2IFMA

Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 angstroms resolution x-ray fibre diffraction data
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre diffraction data.
pubmed doi rcsb
molecule tags Virus
molecule keywords PF1 FILAMENTOUS BACTERIOPHAGE
total genus 17
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1995-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ifmA00
1QL1A 1QL2A 2IFNA 2IFMA 1PFIA 1IFMA 1IFNA 2KSJA 2KLVA 3IFMA 2XKMA 4IFMA 1ZN5A
chains in the Genus database with same CATH superfamily
2FYUJ 3B4SA 3E1RA 1NTZJ 2IYPA 1MFZA 1NTMK 2WPQA 2WITA 1YBKA 3ZDMA 1Y8AA 3TGUE 3WUVA 4H44B 4DZOA 1SFCC 2E76C 1L0LE 4IFDK 2KNCA 2LKMA 3CWBG 3H1LE 3AE6C 5AVTB 5KLIC 2QM8A 2ZFCA 1LTBC 3V2PA 4KHXA 4YXWH 4K35A 1VQPP 1NTKE 3Q2YA 1G2CB 3HE4A 2HPCA 1PP9E 3H1LJ 3PHLA 1NAYA 1NTKD 1IZNB 1URQC 2M5AB 4TLFA 3MZWB 3EFGA 1SFCB 4XE5B 5DJTB 3M9QA 3HD7C 5AW5B 3B5NB 2IBZE 2O01J 4EOTA 2FYUE 2RH0A 3GHGA 3SWYA 3K5BA 1JMMA 2KUBA 4UB8H 1EDKA 3L75E 4IFFA 1HGZA 1NHLA 3AE8C 3L72J 2SPZA 1L0NK 4HJGH 1J1EB 2W6JH 1PPJE 3KPEA 2O01N 2G3AA 1XTGB 2YXQB 3RK3B 1SQQE 2I1JA 1L0LK 1L0NE 2D2CC 3HD7A 4BWNA 1N7SC 1NTZD 1S1CX 3NFQA 3R4YA 3GHGC 4W80A 3VMXA 3VN0A 2HR3A 2K9JA 2OYIC 1GK6A 2HG5D 1N73C 1NTZK 4U7JA 1FJKA 2IZ0A 3MUDC 2J5UA 4H0LB 3RK3C 1HWTC 2ZT9B 3CXHI 2NPSD 3CCUP 5KAIH 1W5CE 1LT9C 1UIXA 2J59M 3PH0A 1SQXE 1VL2A 1GW3A 1BCCG 1EC5A 1N7SA 2Y0DA 3H1KG 3P32A 3PTZA 4RJTA 4LGDE 3RBZA 1EZVI 3L74E 2WSFH 1NTMD 1X22A 1T3UA 2I8DA 2KLUA 2YKPA 3L4FA 3VMYA 3Q1MA 1EXJA 4I1LA 3FXEA 4GDOA 3HE4B 2E76B 1H0TA 1FE6A 1NO4A 2JP3A 2WT7A 3H1JD 2L91A 4EIJA 1N2DC 2G8YA 3S4RA 1LGHB 1DEEG 4KT0J 4HYTB 3PRJA 1JY3N 1NU1E 4PD4I 3L73G 1M8OB 2WMMA 3VP8A 5BU5A 1JY2O 3ITKA 1EDLA 1SFCA 2FXMA 4K3AA 1AVOA 1BGYE 3TGUD 3RK3D 3CCMP 4Y99C 1ZN5A 4BRYA 1W2BO 1T6AA 2FY8A 5APYA 3RL0B 2C9LY 2OYOA 4NPFX 4WY4A 1HJBA 1JEKA 3SSUA 3G71P 1HBWA 3L70J 2BCCJ 3B5ND 2M0BA 3PJSK 2AXTH 2XNDH 3KZIE 1JTHA 3AE2C 3AE9C 1LT1A 2QE7H 2WPSA 2Y0CA 5KJ7C 2L5GB 1BCCJ 1IFPA 1FZAA 1VQMP 2E75B 3BASA 3VMAA 1DD4A 5BVZA 1X8YA 1T3JA 1YTZI 3BCCG 2K1AA 1SQXK 1P84D 3AEFC 5AVXB 1FS0E 1T2KC 1RF1A 2Q3IA 1IFIA 2OGUA 2Q7CA 3AEDC 1G1IA 5KJ7A 1JCCA 3L71J 4W7YA 5CCHA 3CC2P 3HE5B 2JJLA 3H1IG 1PFIA 1K73Q 2H7HA 1RE4A 3TGUJ 1OW8A 1LTAC 1SQVG 4CPGA 4IL6E 1FDMA 2PFXA 2BEZF 2A45H 3L72G 1NTKK 1GD2E 2IPPA 5AVQB 4DCKA 1NTMG 3E7KA 5K5GB 3V2QA 1R5SA 3O6QB 2P7JA 1QGKB 3QH9A 2W6AA 2WT7B 5KLVK 2A06D 3GW6A 1M90Q 1GL2A 2BEQD 3LIDA 2WTYA 2KIKA 1EXIA 2YKOA 1KN7A 1YYCA 2K37A 2GM4A 1RQVA 2QEXP 3RK2B 2YIUC 5CJ4A 1USDA 2IBZI 5APXA 1X0TA 2M8RA 3H1KD 3T97B 1KFMA 1PPJD 4MN4C 3TYYA 1W2EA 2QJPC 3AEBC 3H32A 1SQQK 2E5YA 2YO2A 3A0BH 3BATA 3WUTA 3CMAP 3CC4P 5TISH 1WMKA 1E79H 1YJ9P 1PL5A 1MZ9A 1L0LJ 3WMM0 1SQPD 1LP1B 3NTNA 4LLHA 5CCHC 1M57D 1OMIA 2JWAA 1JTHB 5C39A 1OVRA 1FBMA 3I5CA 3RL0C 1IK9A 5AW1B 1ZR4A 2QVAA 3FXDA 1WT6A 1ZXGA 1RF0A 2E74D 4GOEA 1PZQA 1JO5A 2R5BA 1NAFA 1S5LH 4OVNF 4QMAA 1WRGA 2Z5IA 5KLIB 1Q90D 3L73J 1URQA 4N78D 1SS1A 4R4MA 3B71A 1GTWA 4WB4A 2KZJA 2NPSA 3KHUA 2OYIA 2KZIA 2QJKB 1LWUB 1OXZA 4GT1A 5AVVB 2E42A 1PIXA 1OZHA 2N9BA 1LTGC 4JBZA 4UB6H 5AW4B 4Y28J 4EI2A 1FOSF 4OGQC 1VQ9P 1ZV8A 1VQ4P 1KILE 3H1HJ 2FFDA 2H89C 1R5LA 1P84I 3CX5I 5CMZA 1GZLA 4NPEA 5GTHE 1VF5B 1YJNP 1FZBA 1HH0A 1ZP0C 1VDFA 2FYUD 1LTSC 2KI7B 4HB1A 4I2LC 4C7NA 2YXRB 3CC7P 2D2CB 3FWLA 1FJPA 2ZJSE 3M0AA 4PV1C 4ZMDA 3H32B 5APUA 1NU1K 5CJ0A 3KQGA 1HTLC 1QL1A 1SQBG 3MIWA 4Y99B 1YQ3C 1U57A 2JO1A 1R8EA 1SFCD 1J1EC 4JPZB 5AW7B 1MV8A 4DJGA 5KLVG 1H89A 2AXCA 4H0LD 4OWFA 4WBAA 2P67A 1LTJC 2ZYGA 4H44C 2Q5UA 1JY3P 1FZFA 5H2FE 5AW8B 5APTA 1KB9I 2ITAA 4UB6E 2M5AA 3W67A 1N73B 4YXDC 5BU8B 5KAFH 1NKNA 3KDPB 2IBZG 2ZT9C 3RL0g 1EZVD 2O1KA 3CWBD 3L71G 1USEA 2FBWC 3VP9A 3IN6A 1GW4A 3WUUA 1NGMB 2WSCJ 2YO3A 1NTZE 1URQB 1HGVA 1PPJG 1BCCD 3ABVC 3F89A 3JCUH 3CCJP 3Q5SA 1OFCX 2NPSB 3CL3D 1G2CA 1S5LX 1G1JA 2POHA 3V6IA 1NWQA 3LIEA 1IFMA 3CI9A 4WVZA 2P2UA 1GL2D 1M56D 2XKMA 1CW5A 3GHGB 3CXHD 2OQQA 2IBZD 2NPSC 1BE3G 5B66H 2CPBA 2V7QH 4IL6H 4XA4A 2FYUK 2P10A 4WY4D 3WU2E 4D6TE 1N7SB 1NTMJ 3H1KE 3LW5H 3Q5RA 2B9BA 2O3JA 2PRRA 1SLQA 1PP9D 2KXPB 2R5DA 1SQVD 3A2AA 2OARA 4U3FD 5TJHA 3TGUG 3UIAA 2FFDC 2V4HA 2HODA 1N86A 1KTMA 5APWA 3CLQA 2H43A 1NYHA 2NRGA 3HUSA 1GL2B 4B86A 2GA1A 2ZT9D 3MGNA 4IOIH 1BGYJ 4C46A 1PP9G 2YMYA 3G3ZA 1NU1G 1KQLA 1SQBK 3OAKA 4JYBA 3L75D 3T97A 2OTLP 2B89A 1BDDA 4L75A 5CBOA 1LNQA 1HF9A 2K9YA 1H88A 1URQD 4L76A 1KB9E 3I55P 2KS1A 5B66E 1EZVE 3B5NC 3MD0A 3V2NA 3RGUA 1EDIA 2R3SA 3IF4A 3SFEC 3L70G 4C7RA 3NMDA 1L4AD 1OVUA 3L74J 4TT3H 3EFFK 1YHQP 1PP9J 4RKUJ 1GMJA 3A7OA 3SWFA 2YIUB 4PD4E 3EQ2A 2JKVA 4WY4C 5B5EH 2B87A 2FKWB 1VQ7P 5AW9B 1N7SD 1J2JB 5AVWB 1IJDB 3BCCE 3U1AA 3Q5PA 1T2KD 1VF5C 1GK4A 3H25A 1RF1C 4RESB 1SQPK 1LWUA 3H1JG 1BCCE 1FDIA 1OIPA 2FYNB 3II6A 5AVZB 5KAFE 3CCLP 5AW0B 2IYOA 1KC8Q 1SQPG 1SQQJ 1ZRTE 2C0XA 2HODB 3P7KA 4GODA 2JR8A 2KSJA 1OW7A 1L0ND 1ZRTD 3H1HD 3OJAB 5AVUB 1MFTA 1PV3A 5KAIE 3BVHA 1DX7A 1UIIA 1GDTA 2FYNC 2A06E 2XDJA 3JCUE 1RE3A 4JF7A 1LJ2A 1OW6A 2WZ7A 4O9BA 4DOJA 3BCCJ 1RHZB 1HVVA 4H13D 2BCCD 4OH8B 3C9IA 1HUCA 3CX5H 3L37A 3P8CE 1EDJA 1M1JC 2R32A 5CCHD 1K04A 1A02J 3A0HH 1Q86Q 3HUSC 1RE3C 3PLNA 3CCEP 4JQ0D 2ZVOB 1SQPJ 3D6YA 4D6TJ 2YNYA 2GUVA 3A5TA 2Y9YA 4W7ZA 3RL0D 1S72P 1LWUC 2WSEJ 2QJPB 1CSBA 3KXDA 2IX7C 1X9VA 2MKVA 3O6QA 5AVSB 3CPWO 1AV1A 1KILD 1SQVJ 3SWKA 2GUSA 4ZKUA 4OGQB 4KJMA 1IO4A 1QEXA 2N9YB 3O8ZA 4GKGA 1VQ5P 1BSHA 2IDBA 2Z5HA 3C1LA 1CI6A 2N1TA 2YKQA 4R4LA 4U3FG 2NZ2A 5KJ7D 1J1DC 4I7ZC 3D6ZA 2LR2A 1BGYD 2Q3EA 4H13B 3GF3A 3HTKA 3RK3E 3D70A 2Q1KA 1L4AC 2P1JA 5AW6B 2AEFA 2ZXEB 2Y9ZA 3QWOC 3MTUE 4OGQD 1JMBA 3N7NA 2H88C 3FWNA 1VQNP 1OX3A 3U1CA 3M0DC 5E79H 3H1HE 1KORA 1SQVE 3H6PA 1IFDA 3RBXA 1SQBD 1IK7A 1XTCC 2K9JB 2VRSA 3L72E 3L75G 3TF5A 1JNMA 2BCCG 1K8AQ 1A02F 3B5NA 1ZOYC 2CPSA 3AEGC 5TISE 2YMKA 2JEEA 1LTJB 1NU1J 1QX8A 3M9BA 1VPCA 4AQRD 1T8ZA 3FX0A 1QLED 5AVRB 4IL6X 3Q3DA 1K9MQ 3OW2O 1L0LD 2QIWA 2QJKC 2IFNA 5CCGD 2FXPA 4H0LC 1LTIC 2ZAEB 1CZQA 4ZNCA 1FZCB 3AE1C 3VMZA 2QSIA 1SQBE 1FZEA 3M06A 1LP1A 4U3FJ 1Q82Q 3RK2C 2ZXXA 1JCDA 1M7LA 2XNXA 1SQXG 1M1JB 3I56P 3MHVA 5KLVE 1Y47A 3L35A 3H1ID 1FOSE 5DJUB 2QRXA 4Z1MH 5GTIH 1L0LG 4AUWA 2E76D 1PGPA 3CWBE 3H1LG 2WQYC 1FC2C 3HTKB 3G4SP 1U7MA 2ZVNB 3CX5D 1M1KQ 3BCCD 3GF7A 1CI6B 1KILC 1NTKG 1RQUA 2N1TB 3HD7B 3CWBJ 5H2FH 4NPDA 1EQ7A 2HFED 3L71E 1U7JA 3NXSA 1KZUB 5M1BA 2IZ1A 3L73E 4WWIA 4AYCA 1ZR2A 1VQ8P 4XFJA 1S9KE 1BDCA 1NTZG 2XZRA 2W83C 2FYUG 3TNUA 1NTKJ 2OYHA 3BRTB 2FFDB 1KILB 1KYOI 2J58A 2JWDA 2N1TC 3W68A 4LC1A 4HKZH 2ZYAA 3HD7D 1MUUA 2W27A 3L72D 3GMAA 4YTPC 2QM7A 1H8AA 1SQQG 2MJZA 1L0NG 1SP4A 1AA0A 1RF1B 1SQXJ 3JSVC 3FGAD 2XV5A 3M9HA 1NVOA 3B8EB 2D2CD 1VQLP 2E5TA 3SFDC 3TK1A 1DH3A 2KYVA 1AJYA 1NKZB 1RH5B 2E74B 2JDIH 1JOCA 2PP6A 2WSSH 4JYCA 1K05A 1KYOH 1MKMA 1NOHA 3IR9A 4YPCA 4ASWA 3C8VA 1KFNA 5KKZB 2R44A 2Q9IA 2OYHC 1BE3D 2P58A 2Q6QA 3IAOA 2FXOA 2HLOA 2XU6A 2RN0A 4GIFA 3H1IE 1YI2P 1YTZT 4ASVA 4BRYB 3L36A 3L74G 2N1TD 1VQ6P 1Q2NA 4N78E 4WY4B 1GL2C 1YQ4C 3AEAC 3L75J 1AQ5A 1JY2P 2IFMA 5KKZC 1H0TB 1OVVA 3CXHH 1GU4A 4HH2A 1YIJP 1AFOA 1DIPA 4H13C 3H1LD 3L74D 3VYIA 2WPRA 1KQGB 3GG2A 4UB8E 5KLVJ 1KV4A 3U59A 2KK7A 3TNUB 1E5WA 3V4WA 4PD4H 4PD4D 5B5EE 1KD1Q 2RMZA 2E75D 3L70E 3S1KA 2CK3H 1BGYG 1P84E 5E79E 2HYNA 2WSFJ 1KB9H 2M3BA 1PGJA 1KQSO 1BSNA 1KQFB 3WU2H 3G9RA 3VTPC 2OTKE 1LT9B 1L0NJ 1RF0C 3AE3C 1S5LE 3OA7A 4BXLA 5GTIE 1VF5D 3V2RA 3CCVP 2KS1B 1SQVK 1KB9D 4H44D 1IFNA 1SQQD 1QVGO 2A45G 2B88A 3PP5A 3S9OA 2KLVA 4D6TG 1YITP 1DD3A 1FU1A 4IFMA 2DW3A 3H1KJ 4PJ0E 2LXCB 2W6BA 1Z56A 3HUSB 2W90A 1JY3O 2WSEH 2OYIB 1AQTA 1KILA 1KYOE 3AE7C 4N3YB 1JY2N 3USSA 1J1DB 4I7ZB 4A7PA 3G6EP 5AVYB 2A06G 2ZYDA 3D71A 2PGDA 1L4AB 2M3EA 1JUNA 2AEJA 3M0DA 2KOGA 3V5BA 5APSA 1NJIQ 1D7MA 2O01H 3AEEC 1DEBA 4I6MC 1PGQA 2E75C 1TU3F 2QG4A 1AVYA 1NTME 4D6TD 2OYHB 3GLMA 4EYYQ 1ZMEC 4ZKPA 3IFMA 3CCQP 1EZVG 2V7QJ 3L71D 1YJWP 4GOFA 3H1IJ 2R3CA 2H8PD 2FYZA 3H1JJ 4PV1B 1HJ0A 3F5HA 3CCRP 1KMIZ 1S9KD 2KSEA 5AW2B 1FZGA 1JB0J 2B87B 2WPVB 3MP7B 2C0WA 2O1JA 2A45I 2BASA 1S4XA 3A0HE 3AECC 3N4XA 3KZIH 2K3RA 1QL2A 1VQOP 1ZW0A 4M3LA 5CBNA 3HRNA 2K88A 2KNCB 3CX5E 3TDKA 5CCGA 1N73A 3JC22 3MUDA 1FZCC 1SVFA 1Y9BA 5EFWB 2WSCH 1P84H 1SQBJ 2AEMA 2LXBA 2WVRA 3AE5C 1LTTC 2RKLA 3E1IA 4U3FE 1VQKP 3CMEP 1FAVA 1RY3A 1S2EA 2QJYC 1NU1D 3H1JE 3L70D 3P8MC 4L74A 2KP8A 3KYQA 3VOPA 3R2PA 5KTBA 2HPCB 3CD6P 4DT0A 1N8RQ 5CCGC 3CXHE 1N7LA 1RE4C 1SQPE 2I1KA 5APVA 5AW3B 2E74C 3H1HG 1OWAA 5APQA 4RO0A 2AXTE 3CCSP 1IFJA 4PV1D 3P8CD 4N6JA 1L4AA 2QJYB 4C7NB 5L8RJ 2BCCE 1SQXD 4L73A 1Q81Q 3RK2D 1FDOA 2Z4EA 2UWJE 1LT9A 5GTHH 1QVFO 1L2PA 1X79B 3M91A 1PGOA 3EWKA 3HE5A 2PAJA 1JM0A 2C9NY 3AE4C 3V4QA 1S3JA 3L73D 1FZCA 2WWWA 5CHXA 1KYOD 2KB7P 2W8ZA 3TSIA 5KLVD 2QA4P 1GU5A 1BE3E 2E43A 1ZLLA 4EDFA 3A0BE 2Y0EA 1M1JA 3BRVB 3LW5J 3A3YB 1BE3J 4PJ0H 1Q7YQ 1IC2A 1NH4A 2OTJP 1LTJA
chains in the Genus database with same CATH topology
2WPQA 1MFZA 1NTMK 2WITA 4DZOA 1SFCC 4IFDK 2LKMA 5AVTB 3V2PA 2OYHA 2QM8A 2ZFCA 1LTBC 4KHXA 1RF1C 2HPCA 1G2CB 3HE4A 1URQC 3EFGA 1SFCB 4XE5B 3M9QA 3HD7C 5AW5B 3B5NB 4EOTA 3GHGA 3SWYA 1JMMA 4IFFA 1HGZA 1NHLA 1L0NK 1J1EB 3KPEA 1XTGB 3RK3B 2I1JA 1L0LK 3HD7A 1N7SC 3NFQA 4W80A 3GHGC 3VN0A 3VMXA 2OYIC 1GK6A 2HG5D 1N73C 1NTZK 1FJKA 1HWTC 3RK3C 2NPSD 1LT9C 2J59M 1GW3A 1N7SA 3P32A 4LGDE 2WSFH 2YKPA 1T3UA 3L4FA 3VMYA 4I1LA 3HE4B 1NO4A 2WT7A 4EIJA 1N2DC 1LGHB 4HYTB 1JY3N 3VP8A 5BU5A 1JY2O 1SFCA 2FXMA 3RK3D 4Y99C 1ZN5A 5APYA 2C9LY 4WY4A 1HBWA 3B5ND 1JTHA 2WPSA 5KJ7C 2L5GB 1FZAA 3BASA 5BVZA 1X8YA 1T3JA 1YTZI 1SQXK 1T2KC 5AVXB 1RF1A 2Q3IA 1IFIA 2Q7CA 1G1IA 5KJ7A 1JCCA 4W7YA 5CCHA 3HE5B 2JJLA 1PFIA 2H7HA 1RE4A 1LTAC 1FDMA 2A45H 1NTKK 1GD2E 2IPPA 5AVQB 3V2QA 2P7JA 2W6AA 2WT7B 5KLVK 1GL2A 3LIDA 2WTYA 2YKOA 1YYCA 2GM4A 3RK2B 5CJ4A 5APXA 2M8RA 1KFMA 3TYYA 1W2EA 3H32A 1SQQK 2YO2A 3BATA 3WMM0 1MZ9A 3NTNA 4LLHA 5CCHC 1JTHB 3I5CA 1FBMA 3RL0C 1IK9A 5AW1B 1ZR4A 1WT6A 1RF0A 1JO5A 2R5BA 1NAFA 1WRGA 2Z5IA 1URQA 4N78D 1GTWA 2OYIA 4WB4A 2NPSA 1LWUB 1OXZA 4GT1A 5AVVB 2E42A 1FOSF 2N9BA 1LTGC 5AW4B 1ZV8A 2FFDA 5CMZA 1LTJA 1GZLA 1FZBA 1HH0A 1VDFA 1LTSC 4I2LC 4C7NA 1FJPA 3M0AA 1NWQA 3H32B 5APUA 1NU1K 5CJ0A 3KQGA 1HTLC 1QL1A 4ZKUA 3MIWA 4Y99B 1SFCD 1J1EC 5AW7B 1MV8A 1H89A 4WBAA 2P67A 1LTJC 2Q5UA 1JY3P 1FZFA 5AW8B 5APTA 1N73B 5BU8B 1NKNA 3KDPB 3VP9A 2O1KA 1GW4A 2YO3A 1HGVA 1URQB 2NPSB 3CL3D 1G2CA 2POHA 1G1JA 3LIEA 1IFMA 3CI9A 2P2UA 1GL2D 2XKMA 1CW5A 3GHGB 2NPSC 2CPBA 4XA4A 2FYUK 4WY4D 1N7SB 3LW5H 1SLQA 2R5DA 3A2AA 3UIAA 2FFDC 2OARA 2HODA 1N86A 5APWA 3CLQA 2H43A 3HUSA 1GL2B 4B86A 3MGNA 4C46A 2YMYA 3G3ZA 1KQLA 1SQBK 3OAKA 4JYBA 3T97A 1H88A 1URQD 3B5NC 3MD0A 3V2NA 4C7RA 3NMDA 1L4AD 3A7OA 3SWFA 3EQ2A 4WY4C 2FKWB 5AW9B 1N7SD 1J2JB 5AVWB 1IJDB 3U1AA 1T2KD 1GK4A 4RESB 1SQPK 1LWUA 3II6A 5AVZB 5AW0B 2HODB 2C0XA 3P7KA 2KSJA 3OJAB 5AVUB 1DX7A 3BVHA 1GDTA 2XDJA 4JF7A 4DOJA 1RE3A 4O9BA 2WZ7A 1HVVA 4OH8B 3C9IA 1HUCA 3L37A 3P8CE 1M1JC 5CCHD 1A02J 3HUSC 1RE3C 2YNYA 2GUVA 3A5TA 4W7ZA 3RL0D 1LWUC 1CSBA 2IX7C 1X9VA 5AVSB 1KILD 1IO4A 2GUSA 4GKGA 3O8ZA 2Z5HA 1CI6A 2N1TA 2YKQA 5KJ7D 1J1DC 3HTKA 1L4AC 2P1JA 5AW6B 2ZXEB 3MTUE 3N7NA 3U1CA 3M0DC 3H6PA 1IFDA 1XTCC 2VRSA 1JNMA 1A02F 3B5NA 2CPSA 2JEEA 1LTJB 3M9BA 4AQRD 1VPCA 1T8ZA 5AVRB 5CCGD 2IFNA 1LTIC 1CZQA 1FZCB 3VMZA 3M06A 1FZEA 3RK2C 1JCDA 1M7LA 2XNXA 1M1JB 3L35A 1FOSE 4AUWA 3HTKB 3RL0B 1CI6B 1KILC 2N1TB 3HD7B 1EQ7A 2HFED 3NXSA 1KZUB 1ZR2A 4AYCA 1S9KE 2XZRA 3TNUA 3BRTB 2FFDB 1KILB 2J58A 2N1TC 4LC1A 3HD7D 1MUUA 2W27A 2QM7A 1H8AA 2MJZA 1SP4A 1RF1B 2XV5A 3M9HA 3B8EB 3TK1A 1DH3A 2KYVA 1NKZB 2PP6A 1JOCA 4JYCA 3IR9A 1NOHA 1KFNA 2Q9IA 2OYHC 2HLOA 2XU6A 4GIFA 1YTZT 3L36A 2N1TD 4N78E 4WY4B 1GL2C 1AQ5A 1JY2P 2IFMA 1GU4A 4HH2A 1AFOA 3VYIA 2WPRA 3U59A 3V4WA 3TNUB 1E5WA 2HYNA 2M3BA 3VTPC 1LT9B 1RF0C 3OA7A 3V2RA 1SQVK 1IFNA 2A45G 3PP5A 2KLVA 1FU1A 4IFMA 2W6BA 1Z56A 3HUSB 2WSEH 1JY3O 1KILA 4N3YB 1JY2N 1J1DB 5AVYB 1L4AB 1JUNA 3M0DA 2KOGA 3V5BA 5APSA 2O01H 2OYIB 1DEBA 4I6MC 2OYHB 4ZKPA 3IFMA 2R3CA 2H8PD 2FYZA 1S9KD 1FZGA 5AW2B 2C0WA 2O1JA 2A45I 2BASA 3N4XA 1QL2A 4M3LA 3HRNA 1N73A 5CCGA 1FZCC 3MUDA 1SVFA 2WSCH 3E1IA 1LTTC 1FAVA 1RY3A 3P8MC 3VOPA 5KTBA 2HPCB 3KYQA 3R2PA 5CCGC 5AW3B 1N7LA 1RE4C 2I1KA 5APVA 1HJBA 1OWAA 5APQA 1IFJA 3P8CD 4N6JA 1L4AA 4C7NB 1NH4A 2Z4EA 3RK2D 1LT9A 1X79B 3M91A 3HE5A 2PAJA 2C9NY 3V4QA 1FZCA 2WWWA 5CHXA 3TSIA 2KB7P 1GU5A 2E43A 1ZLLA 1M1JA 3BRVB 3A3YB 1IC2A 2R32A 2KP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QL1 A;  1QL2 A;  2IFN A;  2IFM A;  1PFI A;  1IFM A;  1IFN A;  2KSJ A;  2KLV A;  3IFM A;  2XKM A;  4IFM A;  1ZN5 A; 
#chains in the Genus database with same CATH topology
 2FYU J;  3B4S A;  3E1R A;  1NTZ J;  2IYP A;  1MFZ A;  1NTM K;  2WPQ A;  2WIT A;  1YBK A;  3ZDM A;  1Y8A A;  3TGU E;  3WUV A;  4H44 B;  4DZO A;  1SFC C;  2E76 C;  1L0L E;  4IFD K;  2KNC A;  2LKM A;  3CWB G;  3H1L E;  3AE6 C;  5AVT B;  5KLI C;  2QM8 A;  2ZFC A;  1LTB C;  3V2P A;  4KHX A;  4YXW H;  4K35 A;  1VQP P;  1NTK E;  3Q2Y A;  1G2C B;  3HE4 A;  2HPC A;  1PP9 E;  3H1L J;  3PHL A;  1NAY A;  1NTK D;  1IZN B;  1URQ C;  2M5A B;  4TLF A;  3MZW B;  3EFG A;  1SFC B;  4XE5 B;  5DJT B;  3M9Q A;  3HD7 C;  5AW5 B;  3B5N B;  2IBZ E;  2O01 J;  4EOT A;  2FYU E;  2RH0 A;  3GHG A;  3SWY A;  3K5B A;  1JMM A;  2KUB A;  4UB8 H;  1EDK A;  3L75 E;  4IFF A;  1HGZ A;  1NHL A;  3AE8 C;  3L72 J;  2SPZ A;  1L0N K;  4HJG H;  1J1E B;  2W6J H;  1PPJ E;  3KPE A;  2O01 N;  2G3A A;  1XTG B;  2YXQ B;  3RK3 B;  1SQQ E;  2I1J A;  1L0L K;  1L0N E;  2D2C C;  3HD7 A;  4BWN A;  1N7S C;  1NTZ D;  1S1C X;  3NFQ A;  3R4Y A;  3GHG C;  4W80 A;  3VMX A;  3VN0 A;  2HR3 A;  2K9J A;  2OYI C;  1GK6 A;  2HG5 D;  1N73 C;  1NTZ K;  4U7J A;  1FJK A;  2IZ0 A;  3MUD C;  2J5U A;  4H0L B;  3RK3 C;  1HWT C;  2ZT9 B;  3CXH I;  2NPS D;  3CCU P;  5KAI H;  1W5C E;  1LT9 C;  1UIX A;  2J59 M;  3PH0 A;  1SQX E;  1VL2 A;  1GW3 A;  1BCC G;  1EC5 A;  1N7S A;  2Y0D A;  3H1K G;  3P32 A;  3PTZ A;  4RJT A;  4LGD E;  3RBZ A;  1EZV I;  3L74 E;  2WSF H;  1NTM D;  1X22 A;  1T3U A;  2I8D A;  2KLU A;  2YKP A;  3L4F A;  3VMY A;  3Q1M A;  1EXJ A;  4I1L A;  3FXE A;  4GDO A;  3HE4 B;  2E76 B;  1H0T A;  1FE6 A;  1NO4 A;  2JP3 A;  2WT7 A;  3H1J D;  2L91 A;  4EIJ A;  1N2D C;  2G8Y A;  3S4R A;  1LGH B;  1DEE G;  4KT0 J;  4HYT B;  3PRJ A;  1JY3 N;  1NU1 E;  4PD4 I;  3L73 G;  1M8O B;  2WMM A;  3VP8 A;  5BU5 A;  1JY2 O;  3ITK A;  1EDL A;  1SFC A;  2FXM A;  4K3A A;  1AVO A;  1BGY E;  3TGU D;  3RK3 D;  3CCM P;  4Y99 C;  1ZN5 A;  4BRY A;  1W2B O;  1T6A A;  2FY8 A;  5APY A;  3RL0 B;  2C9L Y;  2OYO A;  4NPF X;  4WY4 A;  1HJB A;  1JEK A;  3SSU A;  3G71 P;  1HBW A;  3L70 J;  2BCC J;  3B5N D;  2M0B A;  3PJS K;  2AXT H;  2XND H;  3KZI E;  1JTH A;  3AE2 C;  3AE9 C;  1LT1 A;  2QE7 H;  2WPS A;  2Y0C A;  5KJ7 C;  2L5G B;  1BCC J;  1IFP A;  1FZA A;  1VQM P;  2E75 B;  3BAS A;  3VMA A;  1DD4 A;  5BVZ A;  1X8Y A;  1T3J A;  1YTZ I;  3BCC G;  2K1A A;  1SQX K;  1P84 D;  3AEF C;  5AVX B;  1FS0 E;  1T2K C;  1RF1 A;  2Q3I A;  1IFI A;  2OGU A;  2Q7C A;  3AED C;  1G1I A;  5KJ7 A;  1JCC A;  3L71 J;  4W7Y A;  5CCH A;  3CC2 P;  3HE5 B;  2JJL A;  3H1I G;  1PFI A;  1K73 Q;  2H7H A;  1RE4 A;  3TGU J;  1OW8 A;  1LTA C;  1SQV G;  4CPG A;  4IL6 E;  1FDM A;  2PFX A;  2BEZ F;  2A45 H;  3L72 G;  1NTK K;  1GD2 E;  2IPP A;  5AVQ B;  4DCK A;  1NTM G;  3E7K A;  5K5G B;  3V2Q A;  1R5S A;  3O6Q B;  2P7J A;  1QGK B;  3QH9 A;  2W6A A;  2WT7 B;  5KLV K;  2A06 D;  3GW6 A;  1M90 Q;  1GL2 A;  2BEQ D;  3LID A;  2WTY A;  2KIK A;  1EXI A;  2YKO A;  1KN7 A;  1YYC A;  2K37 A;  2GM4 A;  1RQV A;  2QEX P;  3RK2 B;  2YIU C;  5CJ4 A;  1USD A;  2IBZ I;  5APX A;  1X0T A;  2M8R A;  3H1K D;  3T97 B;  1KFM A;  1PPJ D;  4MN4 C;  3TYY A;  1W2E A;  2QJP C;  3AEB C;  3H32 A;  1SQQ K;  2E5Y A;  2YO2 A;  3A0B H;  3BAT A;  3WUT A;  3CMA P;  3CC4 P;  5TIS H;  1WMK A;  1E79 H;  1YJ9 P;  1PL5 A;  1MZ9 A;  1L0L J;  3WMM 0;  1SQP D;  1LP1 B;  3NTN A;  4LLH A;  5CCH C;  1M57 D;  1OMI A;  2JWA A;  1JTH B;  5C39 A;  1OVR A;  1FBM A;  3I5C A;  3RL0 C;  1IK9 A;  5AW1 B;  1ZR4 A;  2QVA A;  3FXD A;  1WT6 A;  1ZXG A;  1RF0 A;  2E74 D;  4GOE A;  1PZQ A;  1JO5 A;  2R5B A;  1NAF A;  1S5L H;  4OVN F;  4QMA A;  1WRG A;  2Z5I A;  5KLI B;  1Q90 D;  3L73 J;  1URQ A;  4N78 D;  1SS1 A;  4R4M A;  3B71 A;  1GTW A;  4WB4 A;  2KZJ A;  2NPS A;  3KHU A;  2OYI A;  2KZI A;  2QJK B;  1LWU B;  1OXZ A;  4GT1 A;  5AVV B;  2E42 A;  1PIX A;  1OZH A;  2N9B A;  1LTG C;  4JBZ A;  4UB6 H;  5AW4 B;  4Y28 J;  4EI2 A;  1FOS F;  4OGQ C;  1VQ9 P;  1ZV8 A;  1VQ4 P;  1KIL E;  3H1H J;  2FFD A;  2H89 C;  1R5L A;  1P84 I;  3CX5 I;  5CMZ A;  1GZL A;  4NPE A;  5GTH E;  1VF5 B;  1YJN P;  1FZB A;  1HH0 A;  1ZP0 C;  1VDF A;  2FYU D;  1LTS C;  2KI7 B;  4HB1 A;  4I2L C;  4C7N A;  2YXR B;  3CC7 P;  2D2C B;  3FWL A;  1FJP A;  2ZJS E;  3M0A A;  4PV1 C;  4ZMD A;  3H32 B;  5APU A;  1NU1 K;  5CJ0 A;  3KQG A;  1HTL C;  1QL1 A;  1SQB G;  3MIW A;  4Y99 B;  1YQ3 C;  1U57 A;  2JO1 A;  1R8E A;  1SFC D;  1J1E C;  4JPZ B;  5AW7 B;  1MV8 A;  4DJG A;  5KLV G;  1H89 A;  2AXC A;  4H0L D;  4OWF A;  4WBA A;  2P67 A;  1LTJ C;  2ZYG A;  4H44 C;  2Q5U A;  1JY3 P;  1FZF A;  5H2F E;  5AW8 B;  5APT A;  1KB9 I;  2ITA A;  4UB6 E;  2M5A A;  3W67 A;  1N73 B;  4YXD C;  5BU8 B;  5KAF H;  1NKN A;  3KDP B;  2IBZ G;  2ZT9 C;  3RL0 g;  1EZV D;  2O1K A;  3CWB D;  3L71 G;  1USE A;  2FBW C;  3VP9 A;  3IN6 A;  1GW4 A;  3WUU A;  1NGM B;  2WSC J;  2YO3 A;  1NTZ E;  1URQ B;  1HGV A;  1PPJ G;  1BCC D;  3ABV C;  3F89 A;  3JCU H;  3CCJ P;  3Q5S A;  1OFC X;  2NPS B;  3CL3 D;  1G2C A;  1S5L X;  1G1J A;  2POH A;  3V6I A;  1NWQ A;  3LIE A;  1IFM A;  3CI9 A;  4WVZ A;  2P2U A;  1GL2 D;  1M56 D;  2XKM A;  1CW5 A;  3GHG B;  3CXH D;  2OQQ A;  2IBZ D;  2NPS C;  1BE3 G;  5B66 H;  2CPB A;  2V7Q H;  4IL6 H;  4XA4 A;  2FYU K;  2P10 A;  4WY4 D;  3WU2 E;  4D6T E;  1N7S B;  1NTM J;  3H1K E;  3LW5 H;  3Q5R A;  2B9B A;  2O3J A;  2PRR A;  1SLQ A;  1PP9 D;  2KXP B;  2R5D A;  1SQV D;  3A2A A;  2OAR A;  4U3F D;  5TJH A;  3TGU G;  3UIA A;  2FFD C;  2V4H A;  2HOD A;  1N86 A;  1KTM A;  5APW A;  3CLQ A;  2H43 A;  1NYH A;  2NRG A;  3HUS A;  1GL2 B;  4B86 A;  2GA1 A;  2ZT9 D;  3MGN A;  4IOI H;  1BGY J;  4C46 A;  1PP9 G;  2YMY A;  3G3Z A;  1NU1 G;  1KQL A;  1SQB K;  3OAK A;  4JYB A;  3L75 D;  3T97 A;  2OTL P;  2B89 A;  1BDD A;  4L75 A;  5CBO A;  1LNQ A;  1HF9 A;  2K9Y A;  1H88 A;  1URQ D;  4L76 A;  1KB9 E;  3I55 P;  2KS1 A;  5B66 E;  1EZV E;  3B5N C;  3MD0 A;  3V2N A;  3RGU A;  1EDI A;  2R3S A;  3IF4 A;  3SFE C;  3L70 G;  4C7R A;  3NMD A;  1L4A D;  1OVU A;  3L74 J;  4TT3 H;  3EFF K;  1YHQ P;  1PP9 J;  4RKU J;  1GMJ A;  3A7O A;  3SWF A;  2YIU B;  4PD4 E;  3EQ2 A;  2JKV A;  4WY4 C;  5B5E H;  2B87 A;  2FKW B;  1VQ7 P;  5AW9 B;  1N7S D;  1J2J B;  5AVW B;  1IJD B;  3BCC E;  3U1A A;  3Q5P A;  1T2K D;  1VF5 C;  1GK4 A;  3H25 A;  1RF1 C;  4RES B;  1SQP K;  1LWU A;  3H1J G;  1BCC E;  1FDI A;  1OIP A;  2FYN B;  3II6 A;  5AVZ B;  5KAF E;  3CCL P;  5AW0 B;  2IYO A;  1KC8 Q;  1SQP G;  1SQQ J;  1ZRT E;  2C0X A;  2HOD B;  3P7K A;  4GOD A;  2JR8 A;  2KSJ A;  1OW7 A;  1L0N D;  1ZRT D;  3H1H D;  3OJA B;  5AVU B;  1MFT A;  1PV3 A;  5KAI E;  3BVH A;  1DX7 A;  1UII A;  1GDT A;  2FYN C;  2A06 E;  2XDJ A;  3JCU E;  1RE3 A;  4JF7 A;  1LJ2 A;  1OW6 A;  2WZ7 A;  4O9B A;  4DOJ A;  3BCC J;  1RHZ B;  1HVV A;  4H13 D;  2BCC D;  4OH8 B;  3C9I A;  1HUC A;  3CX5 H;  3L37 A;  3P8C E;  1EDJ A;  1M1J C;  2R32 A;  5CCH D;  1K04 A;  1A02 J;  3A0H H;  1Q86 Q;  3HUS C;  1RE3 C;  3PLN A;  3CCE P;  4JQ0 D;  2ZVO B;  1SQP J;  3D6Y A;  4D6T J;  2YNY A;  2GUV A;  3A5T A;  2Y9Y A;  4W7Z A;  3RL0 D;  1S72 P;  1LWU C;  2WSE J;  2QJP B;  1CSB A;  3KXD A;  2IX7 C;  1X9V A;  2MKV A;  3O6Q A;  5AVS B;  3CPW O;  1AV1 A;  1KIL D;  1SQV J;  3SWK A;  2GUS A;  4ZKU A;  4OGQ B;  4KJM A;  1IO4 A;  1QEX A;  2N9Y B;  3O8Z A;  4GKG A;  1VQ5 P;  1BSH A;  2IDB A;  2Z5H A;  3C1L A;  1CI6 A;  2N1T A;  2YKQ A;  4R4L A;  4U3F G;  2NZ2 A;  5KJ7 D;  1J1D C;  4I7Z C;  3D6Z A;  2LR2 A;  1BGY D;  2Q3E A;  4H13 B;  3GF3 A;  3HTK A;  3RK3 E;  3D70 A;  2Q1K A;  1L4A C;  2P1J A;  5AW6 B;  2AEF A;  2ZXE B;  2Y9Z A;  3QWO C;  3MTU E;  4OGQ D;  1JMB A;  3N7N A;  2H88 C;  3FWN A;  1VQN P;  1OX3 A;  3U1C A;  3M0D C;  5E79 H;  3H1H E;  1KOR A;  1SQV E;  3H6P A;  1IFD A;  3RBX A;  1SQB D;  1IK7 A;  1XTC C;  2K9J B;  2VRS A;  3L72 E;  3L75 G;  3TF5 A;  1JNM A;  2BCC G;  1K8A Q;  1A02 F;  3B5N A;  1ZOY C;  2CPS A;  3AEG C;  5TIS E;  2YMK A;  2JEE A;  1LTJ B;  1NU1 J;  1QX8 A;  3M9B A;  1VPC A;  4AQR D;  1T8Z A;  3FX0 A;  1QLE D;  5AVR B;  4IL6 X;  3Q3D A;  1K9M Q;  3OW2 O;  1L0L D;  2QIW A;  2QJK C;  2IFN A;  5CCG D;  2FXP A;  4H0L C;  1LTI C;  2ZAE B;  1CZQ A;  4ZNC A;  1FZC B;  3AE1 C;  3VMZ A;  2QSI A;  1SQB E;  1FZE A;  3M06 A;  1LP1 A;  4U3F J;  1Q82 Q;  3RK2 C;  2ZXX A;  1JCD A;  1M7L A;  2XNX A;  1SQX G;  1M1J B;  3I56 P;  3MHV A;  5KLV E;  1Y47 A;  3L35 A;  3H1I D;  1FOS E;  5DJU B;  2QRX A;  4Z1M H;  5GTI H;  1L0L G;  4AUW A;  2E76 D;  1PGP A;  3CWB E;  3H1L G;  2WQY C;  1FC2 C;  3HTK B;  3G4S P;  1U7M A;  2ZVN B;  3CX5 D;  1M1K Q;  3BCC D;  3GF7 A;  1CI6 B;  1KIL C;  1NTK G;  1RQU A;  2N1T B;  3HD7 B;  3CWB J;  5H2F H;  4NPD A;  1EQ7 A;  2HFE D;  3L71 E;  1U7J A;  3NXS A;  1KZU B;  5M1B A;  2IZ1 A;  3L73 E;  4WWI A;  4AYC A;  1ZR2 A;  1VQ8 P;  4XFJ A;  1S9K E;  1BDC A;  1NTZ G;  2XZR A;  2W83 C;  2FYU G;  3TNU A;  1NTK J;  2OYH A;  3BRT B;  2FFD B;  1KIL B;  1KYO I;  2J58 A;  2JWD A;  2N1T C;  3W68 A;  4LC1 A;  4HKZ H;  2ZYA A;  3HD7 D;  1MUU A;  2W27 A;  3L72 D;  3GMA A;  4YTP C;  2QM7 A;  1H8A A;  1SQQ G;  2MJZ A;  1L0N G;  1SP4 A;  1AA0 A;  1RF1 B;  1SQX J;  3JSV C;  3FGA D;  2XV5 A;  3M9H A;  1NVO A;  3B8E B;  2D2C D;  1VQL P;  2E5T A;  3SFD C;  3TK1 A;  1DH3 A;  2KYV A;  1AJY A;  1NKZ B;  1RH5 B;  2E74 B;  2JDI H;  1JOC A;  2PP6 A;  2WSS H;  4JYC A;  1K05 A;  1KYO H;  1MKM A;  1NOH A;  3IR9 A;  4YPC A;  4ASW A;  3C8V A;  1KFN A;  5KKZ B;  2R44 A;  2Q9I A;  2OYH C;  1BE3 D;  2P58 A;  2Q6Q A;  3IAO A;  2FXO A;  2HLO A;  2XU6 A;  2RN0 A;  4GIF A;  3H1I E;  1YI2 P;  1YTZ T;  4ASV A;  4BRY B;  3L36 A;  3L74 G;  2N1T D;  1VQ6 P;  1Q2N A;  4N78 E;  4WY4 B;  1GL2 C;  1YQ4 C;  3AEA C;  3L75 J;  1AQ5 A;  1JY2 P;  2IFM A;  5KKZ C;  1H0T B;  1OVV A;  3CXH H;  1GU4 A;  4HH2 A;  1YIJ P;  1AFO A;  1DIP A;  4H13 C;  3H1L D;  3L74 D;  3VYI A;  2WPR A;  1KQG B;  3GG2 A;  4UB8 E;  5KLV J;  1KV4 A;  3U59 A;  2KK7 A;  3TNU B;  1E5W A;  3V4W A;  4PD4 H;  4PD4 D;  5B5E E;  1KD1 Q;  2RMZ A;  2E75 D;  3L70 E;  3S1K A;  2CK3 H;  1BGY G;  1P84 E;  5E79 E;  2HYN A;  2WSF J;  1KB9 H;  2M3B A;  1PGJ A;  1KQS O;  1BSN A;  1KQF B;  3WU2 H;  3G9R A;  3VTP C;  2OTK E;  1LT9 B;  1L0N J;  1RF0 C;  3AE3 C;  1S5L E;  3OA7 A;  4BXL A;  5GTI E;  1VF5 D;  3V2R A;  3CCV P;  2KS1 B;  1SQV K;  1KB9 D;  4H44 D;  1IFN A;  1SQQ D;  1QVG O;  2A45 G;  2B88 A;  3PP5 A;  3S9O A;  2KLV A;  4D6T G;  1YIT P;  1DD3 A;  1FU1 A;  4IFM A;  2DW3 A;  3H1K J;  4PJ0 E;  2LXC B;  2W6B A;  1Z56 A;  3HUS B;  2W90 A;  1JY3 O;  2WSE H;  2OYI B;  1AQT A;  1KIL A;  1KYO E;  3AE7 C;  4N3Y B;  1JY2 N;  3USS A;  1J1D B;  4I7Z B;  4A7P A;  3G6E P;  5AVY B;  2A06 G;  2ZYD A;  3D71 A;  2PGD A;  1L4A B;  2M3E A;  1JUN A;  2AEJ A;  3M0D A;  2KOG A;  3V5B A;  5APS A;  1NJI Q;  1D7M A;  2O01 H;  3AEE C;  1DEB A;  4I6M C;  1PGQ A;  2E75 C;  1TU3 F;  2QG4 A;  1AVY A;  1NTM E;  4D6T D;  2OYH B;  3GLM A;  4EYY Q;  1ZME C;  4ZKP A;  3IFM A;  3CCQ P;  1EZV G;  2V7Q J;  3L71 D;  1YJW P;  4GOF A;  3H1I J;  2R3C A;  2H8P D;  2FYZ A;  3H1J J;  4PV1 B;  1HJ0 A;  3F5H A;  3CCR P;  1KMI Z;  1S9K D;  2KSE A;  5AW2 B;  1FZG A;  1JB0 J;  2B87 B;  2WPV B;  3MP7 B;  2C0W A;  2O1J A;  2A45 I;  2BAS A;  1S4X A;  3A0H E;  3AEC C;  3N4X A;  3KZI H;  2K3R A;  1QL2 A;  1VQO P;  1ZW0 A;  4M3L A;  5CBN A;  3HRN A;  2K88 A;  2KNC B;  3CX5 E;  3TDK A;  5CCG A;  1N73 A;  3JC2 2;  3MUD A;  1FZC C;  1SVF A;  1Y9B A;  5EFW B;  2WSC H;  1P84 H;  1SQB J;  2AEM A;  2LXB A;  2WVR A;  3AE5 C;  1LTT C;  2RKL A;  3E1I A;  4U3F E;  1VQK P;  3CME P;  1FAV A;  1RY3 A;  1S2E A;  2QJY C;  1NU1 D;  3H1J E;  3L70 D;  3P8M C;  4L74 A;  2KP8 A;  3KYQ A;  3VOP A;  3R2P A;  5KTB A;  2HPC B;  3CD6 P;  4DT0 A;  1N8R Q;  5CCG C;  3CXH E;  1N7L A;  1RE4 C;  1SQP E;  2I1K A;  5APV A;  5AW3 B;  2E74 C;  3H1H G;  1OWA A;  5APQ A;  4RO0 A;  2AXT E;  3CCS P;  1IFJ A;  4PV1 D;  3P8C D;  4N6J A;  1L4A A;  2QJY B;  4C7N B;  5L8R J;  2BCC E;  1SQX D;  4L73 A;  1Q81 Q;  3RK2 D;  1FDO A;  2Z4E A;  2UWJ E;  1LT9 A;  5GTH H;  1QVF O;  1L2P A;  1X79 B;  3M91 A;  1PGO A;  3EWK A;  3HE5 A;  2PAJ A;  1JM0 A;  2C9N Y;  3AE4 C;  3V4Q A;  1S3J A;  3L73 D;  1FZC A;  2WWW A;  5CHX A;  1KYO D;  2KB7 P;  2W8Z A;  3TSI A;  5KLV D;  2QA4 P;  1GU5 A;  1BE3 E;  2E43 A;  1ZLL A;  4EDF A;  3A0B E;  2Y0E A;  1M1J A;  3BRV B;  3LW5 J;  3A3Y B;  1BE3 J;  4PJ0 H;  1Q7Y Q;  1IC2 A;  1NH4 A;  2OTJ P;  1LTJ A; 
#chains in the Genus database with same CATH homology
 2WPQ A;  1MFZ A;  1NTM K;  2WIT A;  4DZO A;  1SFC C;  4IFD K;  2LKM A;  5AVT B;  3V2P A;  2OYH A;  2QM8 A;  2ZFC A;  1LTB C;  4KHX A;  1RF1 C;  2HPC A;  1G2C B;  3HE4 A;  1URQ C;  3EFG A;  1SFC B;  4XE5 B;  3M9Q A;  3HD7 C;  5AW5 B;  3B5N B;  4EOT A;  3GHG A;  3SWY A;  1JMM A;  4IFF A;  1HGZ A;  1NHL A;  1L0N K;  1J1E B;  3KPE A;  1XTG B;  3RK3 B;  2I1J A;  1L0L K;  3HD7 A;  1N7S C;  3NFQ A;  4W80 A;  3GHG C;  3VN0 A;  3VMX A;  2OYI C;  1GK6 A;  2HG5 D;  1N73 C;  1NTZ K;  1FJK A;  1HWT C;  3RK3 C;  2NPS D;  1LT9 C;  2J59 M;  1GW3 A;  1N7S A;  3P32 A;  4LGD E;  2WSF H;  2YKP A;  1T3U A;  3L4F A;  3VMY A;  4I1L A;  3HE4 B;  1NO4 A;  2WT7 A;  4EIJ A;  1N2D C;  1LGH B;  4HYT B;  1JY3 N;  3VP8 A;  5BU5 A;  1JY2 O;  1SFC A;  2FXM A;  3RK3 D;  4Y99 C;  1ZN5 A;  5APY A;  2C9L Y;  4WY4 A;  1HBW A;  3B5N D;  1JTH A;  2WPS A;  5KJ7 C;  2L5G B;  1FZA A;  3BAS A;  5BVZ A;  1X8Y A;  1T3J A;  1YTZ I;  1SQX K;  1T2K C;  5AVX B;  1RF1 A;  2Q3I A;  1IFI A;  2Q7C A;  1G1I A;  5KJ7 A;  1JCC A;  4W7Y A;  5CCH A;  3HE5 B;  2JJL A;  1PFI A;  2H7H A;  1RE4 A;  1LTA C;  1FDM A;  2A45 H;  1NTK K;  1GD2 E;  2IPP A;  5AVQ B;  3V2Q A;  2P7J A;  2W6A A;  2WT7 B;  5KLV K;  1GL2 A;  3LID A;  2WTY A;  2YKO A;  1YYC A;  2GM4 A;  3RK2 B;  5CJ4 A;  5APX A;  2M8R A;  1KFM A;  3TYY A;  1W2E A;  3H32 A;  1SQQ K;  2YO2 A;  3BAT A;  3WMM 0;  1MZ9 A;  3NTN A;  4LLH A;  5CCH C;  1JTH B;  3I5C A;  1FBM A;  3RL0 C;  1IK9 A;  5AW1 B;  1ZR4 A;  1WT6 A;  1RF0 A;  1JO5 A;  2R5B A;  1NAF A;  1WRG A;  2Z5I A;  1URQ A;  4N78 D;  1GTW A;  2OYI A;  4WB4 A;  2NPS A;  1LWU B;  1OXZ A;  4GT1 A;  5AVV B;  2E42 A;  1FOS F;  2N9B A;  1LTG C;  5AW4 B;  1ZV8 A;  2FFD A;  5CMZ A;  1LTJ A;  1GZL A;  1FZB A;  1HH0 A;  1VDF A;  1LTS C;  4I2L C;  4C7N A;  1FJP A;  3M0A A;  1NWQ A;  3H32 B;  5APU A;  1NU1 K;  5CJ0 A;  3KQG A;  1HTL C;  1QL1 A;  4ZKU A;  3MIW A;  4Y99 B;  1SFC D;  1J1E C;  5AW7 B;  1MV8 A;  1H89 A;  4WBA A;  2P67 A;  1LTJ C;  2Q5U A;  1JY3 P;  1FZF A;  5AW8 B;  5APT A;  1N73 B;  5BU8 B;  1NKN A;  3KDP B;  3VP9 A;  2O1K A;  1GW4 A;  2YO3 A;  1HGV A;  1URQ B;  2NPS B;  3CL3 D;  1G2C A;  2POH A;  1G1J A;  3LIE A;  1IFM A;  3CI9 A;  2P2U A;  1GL2 D;  2XKM A;  1CW5 A;  3GHG B;  2NPS C;  2CPB A;  4XA4 A;  2FYU K;  4WY4 D;  1N7S B;  3LW5 H;  1SLQ A;  2R5D A;  3A2A A;  3UIA A;  2FFD C;  2OAR A;  2HOD A;  1N86 A;  5APW A;  3CLQ A;  2H43 A;  3HUS A;  1GL2 B;  4B86 A;  3MGN A;  4C46 A;  2YMY A;  3G3Z A;  1KQL A;  1SQB K;  3OAK A;  4JYB A;  3T97 A;  1H88 A;  1URQ D;  3B5N C;  3MD0 A;  3V2N A;  4C7R A;  3NMD A;  1L4A D;  3A7O A;  3SWF A;  3EQ2 A;  4WY4 C;  2FKW B;  5AW9 B;  1N7S D;  1J2J B;  5AVW B;  1IJD B;  3U1A A;  1T2K D;  1GK4 A;  4RES B;  1SQP K;  1LWU A;  3II6 A;  5AVZ B;  5AW0 B;  2HOD B;  2C0X A;  3P7K A;  2KSJ A;  3OJA B;  5AVU B;  1DX7 A;  3BVH A;  1GDT A;  2XDJ A;  4JF7 A;  4DOJ A;  1RE3 A;  4O9B A;  2WZ7 A;  1HVV A;  4OH8 B;  3C9I A;  1HUC A;  3L37 A;  3P8C E;  1M1J C;  5CCH D;  1A02 J;  3HUS C;  1RE3 C;  2YNY A;  2GUV A;  3A5T A;  4W7Z A;  3RL0 D;  1LWU C;  1CSB A;  2IX7 C;  1X9V A;  5AVS B;  1KIL D;  1IO4 A;  2GUS A;  4GKG A;  3O8Z A;  2Z5H A;  1CI6 A;  2N1T A;  2YKQ A;  5KJ7 D;  1J1D C;  3HTK A;  1L4A C;  2P1J A;  5AW6 B;  2ZXE B;  3MTU E;  3N7N A;  3U1C A;  3M0D C;  3H6P A;  1IFD A;  1XTC C;  2VRS A;  1JNM A;  1A02 F;  3B5N A;  2CPS A;  2JEE A;  1LTJ B;  3M9B A;  4AQR D;  1VPC A;  1T8Z A;  5AVR B;  5CCG D;  2IFN A;  1LTI C;  1CZQ A;  1FZC B;  3VMZ A;  3M06 A;  1FZE A;  3RK2 C;  1JCD A;  1M7L A;  2XNX A;  1M1J B;  3L35 A;  1FOS E;  4AUW A;  3HTK B;  3RL0 B;  1CI6 B;  1KIL C;  2N1T B;  3HD7 B;  1EQ7 A;  2HFE D;  3NXS A;  1KZU B;  1ZR2 A;  4AYC A;  1S9K E;  2XZR A;  3TNU A;  3BRT B;  2FFD B;  1KIL B;  2J58 A;  2N1T C;  4LC1 A;  3HD7 D;  1MUU A;  2W27 A;  2QM7 A;  1H8A A;  2MJZ A;  1SP4 A;  1RF1 B;  2XV5 A;  3M9H A;  3B8E B;  3TK1 A;  1DH3 A;  2KYV A;  1NKZ B;  2PP6 A;  1JOC A;  4JYC A;  3IR9 A;  1NOH A;  1KFN A;  2Q9I A;  2OYH C;  2HLO A;  2XU6 A;  4GIF A;  1YTZ T;  3L36 A;  2N1T D;  4N78 E;  4WY4 B;  1GL2 C;  1AQ5 A;  1JY2 P;  2IFM A;  1GU4 A;  4HH2 A;  1AFO A;  3VYI A;  2WPR A;  3U59 A;  3V4W A;  3TNU B;  1E5W A;  2HYN A;  2M3B A;  3VTP C;  1LT9 B;  1RF0 C;  3OA7 A;  3V2R A;  1SQV K;  1IFN A;  2A45 G;  3PP5 A;  2KLV A;  1FU1 A;  4IFM A;  2W6B A;  1Z56 A;  3HUS B;  2WSE H;  1JY3 O;  1KIL A;  4N3Y B;  1JY2 N;  1J1D B;  5AVY B;  1L4A B;  1JUN A;  3M0D A;  2KOG A;  3V5B A;  5APS A;  2O01 H;  2OYI B;  1DEB A;  4I6M C;  2OYH B;  4ZKP A;  3IFM A;  2R3C A;  2H8P D;  2FYZ A;  1S9K D;  1FZG A;  5AW2 B;  2C0W A;  2O1J A;  2A45 I;  2BAS A;  3N4X A;  1QL2 A;  4M3L A;  3HRN A;  1N73 A;  5CCG A;  1FZC C;  3MUD A;  1SVF A;  2WSC H;  3E1I A;  1LTT C;  1FAV A;  1RY3 A;  3P8M C;  3VOP A;  5KTB A;  2HPC B;  3KYQ A;  3R2P A;  5CCG C;  5AW3 B;  1N7L A;  1RE4 C;  2I1K A;  5APV A;  1HJB A;  1OWA A;  5APQ A;  1IFJ A;  3P8C D;  4N6J A;  1L4A A;  4C7N B;  1NH4 A;  2Z4E A;  3RK2 D;  1LT9 A;  1X79 B;  3M91 A;  3HE5 A;  2PAJ A;  2C9N Y;  3V4Q A;  1FZC A;  2WWW A;  5CHX A;  3TSI A;  2KB7 P;  1GU5 A;  2E43 A;  1ZLL A;  1M1J A;  3BRV B;  3A3Y B;  1IC2 A;  2R32 A;  2KP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...