT0J 1KD1Q 4EIJA 2Q5UA 1OW7A 2FYUD 3AEGC 2WQYC 3WU2E 5BVZA 1P84I 2E42A 1NTMK 3Q1MA 1R5LA 2WMMA 2D2CD 3RL0B 2Y0CA 3P32A 1SQBD 1U57A 3L70G 2JWDA 2HLOA 1U7MA 1L4AC 3CWBD 2Q9IA 3HUSC 1BGYJ 3H1KG 1FZCC 1SQVJ 3P7KA 3JCUE 4L75A 2KZJA 1SQVG 3Q5PA 2N1TC 1BCCE 3M91A 1LJ2A 1OW8A 3L72G 1VQ7P 4U3FJ 4KJMA 3OAKA 3V2NA 5AW2B 1NU1K 1PGOA 4Y99C 3CI9A 1CI6A 1FC2C 1FZFA 2BCCJ 4BRYA 1J2JB 3I56P 1SQPE 2Z5IA 2BCCG 5AVYB 4AQRD 2Q7CA 3PH0A 5KKZC 1VQ4P 3CX5H 2A45G 3HUSA 3QH9A 3Q2YA 1FZCA 1JO5A 1FS0E 4O9BA 1IO4A 1VF5D 3L71D 1NOHA 1IC2A 1PGJA 2N1TA 3W68A 4ZKUA 2YXRB 4GT1A 1NTKD 1OZHA 1ZLLA 2RN0A 1NJIQ 2PP6A 4EI2A 1G1JA 2C0WA 2NRGA 3K5BA 1PPJE 3KZIE 3MUDC 1NTMJ 2WSSH 1KFNA 1RE3C 1KB9H 1L2PA 3VMAA 5APQA 3V4WA 1IFNA 4OGQB 4BXLA 1BGYE 1N7SC 1SQVE 1T2KC 4WY4B 4D6TD 1EXIA 3AE4C 1M90Q 3M9QA 2KNCB 3W67A 2FKWB 4U3FE 1E5WA 3KDPB 1VQLP 2R44A 4OWFA 3H1IJ 5CCHD 1PP9D 3NFQA 3H1IG 2DW3A 5KLIB 1ZOYC 5KAFH 2E43A 1YBKA 1WT6A 2BCCE 2W6AA 2V7QJ 5AW4B 1NU1J 3MUDA 2P10A 3AE5C 5AVVB 3L75D 2FFDB 1RE3A 2J58A 2IBZG 2FYNC 1SS1A 5AVUB 2D2CC 1DIPA 1N7SA 1BSHA 1N7LA 4NPDA 1NTZG 4RJTA 1VQOP 1LP1B 1GMJA 2WWWA 2ZXXA 1WMKA 3H1HD 1JY3P 2POHA 2PAJA 3H25A 4WB4A 1JMBA 1VL2A 2FXMA 1SQXK 2JO1A 2I8DA 4IOIH 1NTME 2IPPA 3II6A 5APWA 1GW4A 2BEQD 2C9NY 2GA1A 3V6IA 1M1JC 5C39A 3H1HE 2ZJSE 3KYQA 2YKQA 2WSEH 3TK1A 3VMYA 3ITKA 5TISH 3RL0D 1GK6A 4JPZB 4LLHA 2FBWC 3OJAB 4I7ZB 2GUSA 2YO3A 3L37A 2B87B 4XE5B 4DZOA 3EFFK 1AV1A 2QRXA 3BRTB 2YO2A 4Z1MH 3L4FA 3WU2H 2KUBA 1EZVE 4JF7A 5CHXA 1RH5B 2W27A 1JY2P 2QIWA 4K3AA 3H1IE 3L74D 1EXJA 1VF5C 1NU1E 2OGUA 4H13B 2L91A 1JNMA 3EFGA 1M57D 1M1JA 1NWQA 3CCQP 1AVOA 3VP8A 1RF1C 3Q3DA 1U7JA 3JCUH 2OYIC 2Q3IA 1RQVA 1EDKA 1GTWA 3RK2D 4U7JA 1HF9A 1IK7A 5KLVK 1GU5A 2OYOA 3ABVC 3FXEA 1P84D 3CX5E 3B8EB 1PV3A 3C9IA 1HH0A 1AJYA 1FZAA 2HFED 2XV5A 5AW9B 4EOTA 2Z4EA 2ZYDA 4IL6H 4HKZH 2N9YB 3CMAP 1KC8Q 5M1BA 3CCRP 2PRRA 3V2RA 1X22A 2A45I 2O01H 3M9BA 1SQXJ 3VTPC 1L0NJ 2KS1B 3D71A 3L73D 1SQXG 1KB9E 1L0NG 4AUWA 1PFIA 3WMM0 3M0AA 1K8AQ 2A06D 5CCHC 1IFJA 4HH2A 1RF1A 1A02F 2OYIA 2B9BA 3AEEC 2PFXA 4L76A 3L73E 2GM4A 3BRVB 4WY4D 3H1JJ 5AW6B 1YYCA 3U1CA 3VYIA 3VMZA 3VN0A 1GL2B 1LWUC 2QJKB 1DX7A 2ITAA 1EDJA 3AEAC 3AE1C 3GHGC 1BDCA 1N2DC 2IFNA 5KAFE 2BEZF 3IAOA 1SFCD 2CK3H 1S5LH 3CCJP 3T97B 2IYOA 3AE3C 1EZVI 1URQA 5CCHA 5BU5A 4WVZA 2FYUG 3G4SP 3RL0C 2E75D 1KZUB 2IX7C 3NXSA 4YTPC 5KLVJ 4WBAA 2AEMA 4HJGH 3MIWA 5KLVG 5AVZB 5EFWB 1R5SA 1SQQD 2XKMA 1OW6A 5KAIH 2XNDH 5AVXB 1SQXE 3E7KA 2K9YA 3CWBG 1LWUA 2A45H 1S1CX 3KQGA 3H1LD 3R4YA 5TISE 3GHGA 2O01J 3CX5I 2KIKA 1YQ4C 3S9OA 3TGUE 3HD7B 2OARA 3H1LE 3H1JE 3VP9A 5DJTB 4IFMA 2OTKE 2Y9ZA 4RKUJ 2IZ0A 1RE4C 3RK2C 4HB1A 2Y9YA 3Q5RA 3CXHI 3O8ZA 3L70J 1KB9I 3CD6P 3R2PA 1M56D 2E76B 2KOGA 1IFIA 3JC22 1BCCD 2HR3A 1BE3J 5GTHH 4W7ZA 3H1KJ 2Z5HA 5KJ7D 4H13D 1BE3G 4OVNF 2B89A 1VQ9P 1Q81Q 1IFPA 1QGKB 3L71J 1KQFB 3V2QA 1H89A 3L71G 1RF0A 3HE4B 1PGQA 1NTKJ 4N78D 3L72J 1NTKG 1USDA 1GDTA 1YQ3C 1LTGC 2V7QH 3RK3B 1FU1A 1SQPD 5AW1B 2W83C 1LT9B 1RE4A 2HODB 4N78E 3WUVA 3VMXA 2G8YA 2E5YA 4WY4C 4ZKPA 4IL6E 3E1IA 2WSFJ 3A2AA 4ASVA 1NTZK 1CZQA 4RO0A 1GU4A 3M9HA 1KMIZ 1OVUA 4MN4C 5AW0B 2LKMA 3VOPA 2MKVA 1PPJD 3HE5B 1SFCC 2WT7B 1YHQP 3FXDA 5KLIC 4BRYB 1PP9J 3SFDC 1L4AB 1PP9G 4YXDC 1BGYD 4H0LB 2FFDC 3L70E 2OTJP 1N73C 1SQVD 1QL1A 3CXHH 3HUSB 3L75J 3GLMA 2E75C 5K5GB 2KK7A 3SWYA 1FZCB 1ZV8A 3L75G 2Q1KA 1ZXGA 4PD4H 2ZYAA 3H1KE 1GL2D 4WY4A 1VQ8P 1SP4A 1Q7YQ 4U3FD 1VPCA 3P8CE 2O1JA 2KNCA 1Q2NA 4YXWH 1S5LE 4DOJA 3CC2P 2B88A 4R4LA 3L72E 1IZNB 4CPGA 3TSIA 4W7YA 1LT1A 3ZDMA 2BCCD 3GG2A 2KSJA 3PLNA 2KSEA 1SFCA 1URQD 2PGDA 3TNUA 5B66H 1YJNP 2H8PD 1S3JA 4I7ZC 4ZMDA 2P1JA 2FFDA 1YJWP 4NPFX 1N73A 2QJYB 3B5NB 5KAIE 1JMMA 1AFOA 2QM8A 4DJGA 2OTLP 1QX8A 2Y0EA 1L0LK 3CC7P 4C46A 2C0XA 1GK4A 1T8ZA 1LP1A 2ZYGA 3HTKA 1NTZJ 3AE8C 1LTJC 2FYZA 2QA4P 3BVHA 1M8OB 2K1AA
chains in the Genus database with same CATH topology
2P7JA 2YKPA 3HE5A 1T2KD 1HH0A 2KYVA 2W6BA 5CCGA 3NTNA 1JTHB 4RESB 2WT7A 1FZAA 3RK2B 2HFED 3HD7D 5KJ7C 2XV5A 3V5BA 5AW9B 4EOTA 1W2EA 2Z4EA 2WITA 5APSA 1CI6B 1L4AA 2WTYA 1XTGB 3L36A 1LTIC 1KFMA 4N6JA 1MV8A 1L0NK 3RK3C 2XZRA 3V2RA 2A45I 2OYHC 3B5NC 2O01H 3M9BA 1LWUB 4M3LA 3VTPC 5KTBA 1JY2O 2I1KA 1HGVA 2WPRA 4AYCA 3SWFA 3BASA 3HRNA 4AUWA 3U59A 1PFIA 3WMM0 3A3YB 3M0AA 2YMYA 5CCHC 1IK9A 1IFJA 3GHGB 1NKNA 3P8CD 4HYTB 4HH2A 1RF1A 1NKZB 4EIJA 1ZR2A 1A02F 2Q5UA 5AW5B 1FBMA 4IFFA 2OYIA 1MFZA 1Z56A 1FJPA 2N1TB 2WPSA 1VDFA 4I6MC 3V2PA 5BVZA 2E42A 2GM4A 3BRVB 3A7OA 1NTMK 2R5DA 5CMZA 1DH3A 4WY4D 3CL3D 4KHXA 2WSCH 3MD0A 5AW6B 1LTJA 1HWTC 1YYCA 3U1CA 3RL0B 3VYIA 1LTBC 1KILB 2QM7A 3P8MC 3IR9A 3N4XA 3P32A 2YKOA 2CPSA 3VMZA 1YTZI 1HBWA 3VN0A 1GL2B 1H8AA 4Y99B 2HLOA 1LWUC 1L4AC 5KJ7A 1DX7A 2Q9IA 2NPSD 4IFDK 2R3CA 3GHGC 3HUSC 3LIEA 1OWAA 1N2DC 2IFNA 3MTUE 1FZGA 1FZCC 1SFCD 2WPQA 2KB7P 2OYHA 1CW5A 3P7KA 3B5NA 1EQ7A 4LC1A 2FYUK 2N1TC 2YNYA 1T3UA 5AVSB 2R32A 1URQA 3M91A 5CCHA 5BU5A 1LGHB 3H6PA 2VRSA 3RL0C 1KILC 1KZUB 1NO4A 2L5GB 3LW5H 4B86A 1A02J 1SFCB 1JOCA 3OAKA 2IX7C 3NXSA 3V2NA 5AW2B 1NU1K 4WBAA 1SQBK 2M3BA 3KPEA 1GL2C 3TNUB 1JTHA 4Y99C 3MIWA 3CI9A 5AVZB 2O1KA 2BASA 3A5TA 2XDJA 2XKMA 1N73B 1CI6A 1DEBA 2JEEA 2CPBA 1FZFA 1ZN5A 5AVXB 5CCGD 2MJZA 1S9KE 1J2JB 1LWUA 2Z5IA 4N3YB 2A45H 4JYCA 5APYA 5AVYB 4AQRD 3KQGA 2Q7CA 1L4AD 3HTKB 4LGDE 1N7SB 3H32B 2A45G 3HUSA 3GHGA 4XA4A 2I1JA 1FZCA 3V4QA 3M0DC 1RY3A 1JO5A 4O9BA 1IO4A 2N9BA 2P2UA 1URQC 3HD7B 2OARA 1M7LA 1NOHA 1IC2A 3TYYA 2N1TA 4ZKUA 1HVVA 4GT1A 1NAFA 1ZLLA 2P67A 3VP9A 4JYBA 4C7NB 4IFMA 1NH4A 3MGNA 2PP6A 3LIDA 1KILA 1G1JA 1JCCA 2C0WA 1CSBA 1SQQK 2HG5D 1RE4C 3RK2C 5APXA 1GL2A 1KFNA 1RE3C 3O8ZA 1G2CA 5APQA 1GZLA 1KQLA 4OH8B 3NMDA 3V4WA 1IFNA 5CJ0A 3U1AA 1AQ5A 3R2PA 1N7SC 2KOGA 1T2KC 1IFIA 1HTLC 4WY4B 4W7ZA 2Z5HA 5KJ7D 3HD7C 4I1LA 1T3JA 1X9VA 3T97A 3M9QA 1GW3A 1FZEA 1LTJB 1JUNA 3EQ2A 2ZXEB 3RK3D 1NTKK 3V2QA 1H89A 1MUUA 1OXZA 2FKWB 3B5ND 3M0DA 1RF0A 2J59M 5AW8B 3HE4B 2XNXA 4N78D 1YTZT 1E5WA 2NPSB 3KDPB 4W80A 1JCDA 5CCHD 1MZ9A 4I2LC 4GKGA 1GDTA 3NFQA 1LTGC 1S9KD 3PP5A 3RK3B 1FU1A 5AW1B 5AVQB 2E43A 1LT9B 2OYHB 1WT6A 2C9LY 1RE4A 2W6AA 5AW4B 2HODB 3MUDA 4N78E 5APUA 5AVVB 1M1JB 1FAVA 4C7RA 2WSFH 3VMXA 2FFDB 4WY4C 1RE3A 4ZKPA 2J58A 3E1IA 3A2AA 1NTZK 5AVUB 1CZQA 1GU4A 1N7SA 1J1DB 3BATA 1N7LA 3H32A 3M9HA 2HPCB 2KLVA 3L35A 3HD7A 2NPSC 2WWWA 5AW0B 2LKMA 1FOSF 1JY3P 3VOPA 1X8YA 2POHA 1RF0C 2PAJA 1NHLA 1XTCC 3I5CA 3HE5B 2R5BA 4WB4A 4C7NA 1SFCC 2WT7B 2FXMA 1SQXK 1LT9C 2N1TD 1SQPK 1J1EB 2IPPA 3II6A 5APWA 1GW4A 1L4AB 2C9NY 1M1JC 1QL2A 5AW7B 5AW3B 4GIFA 2FFDC 3KYQA 2YKQA 2WSEH 3TK1A 3VMYA 2H7HA 1N73C 1QL1A 1LTSC 1IFMA 3HUSB 3RL0D 3UIAA 3OA7A 1KILD 1GK6A 3G3ZA 4LLHA 1SVFA 3SWYA 1FZCB 1FJKA 3OJAB 1J1DC 1ZV8A 2GUSA 2YO3A 3L37A 1LTAC 1GL2D 4XE5B 4DZOA 1LTTC 1FZBA 1G1IA 4WY4A 1RF1B 3BRTB 2YO2A 1SP4A 2OYIB 3L4FA 2GUVA 1VPCA 3M06A 3P8CE 2O1JA 4JF7A 5CCGC 1JY3N 1FOSE 5CHXA 1IJDB 4DOJA 2W27A 5AVWB 3HE4A 1N86A 1JY2P 1GD2E 1H88A 2JJLA 2KP8A 2NPSA 3IFMA 1J1EC 5AVRB 1G2CB 3TSIA 2ZFCA 4W7YA 1WRGA 2KSJA 1SLQA 1SFCA 2XU6A 1SQVK 1URQD 2WZ7A 5APVA 1JNMA 5AVTB 3TNUA 3EFGA 1LT9A 1JY3O 2HODA 2H8PD 3CLQA 1IFDA 1M1JA 1NWQA 2P1JA 1HGZA 2FFDA 3VP8A 1N73A 1RF1C 3B5NB 2OYIC 1JMMA 2Q3IA 1X79B 5BU8B 1GTWA 1AFOA 2QM8A 3RK2D 2IFMA 5CJ4A 1L0LK 1URQB 1FDMA 5KLVK 4C46A 2HPCA 2C0XA 2HYNA 1GK4A 1T8ZA 3N7NA 1HJBA 1GU5A 3HTKA 2H43A 3B8EB 1ZR4A 1HUCA 1LTJC 5APTA 2FYZA 3BVHA 1JY2N 1N7SD 2M8RA 3C9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QL2 A;  2IFM A;  1IFN A;  3IFM A;  2KLV A;  2IFN A;  1PFI A;  1IFM A;  2XKM A;  1ZN5 A;  2KSJ A;  4IFM A;  1QL1 A; 
#chains in the Genus database with same CATH topology
 2YKP A;  1NTM D;  2W6B A;  1JTH B;  2V4H A;  3L74 J;  3HD7 D;  5KJ7 C;  2FY8 A;  1H0T B;  4H13 C;  3L74 G;  3V5B A;  1W2E A;  4H44 B;  4ZNC A;  2KLU A;  3L36 A;  1LTI C;  1KFM A;  4N6J A;  1PIX A;  1MV8 A;  1L0N K;  2XZR A;  1N8R Q;  4L74 A;  2OYH C;  5KTB A;  3AE2 C;  3BAS A;  2B87 A;  1EC5 A;  2YMY A;  2RH0 A;  1EZV D;  1ZR2 A;  2IZ1 A;  1FBM A;  1FJP A;  1Y47 A;  5GTH E;  2E76 D;  2WPS A;  1VDF A;  2WPV B;  3V2P A;  3H1I D;  5CMZ A;  2R5D A;  3TF5 A;  1DH3 A;  1FDI A;  4KHX A;  1DD3 A;  3MD0 A;  1LTJ A;  1HWT C;  2QM7 A;  1KIL B;  3IR9 A;  1NU1 D;  2CPS A;  1W5C E;  3TDK A;  1BSN A;  1QVG O;  1H8A A;  3KHU A;  5KJ7 A;  4GOF A;  3GF7 A;  4IFD K;  2R3C A;  1OWA A;  3MTU E;  2WPQ A;  2IBZ E;  2OYH A;  1CW5 A;  1EQ7 A;  5CBN A;  1BDD A;  2JKV A;  2FYU K;  3CX5 D;  2A06 G;  2R32 A;  1PL5 A;  3AE9 C;  2QG4 A;  1NTZ E;  5E79 E;  3A0B E;  1JB0 J;  1K73 Q;  2VRS A;  3LW5 H;  2L5G B;  1KYO I;  1L0L J;  2NZ2 A;  3RK3 E;  2E74 B;  2W90 A;  1SQB K;  2YIU C;  2M3B A;  3KPE A;  1GL2 C;  2K88 A;  1L0L G;  1FE6 A;  2YXQ B;  2BAS A;  3MHV A;  2QJK C;  1OX3 A;  3FX0 A;  2ZT9 B;  2XDJ A;  3CXH D;  3GF3 A;  1DEB A;  2YMK A;  4WWI A;  1ZN5 A;  5CCG D;  1KB9 D;  2MJZ A;  1S9K E;  4N3Y B;  4GDO A;  1K9M Q;  3A0H H;  1L4A D;  1QVF O;  4LGD E;  3FWN A;  3CXH E;  4H0L D;  3H32 B;  4XA4 A;  3O6Q B;  4IL6 X;  3V4Q A;  1RY3 A;  1X0T A;  2N9B A;  2P2U A;  1URQ C;  4PD4 E;  2M5A B;  1M7L A;  3AEF C;  2M3E A;  3TYY A;  3C1L A;  1NYH A;  3PHL A;  1HVV A;  4OGQ D;  4C7N B;  1S72 P;  3MGN A;  5DJU B;  1JCC A;  2JP3 A;  2Q6Q A;  5APX A;  1GL2 A;  1OFC X;  1G2C A;  1SQQ G;  3I55 P;  4OH8 B;  3NMD A;  2O01 N;  2SPZ A;  5CJ0 A;  1AQ5 A;  2AEJ A;  3CCS P;  3BCC J;  1Q82 Q;  4EYY Q;  1HTL C;  3IN6 A;  3BCC G;  5B66 E;  3HD7 C;  4I1L A;  1T3J A;  3T97 A;  1GW3 A;  1YI2 P;  3RBX A;  1JUN A;  1NTK K;  1NGM B;  1MUU A;  3B5N D;  2J59 M;  5L8R J;  2XNX A;  3PJS K;  1L0L E;  2FYU J;  2NPS B;  2QE7 H;  1S5L X;  1KYO H;  1MZ9 A;  5TJH A;  3FGA D;  1SQX D;  3KXD A;  2JR8 A;  3LW5 J;  3PP5 A;  2K9J B;  5AVQ B;  2C9L Y;  1SQB J;  2QJP B;  1FAV A;  4C7R A;  2WSF H;  2IBZ I;  1SQB G;  1VQN P;  3CWB J;  4H44 D;  1VQ5 P;  1OMI A;  1L0N E;  3TGU D;  1J1D B;  2ZVO B;  2HPC B;  3H1J D;  1HJ0 A;  3HD7 A;  4YPC A;  4R4M A;  3S1K A;  1FOS F;  2QSI A;  1USE A;  1RF0 C;  1XTC C;  5GTI H;  3IF4 A;  1QEX A;  1R8E A;  2J5U A;  3D6Z A;  1LT9 C;  1J1E B;  1SQP J;  2H7H A;  2OQQ A;  1LTS C;  1SQP G;  1IFM A;  3B4S A;  3UIA A;  3OA7 A;  3BCC E;  1KIL D;  3G3Z A;  3SSU A;  1SVF A;  2UWJ E;  3C8V A;  1LTA C;  1LTT C;  1FDO A;  4PD4 I;  2IYP A;  2GUV A;  3M06 A;  1KIL E;  5KLV D;  5CCG C;  1JY3 N;  1UIX A;  3RBZ A;  3AEC C;  1IJD B;  2FYU E;  3JSV C;  5AVW B;  4QMA A;  3HE4 A;  1KOR A;  1GD2 E;  1H88 A;  2JJL A;  2KP8 A;  3IFM A;  4UB8 H;  5AVR B;  4PV1 B;  1PPJ G;  2ZFC A;  4H0L C;  3AE6 C;  1WRG A;  5KLV E;  1SLQ A;  2KI7 B;  2XU6 A;  2LXB A;  5APV A;  1SQB E;  1LT9 A;  1BGY G;  2HOD A;  2E74 D;  2P58 A;  3CLQ A;  3CCM P;  1IFD A;  1AA0 A;  4OGQ C;  3CWB E;  1VQM P;  2ZT9 D;  1X79 B;  2AEF A;  3AED C;  1UII A;  5E79 H;  2KXP B;  3A0B H;  3N7N A;  3FWL A;  3A0H E;  4D6T J;  2H43 A;  1HUC A;  4U3F G;  4D6T G;  1JY2 N;  2M8R A;  2P7J A;  3HE5 A;  5CCG A;  2WT7 A;  3RK2 B;  3L70 D;  3SWK A;  1YJ9 P;  4TT3 H;  4Y28 J;  2WIT A;  1CI6 B;  1L4A A;  2WTY A;  1XTG B;  3D70 A;  1VQK P;  2Y0D A;  3EWK A;  1BE3 D;  1E79 H;  3H1K D;  2QJY C;  3B5N C;  3CCE P;  4PJ0 H;  4JBZ A;  2I1K A;  1HGV A;  4AYC A;  3HRN A;  5H2F H;  3U59 A;  3A3Y B;  1MFT A;  1EDI A;  1AQT A;  1NKN A;  3P8C D;  4HYT B;  1JM0 A;  1K05 A;  1NKZ B;  5AW5 B;  1BE3 E;  4IFF A;  1P84 H;  1MFZ A;  1Z56 A;  4UB6 H;  3PRJ A;  3L72 D;  2N1T B;  2W6J H;  3CME P;  4I6M C;  3A7O A;  3MP7 B;  3CL3 D;  1KYO D;  2WSC H;  3L71 E;  3MZW B;  4JQ0 D;  1LTB C;  2H88 C;  4H44 C;  3P8M C;  3H1H J;  1NTM G;  3N4X A;  1NTK E;  2YKO A;  5B5E E;  3RL0 g;  4GOE A;  1YTZ I;  1PGP A;  1KN7 A;  1YIJ P;  1HBW A;  3H1H G;  3WUU A;  4Y99 B;  3WUT A;  1NAY A;  1KQS O;  1KYO E;  2NPS D;  3QWO C;  3LIE A;  1FZG A;  2QVA A;  2KB7 P;  3B5N A;  4LC1 A;  1AVY A;  2LXC B;  2YNY A;  1T3U A;  5KKZ B;  5AVS B;  4D6T E;  1EZV G;  1LGH B;  3H6P A;  4NPE A;  3G71 P;  1KIL C;  1NO4 A;  1A02 J;  4B86 A;  1SFC B;  1JOC A;  1KV4 A;  2O3J A;  3TNU B;  1JTH A;  1Y9B A;  2E5T A;  2AXC A;  2O1K A;  3GMA A;  1H0T A;  3A5T A;  1NU1 G;  5GTI E;  3CC4 P;  1N73 B;  2JEE A;  1PP9 E;  2CPB A;  4XFJ A;  2E75 B;  1ZP0 C;  4JYC A;  5APY A;  2AXT H;  3HTK B;  3L75 E;  1N7S B;  3AE7 C;  2KZI A;  2I1J A;  3M0D C;  1T6A A;  3SFE C;  1ZME C;  4BWN A;  1DD4 A;  2E74 C;  1YIT P;  1RHZ B;  1NAF A;  3PTZ A;  2P67 A;  4DT0 A;  4JYB A;  1MKM A;  4DCK A;  1NH4 A;  2ZT9 C;  3LID A;  1KIL A;  4A7P A;  1CSB A;  1SQQ K;  2HG5 D;  2WSC J;  4UB8 E;  2LR2 A;  2FXP A;  2WVR A;  1GZL A;  1KQL A;  2IBZ D;  2RMZ A;  4PV1 D;  3U1A A;  4TLF A;  1ZW0 A;  3OW2 O;  2QEX P;  1Q90 D;  1NTZ D;  2FYN B;  1X9V A;  2D2C B;  3L73 J;  1Y8A A;  2W8Z A;  1FZE A;  1LTJ B;  3CPW O;  3L73 G;  3EQ2 A;  2ZXE B;  3RK3 D;  3M0D A;  1OXZ A;  1DEE G;  1LNQ A;  5AW8 B;  1ZRT D;  1OIP A;  1YTZ T;  4W80 A;  1TU3 F;  3F5H A;  1JCD A;  1M1K Q;  4I2L C;  4GKG A;  2ZVN B;  5CBO A;  3RGU A;  1S9K D;  3L74 E;  1Q86 Q;  2OYH B;  1ZRT E;  2M0B A;  2G3A A;  3CCV P;  5APU A;  1W2B O;  1M1J B;  1S2E A;  1NVO A;  3GW6 A;  3G9R A;  4PD4 D;  3BAT A;  3H32 A;  4PJ0 E;  2KS1 A;  2KLV A;  3O6Q A;  2R3S A;  3L35 A;  5H2F E;  2M5A A;  4ASW A;  2NPS C;  1X8Y A;  3G6E P;  1NHL A;  3I5C A;  2FXO A;  2K3R A;  1P84 E;  2R5B A;  4UB6 E;  4C7N A;  2RKL A;  4L73 A;  2IDB A;  2N1T D;  1SQP K;  2QJP C;  1QL2 A;  1D7M A;  5AW7 B;  1KQG B;  5AW3 B;  4GIF A;  1RQU A;  2WSE J;  1VF5 B;  1EDL A;  3CCU P;  1SQQ J;  3F89 A;  1FJK A;  1J1D C;  4K35 A;  2H89 C;  1FZB A;  1G1I A;  3TGU J;  3AEB C;  1RF1 B;  3TGU G;  2OYI B;  1VQ6 P;  3H1L J;  2ZAE B;  1L0L D;  2A06 E;  3H1L G;  3H1J G;  1FOS E;  3KZI H;  1N86 A;  3CCL P;  2YIU B;  1KTM A;  2NPS A;  1J1E C;  1G2C B;  2K37 A;  5B5E H;  1OVR A;  1SQV K;  1S4X A;  2WZ7 A;  2K9J A;  5AVT B;  1JY3 O;  1L0N D;  1HGZ A;  3USS A;  1VQP P;  1K04 A;  1OVV A;  2E76 C;  5BU8 B;  2IFM A;  3E1R A;  5CJ4 A;  1URQ B;  1FDM A;  2AXT E;  2HPC A;  2HYN A;  1BCC J;  1HJB A;  1ZR4 A;  2JDI H;  5APT A;  1BCC G;  4PV1 C;  1N7S D;  4GOD A;  3Q5S A;  1JEK A;  1QLE D;  1T2K D;  2KYV A;  3NTN A;  4RES B;  2JWA A;  3S4R A;  5APS A;  3BCC D;  3RK3 C;  2Q3E A;  1SQQ E;  1LWU B;  4M3L A;  4EDF A;  1JY2 O;  2WPR A;  3SWF A;  3D6Y A;  3B71 A;  1IK9 A;  1PZQ A;  3GHG B;  4KT0 J;  1KD1 Q;  4EIJ A;  2Q5U A;  1OW7 A;  2FYU D;  3AEG C;  2WQY C;  3WU2 E;  5BVZ A;  1P84 I;  2E42 A;  1NTM K;  3Q1M A;  1R5L A;  2WMM A;  2D2C D;  3RL0 B;  2Y0C A;  3P32 A;  1SQB D;  1U57 A;  3L70 G;  2JWD A;  2HLO A;  1U7M A;  1L4A C;  3CWB D;  2Q9I A;  3HUS C;  1BGY J;  3H1K G;  1FZC C;  1SQV J;  3P7K A;  3JCU E;  4L75 A;  2KZJ A;  1SQV G;  3Q5P A;  2N1T C;  1BCC E;  3M91 A;  1LJ2 A;  1OW8 A;  3L72 G;  1VQ7 P;  4U3F J;  4KJM A;  3OAK A;  3V2N A;  5AW2 B;  1NU1 K;  1PGO A;  4Y99 C;  3CI9 A;  1CI6 A;  1FC2 C;  1FZF A;  2BCC J;  4BRY A;  1J2J B;  3I56 P;  1SQP E;  2Z5I A;  2BCC G;  5AVY B;  4AQR D;  2Q7C A;  3PH0 A;  5KKZ C;  1VQ4 P;  3CX5 H;  2A45 G;  3HUS A;  3QH9 A;  3Q2Y A;  1FZC A;  1JO5 A;  1FS0 E;  4O9B A;  1IO4 A;  1VF5 D;  3L71 D;  1NOH A;  1IC2 A;  1PGJ A;  2N1T A;  3W68 A;  4ZKU A;  2YXR B;  4GT1 A;  1NTK D;  1OZH A;  1ZLL A;  2RN0 A;  1NJI Q;  2PP6 A;  4EI2 A;  1G1J A;  2C0W A;  2NRG A;  3K5B A;  1PPJ E;  3KZI E;  3MUD C;  1NTM J;  2WSS H;  1KFN A;  1RE3 C;  1KB9 H;  1L2P A;  3VMA A;  5APQ A;  3V4W A;  1IFN A;  4OGQ B;  4BXL A;  1BGY E;  1N7S C;  1SQV E;  1T2K C;  4WY4 B;  4D6T D;  1EXI A;  3AE4 C;  1M90 Q;  3M9Q A;  2KNC B;  3W67 A;  2FKW B;  4U3F E;  1E5W A;  3KDP B;  1VQL P;  2R44 A;  4OWF A;  3H1I J;  5CCH D;  1PP9 D;  3NFQ A;  3H1I G;  2DW3 A;  5KLI B;  1ZOY C;  5KAF H;  2E43 A;  1YBK A;  1WT6 A;  2BCC E;  2W6A A;  2V7Q J;  5AW4 B;  1NU1 J;  3MUD A;  2P10 A;  3AE5 C;  5AVV B;  3L75 D;  2FFD B;  1RE3 A;  2J58 A;  2IBZ G;  2FYN C;  1SS1 A;  5AVU B;  2D2C C;  1DIP A;  1N7S A;  1BSH A;  1N7L A;  4NPD A;  1NTZ G;  4RJT A;  1VQO P;  1LP1 B;  1GMJ A;  2WWW A;  2ZXX A;  1WMK A;  3H1H D;  1JY3 P;  2POH A;  2PAJ A;  3H25 A;  4WB4 A;  1JMB A;  1VL2 A;  2FXM A;  1SQX K;  2JO1 A;  2I8D A;  4IOI H;  1NTM E;  2IPP A;  3II6 A;  5APW A;  1GW4 A;  2BEQ D;  2C9N Y;  2GA1 A;  3V6I A;  1M1J C;  5C39 A;  3H1H E;  2ZJS E;  3KYQ A;  2YKQ A;  2WSE H;  3TK1 A;  3VMY A;  3ITK A;  5TIS H;  3RL0 D;  1GK6 A;  4JPZ B;  4LLH A;  2FBW C;  3OJA B;  4I7Z B;  2GUS A;  2YO3 A;  3L37 A;  2B87 B;  4XE5 B;  4DZO A;  3EFF K;  1AV1 A;  2QRX A;  3BRT B;  2YO2 A;  4Z1M H;  3L4F A;  3WU2 H;  2KUB A;  1EZV E;  4JF7 A;  5CHX A;  1RH5 B;  2W27 A;  1JY2 P;  2QIW A;  4K3A A;  3H1I E;  3L74 D;  1EXJ A;  1VF5 C;  1NU1 E;  2OGU A;  4H13 B;  2L91 A;  1JNM A;  3EFG A;  1M57 D;  1M1J A;  1NWQ A;  3CCQ P;  1AVO A;  3VP8 A;  1RF1 C;  3Q3D A;  1U7J A;  3JCU H;  2OYI C;  2Q3I A;  1RQV A;  1EDK A;  1GTW A;  3RK2 D;  4U7J A;  1HF9 A;  1IK7 A;  5KLV K;  1GU5 A;  2OYO A;  3ABV C;  3FXE A;  1P84 D;  3CX5 E;  3B8E B;  1PV3 A;  3C9I A;  1HH0 A;  1AJY A;  1FZA A;  2HFE D;  2XV5 A;  5AW9 B;  4EOT A;  2Z4E A;  2ZYD A;  4IL6 H;  4HKZ H;  2N9Y B;  3CMA P;  1KC8 Q;  5M1B A;  3CCR P;  2PRR A;  3V2R A;  1X22 A;  2A45 I;  2O01 H;  3M9B A;  1SQX J;  3VTP C;  1L0N J;  2KS1 B;  3D71 A;  3L73 D;  1SQX G;  1KB9 E;  1L0N G;  4AUW A;  1PFI A;  3WMM 0;  3M0A A;  1K8A Q;  2A06 D;  5CCH C;  1IFJ A;  4HH2 A;  1RF1 A;  1A02 F;  2OYI A;  2B9B A;  3AEE C;  2PFX A;  4L76 A;  3L73 E;  2GM4 A;  3BRV B;  4WY4 D;  3H1J J;  5AW6 B;  1YYC A;  3U1C A;  3VYI A;  3VMZ A;  3VN0 A;  1GL2 B;  1LWU C;  2QJK B;  1DX7 A;  2ITA A;  1EDJ A;  3AEA C;  3AE1 C;  3GHG C;  1BDC A;  1N2D C;  2IFN A;  5KAF E;  2BEZ F;  3IAO A;  1SFC D;  2CK3 H;  1S5L H;  3CCJ P;  3T97 B;  2IYO A;  3AE3 C;  1EZV I;  1URQ A;  5CCH A;  5BU5 A;  4WVZ A;  2FYU G;  3G4S P;  3RL0 C;  2E75 D;  1KZU B;  2IX7 C;  3NXS A;  4YTP C;  5KLV J;  4WBA A;  2AEM A;  4HJG H;  3MIW A;  5KLV G;  5AVZ B;  5EFW B;  1R5S A;  1SQQ D;  2XKM A;  1OW6 A;  5KAI H;  2XND H;  5AVX B;  1SQX E;  3E7K A;  2K9Y A;  3CWB G;  1LWU A;  2A45 H;  1S1C X;  3KQG A;  3H1L D;  3R4Y A;  5TIS E;  3GHG A;  2O01 J;  3CX5 I;  2KIK A;  1YQ4 C;  3S9O A;  3TGU E;  3HD7 B;  2OAR A;  3H1L E;  3H1J E;  3VP9 A;  5DJT B;  4IFM A;  2OTK E;  2Y9Z A;  4RKU J;  2IZ0 A;  1RE4 C;  3RK2 C;  4HB1 A;  2Y9Y A;  3Q5R A;  3CXH I;  3O8Z A;  3L70 J;  1KB9 I;  3CD6 P;  3R2P A;  1M56 D;  2E76 B;  2KOG A;  1IFI A;  3JC2 2;  1BCC D;  2HR3 A;  1BE3 J;  5GTH H;  4W7Z A;  3H1K J;  2Z5H A;  5KJ7 D;  4H13 D;  1BE3 G;  4OVN F;  2B89 A;  1VQ9 P;  1Q81 Q;  1IFP A;  1QGK B;  3L71 J;  1KQF B;  3V2Q A;  1H89 A;  3L71 G;  1RF0 A;  3HE4 B;  1PGQ A;  1NTK J;  4N78 D;  3L72 J;  1NTK G;  1USD A;  1GDT A;  1YQ3 C;  1LTG C;  2V7Q H;  3RK3 B;  1FU1 A;  1SQP D;  5AW1 B;  2W83 C;  1LT9 B;  1RE4 A;  2HOD B;  4N78 E;  3WUV A;  3VMX A;  2G8Y A;  2E5Y A;  4WY4 C;  4ZKP A;  4IL6 E;  3E1I A;  2WSF J;  3A2A A;  4ASV A;  1NTZ K;  1CZQ A;  4RO0 A;  1GU4 A;  3M9H A;  1KMI Z;  1OVU A;  4MN4 C;  5AW0 B;  2LKM A;  3VOP A;  2MKV A;  1PPJ D;  3HE5 B;  1SFC C;  2WT7 B;  1YHQ P;  3FXD A;  5KLI C;  4BRY B;  1PP9 J;  3SFD C;  1L4A B;  1PP9 G;  4YXD C;  1BGY D;  4H0L B;  2FFD C;  3L70 E;  2OTJ P;  1N73 C;  1SQV D;  1QL1 A;  3CXH H;  3HUS B;  3L75 J;  3GLM A;  2E75 C;  5K5G B;  2KK7 A;  3SWY A;  1FZC B;  1ZV8 A;  3L75 G;  2Q1K A;  1ZXG A;  4PD4 H;  2ZYA A;  3H1K E;  1GL2 D;  4WY4 A;  1VQ8 P;  1SP4 A;  1Q7Y Q;  4U3F D;  1VPC A;  3P8C E;  2O1J A;  2KNC A;  1Q2N A;  4YXW H;  1S5L E;  4DOJ A;  3CC2 P;  2B88 A;  4R4L A;  3L72 E;  1IZN B;  4CPG A;  3TSI A;  4W7Y A;  1LT1 A;  3ZDM A;  2BCC D;  3GG2 A;  2KSJ A;  3PLN A;  2KSE A;  1SFC A;  1URQ D;  2PGD A;  3TNU A;  5B66 H;  1YJN P;  2H8P D;  1S3J A;  4I7Z C;  4ZMD A;  2P1J A;  2FFD A;  1YJW P;  4NPF X;  1N73 A;  2QJY B;  3B5N B;  5KAI E;  1JMM A;  1AFO A;  2QM8 A;  4DJG A;  2OTL P;  1QX8 A;  2Y0E A;  1L0L K;  3CC7 P;  4C46 A;  2C0X A;  1GK4 A;  1T8Z A;  1LP1 A;  2ZYG A;  3HTK A;  1NTZ J;  3AE8 C;  1LTJ C;  2FYZ A;  2QA4 P;  3BVH A;  1M8O B;  2K1A A; 
#chains in the Genus database with same CATH homology
 2P7J A;  2YKP A;  3HE5 A;  1T2K D;  1HH0 A;  2KYV A;  2W6B A;  5CCG A;  3NTN A;  1JTH B;  4RES B;  2WT7 A;  1FZA A;  3RK2 B;  2HFE D;  3HD7 D;  5KJ7 C;  2XV5 A;  3V5B A;  5AW9 B;  4EOT A;  1W2E A;  2Z4E A;  2WIT A;  5APS A;  1CI6 B;  1L4A A;  2WTY A;  1XTG B;  3L36 A;  1LTI C;  1KFM A;  4N6J A;  1MV8 A;  1L0N K;  3RK3 C;  2XZR A;  3V2R A;  2A45 I;  2OYH C;  3B5N C;  2O01 H;  3M9B A;  1LWU B;  4M3L A;  3VTP C;  5KTB A;  1JY2 O;  2I1K A;  1HGV A;  2WPR A;  4AYC A;  3SWF A;  3BAS A;  3HRN A;  4AUW A;  3U59 A;  1PFI A;  3WMM 0;  3A3Y B;  3M0A A;  2YMY A;  5CCH C;  1IK9 A;  1IFJ A;  3GHG B;  1NKN A;  3P8C D;  4HYT B;  4HH2 A;  1RF1 A;  1NKZ B;  4EIJ A;  1ZR2 A;  1A02 F;  2Q5U A;  5AW5 B;  1FBM A;  4IFF A;  2OYI A;  1MFZ A;  1Z56 A;  1FJP A;  2N1T B;  2WPS A;  1VDF A;  4I6M C;  3V2P A;  5BVZ A;  2E42 A;  2GM4 A;  3BRV B;  3A7O A;  1NTM K;  2R5D A;  5CMZ A;  1DH3 A;  4WY4 D;  3CL3 D;  4KHX A;  2WSC H;  3MD0 A;  5AW6 B;  1LTJ A;  1HWT C;  1YYC A;  3U1C A;  3RL0 B;  3VYI A;  1LTB C;  1KIL B;  2QM7 A;  3P8M C;  3IR9 A;  3N4X A;  3P32 A;  2YKO A;  2CPS A;  3VMZ A;  1YTZ I;  1HBW A;  3VN0 A;  1GL2 B;  1H8A A;  4Y99 B;  2HLO A;  1LWU C;  1L4A C;  5KJ7 A;  1DX7 A;  2Q9I A;  2NPS D;  4IFD K;  2R3C A;  3GHG C;  3HUS C;  3LIE A;  1OWA A;  1N2D C;  2IFN A;  3MTU E;  1FZG A;  1FZC C;  1SFC D;  2WPQ A;  2KB7 P;  2OYH A;  1CW5 A;  3P7K A;  3B5N A;  1EQ7 A;  4LC1 A;  2FYU K;  2N1T C;  2YNY A;  1T3U A;  5AVS B;  2R32 A;  1URQ A;  3M91 A;  5CCH A;  5BU5 A;  1LGH B;  3H6P A;  2VRS A;  3RL0 C;  1KIL C;  1KZU B;  1NO4 A;  2L5G B;  3LW5 H;  4B86 A;  1A02 J;  1SFC B;  1JOC A;  3OAK A;  2IX7 C;  3NXS A;  3V2N A;  5AW2 B;  1NU1 K;  4WBA A;  1SQB K;  2M3B A;  3KPE A;  1GL2 C;  3TNU B;  1JTH A;  4Y99 C;  3MIW A;  3CI9 A;  5AVZ B;  2O1K A;  2BAS A;  3A5T A;  2XDJ A;  2XKM A;  1N73 B;  1CI6 A;  1DEB A;  2JEE A;  2CPB A;  1FZF A;  1ZN5 A;  5AVX B;  5CCG D;  2MJZ A;  1S9K E;  1J2J B;  1LWU A;  2Z5I A;  4N3Y B;  2A45 H;  4JYC A;  5APY A;  5AVY B;  4AQR D;  3KQG A;  2Q7C A;  1L4A D;  3HTK B;  4LGD E;  1N7S B;  3H32 B;  2A45 G;  3HUS A;  3GHG A;  4XA4 A;  2I1J A;  1FZC A;  3V4Q A;  3M0D C;  1RY3 A;  1JO5 A;  4O9B A;  1IO4 A;  2N9B A;  2P2U A;  1URQ C;  3HD7 B;  2OAR A;  1M7L A;  1NOH A;  1IC2 A;  3TYY A;  2N1T A;  4ZKU A;  1HVV A;  4GT1 A;  1NAF A;  1ZLL A;  2P67 A;  3VP9 A;  4JYB A;  4C7N B;  4IFM A;  1NH4 A;  3MGN A;  2PP6 A;  3LID A;  1KIL A;  1G1J A;  1JCC A;  2C0W A;  1CSB A;  1SQQ K;  2HG5 D;  1RE4 C;  3RK2 C;  5APX A;  1GL2 A;  1KFN A;  1RE3 C;  3O8Z A;  1G2C A;  5APQ A;  1GZL A;  1KQL A;  4OH8 B;  3NMD A;  3V4W A;  1IFN A;  5CJ0 A;  3U1A A;  1AQ5 A;  3R2P A;  1N7S C;  2KOG A;  1T2K C;  1IFI A;  1HTL C;  4WY4 B;  4W7Z A;  2Z5H A;  5KJ7 D;  3HD7 C;  4I1L A;  1T3J A;  1X9V A;  3T97 A;  3M9Q A;  1GW3 A;  1FZE A;  1LTJ B;  1JUN A;  3EQ2 A;  2ZXE B;  3RK3 D;  1NTK K;  3V2Q A;  1H89 A;  1MUU A;  1OXZ A;  2FKW B;  3B5N D;  3M0D A;  1RF0 A;  2J59 M;  5AW8 B;  3HE4 B;  2XNX A;  4N78 D;  1YTZ T;  1E5W A;  2NPS B;  3KDP B;  4W80 A;  1JCD A;  5CCH D;  1MZ9 A;  4I2L C;  4GKG A;  1GDT A;  3NFQ A;  1LTG C;  1S9K D;  3PP5 A;  3RK3 B;  1FU1 A;  5AW1 B;  5AVQ B;  2E43 A;  1LT9 B;  2OYH B;  1WT6 A;  2C9L Y;  1RE4 A;  2W6A A;  5AW4 B;  2HOD B;  3MUD A;  4N78 E;  5APU A;  5AVV B;  1M1J B;  1FAV A;  4C7R A;  2WSF H;  3VMX A;  2FFD B;  4WY4 C;  1RE3 A;  4ZKP A;  2J58 A;  3E1I A;  3A2A A;  1NTZ K;  5AVU B;  1CZQ A;  1GU4 A;  1N7S A;  1J1D B;  3BAT A;  1N7L A;  3H32 A;  3M9H A;  2HPC B;  2KLV A;  3L35 A;  3HD7 A;  2NPS C;  2WWW A;  5AW0 B;  2LKM A;  1FOS F;  1JY3 P;  3VOP A;  1X8Y A;  2POH A;  1RF0 C;  2PAJ A;  1NHL A;  1XTC C;  3I5C A;  3HE5 B;  2R5B A;  4WB4 A;  4C7N A;  1SFC C;  2WT7 B;  2FXM A;  1SQX K;  1LT9 C;  2N1T D;  1SQP K;  1J1E B;  2IPP A;  3II6 A;  5APW A;  1GW4 A;  1L4A B;  2C9N Y;  1M1J C;  1QL2 A;  5AW7 B;  5AW3 B;  4GIF A;  2FFD C;  3KYQ A;  2YKQ A;  2WSE H;  3TK1 A;  3VMY A;  2H7H A;  1N73 C;  1QL1 A;  1LTS C;  1IFM A;  3HUS B;  3RL0 D;  3UIA A;  3OA7 A;  1KIL D;  1GK6 A;  3G3Z A;  4LLH A;  1SVF A;  3SWY A;  1FZC B;  1FJK A;  3OJA B;  1J1D C;  1ZV8 A;  2GUS A;  2YO3 A;  3L37 A;  1LTA C;  1GL2 D;  4XE5 B;  4DZO A;  1LTT C;  1FZB A;  1G1I A;  4WY4 A;  1RF1 B;  3BRT B;  2YO2 A;  1SP4 A;  2OYI B;  3L4F A;  2GUV A;  1VPC A;  3M06 A;  3P8C E;  2O1J A;  4JF7 A;  5CCG C;  1JY3 N;  1FOS E;  5CHX A;  1IJD B;  4DOJ A;  2W27 A;  5AVW B;  3HE4 A;  1N86 A;  1JY2 P;  1GD2 E;  1H88 A;  2JJL A;  2KP8 A;  2NPS A;  3IFM A;  1J1E C;  5AVR B;  1G2C B;  3TSI A;  2ZFC A;  4W7Y A;  1WRG A;  2KSJ A;  1SLQ A;  1SFC A;  2XU6 A;  1SQV K;  1URQ D;  2WZ7 A;  5APV A;  1JNM A;  5AVT B;  3TNU A;  3EFG A;  1LT9 A;  1JY3 O;  2HOD A;  2H8P D;  3CLQ A;  1IFD A;  1M1J A;  1NWQ A;  2P1J A;  1HGZ A;  2FFD A;  3VP8 A;  1N73 A;  1RF1 C;  3B5N B;  2OYI C;  1JMM A;  2Q3I A;  1X79 B;  5BU8 B;  1GTW A;  1AFO A;  2QM8 A;  3RK2 D;  2IFM A;  5CJ4 A;  1L0L K;  1URQ B;  1FDM A;  5KLV K;  4C46 A;  2HPC A;  2C0X A;  2HYN A;  1GK4 A;  1T8Z A;  3N7N A;  1HJB A;  1GU5 A;  3HTK A;  2H43 A;  3B8E B;  1ZR4 A;  1HUC A;  1LTJ C;  5APT A;  2FYZ A;  3BVH A;  1JY2 N;  1N7S D;  2M8R A;  3C9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...