2IFQA

Crystal structure of s-nitroso thioredoxin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
105
structure length
104
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASEEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Buried s-nitrosocysteine revealed in crystal structures of human thioredoxin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 33
structure length 104
sequence length 105
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ifqA00
4IBPA 2M72A 1JLWA 4TOPA 2NBSA 4FYBA 4OFMA 5B8AA 4NXIA 1PKWA 2YWIA 4TR1A 3C71A 1O73A 2V32A 1F3BA 3IE3A 1RK4A 4ZB6A 3FW2A 4NV5A 2GVPA 1LU4A 1K3YA 4GF0A 3VWVA 1X9WB 2N5BA 1PGTA 3SWLA 1XFLA 1AAZA 5KN2A 3ERWA 4KCAA 2HSYA 1T7PB 1RW1A 2HT9A 4YQVA 3JCML 4ML1A 3RBTA 1AC1A 3GX0A 4EDZA 2PUKC 2K18A 2HI7A 1WOUA 4PUAA 1AQVA 4RI7A 3GSTA 1OC8A 1TW9A 2VM2A 3DYRA 3AY8A 4IJ3A 1SENA 5ECHB 2JU5A 1F6MC 4ML6A 5DQYA 4GTUA 4TXVA 2BJXA 5F0GA 5ECQB 4MJAA 2YWNA 4ZB9A 3CRTA 5CO3A 1X9SB 1T00A 4XS1A 3GURA 1YY7A 3IRAA 1R26A 2GTUA 3TJBA 4BPYA 4F2IA 1N8JA 1QFNA 2D2ZA 2LRCA 4L5LA 2IJYA 1OKDA 1ERWA 3U5RE 3UOMA 2LSTA 2CAIA 3J7Yk 5DQSA 1TTZA 3CTGA 1XOBA 3KIJA 1IYIA 4GSTA 1B9XC 5IMDA 1MD3A 5IMVA 2P0GA 2DIZA 3CYNA 6GSVA 4KB3A 4H86A 5A4WA 2DJ3A 3VWXA 2RM6A 2ZUPA 7GSSA 5F06A 1ZYQB 3GL3A 5J3RA 1KBNA 3FEUA 4XHMA 1SD8A 2N5AA 3H8QA 1V9WA 2RM5A 3IPZA 2YP6A 2MBTA 2I4AA 1ZYEA 2B7KA 1GRXA 2L5OA 2IN3A 2LRTA 1K3OA 1K0MA 2VUPA 4JBBA 5G31A 1NM3A 2P31A 3GSSA 2NDOA 2IWTA 3Q6OA 3HCZA 2WDUA 4K8MA 1X5DA 4MJCA 4F0CA 4LL4B 1H4OA 2VCXA 3FK8A 1KEBA 3O6TA 3P2AA 4TR1B 1M9BA 2GQMA 1ZMAA 4LA1A 3IV4A 4KSMA 3NZNA 5KN1A 3GKNA 3EYTA 5ECMB 2OBIA 3HVVA 2GT5A 4GXZA 4WETA 1VF2A 4TW5A 4NWYA 3ZZXA 4N11A 2H8LA 1WMJA 4Q5QA 3EURA 2TRCP 3D21A 3KJYA 1GTUA 3UARA 6GSWA 3HZ8A 3G7IA 1YEPA 1G7OA 4WKWA 4KH7A 1FO5A 1Z6NA 4BWSA 4ID0A 3RPNA 1A2JA 5G1LA 1SK0A 4L0UA 3CMIA 2X99A 1SK2A 4K0GA 1T4ZA 3HA9A 4NHWA 3BJ5A 2H75A 3RDWA 4TVEA 3FHKA 2FWHA 1K0DA 2JACA 1ZOFA 5IO2A 5G5FA 4KNDA 5DAKA 3TUEA 2PBJA 2YCDA 5LD0A 1AUCA 3E0UA 3QAVA 2H0HA 3KMNA 4MCUA 3KH7A 1Z5YE 2QC7A 3ZMKA 4IP1A 2HZEA 2LNTA 1SU9A 3GNJA 4HQSA 4OCFA 5CRWA 4MMMA 3M8NA 1SKRB 2IMDA 11GSA 3LORA 4Z7XA 1CQGA 1XXUA 1SYXA 3D5JA 3HJPA 4HS1A 1S3CA 5HR1A 3IOSA 4TR0A 1SJZA 3TGZA 3ZL5A 2F3MA 1AIUA 4L5OA 3UBKA 4MF7A 1FB6A 1WJKA 2VD0A 6GSUA 4OMVA 2FHEA 1B4QA 2DJ1A 2LUSA 3PH9A 4IQAA 4WEYA 2H6XA 1XCCA 3Q74A 4IGJA 4MK3A 1GWCA 4TRXA 5C04A 2HYXA 1LJRA 1NHYA 5HR3A 3FR9A 4V1Ap 3FZ4A 9GSSA 1QQ2A 1Q4JA 3ME7A 3MSZA 3ZLPA 3F8UA 1X9MB 4G9HA 1JZRA 1U88A 2GDRA 3FZ9A 3UIWA 1TI1A 1J9BA 2XC2A 4MZCA 4ZIJA 3F4RA 3QAWA 4PGTA 3ZIVA 2C80A 2IL3A 3E9JB 5AGYA 5ECOB 4PX1A 4K6XA 3TKPA 3H1NA 3LEFA 3HYPA 4CHSA 3LXTA 4HZ2A 4I97A 3E3EA 5CYYA 2LJKA 2XPDA 3WGEA 1O7UA 4IJIA 3FZ5A 4L0WA 4NPBA 2I9HA 1WE0A 3HD5A 4NMUA 4ZBBA 2YZHA 1K0NA 2R37A 2JZSA 3DD3A 3G7YA 4RQRA 3TJFA 5JWRB 3GKKA 3PR8A 4BVXA 3K8NA 2VAFA 4HUAA 5DAKB 2FNOA 2H72A 2OE1A 3ISOA 5IM9A 5KN0A 4IELA 2J23A 3IXRA 5CP1A 1KNGA 2GS3A 4LMWA 3TOTA 4PQHA 1J0FA 4O32A 5DDLA 2HZEB 4F0BA 4HZ4A 5HQPA 3VLNA 4MPFA 1AQWA 5IOWA 4JE1A 1THOA 2AUVA 3GN3A 2C0FA 4KAEA 4MA9A 2B3SA 4P3YB 1K0CA 5H5QA 4AJ8A 3F3RA 4POKA 2L59A 1XBSA 3EMPA 3EE2A 3O3TA 3BCKA 1ST9A 3FR3A 3FR6A 3Q19A 3ME8A 2B1LA 4KDUA 5EL8A 1EOGA 1R5AA 1OKTA 3VI5A 4DSSA 4JZQA 2HLSA 1OC9A 2GT6A 1AQXA 2IPAA 1K0OA 2OE3A 3KP9A 5JCGA 2MMNA 4JR6A 4IP6A 2IMFA 5J5NA 2PVOC 5D8IA 1V57A 3I69A 4KDXA 2H74A 2O85A 1GNEA 5COHA 4AF2A 1V58A 1BG5A 1QUWA 2JZTA 4MPGA 2K6VA 2RUEA 4X1UA 3UAPA 5EPFA 4ECJA 3ZVJA 4V2NA 3N9JA 1PRXA 4BA7A 3IK7A 2MZCA 2X64A 1GSYA 2LQQA 2H66A 2VLUA 3ZTLA 1XVQA 2PU9C 2F9SA 4JEDA 5ELAA 3BOAA 2YOIA 2GZYA 2R4VA 1ERUA 1F37A 2FY6A 2X8CA 2L6DA 1HQOA 4EO3A 1ZCPA 1RQMA 2KOKA 2V1MA 4K9ZA 2GQKA 2H0IA 5IIZA 3DMLA 1KTEA 2B7JA 3KH9A 2CA8A 1O85A 5IMAA 3TRPA 5IMFA 1FW1A 2CVBA 2JSZA 4V2LA 3A5WA 1HNAA 4KGIA 2AJQB 4K7IA 1EEJA 1FG4A 3UVHA 2AYTA 1UN2A 3L0HA 5ELGA 3Q18A 2KHPA 4ILFA 1EOHA 3L9VA 2YANA 2PERA 3P8WA 4IVFA 2N5FA 3VWWA 5ECKB 2KP2A 1QMVA 1H75A 1M2DA 3GHAA 3HJOA 4XRAA 1GSUA 2F8AA 2PMTA 2LKUA 4O92A 1B48A 3QFAC 3TKSC 4MDCA 2B1KA 4MP4A 2E0QA 4IW9A 3GUSA 1PQNA 1YF1A 2HFDA 2MMOA 2YWMA 3P90A 3TJGA 1Y6EA 1QK8A 4DSSB 1OC9B 3N5OA 4ZILA 5IPHA 1GUMA 4BVYA 1F9MA 4RQXA 4HEA2 2LV3A 2C0GA 2DC5A 1GLQA 1XWGA 2LRNA 4Q5FA 2ALBA 2MMZA 1PN9A 2WGRA 4ZBDA 2K8VA 3VWUA 3A2VA 2FD3A 2VCQA 5F05A 2HXKA 3OR5A 3O76A 4MZWA 2NPBA 1JLVA 3LJRA 1GUHA 4V2MA 3ZIJA 4HU7A 4XS4B 3GV1A 2REMA 3TRQA 4LMVA 1SD9A 4WXTA 5L71A 2H19A 3SBCA 4EKZA 2VCWA 5IMZA 1GTAA 2R5GA 1XWBA 4GSSA 4YQMA 2VM1A 1JFUA 2HRFA 5LNKe 1MDJA 2WFCA 2OKAA 1MD4A 1R5PA 3QPMA 1EGRA 2M80A 1MEKA 2X8HA 2P5QA 1F2EA 2WRTA 2QGVA 1GSEA 5A4VA 5D9TA 3EVIA 2HRNA 5D9WA 1TKDB 4I6XA 2DJKA 1DE2A 4HJMA 1XPVA 2K9FA 1ML6A 2CQ9A 3ZVJD 4EE0A 4ULXA 4NHZA 3RAZA 4YAVA 2I81A 2EIQA 5LCZA 5GZZB 4EL1A 4ECCA 10GSA 2H73A 3CSJA 2I1UA 4EXJA 1B9YC 1TOFA 5AN1A 4OO4A 4N10A 1HD2A 1O8WA 2C3TA 1EP7A 3ZYWA 4HU9A 3GKMA 4L8EA 3DVWA 3EU4A 2JADA 4HOJA 4F9ZA 5IMCA 4PNGA 1NSWA 3U6VA 3QFBC 3TJJA 5D73A 4YQUA 1TRSA 2CVKA 1G0TA 2B5YA 4KDYA 3D22A 5D9VA 19GSA 3QAGA 3D0ZA 1MTCA 3L9SA 1ABAA 1R7HA 2RUFA 3F4SA 1YKAA 4FYCA 3QCPA 5FWGA 1WPIA 1V98A 4KSOA 4X43A 2E2MA 4POLA 1UC7A 1GSFA 5ECSA 1TI3A 2IMIA 3GX8A 4WBRD 2DJJA 3VK9A 4PQIA 2A2RA 4PXOA 1A8YA 2QKEA 4ZL7A 4GRFA 3WT2A 4K0NA 5G5EA 3L4NA 2CV4A 5ECIB 1NHOA 4ISDA 4DVCA 4Q5NA 2VL9A 5DJMA 3NOFA 4MH2A 3QMXA 3L78A 2TIRA 12GSA 1HYUA 1ZZYA 3UVTA 1BQ7A 3CTFA 1W4VA 1BYEA 2C0EA 3BCIA 5INYA 1A0RP 3R2QA 2H01A 1EGOA 3RHBA 3CSHA 4IHUA 2ON5A 3F6FA 2GSTA 1UVZA 4WF5A 1EP8A 1XWKA 3D6IA 3HXSA 5IOXA 5JCUA 3HVSA 2IIYA 5E4WA 3TJKA 5EY6A 2C1YA 2Z9SA 1XVWA 3TCOA 5ID2A 4K2DA 2RLIA 2H1BA 5G1KA 5ABRA 2GSQA 1HNCA 1TK0B 1TJDA 1PL1A 1WRYA 1U3IA 1FOVA 2TRXA 2B6MA 4RI6A 1DSBA 2J9HA 2LJRA 2EIOA 2XBIA 3F6DA 3IAS2 2DMMA 2M46A 4WF4A 2FWFA 1QGVA 2F51A 2YJHA 3DEXA 4EDYA 2L5LA 3GYKA 3EMXA 3EU3A 2KLXA 5ECRB 4KX4A 5HR2A 4MJBA 1EV9A 2VLTA 3DIEA 4FIWA 4HDEA 4YH2A 3W8SA 5FHIA 2IMEA 4MZBA 1GNWA 1XW5A 3TKRA 4EF0A 5C00A 1VGLA 3IBHA 3CRUA 4J57E 5E59A 2P5RA 3EINA 1CQHA 5DJLA 1FAAA 13GSA 4K7OA 3ZMLA 1Z7PA 2WULA 1E2YA 4TKYA 1BJXA 2JSYA 5HFGA 3GMFA 1OVNA 4DSRA 2XBQA 1GSQA 1PKZA 4J2FA 1XWCA 2WB9A 3D4MA 4KW6A 2GZZA 3QD9A 2VLVA 2R2JA 1S3DA 1O81A 3CBUA 1WWJA 3KCMA 1EV4A 1X0RA 2G2QA 4TXOA 3IR4A 3IC4A 1A24A 4XCSA 3HY2A 1X5EA 3UEMA 2CZ3A 2OACA 1B8XA 2VIMA 5G30A 1TU8A 1GTIA 2WJUA 3F4TA 1NW2A 2HNLA 1YDKA 3US3A 1U6TA 2H70A 2OADA 4J56E 2BMXA 3BBYA 5CRGA 1TRUA 2DLXA 4EUYA 4MABA 1DE1A 3PINA 3ZFLA 2OA7A 1TP9A 6GSSA 3RPPA 20GSA 3IDVA 1O8XA 4K1FA 2IFQA 3TOUA 1EEMA 1X5CA 3WYWA 14GSA 5ENUA 3TKSA 4WBJA 1A2MA 1O6JA 4EC0A 5DCHA 2C4JA 3LQ7A 5AIXA 2CVDA 2PGTA 2WS2A 4TR3A 4N0ZA 1ZGNA 2H30A 1FVKA 4ZL8A 3WD6A 4NV2A 5JWOB 1ILOA 1FVJA 4XS4A 4GSNA 1R4WA 2K8SA 4E8HA 3GKXA 5ID2B 2E7PA 2YWOA 1U87A 1OE7A 1PL2A 3LFLA 2A2SA 2PPTA 3APQA 3I43A 3DXBA 1F3AA 5ECLB 3G9BA 4EVMA 1G6YA 3GH6A 5AISA 3DWVA 1JZDA 1YQ1A 3ZREA 5GSSA 2FA4A 3QOUA 1VF4A 5CREA 1YF0A 3KGKA 3L9UA 2MMAA 5CRHA 4PURA 2HSHA 4N0VA 4O7HA 1ACVA 5EVOA 2FUG2 1SL2B 1OAZA 1FB0A 5G2ZA 4TN8A 2VD1A 2GGTA 2HE3A 2CT6A 3TKSE 3F0IA 3QR6A 4QL7A 5B6MA 4OCEA 1GSDA 4MLYA 1M99A 3TRXA 3BD2A 4OD7A 2LTKA 1S3AA 2C3NA 3IHQA 5F8BA 4XRDA 2KP1A 1LBKA 3M0FA 2VL2C 3CXGA 1SKSB 4KE3A 2GSSA 2FGXA 4IQ1A 4WR5A 3GH9A 1BX9A 1TXXA 4JU5A 3HZ4A 4AGSA 4TXOB 3C7MA 1MDIA 4F03A 3HJMA 1A23A 1A2LA 1SJIA 1XW6A 3KMOA 3LG6A 2O89A 2MYGA 2LJAA 4FO5A 3LGCA 1AW9A 2JL4A 1WP0A 2CAQA 4JRRA 5B7CA 4I2TA 1YZXA 4HQZA 3KZQA 3HHVA 3EC3A 2RIIA 3MAKA 2NTOA 2C8UA 2IFQB 1GLPA 2LQOA 2QSIA 2R3XA 5J4UA 1TRVA 3I6AA 3C73A 1M2BA 3FY7A 2H6ZA 5KEJA 4G2EA 4FH8A 1Q98A 3UL3A 1VF1A 1OC3A 2YN1A 2YPMA 2F8FA 2AV4A 4HI7A 5JWQB 2PWJA 1JZWA 2DJ0A 1W89A 1BEDA 1UA5A 6GSTA 1K3LA 2AAWA 3MWHA 1I9DA 3KP8A 3KD0A 2XHFA 2O8VB 1YJ6A 3DKSA 3EWLA 4DEJA 1VRSD 2EC4A 2O7KA 5B8BA 3ZFBA 3PGTA 1DBYA 4PUFC 4XS6A 3WT1A 3ED3A 4XIHA 4MF5A 1DUGA 6GSYA 2O87A 2GSRA 5DCGA 3VI7A 1C72A 4E8EA 1M2AA 4QL9A 4KUNA 1JHBA 3ERFA 4HJ2A 4ZL9A 4TR4A 2DSAA 3A3TA 5IPGA 1N2AA 4IN0A 1B4PA 2B5EA 4PQ1A 4DSQA 1GULA 3UBLA 2KUCA 3GFKA 1Z3EA 3KM6A 1M9AA 1ZL9A 2E2GA 4BWQA 4GWRA 2AB6A 2CX4A 1V40A 4AJ7A 1XWAA 3H4KA 2L6CA 2FLSA 4KA0A 2WZ9A 2DJ2A 1T3BA 3LSZA 5GAND 3S9FA 2YV7A 2LS5A 1Z9HA 2EIRA 3FKFA 1ERTA 2LEGA 1PD21 3WGDA 3KTBA 3M1GA 4I8BA 2H76A 2PVQA 3APOA 1MDKA 2CX3A 1SKWB 5J9BA 4ZBAA 2H1GA 3H93A 1TU7A 3M9KA 5A5KA 2GZPA 2VOCA 2LNSA 4GQFA 1BAYA 4POMA 2FCHA 2L4QA 3QDNA 1K0AA 4N30A 5DALA 1T8EB 1TRWA 4ZXGA 4Q5RA 5HFIA 3G7JA 2VCTA 3W8JA 2XPEA 1Z6MA 2I3YA 2OBKA 5GSTA 4ACSA 1GH2A 1SJ6A 5F07A 5A4UA 4ECIA 5HR0A 3RHCA 5IO0A 3IK9A 4G19A 4POBA 1OE8A 4YAPA 1AXDA 3WGXA 1JZOA 3GRXA 3IAM2 2H6YA 3GL5A 4OWYA 1Z7RA 3LYPA 1T1VA 3ERGA 2GQLA 2DIYA 1QXHA 3D4TA 4OFTA 4V1Ag 3V1WA 3A2XA 3FYGA 2MBSA 1THXA 1TK5B 2YZUA 3FRCA 2ES7A 3W6GA 2V6OA 5J9CA 1XZOA 4ECBA 3KEBA 4LL1B 2B5XA 1GTBA 1GL8A 3HVXA 2AHEA 4D73A 5H5SA 3NIVA 2FWGA 3GTUA 1E6BA 2H1DA 22GSA 3CSIA 1J08A 5H5RA 3DVXA 1PA3A 3KXOA 4BL7A 3HKRA 3C1SA 4MJEA 3UMAA 1URMA 4F82A 4O5RA 1WIKA 2BTOT 5J41A 1GUKA 4MH3A 2VL3A 2ZCTA 1XIYA 2PN8A 3DGQA 3TB2A 1TK8B 3APSA 2DMLA 5B6NA 5DBQA 3I9V2 5ECNB 3LYKA 3VPQA 3DRNA 1XW9A 4OFNA 2VCZA 4PNFA 5D93A 1PX7A 1PX6A 1HNBA 5CNWA 2H71A 3ZITA 2JZRA 4I5QA 4CW9A 4LLRA 1ON4A 1PMTA 5CAXA 3IA1A 3F63A 6GSXA 1OYJA 4QQ7A 3F3QA 1TDIA 4JR4A 3MNGA 3A2WA 3LXZA 3KTLA 2A4VA 3M3MA 5D96A 4I2UA 4KCEA 3P7XA 4CDOA 2V41A 1XOAA 3GIXA 5GAPD 1IYHA 3VURA 1ERVA 5ECPB 3UJ1A 5CRDA 4IS0A 4AJ6A 4NAXA 2L4CA 2OE0A 3H79A 5DALB 1EZKA 3GA4A 1SYRA 3HDCA 1YEXA 1M0UA 2H1AA 1SL0B 1V2AA 2FA8A 3VPTA 4ZB8A 1GP1A 4FYUA 4MF6A 2FWEA 2YJ7A 2V2GA 2IMKA 5D9XA 2G0FA 3FZAA 1G7EA 5IQYA 1PSQA 3M9JA 2NVLA 1A0FA 3C8EA 1GSSA 17GSA 2C3QA 5AIVA 3J7Yb 1T4YA 2CZ2A 18GSA 4XTSA 1G6WA 4RUVA 3ZRDA 2VCVA 2DBCA 1I5GA 2WCIA 2R6KA 1YKCA 1SK1A 1Y25A 2VL2A 4K7NA 2C0DA 8GSSA 2ZNMA 1SL1B 2HZFA 4GCIA 2YNXA 3LWAA 2GLRA 3MDKA 1EWXA 4X0XA 3TKQA 4D73B 1A8LA 3C1RA 4OO5A 3GTUB 1VF3A 2YV9A 16GSA 4G10A 3TDGA 5KN3A 1USBA 5JCWA 5DVBA 2VO4A 3VFIA 1FHEA 1U3AA 1K0BA 2H0GA 2L57A 2ON7A 1M7TA 3F9UA 5FT3A 2OJLA 4GLTA 2X8GA 4WR4A 4GQCA 5HFKA 4IKHA 2V6KA
chains in the Genus database with same CATH superfamily
4IBPA 2X4AA 2M72A 1JLWA 4TOPA 2NBSA 4FYBA 2A2PA 1PN0A 4OFMA 5B8AA 4NXIA 1PKWA 2YWIA 4TR1A 3C71A 1O73A 2V32A 1F3BA 3IE3A 1RK4A 4ZB6A 2R0GA 3FW2A 4NV5A 2GVPA 1LU4A 1K3YA 4GF0A 3VWVA 1X9WB 2N5BA 1PGTA 3SWLA 1XFLA 1AAZA 5KN2A 3ERWA 4KCAA 2HSYA 1T7PB 1RW1A 2HT9A 4YQVA 3JCML 4ML1A 3RBTA 1AC1A 3GX0A 4EDZA 2PUKC 2K18A 2HI7A 1WOUA 4PUAA 1AQVA 4RI7A 3GSTA 1OC8A 1TW9A 2VM2A 3DYRA 3AY8A 4IJ3A 1SENA 5ECHB 2JU5A 1F6MC 4ML6A 5DQYA 4GTUA 4TXVA 2BJXA 5F0GA 5ECQB 4MJAA 2YWNA 4ZB9A 3CRTA 5CO3A 1X9SB 1T00A 4XS1A 3GURA 1YY7A 3IRAA 1R26A 2GTUA 3TJBA 4BPYA 4F2IA 1N8JA 1QFNA 2D2ZA 2LRCA 4L5LA 2IJYA 1OKDA 1ERWA 3U5RE 3UOMA 2LSTA 2CAIA 3J7Yk 5DQSA 1TTZA 3CTGA 1XOBA 3KIJA 1IYIA 4GSTA 1B9XC 5IMDA 1MD3A 5IMVA 2P0GA 2DIZA 3CYNA 6GSVA 4KB3A 4H86A 2X49A 5A4WA 2DJ3A 3VWXA 2RM6A 2ZUPA 7GSSA 5F06A 1ZYQB 3GL3A 5J3RA 1KBNA 3FEUA 4XHMA 1SD8A 2N5AA 3H8QA 1V9WA 2RM5A 3IPZA 2YP6A 2MBTA 2I4AA 1ZYEA 2B7KA 1GRXA 2L5OA 2IN3A 2LRTA 1K3OA 1K0MA 2VUPA 4JBBA 5G31A 1NM3A 2P31A 3GSSA 2NDOA 2IWTA 4O5UA 3Q6OA 3HCZA 2WDUA 4K8MA 1X5DA 4MJCA 4F0CA 4LL4B 1H4OA 2VCXA 3FK8A 1KEBA 3O6TA 3P2AA 4TR1B 1M9BA 2GQMA 1ZMAA 4LA1A 3IV4A 4KSMA 3NZNA 5KN1A 3GKNA 3EYTA 5ECMB 2OBIA 3HVVA 2GT5A 4GXZA 4WETA 1VF2A 4Z2TA 4TW5A 4NWYA 3ZZXA 4N11A 2H8LA 1WMJA 4Q5QA 3EURA 2TRCP 3D21A 3KJYA 1GTUA 3UARA 2R0PA 6GSWA 3HZ8A 3G7IA 1YEPA 1G7OA 4WKWA 4KH7A 1FO5A 1Z6NA 4BWSA 4ID0A 3RPNA 1A2JA 5G1LA 1SK0A 4L0UA 3CMIA 2X99A 1SK2A 4K0GA 1T4ZA 3HA9A 4NHWA 3BJ5A 2H75A 3RDWA 4TVEA 3FHKA 2FWHA 1K0DA 2JACA 1ZOFA 5IO2A 5G5FA 4KNDA 5DAKA 3TUEA 2PBJA 2YCDA 5LD0A 1AUCA 3E0UA 2DKHA 3QAVA 2H0HA 3KMNA 4MCUA 3KH7A 1Z5YE 2QC7A 3ZMKA 4IP1A 2HZEA 2LNTA 1SU9A 3GNJA 4HQSA 4OCFA 5CRWA 4MMMA 3M8NA 5BMUA 1SKRB 2IMDA 11GSA 3LORA 4Z7XA 1CQGA 1XXUA 1SYXA 3D5JA 3HJPA 4BVYB 4HS1A 1S3CA 5HR1A 3IOSA 4TR0A 1SJZA 3TGZA 3ZL5A 2F3MA 1AIUA 4L5OA 3UBKA 4MF7A 1FB6A 1WJKA 2VD0A 6GSUA 4OMVA 2FHEA 1B4QA 2DJ1A 2LUSA 3PH9A 4IQAA 4WEYA 2H6XA 1XCCA 3Q74A 4IGJA 4MK3A 1GWCA 4TRXA 5C04A 2HYXA 1LJRA 1NHYA 5HR3A 3FR9A 4V1Ap 3FZ4A 9GSSA 1QQ2A 1Q4JA 3MYDA 3ME7A 3MSZA 3ZLPA 3F8UA 1X9MB 4G9HA 1JZRA 1U88A 2GDRA 3FZ9A 3UIWA 1TI1A 1J9BA 2XC2A 4MZCA 4ZIJA 3F4RA 3QAWA 4PGTA 3ZIVA 2C80A 2IL3A 3E9JB 4KF9A 5AGYA 4PX1A 5ECOB 4K6XA 3TKPA 3H1NA 3LEFA 3HYPA 4CHSA 3LXTA 4HZ2A 4I97A 3E3EA 5CYYA 2LJKA 2XPDA 3WGEA 1O7UA 4IJIA 3FZ5A 4L0WA 4NPBA 2I9HA 1WE0A 3HD5A 4NMUA 4ZBBA 2YZHA 1K0NA 3FMWA 2R37A 2JZSA 3DD3A 3G7YA 4RQRA 3TJFA 5JWRB 3GKKA 3PR8A 4BVXA 3K8NA 2VAFA 3PPUA 4HUAA 5DAKB 2FNOA 2H72A 2OE1A 3ISOA 5IM9A 5KN0A 4IELA 2J23A 3IXRA 5CP1A 1KNGA 2GS3A 4LMWA 3TOTA 4PQHA 1J0FA 4O32A 5DDLA 2HZEB 4F0BA 4HZ4A 5HQPA 3VLNA 4MPFA 1AQWA 5IOWA 4JE1A 1THOA 2AUVA 4G0LA 3GN3A 2C0FA 4KAEA 4MA9A 2B3SA 4P3YB 1K0CA 5H5QA 4AJ8A 3F3RA 4POKA 2L59A 1XBSA 3EMPA 3EE2A 3O3TA 3BCKA 1ST9A 3FR3A 3FR6A 3Q19A 3ME8A 2B1LA 2DKIA 4KDUA 5EL8A 1EOGA 1R5AA 1OKTA 3VI5A 4DSSA 4JZQA 2HLSA 1OC9A 2GT6A 1AQXA 2IPAA 1K0OA 2OE3A 3KP9A 5JCGA 2MMNA 4JR6A 4IP6A 2IMFA 5J5NA 2PVOC 5D8IA 1V57A 3I69A 4KDXA 2H74A 2O85A 1GNEA 5COHA 4AF2A 1V58A 1BG5A 1QUWA 2JZTA 4MPGA 2K6VA 2RUEA 4X1UA 3UAPA 5EPFA 4ECJA 3ZVJA 4V2NA 3N9JA 1PRXA 4BA7A 3IK7A 2MZCA 2X64A 1GSYA 2R0CA 2LQQA 1PFOA 2H66A 2VLUA 3ZTLA 1XVQA 2PU9C 2F9SA 4JEDA 5ELAA 3BOAA 2YOIA 2GZYA 2R4VA 1ERUA 1F37A 3IHGA 4BVXB 2FY6A 2X8CA 2L6DA 1HQOA 4EO3A 1ZCPA 1RQMA 2KOKA 2V1MA 4K9ZA 2GQKA 2H0IA 5IIZA 3DMLA 1KTEA 2B7JA 3KH9A 2CA8A 1O85A 5IMAA 3TRPA 5IMFA 1FW1A 2CVBA 2JSZA 4V2LA 3A5WA 1HNAA 4KGIA 2AJQB 4K7IA 1EEJA 1FG4A 3UVHA 2AYTA 1UN2A 3L0HA 5ELGA 3Q18A 2KHPA 4ILFA 1EOHA 3L9VA 4K2XA 2YANA 2PERA 3LW9A 3P8WA 4IVFA 2N5FA 3VWWA 5ECKB 2KP2A 1QMVA 1H75A 1M2DA 3GHAA 3HJOA 4XRAA 1GSUA 2F8AA 2PMTA 2LKUA 4O92A 1B48A 3QFAC 3TKSC 4MDCA 2B1KA 4MP4A 2E0QA 4IW9A 4EIQA 3GUSA 1PQNA 1M3JA 1YF1A 2HFDA 2MMOA 2YWMA 3P90A 3TJGA 1Y6EA 1QK8A 4DSSB 1OC9B 3N5OA 4ZILA 5IPHA 1GUMA 4BVYA 1F9MA 4RQXA 4HEA2 2LV3A 1S3RA 2C0GA 2DC5A 1GLQA 1XWGA 2LRNA 4Q5FA 2ALBA 4G0KA 2MMZA 1PN9A 2WGRA 4ZBDA 2K8VA 3VWUA 3A2VA 2FD3A 2VCQA 5F05A 2HXKA 3OR5A 3O76A 4MZWA 2NPBA 1JLVA 3LJRA 1GUHA 4V2MA 3ZIJA 4HU7A 4XS4B 3GV1A 2REMA 3TRQA 4LMVA 1SD9A 1XG8A 4WXTA 5L71A 2H19A 3SBCA 4EKZA 2VCWA 5IMZA 4Z2UA 1GTAA 2R5GA 1XWBA 4GSSA 2VM1A 4YQMA 1JFUA 2HRFA 5LNKe 1MDJA 2WFCA 2OKAA 1MD4A 4MNNA 1R5PA 3QPMA 1EGRA 2M80A 1MEKA 2X8HA 2P5QA 1F2EA 2WRTA 2QGVA 1GSEA 5A4VA 5D9TA 3EVIA 2HRNA 5D9WA 1TKDB 4I6XA 2DJKA 1ZYPA 1DE2A 4HJMA 1XPVA 2K9FA 1ML6A 2CQ9A 3ZVJD 4EE0A 4ULXA 4NHZA 3RAZA 4YAVA 2I81A 2EIQA 5LCZA 4YKFA 5GZZB 4EL1A 4ECCA 10GSA 2H73A 3CSJA 2I1UA 4EXJA 1B9YC 1TOFA 5AN1A 4OO4A 4N10A 1HD2A 1O8WA 2C3TA 1EP7A 3ZYWA 4HU9A 3GKMA 4L8EA 3DVWA 3EU4A 2JADA 4HOJA 4F9ZA 5IMCA 4PNGA 1NSWA 3U6VA 3QFBC 3TJJA 5D73A 4YQUA 1TRSA 2CVKA 1G0TA 2B5YA 4KDYA 3D22A 5D9VA 19GSA 5KOWA 3QAGA 3D0ZA 1MTCA 3L9SA 1ABAA 1R7HA 2RUFA 3F4SA 1YKAA 4FYCA 3QCPA 5FWGA 1WPIA 1V98A 4KSOA 4X43A 2E2MA 4POLA 1UC7A 1GSFA 5ECSA 1TI3A 2IMIA 3GX8A 4WBRD 2DJJA 3VK9A 4PQIA 3CQFA 2A2RA 4PXOA 1A8YA 2QA1A 2QKEA 4ZL7A 4GRFA 3WT2A 4K0NA 5G5EA 3L4NA 2CV4A 5ECIB 1NHOA 4ISDA 4DVCA 4Q5NA 2VL9A 5DJMA 3NOFA 4MH2A 3QMXA 3L78A 2TIRA 12GSA 1HYUA 1ZZYA 3UVTA 1BQ7A 3CTFA 1W4VA 1BYEA 2C0EA 3BCIA 5INYA 1A0RP 2HSMA 3R2QA 2H01A 1EGOA 4K5SA 3RHBA 3CSHA 4IHUA 2ON5A 3F6FA 1M3IA 2GSTA 1UVZA 4WF5A 1EP8A 1XWKA 3D6IA 3HXSA 5IOXA 5JCUA 3HVSA 2IIYA 5E4WA 3TJKA 5EY6A 2C1YA 2Z9SA 1XVWA 3TCOA 5ID2A 4K2DA 2RLIA 2H1BA 5G1KA 5ABRA 2GSQA 1HNCA 1TK0B 1TJDA 1PL1A 1WRYA 1U3IA 1FOVA 2TRXA 2B6MA 4RI6A 1DSBA 2J9HA 2LJRA 2EIOA 2XBIA 3F6DA 3IAS2 2DMMA 2M46A 4WF4A 2FWFA 1QGVA 2F51A 2YJHA 3DEXA 4EDYA 2L5LA 4G0IA 2HRKA 3GYKA 3EMXA 3EU3A 2KLXA 5ECRB 4KX4A 5HR2A 4MJBA 1EV9A 2VLTA 3DIEA 4FIWA 4HDEA 4YH2A 3W8SA 5FHIA 2IMEA 4MZBA 1GNWA 1XW5A 3TKRA 4EF0A 5C00A 1VGLA 3IBHA 3CRUA 4J57E 5E59A 2P5RA 4YKGA 3EINA 1CQHA 5DJLA 1FAAA 13GSA 4K7OA 3ZMLA 2HRAA 1Z7PA 2WULA 1E2YA 4TKYA 1BJXA 2JSYA 5HFGA 3GMFA 1OVNA 4DSRA 2XBQA 1GSQA 1PKZA 4J2FA 1XWCA 2WB9A 3D4MA 4KW6A 2GZZA 3QD9A 2VLVA 2R2JA 1S3DA 1O81A 3CBUA 1WWJA 3KCMA 1EV4A 1X0RA 2G2QA 4TXOA 3IR4A 3IC4A 1A24A 4XCSA 3HY2A 1X5EA 3UEMA 2CZ3A 2OACA 1B8XA 2VIMA 5G30A 1TU8A 1GTIA 4Z2RA 2WJUA 3F4TA 1NW2A 2HNLA 1YDKA 3US3A 1U6TA 2H70A 2OADA 4J56E 2BMXA 3BBYA 5CRGA 1TRUA 2DLXA 4EUYA 4MABA 1DE1A 3PINA 3ZFLA 2OA7A 1TP9A 6GSSA 3RPPA 20GSA 3IDVA 1O8XA 4K1FA 2IFQA 3TOUA 1EEMA 1X5CA 3WYWA 14GSA 5ENUA 3TKSA 4WBJA 1A2MA 1O6JA 4EC0A 5DCHA 2C4JA 3LQ7A 5AIXA 2CVDA 2PGTA 2WS2A 4TR3A 4N0ZA 1ZGNA 2H30A 1ZYNA 1FVKA 4ZL8A 3WD6A 4NV2A 5JWOB 1ILOA 1FVJA 4XS4A 4GSNA 1R4WA 2K8SA 4E8HA 3GKXA 5ID2B 2E7PA 2YWOA 1U87A 1OE7A 1PL2A 3LFLA 2A2SA 2PPTA 3APQA 3I43A 3DXBA 1F3AA 5ECLB 3G9BA 4EVMA 1G6YA 3GH6A 5AISA 3DWVA 1JZDA 1YQ1A 3ZREA 5GSSA 2FA4A 3MIXA 3QOUA 1VF4A 5CREA 1YF0A 3KGKA 3L9UA 2MMAA 5CRHA 4PURA 2HSHA 4N0VA 4O7HA 4CY8A 1ACVA 5EVOA 2FUG2 1SL2B 1OAZA 1FB0A 5G2ZA 4TN8A 4BIKA 2VD1A 2GGTA 2HE3A 2CT6A 3TKSE 3F0IA 3QR6A 4QL7A 5B6MA 4OCEA 1GSDA 4MLYA 1M99A 3TRXA 3BD2A 4OD7A 2LTKA 1S3AA 3EPTA 2C3NA 3IHQA 5F8BA 4XRDA 2KP1A 1LBKA 3M0FA 2VL2C 3CXGA 1SKSB 4KE3A 2GSSA 2FGXA 4IQ1A 4WR5A 3GH9A 1BX9A 1TXXA 4JU5A 3HZ4A 4AGSA 4TXOB 3C7MA 1MDIA 4F03A 3HJMA 1A23A 1A2LA 1SJIA 1XW6A 3KMOA 3LG6A 2O89A 2MYGA 2LJAA 4FO5A 4K5RA 3LGCA 1AW9A 2JL4A 1WP0A 2CAQA 4JRRA 5B7CA 4EIPA 4I2TA 1YZXA 4HQZA 3KZQA 3HHVA 3EC3A 2RIIA 3MAKA 2NTOA 2C8UA 2IFQB 1GLPA 2LQOA 2QSIA 2R3XA 5J4UA 1TRVA 3I6AA 3C73A 1M2BA 3FY7A 2H6ZA 5KEJA 4G2EA 4FH8A 1Q98A 3UL3A 1VF1A 1OC3A 2YN1A 4HSCX 2YPMA 2F8FA 2AV4A 4HI7A 5JWQB 2PWJA 1JZWA 2DJ0A 1W89A 1BEDA 4ICYA 1UA5A 4CY6A 6GSTA 1K3LA 2AAWA 3MWHA 1I9DA 3KP8A 3KD0A 2XHFA 2O8VB 1YJ6A 3DKSA 3EWLA 4DEJA 1VRSD 2EC4A 2O7KA 5B8BA 3ZFBA 3PGTA 1DBYA 4PUFC 4XS6A 3WT1A 3ED3A 4XIHA 4MF5A 1DUGA 6GSYA 2O87A 2GSRA 5DCGA 3VI7A 1C72A 4E8EA 1M2AA 4QL9A 4KUNA 1JHBA 3ERFA 4O5QA 4HJ2A 4ZL9A 4TR4A 2DSAA 3A3TA 5IPGA 1N2AA 4IN0A 1B4PA 2B5EA 4PQ1A 4DSQA 1GULA 3UBLA 2KUCA 3GFKA 4X4JA 1Z3EA 3KM6A 1M9AA 1ZL9A 2E2GA 4BWQA 4GWRA 2AB6A 2CX4A 1V40A 4AJ7A 1XWAA 3H4KA 2L6CA 2FLSA 4KA0A 2WZ9A 2DJ2A 1T3BA 3LSZA 5GAND 3S9FA 2YV7A 2LS5A 1Z9HA 3R3EA 5KOXA 2EIRA 3FKFA 1ERTA 2LEGA 1PD21 3WGDA 3KTBA 3M1GA 4I8BA 2H76A 2PVQA 3APOA 1MDKA 2CX3A 1SKWB 5J9BA 4ZBAA 2H1GA 3H93A 1TU7A 3M9KA 5A5KA 2GZPA 2VOCA 2LNSA 4GQFA 1BAYA 4POMA 2FCHA 2A4HA 2L4QA 3QDNA 1K0AA 4N30A 5DALA 1T8EB 1TRWA 2UZ8A 4ZXGA 4Q5RA 5HFIA 3G7JA 5BRTA 2VCTA 3W8JA 2XPEA 1Z6MA 2I3YA 2OBKA 5GSTA 4ACSA 1GH2A 1SJ6A 5F07A 5A4UA 4ECIA 5HR0A 3RHCA 4A5PA 5IO0A 3IK9A 4G19A 4POBA 1OE8A 4YAPA 1AXDA 3WGXA 1JZOA 3GRXA 3IAM2 2H6YA 3GL5A 4OWYA 3IC8A 1Z7RA 3LYPA 1T1VA 3ERGA 4USSA 1FOHA 2GQLA 2DIYA 1QXHA 3D4TA 4PTSA 4OFTA 4V1Ag 3V1WA 3A2XA 3FYGA 2MBSA 1THXA 1TK5B 2YZUA 3FRCA 2ES7A 3W6GA 2V6OA 5J9CA 1XZOA 4ECBA 3KEBA 4LL1B 2B5XA 1GTBA 1GL8A 3HVXA 2AHEA 4D73A 5H5SA 3NIVA 2FWGA 3GTUA 1E6BA 2H1DA 22GSA 3CSIA 1J08A 5H5RA 3DVXA 1PA3A 3KXOA 4BL7A 3HKRA 3C1SA 4MJEA 3UMAA 1URMA 4F82A 4O5RA 1WIKA 2BTOT 5J41A 1GUKA 4MH3A 2VL3A 2ZCTA 1XIYA 2PN8A 3DGQA 3TB2A 1TK8B 3APSA 2DMLA 5B6NA 5DBQA 3I9V2 5ECNB 3LYKA 4FQUA 3VPQA 3DRNA 1XW9A 4OFNA 2VCZA 4PNFA 5D93A 1PX7A 1PX6A 1HNBA 5CNWA 2H71A 3ZITA 2JZRA 4I5QA 4CW9A 4LLRA 1ON4A 1PMTA 5CAXA 3IA1A 3F63A 6GSXA 1OYJA 4QQ7A 3F3QA 1TDIA 4JR4A 3MNGA 3A2WA 3LXZA 3KTLA 2A4VA 3M3MA 5D96A 4I2UA 4KCEA 3P7XA 4CDOA 2V41A 1XOAA 3GIXA 5GAPD 1IYHA 3VURA 1ERVA 5ECPB 3UJ1A 5CRDA 4IS0A 4AJ6A 4NAXA 2L4CA 2OE0A 3H79A 5DALB 1EZKA 3HVNA 3GA4A 1SYRA 3HDCA 1YEXA 1M0UA 2H1AA 1SL0B 1V2AA 2FA8A 3VPTA 4ZB8A 1GP1A 4FYUA 2QA2A 4MF6A 2FWEA 2YJ7A 2V2GA 2IMKA 5D9XA 2G0FA 3FZAA 1G7EA 5IQYA 1PSQA 3M9JA 2NVLA 1A0FA 3C8EA 1GSSA 17GSA 2C3QA 5AIVA 3J7Yb 1T4YA 2CZ2A 18GSA 4XTSA 1G6WA 4RUVA 3ZRDA 2VCVA 2DBCA 1I5GA 3A5IA 2WCIA 2R6KA 1YKCA 1SK1A 1Y25A 2VL2A 4K7NA 2C0DA 8GSSA 2ZNMA 1SL1B 2HZFA 4GCIA 2YNXA 3LWAA 2GLRA 3MDKA 1EWXA 4X0XA 3TKQA 4D73B 1A8LA 3C1RA 4OO5A 3GTUB 1VF3A 2YV9A 16GSA 4G10A 3TDGA 5KN3A 1USBA 5JCWA 5DVBA 4BL7B 2VO4A 3VFIA 1FHEA 1U3AA 1K0BA 2H0GA 2L57A 2ON7A 1M7TA 3F9UA 5FT3A 2OJLA 4GLTA 2X8GA 4WR4A 4GQCA 5HFKA 4IKHA 2V6KA
chains in the Genus database with same CATH topology
4IBPA 2X4AA 2M72A 1JLWA 4TOPA 2NBSA 4FYBA 2A2PA 1PN0A 4OFMA 5B8AA 4NXIA 1PKWA 2YWIA 4TR1A 3C71A 1O73A 2V32A 1F3BA 3IE3A 1RK4A 4ZB6A 2R0GA 3FW2A 4NV5A 2GVPA 1LU4A 1K3YA 4GF0A 3VWVA 1X9WB 2N5BA 1PGTA 3SWLA 1XFLA 1AAZA 5KN2A 3ERWA 4KCAA 2HSYA 1T7PB 1RW1A 2HT9A 4YQVA 3JCML 4ML1A 3RBTA 1AC1A 3GX0A 4EDZA 2PUKC 2K18A 2HI7A 1WOUA 4PUAA 1AQVA 4RI7A 3GSTA 1OC8A 1TW9A 2VM2A 3DYRA 3AY8A 4IJ3A 1SENA 5ECHB 2JU5A 1F6MC 4ML6A 5DQYA 4GTUA 4TXVA 2BJXA 5F0GA 5ECQB 4MJAA 2YWNA 4ZB9A 3CRTA 5CO3A 1X9SB 1T00A 4XS1A 3GURA 1YY7A 3IRAA 1R26A 2GTUA 3TJBA 4BPYA 4F2IA 1N8JA 1QFNA 2D2ZA 2LRCA 4L5LA 2IJYA 1OKDA 1ERWA 3U5RE 3UOMA 2LSTA 2CAIA 3J7Yk 5DQSA 1TTZA 3CTGA 1XOBA 3KIJA 1IYIA 4GSTA 1B9XC 5IMDA 1MD3A 5IMVA 2P0GA 2DIZA 3CYNA 6GSVA 4KB3A 4H86A 2X49A 5A4WA 2DJ3A 3VWXA 2RM6A 2ZUPA 7GSSA 5F06A 1ZYQB 3GL3A 5J3RA 1KBNA 3FEUA 4XHMA 1SD8A 2N5AA 3H8QA 1V9WA 2RM5A 3IPZA 2YP6A 2MBTA 2I4AA 1ZYEA 2B7KA 1GRXA 2L5OA 2IN3A 2LRTA 1K3OA 1K0MA 2VUPA 4JBBA 5G31A 1NM3A 2P31A 3GSSA 2NDOA 2IWTA 4O5UA 3Q6OA 3HCZA 2WDUA 4K8MA 1X5DA 4MJCA 4F0CA 4LL4B 1H4OA 2VCXA 3FK8A 1KEBA 3O6TA 3P2AA 4TR1B 1M9BA 2GQMA 1ZMAA 4LA1A 3IV4A 4KSMA 3NZNA 5KN1A 3GKNA 3EYTA 5ECMB 2OBIA 3HVVA 2GT5A 4GXZA 4WETA 1VF2A 4Z2TA 4TW5A 4NWYA 3ZZXA 4N11A 2H8LA 1WMJA 4Q5QA 3EURA 2TRCP 3D21A 3KJYA 1GTUA 3UARA 2R0PA 6GSWA 3HZ8A 3G7IA 1YEPA 1G7OA 4WKWA 4KH7A 1FO5A 1Z6NA 4BWSA 4ID0A 3RPNA 1A2JA 5G1LA 1SK0A 4L0UA 3CMIA 2X99A 1SK2A 4K0GA 1T4ZA 3HA9A 4NHWA 3BJ5A 2H75A 3RDWA 4TVEA 3FHKA 2FWHA 1K0DA 2JACA 1ZOFA 5IO2A 5G5FA 4KNDA 5DAKA 3TUEA 2PBJA 2YCDA 5LD0A 1AUCA 3E0UA 2DKHA 3QAVA 2H0HA 3KMNA 4MCUA 3KH7A 1Z5YE 2QC7A 3ZMKA 4IP1A 2HZEA 2LNTA 1SU9A 3GNJA 4HQSA 4OCFA 5CRWA 4MMMA 3M8NA 5BMUA 1SKRB 2IMDA 11GSA 3LORA 4Z7XA 1CQGA 1XXUA 1SYXA 3D5JA 3HJPA 4BVYB 4HS1A 1S3CA 5HR1A 3IOSA 4TR0A 1SJZA 3TGZA 3ZL5A 2F3MA 1AIUA 4L5OA 3UBKA 4MF7A 1FB6A 1WJKA 2VD0A 6GSUA 4OMVA 2FHEA 1B4QA 2DJ1A 2LUSA 3PH9A 4IQAA 4WEYA 2H6XA 1XCCA 3Q74A 4IGJA 4MK3A 1GWCA 4TRXA 5C04A 2HYXA 1LJRA 1NHYA 5HR3A 3FR9A 4V1Ap 3FZ4A 9GSSA 1QQ2A 1Q4JA 3MYDA 3ME7A 3MSZA 3ZLPA 3F8UA 1X9MB 4G9HA 1JZRA 1U88A 2GDRA 3FZ9A 3UIWA 1TI1A 1J9BA 2XC2A 4MZCA 4ZIJA 3F4RA 3QAWA 4PGTA 3ZIVA 2C80A 2IL3A 3E9JB 4KF9A 5AGYA 4PX1A 5ECOB 4K6XA 3TKPA 3H1NA 3LEFA 3HYPA 4CHSA 3LXTA 4HZ2A 4I97A 3E3EA 5CYYA 2LJKA 2XPDA 3WGEA 1O7UA 4IJIA 3FZ5A 4L0WA 4NPBA 2I9HA 1WE0A 3HD5A 4NMUA 4ZBBA 2YZHA 1K0NA 3FMWA 2R37A 2JZSA 3DD3A 3G7YA 4RQRA 3TJFA 5JWRB 3GKKA 3PR8A 4BVXA 3K8NA 2VAFA 3PPUA 4HUAA 5DAKB 2FNOA 2H72A 2OE1A 3ISOA 5IM9A 5KN0A 4IELA 2J23A 3IXRA 5CP1A 1KNGA 2GS3A 4LMWA 3TOTA 4PQHA 1J0FA 4O32A 5DDLA 2HZEB 4F0BA 4HZ4A 5HQPA 3VLNA 4MPFA 1AQWA 5IOWA 4JE1A 1THOA 2AUVA 4G0LA 3GN3A 2C0FA 4KAEA 4MA9A 2B3SA 4P3YB 1K0CA 5H5QA 4AJ8A 3F3RA 4POKA 2L59A 1XBSA 3EMPA 3EE2A 3O3TA 3BCKA 1ST9A 3FR3A 3FR6A 3Q19A 3ME8A 2B1LA 2DKIA 4KDUA 5EL8A 1EOGA 1R5AA 1OKTA 3VI5A 4DSSA 4JZQA 2HLSA 1OC9A 2GT6A 1AQXA 2IPAA 1K0OA 2OE3A 3KP9A 5JCGA 2MMNA 4JR6A 4IP6A 2IMFA 5J5NA 2PVOC 5D8IA 1V57A 3I69A 4KDXA 2H74A 2O85A 1GNEA 5COHA 4AF2A 1V58A 1BG5A 1QUWA 2JZTA 4MPGA 2K6VA 2RUEA 4X1UA 3UAPA 5EPFA 4ECJA 3ZVJA 4V2NA 3N9JA 1PRXA 4BA7A 3IK7A 2MZCA 2X64A 1GSYA 2R0CA 2LQQA 2H66A 2VLUA 3ZTLA 1XVQA 2PU9C 2F9SA 4JEDA 5ELAA 3BOAA 2YOIA 2GZYA 2R4VA 1ERUA 1F37A 3IHGA 4BVXB 2FY6A 2X8CA 2L6DA 1HQOA 4EO3A 1ZCPA 1RQMA 2KOKA 2V1MA 4K9ZA 2GQKA 2H0IA 5IIZA 3DMLA 1KTEA 2B7JA 3KH9A 2CA8A 1O85A 5IMAA 3TRPA 5IMFA 1FW1A 2CVBA 2JSZA 4V2LA 3A5WA 1HNAA 4KGIA 2AJQB 4K7IA 1EEJA 1FG4A 3UVHA 2AYTA 1UN2A 3L0HA 5ELGA 3Q18A 2KHPA 4ILFA 1EOHA 3L9VA 4K2XA 2YANA 2PERA 3LW9A 3P8WA 4IVFA 2N5FA 3VWWA 5ECKB 2KP2A 1QMVA 1H75A 1M2DA 3GHAA 3HJOA 4XRAA 1GSUA 2F8AA 2PMTA 2LKUA 4O92A 1B48A 3QFAC 3TKSC 4MDCA 2B1KA 4MP4A 2E0QA 4IW9A 4EIQA 3GUSA 1PQNA 1YF1A 2HFDA 2MMOA 2YWMA 3P90A 3TJGA 1Y6EA 1QK8A 4DSSB 1OC9B 3N5OA 4ZILA 5IPHA 1GUMA 4BVYA 1F9MA 4RQXA 4HEA2 2LV3A 2C0GA 2DC5A 1GLQA 1XWGA 2LRNA 4Q5FA 2ALBA 4G0KA 2MMZA 1PN9A 2WGRA 4ZBDA 2K8VA 3VWUA 3A2VA 2FD3A 2VCQA 5F05A 2HXKA 3OR5A 3O76A 4MZWA 2NPBA 1JLVA 3LJRA 1GUHA 4V2MA 3ZIJA 4HU7A 4XS4B 3GV1A 2REMA 3TRQA 4LMVA 1SD9A 4WXTA 5L71A 2H19A 3SBCA 4EKZA 2VCWA 5IMZA 4Z2UA 1GTAA 2R5GA 1XWBA 4GSSA 4YQMA 2VM1A 1JFUA 2HRFA 5LNKe 1MDJA 2WFCA 2OKAA 1MD4A 4MNNA 1R5PA 3QPMA 1EGRA 2M80A 1MEKA 2X8HA 2P5QA 1F2EA 2WRTA 2QGVA 1GSEA 5A4VA 5D9TA 3EVIA 2HRNA 5D9WA 1TKDB 4I6XA 2DJKA 1ZYPA 1DE2A 4HJMA 1XPVA 2K9FA 1ML6A 2CQ9A 3ZVJD 4EE0A 4ULXA 4NHZA 3RAZA 4YAVA 2I81A 2EIQA 5LCZA 4YKFA 5GZZB 4EL1A 4ECCA 10GSA 2H73A 3CSJA 2I1UA 4EXJA 1B9YC 1TOFA 5AN1A 4OO4A 4N10A 1HD2A 1O8WA 2C3TA 1EP7A 3ZYWA 4HU9A 3GKMA 4L8EA 3DVWA 3EU4A 2JADA 4HOJA 4F9ZA 5IMCA 4PNGA 1NSWA 3U6VA 3QFBC 3TJJA 5D73A 4YQUA 1TRSA 2CVKA 1G0TA 2B5YA 4KDYA 3D22A 5D9VA 19GSA 5KOWA 3QAGA 3D0ZA 1MTCA 3L9SA 1ABAA 1R7HA 2RUFA 3F4SA 1YKAA 4FYCA 3QCPA 5FWGA 1WPIA 1V98A 4KSOA 4X43A 2E2MA 4POLA 1UC7A 1GSFA 5ECSA 1TI3A 2IMIA 3GX8A 4WBRD 2DJJA 3VK9A 4PQIA 2A2RA 4PXOA 1A8YA 2QA1A 2QKEA 4ZL7A 4GRFA 3WT2A 4K0NA 5G5EA 3L4NA 2CV4A 5ECIB 1NHOA 4ISDA 4DVCA 4Q5NA 2VL9A 5DJMA 3NOFA 4MH2A 3QMXA 3L78A 2TIRA 12GSA 1HYUA 1ZZYA 3UVTA 1BQ7A 3CTFA 1W4VA 1BYEA 2C0EA 3BCIA 5INYA 1A0RP 2HSMA 3R2QA 2H01A 1EGOA 4K5SA 3RHBA 3CSHA 4IHUA 2ON5A 3F6FA 2GSTA 1UVZA 4WF5A 1EP8A 1XWKA 3D6IA 3HXSA 5IOXA 5JCUA 3HVSA 2IIYA 5E4WA 3TJKA 5EY6A 2C1YA 2Z9SA 1XVWA 3TCOA 5ID2A 4K2DA 2RLIA 2H1BA 5G1KA 5ABRA 2GSQA 1HNCA 1TK0B 1TJDA 1PL1A 1WRYA 1U3IA 1FOVA 2TRXA 2B6MA 4RI6A 1DSBA 2J9HA 2LJRA 2EIOA 2XBIA 3F6DA 3IAS2 2DMMA 2M46A 4WF4A 2FWFA 1QGVA 2F51A 2YJHA 3DEXA 4EDYA 2L5LA 4G0IA 2HRKA 3GYKA 3EMXA 3EU3A 2KLXA 5ECRB 4KX4A 5HR2A 4MJBA 1EV9A 2VLTA 3DIEA 4FIWA 4HDEA 4YH2A 3W8SA 5FHIA 2IMEA 4MZBA 1GNWA 1XW5A 3TKRA 4EF0A 5C00A 1VGLA 3IBHA 3CRUA 4J57E 5E59A 2P5RA 4YKGA 3EINA 1CQHA 5DJLA 1FAAA 13GSA 4K7OA 3ZMLA 2HRAA 1Z7PA 2WULA 1E2YA 4TKYA 1BJXA 2JSYA 5HFGA 3GMFA 1OVNA 4DSRA 2XBQA 1GSQA 1PKZA 4J2FA 1XWCA 2WB9A 3D4MA 4KW6A 2GZZA 3QD9A 2VLVA 2R2JA 1S3DA 1O81A 3CBUA 1WWJA 3KCMA 1EV4A 1X0RA 2G2QA 4TXOA 3IR4A 3IC4A 1A24A 4XCSA 3HY2A 1X5EA 3UEMA 2CZ3A 2OACA 1B8XA 2VIMA 5G30A 1TU8A 1GTIA 4Z2RA 2WJUA 3F4TA 1NW2A 2HNLA 1YDKA 3US3A 1U6TA 2H70A 2OADA 4J56E 2BMXA 3BBYA 5CRGA 1TRUA 2DLXA 4EUYA 4MABA 1DE1A 3PINA 3ZFLA 2OA7A 1TP9A 6GSSA 3RPPA 20GSA 3IDVA 1O8XA 4K1FA 2IFQA 3TOUA 1EEMA 1X5CA 3WYWA 14GSA 5ENUA 3TKSA 4WBJA 1A2MA 1O6JA 4EC0A 5DCHA 2C4JA 3LQ7A 5AIXA 2CVDA 2PGTA 2WS2A 4TR3A 4N0ZA 1ZGNA 2H30A 1ZYNA 1FVKA 4ZL8A 3WD6A 4NV2A 5JWOB 1ILOA 1FVJA 4XS4A 4GSNA 1R4WA 2K8SA 4E8HA 3GKXA 5ID2B 2E7PA 2YWOA 1U87A 1OE7A 1PL2A 3LFLA 2A2SA 2PPTA 3APQA 3I43A 3DXBA 1F3AA 5ECLB 3G9BA 4EVMA 1G6YA 3GH6A 5AISA 3DWVA 1JZDA 1YQ1A 3ZREA 5GSSA 2FA4A 3MIXA 3QOUA 1VF4A 5CREA 1YF0A 3KGKA 3L9UA 2MMAA 5CRHA 4PURA 2HSHA 4N0VA 4O7HA 4CY8A 1ACVA 5EVOA 2FUG2 1SL2B 1OAZA 1FB0A 5G2ZA 4TN8A 2VD1A 2GGTA 2HE3A 2CT6A 3TKSE 3F0IA 3QR6A 4QL7A 5B6MA 4OCEA 1GSDA 4MLYA 1M99A 3TRXA 3BD2A 4OD7A 2LTKA 1S3AA 3EPTA 2C3NA 3IHQA 5F8BA 4XRDA 2KP1A 1LBKA 3M0FA 2VL2C 3CXGA 1SKSB 4KE3A 2GSSA 2FGXA 4IQ1A 4WR5A 3GH9A 1BX9A 1TXXA 4JU5A 3HZ4A 4AGSA 4TXOB 3C7MA 1MDIA 4F03A 3HJMA 1A23A 1A2LA 1SJIA 1XW6A 3KMOA 3LG6A 2O89A 2MYGA 2LJAA 4FO5A 4K5RA 3LGCA 1AW9A 2JL4A 1WP0A 2CAQA 4JRRA 5B7CA 4EIPA 4I2TA 1YZXA 4HQZA 3KZQA 3HHVA 3EC3A 2RIIA 3MAKA 2NTOA 2C8UA 2IFQB 1GLPA 2LQOA 2QSIA 2R3XA 5J4UA 1TRVA 3I6AA 3C73A 1M2BA 3FY7A 2H6ZA 5KEJA 4G2EA 4FH8A 1Q98A 3UL3A 1VF1A 1OC3A 2YN1A 2YPMA 2F8FA 2AV4A 4HI7A 5JWQB 2PWJA 1JZWA 2DJ0A 1W89A 1BEDA 4ICYA 1UA5A 4CY6A 6GSTA 1K3LA 2AAWA 3MWHA 1I9DA 3KP8A 3KD0A 2XHFA 2O8VB 1YJ6A 3DKSA 3EWLA 4DEJA 1VRSD 2EC4A 2O7KA 5B8BA 3ZFBA 3PGTA 1DBYA 4PUFC 4XS6A 3WT1A 3ED3A 4XIHA 4MF5A 1DUGA 6GSYA 2O87A 2GSRA 5DCGA 3VI7A 1C72A 4E8EA 1M2AA 4QL9A 4KUNA 1JHBA 3ERFA 4O5QA 4HJ2A 4ZL9A 4TR4A 2DSAA 3A3TA 5IPGA 1N2AA 4IN0A 1B4PA 2B5EA 4PQ1A 4DSQA 1GULA 3UBLA 2KUCA 3GFKA 4X4JA 1Z3EA 3KM6A 1M9AA 1ZL9A 2E2GA 4BWQA 4GWRA 2AB6A 2CX4A 1V40A 4AJ7A 1XWAA 3H4KA 2L6CA 2FLSA 4KA0A 2WZ9A 2DJ2A 1T3BA 3LSZA 5GAND 3S9FA 2YV7A 2LS5A 1Z9HA 3R3EA 5KOXA 2EIRA 3FKFA 1ERTA 2LEGA 1PD21 3WGDA 3KTBA 3M1GA 4I8BA 2H76A 2PVQA 3APOA 1MDKA 2CX3A 1SKWB 5J9BA 4ZBAA 2H1GA 3H93A 1TU7A 3M9KA 5A5KA 2GZPA 2VOCA 2LNSA 4GQFA 1BAYA 4POMA 2FCHA 2A4HA 2L4QA 3QDNA 1K0AA 4N30A 5DALA 1T8EB 1TRWA 2UZ8A 4ZXGA 4Q5RA 5HFIA 3G7JA 5BRTA 2VCTA 3W8JA 2XPEA 1Z6MA 2I3YA 2OBKA 5GSTA 4ACSA 1GH2A 1SJ6A 5F07A 5A4UA 4ECIA 5HR0A 3RHCA 4A5PA 5IO0A 3IK9A 4G19A 4POBA 1OE8A 4YAPA 1AXDA 3WGXA 1JZOA 3GRXA 3IAM2 2H6YA 3GL5A 4OWYA 3IC8A 1Z7RA 3LYPA 1T1VA 3ERGA 4USSA 1FOHA 2GQLA 2DIYA 1QXHA 3D4TA 4PTSA 4OFTA 4V1Ag 3V1WA 3A2XA 3FYGA 2MBSA 1THXA 1TK5B 2YZUA 3FRCA 2ES7A 3W6GA 2V6OA 5J9CA 1XZOA 4ECBA 3KEBA 4LL1B 2B5XA 1GTBA 1GL8A 3HVXA 2AHEA 4D73A 5H5SA 3NIVA 2FWGA 3GTUA 1E6BA 2H1DA 22GSA 3CSIA 1J08A 5H5RA 3DVXA 1PA3A 3KXOA 4BL7A 3HKRA 3C1SA 4MJEA 3UMAA 1URMA 4F82A 4O5RA 1WIKA 2BTOT 5J41A 1GUKA 4MH3A 2VL3A 2ZCTA 1XIYA 2PN8A 3DGQA 3TB2A 1TK8B 3APSA 2DMLA 5B6NA 5DBQA 3I9V2 5ECNB 3LYKA 4FQUA 3VPQA 3DRNA 1XW9A 4OFNA 2VCZA 4PNFA 5D93A 1PX7A 1PX6A 1HNBA 5CNWA 2H71A 3ZITA 2JZRA 4I5QA 4CW9A 4LLRA 1ON4A 1PMTA 5CAXA 3IA1A 3F63A 6GSXA 1OYJA 4QQ7A 3F3QA 1TDIA 4JR4A 3MNGA 3A2WA 3LXZA 3KTLA 2A4VA 3M3MA 5D96A 4I2UA 4KCEA 3P7XA 4CDOA 2V41A 1XOAA 3GIXA 5GAPD 1IYHA 3VURA 1ERVA 5ECPB 3UJ1A 5CRDA 4IS0A 4AJ6A 4NAXA 2L4CA 2OE0A 3H79A 5DALB 1EZKA 3GA4A 1SYRA 3HDCA 1YEXA 1M0UA 2H1AA 1SL0B 1V2AA 2FA8A 3VPTA 4ZB8A 1GP1A 4FYUA 2QA2A 4MF6A 2FWEA 2YJ7A 2V2GA 2IMKA 5D9XA 2G0FA 3FZAA 1G7EA 5IQYA 1PSQA 3M9JA 2NVLA 1A0FA 3C8EA 1GSSA 17GSA 2C3QA 5AIVA 3J7Yb 1T4YA 2CZ2A 18GSA 4XTSA 1G6WA 4RUVA 3ZRDA 2VCVA 2DBCA 1I5GA 3A5IA 2WCIA 2R6KA 1YKCA 1SK1A 1Y25A 2VL2A 4K7NA 2C0DA 8GSSA 2ZNMA 1SL1B 2HZFA 4GCIA 2YNXA 3LWAA 2GLRA 3MDKA 1EWXA 4X0XA 3TKQA 4D73B 1A8LA 3C1RA 4OO5A 3GTUB 1VF3A 2YV9A 16GSA 4G10A 3TDGA 5KN3A 1USBA 5JCWA 5DVBA 4BL7B 2VO4A 3VFIA 1FHEA 1U3AA 1K0BA 2H0GA 2L57A 2ON7A 1M7TA 3F9UA 5FT3A 2OJLA 4GLTA 2X8GA 4WR4A 4GQCA 5HFKA 4IKHA 2V6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBP A;  2M72 A;  1JLW A;  4TOP A;  2NBS A;  4FYB A;  4OFM A;  5B8A A;  4NXI A;  1PKW A;  2YWI A;  4TR1 A;  3C71 A;  1O73 A;  2V32 A;  1F3B A;  3IE3 A;  1RK4 A;  4ZB6 A;  3FW2 A;  4NV5 A;  2GVP A;  1LU4 A;  1K3Y A;  4GF0 A;  3VWV A;  1X9W B;  2N5B A;  1PGT A;  3SWL A;  1XFL A;  1AAZ A;  5KN2 A;  3ERW A;  4KCA A;  2HSY A;  1T7P B;  1RW1 A;  2HT9 A;  4YQV A;  3JCM L;  4ML1 A;  3RBT A;  1AC1 A;  3GX0 A;  4EDZ A;  2PUK C;  2K18 A;  2HI7 A;  1WOU A;  4PUA A;  1AQV A;  4RI7 A;  3GST A;  1OC8 A;  1TW9 A;  2VM2 A;  3DYR A;  3AY8 A;  4IJ3 A;  1SEN A;  5ECH B;  2JU5 A;  1F6M C;  4ML6 A;  5DQY A;  4GTU A;  4TXV A;  2BJX A;  5F0G A;  5ECQ B;  4MJA A;  2YWN A;  4ZB9 A;  3CRT A;  5CO3 A;  1X9S B;  1T00 A;  4XS1 A;  3GUR A;  1YY7 A;  3IRA A;  1R26 A;  2GTU A;  3TJB A;  4BPY A;  4F2I A;  1N8J A;  1QFN A;  2D2Z A;  2LRC A;  4L5L A;  2IJY A;  1OKD A;  1ERW A;  3U5R E;  3UOM A;  2LST A;  2CAI A;  3J7Y k;  5DQS A;  1TTZ A;  3CTG A;  1XOB A;  3KIJ A;  1IYI A;  4GST A;  1B9X C;  5IMD A;  1MD3 A;  5IMV A;  2P0G A;  2DIZ A;  3CYN A;  6GSV A;  4KB3 A;  4H86 A;  5A4W A;  2DJ3 A;  3VWX A;  2RM6 A;  2ZUP A;  7GSS A;  5F06 A;  1ZYQ B;  3GL3 A;  5J3R A;  1KBN A;  3FEU A;  4XHM A;  1SD8 A;  2N5A A;  3H8Q A;  1V9W A;  2RM5 A;  3IPZ A;  2YP6 A;  2MBT A;  2I4A A;  1ZYE A;  2B7K A;  1GRX A;  2L5O A;  2IN3 A;  2LRT A;  1K3O A;  1K0M A;  2VUP A;  4JBB A;  5G31 A;  1NM3 A;  2P31 A;  3GSS A;  2NDO A;  2IWT A;  3Q6O A;  3HCZ A;  2WDU A;  4K8M A;  1X5D A;  4MJC A;  4F0C A;  4LL4 B;  1H4O A;  2VCX A;  3FK8 A;  1KEB A;  3O6T A;  3P2A A;  4TR1 B;  1M9B A;  2GQM A;  1ZMA A;  4LA1 A;  3IV4 A;  4KSM A;  3NZN A;  5KN1 A;  3GKN A;  3EYT A;  5ECM B;  2OBI A;  3HVV A;  2GT5 A;  4GXZ A;  4WET A;  1VF2 A;  4TW5 A;  4NWY A;  3ZZX A;  4N11 A;  2H8L A;  1WMJ A;  4Q5Q A;  3EUR A;  2TRC P;  3D21 A;  3KJY A;  1GTU A;  3UAR A;  6GSW A;  3HZ8 A;  3G7I A;  1YEP A;  1G7O A;  4WKW A;  4KH7 A;  1FO5 A;  1Z6N A;  4BWS A;  4ID0 A;  3RPN A;  1A2J A;  5G1L A;  1SK0 A;  4L0U A;  3CMI A;  2X99 A;  1SK2 A;  4K0G A;  1T4Z A;  3HA9 A;  4NHW A;  3BJ5 A;  2H75 A;  3RDW A;  4TVE A;  3FHK A;  2FWH A;  1K0D A;  2JAC A;  1ZOF A;  5IO2 A;  5G5F A;  4KND A;  5DAK A;  3TUE A;  2PBJ A;  2YCD A;  5LD0 A;  1AUC A;  3E0U A;  3QAV A;  2H0H A;  3KMN A;  4MCU A;  3KH7 A;  1Z5Y E;  2QC7 A;  3ZMK A;  4IP1 A;  2HZE A;  2LNT A;  1SU9 A;  3GNJ A;  4HQS A;  4OCF A;  5CRW A;  4MMM A;  3M8N A;  1SKR B;  2IMD A;  11GS A;  3LOR A;  4Z7X A;  1CQG A;  1XXU A;  1SYX A;  3D5J A;  3HJP A;  4HS1 A;  1S3C A;  5HR1 A;  3IOS A;  4TR0 A;  1SJZ A;  3TGZ A;  3ZL5 A;  2F3M A;  1AIU A;  4L5O A;  3UBK A;  4MF7 A;  1FB6 A;  1WJK A;  2VD0 A;  6GSU A;  4OMV A;  2FHE A;  1B4Q A;  2DJ1 A;  2LUS A;  3PH9 A;  4IQA A;  4WEY A;  2H6X A;  1XCC A;  3Q74 A;  4IGJ A;  4MK3 A;  1GWC A;  4TRX A;  5C04 A;  2HYX A;  1LJR A;  1NHY A;  5HR3 A;  3FR9 A;  4V1A p;  3FZ4 A;  9GSS A;  1QQ2 A;  1Q4J A;  3ME7 A;  3MSZ A;  3ZLP A;  3F8U A;  1X9M B;  4G9H A;  1JZR A;  1U88 A;  2GDR A;  3FZ9 A;  3UIW A;  1TI1 A;  1J9B A;  2XC2 A;  4MZC A;  4ZIJ A;  3F4R A;  3QAW A;  4PGT A;  3ZIV A;  2C80 A;  2IL3 A;  3E9J B;  5AGY A;  5ECO B;  4PX1 A;  4K6X A;  3TKP A;  3H1N A;  3LEF A;  3HYP A;  4CHS A;  3LXT A;  4HZ2 A;  4I97 A;  3E3E A;  5CYY A;  2LJK A;  2XPD A;  3WGE A;  1O7U A;  4IJI A;  3FZ5 A;  4L0W A;  4NPB A;  2I9H A;  1WE0 A;  3HD5 A;  4NMU A;  4ZBB A;  2YZH A;  1K0N A;  2R37 A;  2JZS A;  3DD3 A;  3G7Y A;  4RQR A;  3TJF A;  5JWR B;  3GKK A;  3PR8 A;  4BVX A;  3K8N A;  2VAF A;  4HUA A;  5DAK B;  2FNO A;  2H72 A;  2OE1 A;  3ISO A;  5IM9 A;  5KN0 A;  4IEL A;  2J23 A;  3IXR A;  5CP1 A;  1KNG A;  2GS3 A;  4LMW A;  3TOT A;  4PQH A;  1J0F A;  4O32 A;  5DDL A;  2HZE B;  4F0B A;  4HZ4 A;  5HQP A;  3VLN A;  4MPF A;  1AQW A;  5IOW A;  4JE1 A;  1THO A;  2AUV A;  3GN3 A;  2C0F A;  4KAE A;  4MA9 A;  2B3S A;  4P3Y B;  1K0C A;  5H5Q A;  4AJ8 A;  3F3R A;  4POK A;  2L59 A;  1XBS A;  3EMP A;  3EE2 A;  3O3T A;  3BCK A;  1ST9 A;  3FR3 A;  3FR6 A;  3Q19 A;  3ME8 A;  2B1L A;  4KDU A;  5EL8 A;  1EOG A;  1R5A A;  1OKT A;  3VI5 A;  4DSS A;  4JZQ A;  2HLS A;  1OC9 A;  2GT6 A;  1AQX A;  2IPA A;  1K0O A;  2OE3 A;  3KP9 A;  5JCG A;  2MMN A;  4JR6 A;  4IP6 A;  2IMF A;  5J5N A;  2PVO C;  5D8I A;  1V57 A;  3I69 A;  4KDX A;  2H74 A;  2O85 A;  1GNE A;  5COH A;  4AF2 A;  1V58 A;  1BG5 A;  1QUW A;  2JZT A;  4MPG A;  2K6V A;  2RUE A;  4X1U A;  3UAP A;  5EPF A;  4ECJ A;  3ZVJ A;  4V2N A;  3N9J A;  1PRX A;  4BA7 A;  3IK7 A;  2MZC A;  2X64 A;  1GSY A;  2LQQ A;  2H66 A;  2VLU A;  3ZTL A;  1XVQ A;  2PU9 C;  2F9S A;  4JED A;  5ELA A;  3BOA A;  2YOI A;  2GZY A;  2R4V A;  1ERU A;  1F37 A;  2FY6 A;  2X8C A;  2L6D A;  1HQO A;  4EO3 A;  1ZCP A;  1RQM A;  2KOK A;  2V1M A;  4K9Z A;  2GQK A;  2H0I A;  5IIZ A;  3DML A;  1KTE A;  2B7J A;  3KH9 A;  2CA8 A;  1O85 A;  5IMA A;  3TRP A;  5IMF A;  1FW1 A;  2CVB A;  2JSZ A;  4V2L A;  3A5W A;  1HNA A;  4KGI A;  2AJQ B;  4K7I A;  1EEJ A;  1FG4 A;  3UVH A;  2AYT A;  1UN2 A;  3L0H A;  5ELG A;  3Q18 A;  2KHP A;  4ILF A;  1EOH A;  3L9V A;  2YAN A;  2PER A;  3P8W A;  4IVF A;  2N5F A;  3VWW A;  5ECK B;  2KP2 A;  1QMV A;  1H75 A;  1M2D A;  3GHA A;  3HJO A;  4XRA A;  1GSU A;  2F8A A;  2PMT A;  2LKU A;  4O92 A;  1B48 A;  3QFA C;  3TKS C;  4MDC A;  2B1K A;  4MP4 A;  2E0Q A;  4IW9 A;  3GUS A;  1PQN A;  1YF1 A;  2HFD A;  2MMO A;  2YWM A;  3P90 A;  3TJG A;  1Y6E A;  1QK8 A;  4DSS B;  1OC9 B;  3N5O A;  4ZIL A;  5IPH A;  1GUM A;  4BVY A;  1F9M A;  4RQX A;  4HEA 2;  2LV3 A;  2C0G A;  2DC5 A;  1GLQ A;  1XWG A;  2LRN A;  4Q5F A;  2ALB A;  2MMZ A;  1PN9 A;  2WGR A;  4ZBD A;  2K8V A;  3VWU A;  3A2V A;  2FD3 A;  2VCQ A;  5F05 A;  2HXK A;  3OR5 A;  3O76 A;  4MZW A;  2NPB A;  1JLV A;  3LJR A;  1GUH A;  4V2M A;  3ZIJ A;  4HU7 A;  4XS4 B;  3GV1 A;  2REM A;  3TRQ A;  4LMV A;  1SD9 A;  4WXT A;  5L71 A;  2H19 A;  3SBC A;  4EKZ A;  2VCW A;  5IMZ A;  1GTA A;  2R5G A;  1XWB A;  4GSS A;  4YQM A;  2VM1 A;  1JFU A;  2HRF A;  5LNK e;  1MDJ A;  2WFC A;  2OKA A;  1MD4 A;  1R5P A;  3QPM A;  1EGR A;  2M80 A;  1MEK A;  2X8H A;  2P5Q A;  1F2E A;  2WRT A;  2QGV A;  1GSE A;  5A4V A;  5D9T A;  3EVI A;  2HRN A;  5D9W A;  1TKD B;  4I6X A;  2DJK A;  1DE2 A;  4HJM A;  1XPV A;  2K9F A;  1ML6 A;  2CQ9 A;  3ZVJ D;  4EE0 A;  4ULX A;  4NHZ A;  3RAZ A;  4YAV A;  2I81 A;  2EIQ A;  5LCZ A;  5GZZ B;  4EL1 A;  4ECC A;  10GS A;  2H73 A;  3CSJ A;  2I1U A;  4EXJ A;  1B9Y C;  1TOF A;  5AN1 A;  4OO4 A;  4N10 A;  1HD2 A;  1O8W A;  2C3T A;  1EP7 A;  3ZYW A;  4HU9 A;  3GKM A;  4L8E A;  3DVW A;  3EU4 A;  2JAD A;  4HOJ A;  4F9Z A;  5IMC A;  4PNG A;  1NSW A;  3U6V A;  3QFB C;  3TJJ A;  5D73 A;  4YQU A;  1TRS A;  2CVK A;  1G0T A;  2B5Y A;  4KDY A;  3D22 A;  5D9V A;  19GS A;  3QAG A;  3D0Z A;  1MTC A;  3L9S A;  1ABA A;  1R7H A;  2RUF A;  3F4S A;  1YKA A;  4FYC A;  3QCP A;  5FWG A;  1WPI A;  1V98 A;  4KSO A;  4X43 A;  2E2M A;  4POL A;  1UC7 A;  1GSF A;  5ECS A;  1TI3 A;  2IMI A;  3GX8 A;  4WBR D;  2DJJ A;  3VK9 A;  4PQI A;  2A2R A;  4PXO A;  1A8Y A;  2QKE A;  4ZL7 A;  4GRF A;  3WT2 A;  4K0N A;  5G5E A;  3L4N A;  2CV4 A;  5ECI B;  1NHO A;  4ISD A;  4DVC A;  4Q5N A;  2VL9 A;  5DJM A;  3NOF A;  4MH2 A;  3QMX A;  3L78 A;  2TIR A;  12GS A;  1HYU A;  1ZZY A;  3UVT A;  1BQ7 A;  3CTF A;  1W4V A;  1BYE A;  2C0E A;  3BCI A;  5INY A;  1A0R P;  3R2Q A;  2H01 A;  1EGO A;  3RHB A;  3CSH A;  4IHU A;  2ON5 A;  3F6F A;  2GST A;  1UVZ A;  4WF5 A;  1EP8 A;  1XWK A;  3D6I A;  3HXS A;  5IOX A;  5JCU A;  3HVS A;  2IIY A;  5E4W A;  3TJK A;  5EY6 A;  2C1Y A;  2Z9S A;  1XVW A;  3TCO A;  5ID2 A;  4K2D A;  2RLI A;  2H1B A;  5G1K A;  5ABR A;  2GSQ A;  1HNC A;  1TK0 B;  1TJD A;  1PL1 A;  1WRY A;  1U3I A;  1FOV A;  2TRX A;  2B6M A;  4RI6 A;  1DSB A;  2J9H A;  2LJR A;  2EIO A;  2XBI A;  3F6D A;  3IAS 2;  2DMM A;  2M46 A;  4WF4 A;  2FWF A;  1QGV A;  2F51 A;  2YJH A;  3DEX A;  4EDY A;  2L5L A;  3GYK A;  3EMX A;  3EU3 A;  2KLX A;  5ECR B;  4KX4 A;  5HR2 A;  4MJB A;  1EV9 A;  2VLT A;  3DIE A;  4FIW A;  4HDE A;  4YH2 A;  3W8S A;  5FHI A;  2IME A;  4MZB A;  1GNW A;  1XW5 A;  3TKR A;  4EF0 A;  5C00 A;  1VGL A;  3IBH A;  3CRU A;  4J57 E;  5E59 A;  2P5R A;  3EIN A;  1CQH A;  5DJL A;  1FAA A;  13GS A;  4K7O A;  3ZML A;  1Z7P A;  2WUL A;  1E2Y A;  4TKY A;  1BJX A;  2JSY A;  5HFG A;  3GMF A;  1OVN A;  4DSR A;  2XBQ A;  1GSQ A;  1PKZ A;  4J2F A;  1XWC A;  2WB9 A;  3D4M A;  4KW6 A;  2GZZ A;  3QD9 A;  2VLV A;  2R2J A;  1S3D A;  1O81 A;  3CBU A;  1WWJ A;  3KCM A;  1EV4 A;  1X0R A;  2G2Q A;  4TXO A;  3IR4 A;  3IC4 A;  1A24 A;  4XCS A;  3HY2 A;  1X5E A;  3UEM A;  2CZ3 A;  2OAC A;  1B8X A;  2VIM A;  5G30 A;  1TU8 A;  1GTI A;  2WJU A;  3F4T A;  1NW2 A;  2HNL A;  1YDK A;  3US3 A;  1U6T A;  2H70 A;  2OAD A;  4J56 E;  2BMX A;  3BBY A;  5CRG A;  1TRU A;  2DLX A;  4EUY A;  4MAB A;  1DE1 A;  3PIN A;  3ZFL A;  2OA7 A;  1TP9 A;  6GSS A;  3RPP A;  20GS A;  3IDV A;  1O8X A;  4K1F A;  2IFQ A;  3TOU A;  1EEM A;  1X5C A;  3WYW A;  14GS A;  5ENU A;  3TKS A;  4WBJ A;  1A2M A;  1O6J A;  4EC0 A;  5DCH A;  2C4J A;  3LQ7 A;  5AIX A;  2CVD A;  2PGT A;  2WS2 A;  4TR3 A;  4N0Z A;  1ZGN A;  2H30 A;  1FVK A;  4ZL8 A;  3WD6 A;  4NV2 A;  5JWO B;  1ILO A;  1FVJ A;  4XS4 A;  4GSN A;  1R4W A;  2K8S A;  4E8H A;  3GKX A;  5ID2 B;  2E7P A;  2YWO A;  1U87 A;  1OE7 A;  1PL2 A;  3LFL A;  2A2S A;  2PPT A;  3APQ A;  3I43 A;  3DXB A;  1F3A A;  5ECL B;  3G9B A;  4EVM A;  1G6Y A;  3GH6 A;  5AIS A;  3DWV A;  1JZD A;  1YQ1 A;  3ZRE A;  5GSS A;  2FA4 A;  3QOU A;  1VF4 A;  5CRE A;  1YF0 A;  3KGK A;  3L9U A;  2MMA A;  5CRH A;  4PUR A;  2HSH A;  4N0V A;  4O7H A;  1ACV A;  5EVO A;  2FUG 2;  1SL2 B;  1OAZ A;  1FB0 A;  5G2Z A;  4TN8 A;  2VD1 A;  2GGT A;  2HE3 A;  2CT6 A;  3TKS E;  3F0I A;  3QR6 A;  4QL7 A;  5B6M A;  4OCE A;  1GSD A;  4MLY A;  1M99 A;  3TRX A;  3BD2 A;  4OD7 A;  2LTK A;  1S3A A;  2C3N A;  3IHQ A;  5F8B A;  4XRD A;  2KP1 A;  1LBK A;  3M0F A;  2VL2 C;  3CXG A;  1SKS B;  4KE3 A;  2GSS A;  2FGX A;  4IQ1 A;  4WR5 A;  3GH9 A;  1BX9 A;  1TXX A;  4JU5 A;  3HZ4 A;  4AGS A;  4TXO B;  3C7M A;  1MDI A;  4F03 A;  3HJM A;  1A23 A;  1A2L A;  1SJI A;  1XW6 A;  3KMO A;  3LG6 A;  2O89 A;  2MYG A;  2LJA A;  4FO5 A;  3LGC A;  1AW9 A;  2JL4 A;  1WP0 A;  2CAQ A;  4JRR A;  5B7C A;  4I2T A;  1YZX A;  4HQZ A;  3KZQ A;  3HHV A;  3EC3 A;  2RII A;  3MAK A;  2NTO A;  2C8U A;  2IFQ B;  1GLP A;  2LQO A;  2QSI A;  2R3X A;  5J4U A;  1TRV A;  3I6A A;  3C73 A;  1M2B A;  3FY7 A;  2H6Z A;  5KEJ A;  4G2E A;  4FH8 A;  1Q98 A;  3UL3 A;  1VF1 A;  1OC3 A;  2YN1 A;  2YPM A;  2F8F A;  2AV4 A;  4HI7 A;  5JWQ B;  2PWJ A;  1JZW A;  2DJ0 A;  1W89 A;  1BED A;  1UA5 A;  6GST A;  1K3L A;  2AAW A;  3MWH A;  1I9D A;  3KP8 A;  3KD0 A;  2XHF A;  2O8V B;  1YJ6 A;  3DKS A;  3EWL A;  4DEJ A;  1VRS D;  2EC4 A;  2O7K A;  5B8B A;  3ZFB A;  3PGT A;  1DBY A;  4PUF C;  4XS6 A;  3WT1 A;  3ED3 A;  4XIH A;  4MF5 A;  1DUG A;  6GSY A;  2O87 A;  2GSR A;  5DCG A;  3VI7 A;  1C72 A;  4E8E A;  1M2A A;  4QL9 A;  4KUN A;  1JHB A;  3ERF A;  4HJ2 A;  4ZL9 A;  4TR4 A;  2DSA A;  3A3T A;  5IPG A;  1N2A A;  4IN0 A;  1B4P A;  2B5E A;  4PQ1 A;  4DSQ A;  1GUL A;  3UBL A;  2KUC A;  3GFK A;  1Z3E A;  3KM6 A;  1M9A A;  1ZL9 A;  2E2G A;  4BWQ A;  4GWR A;  2AB6 A;  2CX4 A;  1V40 A;  4AJ7 A;  1XWA A;  3H4K A;  2L6C A;  2FLS A;  4KA0 A;  2WZ9 A;  2DJ2 A;  1T3B A;  3LSZ A;  5GAN D;  3S9F A;  2YV7 A;  2LS5 A;  1Z9H A;  2EIR A;  3FKF A;  1ERT A;  2LEG A;  1PD2 1;  3WGD A;  3KTB A;  3M1G A;  4I8B A;  2H76 A;  2PVQ A;  3APO A;  1MDK A;  2CX3 A;  1SKW B;  5J9B A;  4ZBA A;  2H1G A;  3H93 A;  1TU7 A;  3M9K A;  5A5K A;  2GZP A;  2VOC A;  2LNS A;  4GQF A;  1BAY A;  4POM A;  2FCH A;  2L4Q A;  3QDN A;  1K0A A;  4N30 A;  5DAL A;  1T8E B;  1TRW A;  4ZXG A;  4Q5R A;  5HFI A;  3G7J A;  2VCT A;  3W8J A;  2XPE A;  1Z6M A;  2I3Y A;  2OBK A;  5GST A;  4ACS A;  1GH2 A;  1SJ6 A;  5F07 A;  5A4U A;  4ECI A;  5HR0 A;  3RHC A;  5IO0 A;  3IK9 A;  4G19 A;  4POB A;  1OE8 A;  4YAP A;  1AXD A;  3WGX A;  1JZO A;  3GRX A;  3IAM 2;  2H6Y A;  3GL5 A;  4OWY A;  1Z7R A;  3LYP A;  1T1V A;  3ERG A;  2GQL A;  2DIY A;  1QXH A;  3D4T A;  4OFT A;  4V1A g;  3V1W A;  3A2X A;  3FYG A;  2MBS A;  1THX A;  1TK5 B;  2YZU A;  3FRC A;  2ES7 A;  3W6G A;  2V6O A;  5J9C A;  1XZO A;  4ECB A;  3KEB A;  4LL1 B;  2B5X A;  1GTB A;  1GL8 A;  3HVX A;  2AHE A;  4D73 A;  5H5S A;  3NIV A;  2FWG A;  3GTU A;  1E6B A;  2H1D A;  22GS A;  3CSI A;  1J08 A;  5H5R A;  3DVX A;  1PA3 A;  3KXO A;  4BL7 A;  3HKR A;  3C1S A;  4MJE A;  3UMA A;  1URM A;  4F82 A;  4O5R A;  1WIK A;  2BTO T;  5J41 A;  1GUK A;  4MH3 A;  2VL3 A;  2ZCT A;  1XIY A;  2PN8 A;  3DGQ A;  3TB2 A;  1TK8 B;  3APS A;  2DML A;  5B6N A;  5DBQ A;  3I9V 2;  5ECN B;  3LYK A;  3VPQ A;  3DRN A;  1XW9 A;  4OFN A;  2VCZ A;  4PNF A;  5D93 A;  1PX7 A;  1PX6 A;  1HNB A;  5CNW A;  2H71 A;  3ZIT A;  2JZR A;  4I5Q A;  4CW9 A;  4LLR A;  1ON4 A;  1PMT A;  5CAX A;  3IA1 A;  3F63 A;  6GSX A;  1OYJ A;  4QQ7 A;  3F3Q A;  1TDI A;  4JR4 A;  3MNG A;  3A2W A;  3LXZ A;  3KTL A;  2A4V A;  3M3M A;  5D96 A;  4I2U A;  4KCE A;  3P7X A;  4CDO A;  2V41 A;  1XOA A;  3GIX A;  5GAP D;  1IYH A;  3VUR A;  1ERV A;  5ECP B;  3UJ1 A;  5CRD A;  4IS0 A;  4AJ6 A;  4NAX A;  2L4C A;  2OE0 A;  3H79 A;  5DAL B;  1EZK A;  3GA4 A;  1SYR A;  3HDC A;  1YEX A;  1M0U A;  2H1A A;  1SL0 B;  1V2A A;  2FA8 A;  3VPT A;  4ZB8 A;  1GP1 A;  4FYU A;  4MF6 A;  2FWE A;  2YJ7 A;  2V2G A;  2IMK A;  5D9X A;  2G0F A;  3FZA A;  1G7E A;  5IQY A;  1PSQ A;  3M9J A;  2NVL A;  1A0F A;  3C8E A;  1GSS A;  17GS A;  2C3Q A;  5AIV A;  3J7Y b;  1T4Y A;  2CZ2 A;  18GS A;  4XTS A;  1G6W A;  4RUV A;  3ZRD A;  2VCV A;  2DBC A;  1I5G A;  2WCI A;  2R6K A;  1YKC A;  1SK1 A;  1Y25 A;  2VL2 A;  4K7N A;  2C0D A;  8GSS A;  2ZNM A;  1SL1 B;  2HZF A;  4GCI A;  2YNX A;  3LWA A;  2GLR A;  3MDK A;  1EWX A;  4X0X A;  3TKQ A;  4D73 B;  1A8L A;  3C1R A;  4OO5 A;  3GTU B;  1VF3 A;  2YV9 A;  16GS A;  4G10 A;  3TDG A;  5KN3 A;  1USB A;  5JCW A;  5DVB A;  2VO4 A;  3VFI A;  1FHE A;  1U3A A;  1K0B A;  2H0G A;  2L57 A;  2ON7 A;  1M7T A;  3F9U A;  5FT3 A;  2OJL A;  4GLT A;  2X8G A;  4WR4 A;  4GQC A;  5HFK A;  4IKH A;  2V6K A; 
#chains in the Genus database with same CATH topology
 4IBP A;  2X4A A;  2M72 A;  1JLW A;  4TOP A;  2NBS A;  4FYB A;  2A2P A;  1PN0 A;  4OFM A;  5B8A A;  4NXI A;  1PKW A;  2YWI A;  4TR1 A;  3C71 A;  1O73 A;  2V32 A;  1F3B A;  3IE3 A;  1RK4 A;  4ZB6 A;  2R0G A;  3FW2 A;  4NV5 A;  2GVP A;  1LU4 A;  1K3Y A;  4GF0 A;  3VWV A;  1X9W B;  2N5B A;  1PGT A;  3SWL A;  1XFL A;  1AAZ A;  5KN2 A;  3ERW A;  4KCA A;  2HSY A;  1T7P B;  1RW1 A;  2HT9 A;  4YQV A;  3JCM L;  4ML1 A;  3RBT A;  1AC1 A;  3GX0 A;  4EDZ A;  2PUK C;  2K18 A;  2HI7 A;  1WOU A;  4PUA A;  1AQV A;  4RI7 A;  3GST A;  1OC8 A;  1TW9 A;  2VM2 A;  3DYR A;  3AY8 A;  4IJ3 A;  1SEN A;  5ECH B;  2JU5 A;  1F6M C;  4ML6 A;  5DQY A;  4GTU A;  4TXV A;  2BJX A;  5F0G A;  5ECQ B;  4MJA A;  2YWN A;  4ZB9 A;  3CRT A;  5CO3 A;  1X9S B;  1T00 A;  4XS1 A;  3GUR A;  1YY7 A;  3IRA A;  1R26 A;  2GTU A;  3TJB A;  4BPY A;  4F2I A;  1N8J A;  1QFN A;  2D2Z A;  2LRC A;  4L5L A;  2IJY A;  1OKD A;  1ERW A;  3U5R E;  3UOM A;  2LST A;  2CAI A;  3J7Y k;  5DQS A;  1TTZ A;  3CTG A;  1XOB A;  3KIJ A;  1IYI A;  4GST A;  1B9X C;  5IMD A;  1MD3 A;  5IMV A;  2P0G A;  2DIZ A;  3CYN A;  6GSV A;  4KB3 A;  4H86 A;  2X49 A;  5A4W A;  2DJ3 A;  3VWX A;  2RM6 A;  2ZUP A;  7GSS A;  5F06 A;  1ZYQ B;  3GL3 A;  5J3R A;  1KBN A;  3FEU A;  4XHM A;  1SD8 A;  2N5A A;  3H8Q A;  1V9W A;  2RM5 A;  3IPZ A;  2YP6 A;  2MBT A;  2I4A A;  1ZYE A;  2B7K A;  1GRX A;  2L5O A;  2IN3 A;  2LRT A;  1K3O A;  1K0M A;  2VUP A;  4JBB A;  5G31 A;  1NM3 A;  2P31 A;  3GSS A;  2NDO A;  2IWT A;  4O5U A;  3Q6O A;  3HCZ A;  2WDU A;  4K8M A;  1X5D A;  4MJC A;  4F0C A;  4LL4 B;  1H4O A;  2VCX A;  3FK8 A;  1KEB A;  3O6T A;  3P2A A;  4TR1 B;  1M9B A;  2GQM A;  1ZMA A;  4LA1 A;  3IV4 A;  4KSM A;  3NZN A;  5KN1 A;  3GKN A;  3EYT A;  5ECM B;  2OBI A;  3HVV A;  2GT5 A;  4GXZ A;  4WET A;  1VF2 A;  4Z2T A;  4TW5 A;  4NWY A;  3ZZX A;  4N11 A;  2H8L A;  1WMJ A;  4Q5Q A;  3EUR A;  2TRC P;  3D21 A;  3KJY A;  1GTU A;  3UAR A;  2R0P A;  6GSW A;  3HZ8 A;  3G7I A;  1YEP A;  1G7O A;  4WKW A;  4KH7 A;  1FO5 A;  1Z6N A;  4BWS A;  4ID0 A;  3RPN A;  1A2J A;  5G1L A;  1SK0 A;  4L0U A;  3CMI A;  2X99 A;  1SK2 A;  4K0G A;  1T4Z A;  3HA9 A;  4NHW A;  3BJ5 A;  2H75 A;  3RDW A;  4TVE A;  3FHK A;  2FWH A;  1K0D A;  2JAC A;  1ZOF A;  5IO2 A;  5G5F A;  4KND A;  5DAK A;  3TUE A;  2PBJ A;  2YCD A;  5LD0 A;  1AUC A;  3E0U A;  2DKH A;  3QAV A;  2H0H A;  3KMN A;  4MCU A;  3KH7 A;  1Z5Y E;  2QC7 A;  3ZMK A;  4IP1 A;  2HZE A;  2LNT A;  1SU9 A;  3GNJ A;  4HQS A;  4OCF A;  5CRW A;  4MMM A;  3M8N A;  5BMU A;  1SKR B;  2IMD A;  11GS A;  3LOR A;  4Z7X A;  1CQG A;  1XXU A;  1SYX A;  3D5J A;  3HJP A;  4BVY B;  4HS1 A;  1S3C A;  5HR1 A;  3IOS A;  4TR0 A;  1SJZ A;  3TGZ A;  3ZL5 A;  2F3M A;  1AIU A;  4L5O A;  3UBK A;  4MF7 A;  1FB6 A;  1WJK A;  2VD0 A;  6GSU A;  4OMV A;  2FHE A;  1B4Q A;  2DJ1 A;  2LUS A;  3PH9 A;  4IQA A;  4WEY A;  2H6X A;  1XCC A;  3Q74 A;  4IGJ A;  4MK3 A;  1GWC A;  4TRX A;  5C04 A;  2HYX A;  1LJR A;  1NHY A;  5HR3 A;  3FR9 A;  4V1A p;  3FZ4 A;  9GSS A;  1QQ2 A;  1Q4J A;  3MYD A;  3ME7 A;  3MSZ A;  3ZLP A;  3F8U A;  1X9M B;  4G9H A;  1JZR A;  1U88 A;  2GDR A;  3FZ9 A;  3UIW A;  1TI1 A;  1J9B A;  2XC2 A;  4MZC A;  4ZIJ A;  3F4R A;  3QAW A;  4PGT A;  3ZIV A;  2C80 A;  2IL3 A;  3E9J B;  4KF9 A;  5AGY A;  4PX1 A;  5ECO B;  4K6X A;  3TKP A;  3H1N A;  3LEF A;  3HYP A;  4CHS A;  3LXT A;  4HZ2 A;  4I97 A;  3E3E A;  5CYY A;  2LJK A;  2XPD A;  3WGE A;  1O7U A;  4IJI A;  3FZ5 A;  4L0W A;  4NPB A;  2I9H A;  1WE0 A;  3HD5 A;  4NMU A;  4ZBB A;  2YZH A;  1K0N A;  3FMW A;  2R37 A;  2JZS A;  3DD3 A;  3G7Y A;  4RQR A;  3TJF A;  5JWR B;  3GKK A;  3PR8 A;  4BVX A;  3K8N A;  2VAF A;  3PPU A;  4HUA A;  5DAK B;  2FNO A;  2H72 A;  2OE1 A;  3ISO A;  5IM9 A;  5KN0 A;  4IEL A;  2J23 A;  3IXR A;  5CP1 A;  1KNG A;  2GS3 A;  4LMW A;  3TOT A;  4PQH A;  1J0F A;  4O32 A;  5DDL A;  2HZE B;  4F0B A;  4HZ4 A;  5HQP A;  3VLN A;  4MPF A;  1AQW A;  5IOW A;  4JE1 A;  1THO A;  2AUV A;  4G0L A;  3GN3 A;  2C0F A;  4KAE A;  4MA9 A;  2B3S A;  4P3Y B;  1K0C A;  5H5Q A;  4AJ8 A;  3F3R A;  4POK A;  2L59 A;  1XBS A;  3EMP A;  3EE2 A;  3O3T A;  3BCK A;  1ST9 A;  3FR3 A;  3FR6 A;  3Q19 A;  3ME8 A;  2B1L A;  2DKI A;  4KDU A;  5EL8 A;  1EOG A;  1R5A A;  1OKT A;  3VI5 A;  4DSS A;  4JZQ A;  2HLS A;  1OC9 A;  2GT6 A;  1AQX A;  2IPA A;  1K0O A;  2OE3 A;  3KP9 A;  5JCG A;  2MMN A;  4JR6 A;  4IP6 A;  2IMF A;  5J5N A;  2PVO C;  5D8I A;  1V57 A;  3I69 A;  4KDX A;  2H74 A;  2O85 A;  1GNE A;  5COH A;  4AF2 A;  1V58 A;  1BG5 A;  1QUW A;  2JZT A;  4MPG A;  2K6V A;  2RUE A;  4X1U A;  3UAP A;  5EPF A;  4ECJ A;  3ZVJ A;  4V2N A;  3N9J A;  1PRX A;  4BA7 A;  3IK7 A;  2MZC A;  2X64 A;  1GSY A;  2R0C A;  2LQQ A;  1PFO A;  2H66 A;  2VLU A;  3ZTL A;  1XVQ A;  2PU9 C;  2F9S A;  4JED A;  5ELA A;  3BOA A;  2YOI A;  2GZY A;  2R4V A;  1ERU A;  1F37 A;  3IHG A;  4BVX B;  2FY6 A;  2X8C A;  2L6D A;  1HQO A;  4EO3 A;  1ZCP A;  1RQM A;  2KOK A;  2V1M A;  4K9Z A;  2GQK A;  2H0I A;  5IIZ A;  3DML A;  1KTE A;  2B7J A;  3KH9 A;  2CA8 A;  1O85 A;  5IMA A;  3TRP A;  5IMF A;  1FW1 A;  2CVB A;  2JSZ A;  4V2L A;  3A5W A;  1HNA A;  4KGI A;  2AJQ B;  4K7I A;  1EEJ A;  1FG4 A;  3UVH A;  2AYT A;  1UN2 A;  3L0H A;  5ELG A;  3Q18 A;  2KHP A;  4ILF A;  1EOH A;  3L9V A;  4K2X A;  2YAN A;  2PER A;  3LW9 A;  3P8W A;  4IVF A;  2N5F A;  3VWW A;  5ECK B;  2KP2 A;  1QMV A;  1H75 A;  1M2D A;  3GHA A;  3HJO A;  4XRA A;  1GSU A;  2F8A A;  2PMT A;  2LKU A;  4O92 A;  1B48 A;  3QFA C;  3TKS C;  4MDC A;  2B1K A;  4MP4 A;  2E0Q A;  4IW9 A;  4EIQ A;  3GUS A;  1PQN A;  1M3J A;  1YF1 A;  2HFD A;  2MMO A;  2YWM A;  3P90 A;  3TJG A;  1Y6E A;  1QK8 A;  4DSS B;  1OC9 B;  3N5O A;  4ZIL A;  5IPH A;  1GUM A;  4BVY A;  1F9M A;  4RQX A;  4HEA 2;  2LV3 A;  1S3R A;  2C0G A;  2DC5 A;  1GLQ A;  1XWG A;  2LRN A;  4Q5F A;  2ALB A;  4G0K A;  2MMZ A;  1PN9 A;  2WGR A;  4ZBD A;  2K8V A;  3VWU A;  3A2V A;  2FD3 A;  2VCQ A;  5F05 A;  2HXK A;  3OR5 A;  3O76 A;  4MZW A;  2NPB A;  1JLV A;  3LJR A;  1GUH A;  4V2M A;  3ZIJ A;  4HU7 A;  4XS4 B;  3GV1 A;  2REM A;  3TRQ A;  4LMV A;  1SD9 A;  1XG8 A;  4WXT A;  5L71 A;  2H19 A;  3SBC A;  4EKZ A;  2VCW A;  5IMZ A;  4Z2U A;  1GTA A;  2R5G A;  1XWB A;  4GSS A;  2VM1 A;  4YQM A;  1JFU A;  2HRF A;  5LNK e;  1MDJ A;  2WFC A;  2OKA A;  1MD4 A;  4MNN A;  1R5P A;  3QPM A;  1EGR A;  2M80 A;  1MEK A;  2X8H A;  2P5Q A;  1F2E A;  2WRT A;  2QGV A;  1GSE A;  5A4V A;  5D9T A;  3EVI A;  2HRN A;  5D9W A;  1TKD B;  4I6X A;  2DJK A;  1ZYP A;  1DE2 A;  4HJM A;  1XPV A;  2K9F A;  1ML6 A;  2CQ9 A;  3ZVJ D;  4EE0 A;  4ULX A;  4NHZ A;  3RAZ A;  4YAV A;  2I81 A;  2EIQ A;  5LCZ A;  4YKF A;  5GZZ B;  4EL1 A;  4ECC A;  10GS A;  2H73 A;  3CSJ A;  2I1U A;  4EXJ A;  1B9Y C;  1TOF A;  5AN1 A;  4OO4 A;  4N10 A;  1HD2 A;  1O8W A;  2C3T A;  1EP7 A;  3ZYW A;  4HU9 A;  3GKM A;  4L8E A;  3DVW A;  3EU4 A;  2JAD A;  4HOJ A;  4F9Z A;  5IMC A;  4PNG A;  1NSW A;  3U6V A;  3QFB C;  3TJJ A;  5D73 A;  4YQU A;  1TRS A;  2CVK A;  1G0T A;  2B5Y A;  4KDY A;  3D22 A;  5D9V A;  19GS A;  5KOW A;  3QAG A;  3D0Z A;  1MTC A;  3L9S A;  1ABA A;  1R7H A;  2RUF A;  3F4S A;  1YKA A;  4FYC A;  3QCP A;  5FWG A;  1WPI A;  1V98 A;  4KSO A;  4X43 A;  2E2M A;  4POL A;  1UC7 A;  1GSF A;  5ECS A;  1TI3 A;  2IMI A;  3GX8 A;  4WBR D;  2DJJ A;  3VK9 A;  4PQI A;  3CQF A;  2A2R A;  4PXO A;  1A8Y A;  2QA1 A;  2QKE A;  4ZL7 A;  4GRF A;  3WT2 A;  4K0N A;  5G5E A;  3L4N A;  2CV4 A;  5ECI B;  1NHO A;  4ISD A;  4DVC A;  4Q5N A;  2VL9 A;  5DJM A;  3NOF A;  4MH2 A;  3QMX A;  3L78 A;  2TIR A;  12GS A;  1HYU A;  1ZZY A;  3UVT A;  1BQ7 A;  3CTF A;  1W4V A;  1BYE A;  2C0E A;  3BCI A;  5INY A;  1A0R P;  2HSM A;  3R2Q A;  2H01 A;  1EGO A;  4K5S A;  3RHB A;  3CSH A;  4IHU A;  2ON5 A;  3F6F A;  1M3I A;  2GST A;  1UVZ A;  4WF5 A;  1EP8 A;  1XWK A;  3D6I A;  3HXS A;  5IOX A;  5JCU A;  3HVS A;  2IIY A;  5E4W A;  3TJK A;  5EY6 A;  2C1Y A;  2Z9S A;  1XVW A;  3TCO A;  5ID2 A;  4K2D A;  2RLI A;  2H1B A;  5G1K A;  5ABR A;  2GSQ A;  1HNC A;  1TK0 B;  1TJD A;  1PL1 A;  1WRY A;  1U3I A;  1FOV A;  2TRX A;  2B6M A;  4RI6 A;  1DSB A;  2J9H A;  2LJR A;  2EIO A;  2XBI A;  3F6D A;  3IAS 2;  2DMM A;  2M46 A;  4WF4 A;  2FWF A;  1QGV A;  2F51 A;  2YJH A;  3DEX A;  4EDY A;  2L5L A;  4G0I A;  2HRK A;  3GYK A;  3EMX A;  3EU3 A;  2KLX A;  5ECR B;  4KX4 A;  5HR2 A;  4MJB A;  1EV9 A;  2VLT A;  3DIE A;  4FIW A;  4HDE A;  4YH2 A;  3W8S A;  5FHI A;  2IME A;  4MZB A;  1GNW A;  1XW5 A;  3TKR A;  4EF0 A;  5C00 A;  1VGL A;  3IBH A;  3CRU A;  4J57 E;  5E59 A;  2P5R A;  4YKG A;  3EIN A;  1CQH A;  5DJL A;  1FAA A;  13GS A;  4K7O A;  3ZML A;  2HRA A;  1Z7P A;  2WUL A;  1E2Y A;  4TKY A;  1BJX A;  2JSY A;  5HFG A;  3GMF A;  1OVN A;  4DSR A;  2XBQ A;  1GSQ A;  1PKZ A;  4J2F A;  1XWC A;  2WB9 A;  3D4M A;  4KW6 A;  2GZZ A;  3QD9 A;  2VLV A;  2R2J A;  1S3D A;  1O81 A;  3CBU A;  1WWJ A;  3KCM A;  1EV4 A;  1X0R A;  2G2Q A;  4TXO A;  3IR4 A;  3IC4 A;  1A24 A;  4XCS A;  3HY2 A;  1X5E A;  3UEM A;  2CZ3 A;  2OAC A;  1B8X A;  2VIM A;  5G30 A;  1TU8 A;  1GTI A;  4Z2R A;  2WJU A;  3F4T A;  1NW2 A;  2HNL A;  1YDK A;  3US3 A;  1U6T A;  2H70 A;  2OAD A;  4J56 E;  2BMX A;  3BBY A;  5CRG A;  1TRU A;  2DLX A;  4EUY A;  4MAB A;  1DE1 A;  3PIN A;  3ZFL A;  2OA7 A;  1TP9 A;  6GSS A;  3RPP A;  20GS A;  3IDV A;  1O8X A;  4K1F A;  2IFQ A;  3TOU A;  1EEM A;  1X5C A;  3WYW A;  14GS A;  5ENU A;  3TKS A;  4WBJ A;  1A2M A;  1O6J A;  4EC0 A;  5DCH A;  2C4J A;  3LQ7 A;  5AIX A;  2CVD A;  2PGT A;  2WS2 A;  4TR3 A;  4N0Z A;  1ZGN A;  2H30 A;  1ZYN A;  1FVK A;  4ZL8 A;  3WD6 A;  4NV2 A;  5JWO B;  1ILO A;  1FVJ A;  4XS4 A;  4GSN A;  1R4W A;  2K8S A;  4E8H A;  3GKX A;  5ID2 B;  2E7P A;  2YWO A;  1U87 A;  1OE7 A;  1PL2 A;  3LFL A;  2A2S A;  2PPT A;  3APQ A;  3I43 A;  3DXB A;  1F3A A;  5ECL B;  3G9B A;  4EVM A;  1G6Y A;  3GH6 A;  5AIS A;  3DWV A;  1JZD A;  1YQ1 A;  3ZRE A;  5GSS A;  2FA4 A;  3MIX A;  3QOU A;  1VF4 A;  5CRE A;  1YF0 A;  3KGK A;  3L9U A;  2MMA A;  5CRH A;  4PUR A;  2HSH A;  4N0V A;  4O7H A;  4CY8 A;  1ACV A;  5EVO A;  2FUG 2;  1SL2 B;  1OAZ A;  1FB0 A;  5G2Z A;  4TN8 A;  4BIK A;  2VD1 A;  2GGT A;  2HE3 A;  2CT6 A;  3TKS E;  3F0I A;  3QR6 A;  4QL7 A;  5B6M A;  4OCE A;  1GSD A;  4MLY A;  1M99 A;  3TRX A;  3BD2 A;  4OD7 A;  2LTK A;  1S3A A;  3EPT A;  2C3N A;  3IHQ A;  5F8B A;  4XRD A;  2KP1 A;  1LBK A;  3M0F A;  2VL2 C;  3CXG A;  1SKS B;  4KE3 A;  2GSS A;  2FGX A;  4IQ1 A;  4WR5 A;  3GH9 A;  1BX9 A;  1TXX A;  4JU5 A;  3HZ4 A;  4AGS A;  4TXO B;  3C7M A;  1MDI A;  4F03 A;  3HJM A;  1A23 A;  1A2L A;  1SJI A;  1XW6 A;  3KMO A;  3LG6 A;  2O89 A;  2MYG A;  2LJA A;  4FO5 A;  4K5R A;  3LGC A;  1AW9 A;  2JL4 A;  1WP0 A;  2CAQ A;  4JRR A;  5B7C A;  4EIP A;  4I2T A;  1YZX A;  4HQZ A;  3KZQ A;  3HHV A;  3EC3 A;  2RII A;  3MAK A;  2NTO A;  2C8U A;  2IFQ B;  1GLP A;  2LQO A;  2QSI A;  2R3X A;  5J4U A;  1TRV A;  3I6A A;  3C73 A;  1M2B A;  3FY7 A;  2H6Z A;  5KEJ A;  4G2E A;  4FH8 A;  1Q98 A;  3UL3 A;  1VF1 A;  1OC3 A;  2YN1 A;  4HSC X;  2YPM A;  2F8F A;  2AV4 A;  4HI7 A;  5JWQ B;  2PWJ A;  1JZW A;  2DJ0 A;  1W89 A;  1BED A;  4ICY A;  1UA5 A;  4CY6 A;  6GST A;  1K3L A;  2AAW A;  3MWH A;  1I9D A;  3KP8 A;  3KD0 A;  2XHF A;  2O8V B;  1YJ6 A;  3DKS A;  3EWL A;  4DEJ A;  1VRS D;  2EC4 A;  2O7K A;  5B8B A;  3ZFB A;  3PGT A;  1DBY A;  4PUF C;  4XS6 A;  3WT1 A;  3ED3 A;  4XIH A;  4MF5 A;  1DUG A;  6GSY A;  2O87 A;  2GSR A;  5DCG A;  3VI7 A;  1C72 A;  4E8E A;  1M2A A;  4QL9 A;  4KUN A;  1JHB A;  3ERF A;  4O5Q A;  4HJ2 A;  4ZL9 A;  4TR4 A;  2DSA A;  3A3T A;  5IPG A;  1N2A A;  4IN0 A;  1B4P A;  2B5E A;  4PQ1 A;  4DSQ A;  1GUL A;  3UBL A;  2KUC A;  3GFK A;  4X4J A;  1Z3E A;  3KM6 A;  1M9A A;  1ZL9 A;  2E2G A;  4BWQ A;  4GWR A;  2AB6 A;  2CX4 A;  1V40 A;  4AJ7 A;  1XWA A;  3H4K A;  2L6C A;  2FLS A;  4KA0 A;  2WZ9 A;  2DJ2 A;  1T3B A;  3LSZ A;  5GAN D;  3S9F A;  2YV7 A;  2LS5 A;  1Z9H A;  3R3E A;  5KOX A;  2EIR A;  3FKF A;  1ERT A;  2LEG A;  1PD2 1;  3WGD A;  3KTB A;  3M1G A;  4I8B A;  2H76 A;  2PVQ A;  3APO A;  1MDK A;  2CX3 A;  1SKW B;  5J9B A;  4ZBA A;  2H1G A;  3H93 A;  1TU7 A;  3M9K A;  5A5K A;  2GZP A;  2VOC A;  2LNS A;  4GQF A;  1BAY A;  4POM A;  2FCH A;  2A4H A;  2L4Q A;  3QDN A;  1K0A A;  4N30 A;  5DAL A;  1T8E B;  1TRW A;  2UZ8 A;  4ZXG A;  4Q5R A;  5HFI A;  3G7J A;  5BRT A;  2VCT A;  3W8J A;  2XPE A;  1Z6M A;  2I3Y A;  2OBK A;  5GST A;  4ACS A;  1GH2 A;  1SJ6 A;  5F07 A;  5A4U A;  4ECI A;  5HR0 A;  3RHC A;  4A5P A;  5IO0 A;  3IK9 A;  4G19 A;  4POB A;  1OE8 A;  4YAP A;  1AXD A;  3WGX A;  1JZO A;  3GRX A;  3IAM 2;  2H6Y A;  3GL5 A;  4OWY A;  3IC8 A;  1Z7R A;  3LYP A;  1T1V A;  3ERG A;  4USS A;  1FOH A;  2GQL A;  2DIY A;  1QXH A;  3D4T A;  4PTS A;  4OFT A;  4V1A g;  3V1W A;  3A2X A;  3FYG A;  2MBS A;  1THX A;  1TK5 B;  2YZU A;  3FRC A;  2ES7 A;  3W6G A;  2V6O A;  5J9C A;  1XZO A;  4ECB A;  3KEB A;  4LL1 B;  2B5X A;  1GTB A;  1GL8 A;  3HVX A;  2AHE A;  4D73 A;  5H5S A;  3NIV A;  2FWG A;  3GTU A;  1E6B A;  2H1D A;  22GS A;  3CSI A;  1J08 A;  5H5R A;  3DVX A;  1PA3 A;  3KXO A;  4BL7 A;  3HKR A;  3C1S A;  4MJE A;  3UMA A;  1URM A;  4F82 A;  4O5R A;  1WIK A;  2BTO T;  5J41 A;  1GUK A;  4MH3 A;  2VL3 A;  2ZCT A;  1XIY A;  2PN8 A;  3DGQ A;  3TB2 A;  1TK8 B;  3APS A;  2DML A;  5B6N A;  5DBQ A;  3I9V 2;  5ECN B;  3LYK A;  4FQU A;  3VPQ A;  3DRN A;  1XW9 A;  4OFN A;  2VCZ A;  4PNF A;  5D93 A;  1PX7 A;  1PX6 A;  1HNB A;  5CNW A;  2H71 A;  3ZIT A;  2JZR A;  4I5Q A;  4CW9 A;  4LLR A;  1ON4 A;  1PMT A;  5CAX A;  3IA1 A;  3F63 A;  6GSX A;  1OYJ A;  4QQ7 A;  3F3Q A;  1TDI A;  4JR4 A;  3MNG A;  3A2W A;  3LXZ A;  3KTL A;  2A4V A;  3M3M A;  5D96 A;  4I2U A;  4KCE A;  3P7X A;  4CDO A;  2V41 A;  1XOA A;  3GIX A;  5GAP D;  1IYH A;  3VUR A;  1ERV A;  5ECP B;  3UJ1 A;  5CRD A;  4IS0 A;  4AJ6 A;  4NAX A;  2L4C A;  2OE0 A;  3H79 A;  5DAL B;  1EZK A;  3HVN A;  3GA4 A;  1SYR A;  3HDC A;  1YEX A;  1M0U A;  2H1A A;  1SL0 B;  1V2A A;  2FA8 A;  3VPT A;  4ZB8 A;  1GP1 A;  4FYU A;  2QA2 A;  4MF6 A;  2FWE A;  2YJ7 A;  2V2G A;  2IMK A;  5D9X A;  2G0F A;  3FZA A;  1G7E A;  5IQY A;  1PSQ A;  3M9J A;  2NVL A;  1A0F A;  3C8E A;  1GSS A;  17GS A;  2C3Q A;  5AIV A;  3J7Y b;  1T4Y A;  2CZ2 A;  18GS A;  4XTS A;  1G6W A;  4RUV A;  3ZRD A;  2VCV A;  2DBC A;  1I5G A;  3A5I A;  2WCI A;  2R6K A;  1YKC A;  1SK1 A;  1Y25 A;  2VL2 A;  4K7N A;  2C0D A;  8GSS A;  2ZNM A;  1SL1 B;  2HZF A;  4GCI A;  2YNX A;  3LWA A;  2GLR A;  3MDK A;  1EWX A;  4X0X A;  3TKQ A;  4D73 B;  1A8L A;  3C1R A;  4OO5 A;  3GTU B;  1VF3 A;  2YV9 A;  16GS A;  4G10 A;  3TDG A;  5KN3 A;  1USB A;  5JCW A;  5DVB A;  4BL7 B;  2VO4 A;  3VFI A;  1FHE A;  1U3A A;  1K0B A;  2H0G A;  2L57 A;  2ON7 A;  1M7T A;  3F9U A;  5FT3 A;  2OJL A;  4GLT A;  2X8G A;  4WR4 A;  4GQC A;  5HFK A;  4IKH A;  2V6K A; 
#chains in the Genus database with same CATH homology
 4IBP A;  2X4A A;  2M72 A;  1JLW A;  4TOP A;  2NBS A;  4FYB A;  2A2P A;  1PN0 A;  4OFM A;  5B8A A;  4NXI A;  1PKW A;  2YWI A;  4TR1 A;  3C71 A;  1O73 A;  2V32 A;  1F3B A;  3IE3 A;  1RK4 A;  4ZB6 A;  2R0G A;  3FW2 A;  4NV5 A;  2GVP A;  1LU4 A;  1K3Y A;  4GF0 A;  3VWV A;  1X9W B;  2N5B A;  1PGT A;  3SWL A;  1XFL A;  1AAZ A;  5KN2 A;  3ERW A;  4KCA A;  2HSY A;  1T7P B;  1RW1 A;  2HT9 A;  4YQV A;  3JCM L;  4ML1 A;  3RBT A;  1AC1 A;  3GX0 A;  4EDZ A;  2PUK C;  2K18 A;  2HI7 A;  1WOU A;  4PUA A;  1AQV A;  4RI7 A;  3GST A;  1OC8 A;  1TW9 A;  2VM2 A;  3DYR A;  3AY8 A;  4IJ3 A;  1SEN A;  5ECH B;  2JU5 A;  1F6M C;  4ML6 A;  5DQY A;  4GTU A;  4TXV A;  2BJX A;  5F0G A;  5ECQ B;  4MJA A;  2YWN A;  4ZB9 A;  3CRT A;  5CO3 A;  1X9S B;  1T00 A;  4XS1 A;  3GUR A;  1YY7 A;  3IRA A;  1R26 A;  2GTU A;  3TJB A;  4BPY A;  4F2I A;  1N8J A;  1QFN A;  2D2Z A;  2LRC A;  4L5L A;  2IJY A;  1OKD A;  1ERW A;  3U5R E;  3UOM A;  2LST A;  2CAI A;  3J7Y k;  5DQS A;  1TTZ A;  3CTG A;  1XOB A;  3KIJ A;  1IYI A;  4GST A;  1B9X C;  5IMD A;  1MD3 A;  5IMV A;  2P0G A;  2DIZ A;  3CYN A;  6GSV A;  4KB3 A;  4H86 A;  2X49 A;  5A4W A;  2DJ3 A;  3VWX A;  2RM6 A;  2ZUP A;  7GSS A;  5F06 A;  1ZYQ B;  3GL3 A;  5J3R A;  1KBN A;  3FEU A;  4XHM A;  1SD8 A;  2N5A A;  3H8Q A;  1V9W A;  2RM5 A;  3IPZ A;  2YP6 A;  2MBT A;  2I4A A;  1ZYE A;  2B7K A;  1GRX A;  2L5O A;  2IN3 A;  2LRT A;  1K3O A;  1K0M A;  2VUP A;  4JBB A;  5G31 A;  1NM3 A;  2P31 A;  3GSS A;  2NDO A;  2IWT A;  4O5U A;  3Q6O A;  3HCZ A;  2WDU A;  4K8M A;  1X5D A;  4MJC A;  4F0C A;  4LL4 B;  1H4O A;  2VCX A;  3FK8 A;  1KEB A;  3O6T A;  3P2A A;  4TR1 B;  1M9B A;  2GQM A;  1ZMA A;  4LA1 A;  3IV4 A;  4KSM A;  3NZN A;  5KN1 A;  3GKN A;  3EYT A;  5ECM B;  2OBI A;  3HVV A;  2GT5 A;  4GXZ A;  4WET A;  1VF2 A;  4Z2T A;  4TW5 A;  4NWY A;  3ZZX A;  4N11 A;  2H8L A;  1WMJ A;  4Q5Q A;  3EUR A;  2TRC P;  3D21 A;  3KJY A;  1GTU A;  3UAR A;  2R0P A;  6GSW A;  3HZ8 A;  3G7I A;  1YEP A;  1G7O A;  4WKW A;  4KH7 A;  1FO5 A;  1Z6N A;  4BWS A;  4ID0 A;  3RPN A;  1A2J A;  5G1L A;  1SK0 A;  4L0U A;  3CMI A;  2X99 A;  1SK2 A;  4K0G A;  1T4Z A;  3HA9 A;  4NHW A;  3BJ5 A;  2H75 A;  3RDW A;  4TVE A;  3FHK A;  2FWH A;  1K0D A;  2JAC A;  1ZOF A;  5IO2 A;  5G5F A;  4KND A;  5DAK A;  3TUE A;  2PBJ A;  2YCD A;  5LD0 A;  1AUC A;  3E0U A;  2DKH A;  3QAV A;  2H0H A;  3KMN A;  4MCU A;  3KH7 A;  1Z5Y E;  2QC7 A;  3ZMK A;  4IP1 A;  2HZE A;  2LNT A;  1SU9 A;  3GNJ A;  4HQS A;  4OCF A;  5CRW A;  4MMM A;  3M8N A;  5BMU A;  1SKR B;  2IMD A;  11GS A;  3LOR A;  4Z7X A;  1CQG A;  1XXU A;  1SYX A;  3D5J A;  3HJP A;  4BVY B;  4HS1 A;  1S3C A;  5HR1 A;  3IOS A;  4TR0 A;  1SJZ A;  3TGZ A;  3ZL5 A;  2F3M A;  1AIU A;  4L5O A;  3UBK A;  4MF7 A;  1FB6 A;  1WJK A;  2VD0 A;  6GSU A;  4OMV A;  2FHE A;  1B4Q A;  2DJ1 A;  2LUS A;  3PH9 A;  4IQA A;  4WEY A;  2H6X A;  1XCC A;  3Q74 A;  4IGJ A;  4MK3 A;  1GWC A;  4TRX A;  5C04 A;  2HYX A;  1LJR A;  1NHY A;  5HR3 A;  3FR9 A;  4V1A p;  3FZ4 A;  9GSS A;  1QQ2 A;  1Q4J A;  3MYD A;  3ME7 A;  3MSZ A;  3ZLP A;  3F8U A;  1X9M B;  4G9H A;  1JZR A;  1U88 A;  2GDR A;  3FZ9 A;  3UIW A;  1TI1 A;  1J9B A;  2XC2 A;  4MZC A;  4ZIJ A;  3F4R A;  3QAW A;  4PGT A;  3ZIV A;  2C80 A;  2IL3 A;  3E9J B;  4KF9 A;  5AGY A;  4PX1 A;  5ECO B;  4K6X A;  3TKP A;  3H1N A;  3LEF A;  3HYP A;  4CHS A;  3LXT A;  4HZ2 A;  4I97 A;  3E3E A;  5CYY A;  2LJK A;  2XPD A;  3WGE A;  1O7U A;  4IJI A;  3FZ5 A;  4L0W A;  4NPB A;  2I9H A;  1WE0 A;  3HD5 A;  4NMU A;  4ZBB A;  2YZH A;  1K0N A;  3FMW A;  2R37 A;  2JZS A;  3DD3 A;  3G7Y A;  4RQR A;  3TJF A;  5JWR B;  3GKK A;  3PR8 A;  4BVX A;  3K8N A;  2VAF A;  3PPU A;  4HUA A;  5DAK B;  2FNO A;  2H72 A;  2OE1 A;  3ISO A;  5IM9 A;  5KN0 A;  4IEL A;  2J23 A;  3IXR A;  5CP1 A;  1KNG A;  2GS3 A;  4LMW A;  3TOT A;  4PQH A;  1J0F A;  4O32 A;  5DDL A;  2HZE B;  4F0B A;  4HZ4 A;  5HQP A;  3VLN A;  4MPF A;  1AQW A;  5IOW A;  4JE1 A;  1THO A;  2AUV A;  4G0L A;  3GN3 A;  2C0F A;  4KAE A;  4MA9 A;  2B3S A;  4P3Y B;  1K0C A;  5H5Q A;  4AJ8 A;  3F3R A;  4POK A;  2L59 A;  1XBS A;  3EMP A;  3EE2 A;  3O3T A;  3BCK A;  1ST9 A;  3FR3 A;  3FR6 A;  3Q19 A;  3ME8 A;  2B1L A;  2DKI A;  4KDU A;  5EL8 A;  1EOG A;  1R5A A;  1OKT A;  3VI5 A;  4DSS A;  4JZQ A;  2HLS A;  1OC9 A;  2GT6 A;  1AQX A;  2IPA A;  1K0O A;  2OE3 A;  3KP9 A;  5JCG A;  2MMN A;  4JR6 A;  4IP6 A;  2IMF A;  5J5N A;  2PVO C;  5D8I A;  1V57 A;  3I69 A;  4KDX A;  2H74 A;  2O85 A;  1GNE A;  5COH A;  4AF2 A;  1V58 A;  1BG5 A;  1QUW A;  2JZT A;  4MPG A;  2K6V A;  2RUE A;  4X1U A;  3UAP A;  5EPF A;  4ECJ A;  3ZVJ A;  4V2N A;  3N9J A;  1PRX A;  4BA7 A;  3IK7 A;  2MZC A;  2X64 A;  1GSY A;  2R0C A;  2LQQ A;  2H66 A;  2VLU A;  3ZTL A;  1XVQ A;  2PU9 C;  2F9S A;  4JED A;  5ELA A;  3BOA A;  2YOI A;  2GZY A;  2R4V A;  1ERU A;  1F37 A;  3IHG A;  4BVX B;  2FY6 A;  2X8C A;  2L6D A;  1HQO A;  4EO3 A;  1ZCP A;  1RQM A;  2KOK A;  2V1M A;  4K9Z A;  2GQK A;  2H0I A;  5IIZ A;  3DML A;  1KTE A;  2B7J A;  3KH9 A;  2CA8 A;  1O85 A;  5IMA A;  3TRP A;  5IMF A;  1FW1 A;  2CVB A;  2JSZ A;  4V2L A;  3A5W A;  1HNA A;  4KGI A;  2AJQ B;  4K7I A;  1EEJ A;  1FG4 A;  3UVH A;  2AYT A;  1UN2 A;  3L0H A;  5ELG A;  3Q18 A;  2KHP A;  4ILF A;  1EOH A;  3L9V A;  4K2X A;  2YAN A;  2PER A;  3LW9 A;  3P8W A;  4IVF A;  2N5F A;  3VWW A;  5ECK B;  2KP2 A;  1QMV A;  1H75 A;  1M2D A;  3GHA A;  3HJO A;  4XRA A;  1GSU A;  2F8A A;  2PMT A;  2LKU A;  4O92 A;  1B48 A;  3QFA C;  3TKS C;  4MDC A;  2B1K A;  4MP4 A;  2E0Q A;  4IW9 A;  4EIQ A;  3GUS A;  1PQN A;  1YF1 A;  2HFD A;  2MMO A;  2YWM A;  3P90 A;  3TJG A;  1Y6E A;  1QK8 A;  4DSS B;  1OC9 B;  3N5O A;  4ZIL A;  5IPH A;  1GUM A;  4BVY A;  1F9M A;  4RQX A;  4HEA 2;  2LV3 A;  2C0G A;  2DC5 A;  1GLQ A;  1XWG A;  2LRN A;  4Q5F A;  2ALB A;  4G0K A;  2MMZ A;  1PN9 A;  2WGR A;  4ZBD A;  2K8V A;  3VWU A;  3A2V A;  2FD3 A;  2VCQ A;  5F05 A;  2HXK A;  3OR5 A;  3O76 A;  4MZW A;  2NPB A;  1JLV A;  3LJR A;  1GUH A;  4V2M A;  3ZIJ A;  4HU7 A;  4XS4 B;  3GV1 A;  2REM A;  3TRQ A;  4LMV A;  1SD9 A;  4WXT A;  5L71 A;  2H19 A;  3SBC A;  4EKZ A;  2VCW A;  5IMZ A;  4Z2U A;  1GTA A;  2R5G A;  1XWB A;  4GSS A;  4YQM A;  2VM1 A;  1JFU A;  2HRF A;  5LNK e;  1MDJ A;  2WFC A;  2OKA A;  1MD4 A;  4MNN A;  1R5P A;  3QPM A;  1EGR A;  2M80 A;  1MEK A;  2X8H A;  2P5Q A;  1F2E A;  2WRT A;  2QGV A;  1GSE A;  5A4V A;  5D9T A;  3EVI A;  2HRN A;  5D9W A;  1TKD B;  4I6X A;  2DJK A;  1ZYP A;  1DE2 A;  4HJM A;  1XPV A;  2K9F A;  1ML6 A;  2CQ9 A;  3ZVJ D;  4EE0 A;  4ULX A;  4NHZ A;  3RAZ A;  4YAV A;  2I81 A;  2EIQ A;  5LCZ A;  4YKF A;  5GZZ B;  4EL1 A;  4ECC A;  10GS A;  2H73 A;  3CSJ A;  2I1U A;  4EXJ A;  1B9Y C;  1TOF A;  5AN1 A;  4OO4 A;  4N10 A;  1HD2 A;  1O8W A;  2C3T A;  1EP7 A;  3ZYW A;  4HU9 A;  3GKM A;  4L8E A;  3DVW A;  3EU4 A;  2JAD A;  4HOJ A;  4F9Z A;  5IMC A;  4PNG A;  1NSW A;  3U6V A;  3QFB C;  3TJJ A;  5D73 A;  4YQU A;  1TRS A;  2CVK A;  1G0T A;  2B5Y A;  4KDY A;  3D22 A;  5D9V A;  19GS A;  5KOW A;  3QAG A;  3D0Z A;  1MTC A;  3L9S A;  1ABA A;  1R7H A;  2RUF A;  3F4S A;  1YKA A;  4FYC A;  3QCP A;  5FWG A;  1WPI A;  1V98 A;  4KSO A;  4X43 A;  2E2M A;  4POL A;  1UC7 A;  1GSF A;  5ECS A;  1TI3 A;  2IMI A;  3GX8 A;  4WBR D;  2DJJ A;  3VK9 A;  4PQI A;  2A2R A;  4PXO A;  1A8Y A;  2QA1 A;  2QKE A;  4ZL7 A;  4GRF A;  3WT2 A;  4K0N A;  5G5E A;  3L4N A;  2CV4 A;  5ECI B;  1NHO A;  4ISD A;  4DVC A;  4Q5N A;  2VL9 A;  5DJM A;  3NOF A;  4MH2 A;  3QMX A;  3L78 A;  2TIR A;  12GS A;  1HYU A;  1ZZY A;  3UVT A;  1BQ7 A;  3CTF A;  1W4V A;  1BYE A;  2C0E A;  3BCI A;  5INY A;  1A0R P;  2HSM A;  3R2Q A;  2H01 A;  1EGO A;  4K5S A;  3RHB A;  3CSH A;  4IHU A;  2ON5 A;  3F6F A;  2GST A;  1UVZ A;  4WF5 A;  1EP8 A;  1XWK A;  3D6I A;  3HXS A;  5IOX A;  5JCU A;  3HVS A;  2IIY A;  5E4W A;  3TJK A;  5EY6 A;  2C1Y A;  2Z9S A;  1XVW A;  3TCO A;  5ID2 A;  4K2D A;  2RLI A;  2H1B A;  5G1K A;  5ABR A;  2GSQ A;  1HNC A;  1TK0 B;  1TJD A;  1PL1 A;  1WRY A;  1U3I A;  1FOV A;  2TRX A;  2B6M A;  4RI6 A;  1DSB A;  2J9H A;  2LJR A;  2EIO A;  2XBI A;  3F6D A;  3IAS 2;  2DMM A;  2M46 A;  4WF4 A;  2FWF A;  1QGV A;  2F51 A;  2YJH A;  3DEX A;  4EDY A;  2L5L A;  4G0I A;  2HRK A;  3GYK A;  3EMX A;  3EU3 A;  2KLX A;  5ECR B;  4KX4 A;  5HR2 A;  4MJB A;  1EV9 A;  2VLT A;  3DIE A;  4FIW A;  4HDE A;  4YH2 A;  3W8S A;  5FHI A;  2IME A;  4MZB A;  1GNW A;  1XW5 A;  3TKR A;  4EF0 A;  5C00 A;  1VGL A;  3IBH A;  3CRU A;  4J57 E;  5E59 A;  2P5R A;  4YKG A;  3EIN A;  1CQH A;  5DJL A;  1FAA A;  13GS A;  4K7O A;  3ZML A;  2HRA A;  1Z7P A;  2WUL A;  1E2Y A;  4TKY A;  1BJX A;  2JSY A;  5HFG A;  3GMF A;  1OVN A;  4DSR A;  2XBQ A;  1GSQ A;  1PKZ A;  4J2F A;  1XWC A;  2WB9 A;  3D4M A;  4KW6 A;  2GZZ A;  3QD9 A;  2VLV A;  2R2J A;  1S3D A;  1O81 A;  3CBU A;  1WWJ A;  3KCM A;  1EV4 A;  1X0R A;  2G2Q A;  4TXO A;  3IR4 A;  3IC4 A;  1A24 A;  4XCS A;  3HY2 A;  1X5E A;  3UEM A;  2CZ3 A;  2OAC A;  1B8X A;  2VIM A;  5G30 A;  1TU8 A;  1GTI A;  4Z2R A;  2WJU A;  3F4T A;  1NW2 A;  2HNL A;  1YDK A;  3US3 A;  1U6T A;  2H70 A;  2OAD A;  4J56 E;  2BMX A;  3BBY A;  5CRG A;  1TRU A;  2DLX A;  4EUY A;  4MAB A;  1DE1 A;  3PIN A;  3ZFL A;  2OA7 A;  1TP9 A;  6GSS A;  3RPP A;  20GS A;  3IDV A;  1O8X A;  4K1F A;  2IFQ A;  3TOU A;  1EEM A;  1X5C A;  3WYW A;  14GS A;  5ENU A;  3TKS A;  4WBJ A;  1A2M A;  1O6J A;  4EC0 A;  5DCH A;  2C4J A;  3LQ7 A;  5AIX A;  2CVD A;  2PGT A;  2WS2 A;  4TR3 A;  4N0Z A;  1ZGN A;  2H30 A;  1ZYN A;  1FVK A;  4ZL8 A;  3WD6 A;  4NV2 A;  5JWO B;  1ILO A;  1FVJ A;  4XS4 A;  4GSN A;  1R4W A;  2K8S A;  4E8H A;  3GKX A;  5ID2 B;  2E7P A;  2YWO A;  1U87 A;  1OE7 A;  1PL2 A;  3LFL A;  2A2S A;  2PPT A;  3APQ A;  3I43 A;  3DXB A;  1F3A A;  5ECL B;  3G9B A;  4EVM A;  1G6Y A;  3GH6 A;  5AIS A;  3DWV A;  1JZD A;  1YQ1 A;  3ZRE A;  5GSS A;  2FA4 A;  3MIX A;  3QOU A;  1VF4 A;  5CRE A;  1YF0 A;  3KGK A;  3L9U A;  2MMA A;  5CRH A;  4PUR A;  2HSH A;  4N0V A;  4O7H A;  4CY8 A;  1ACV A;  5EVO A;  2FUG 2;  1SL2 B;  1OAZ A;  1FB0 A;  5G2Z A;  4TN8 A;  2VD1 A;  2GGT A;  2HE3 A;  2CT6 A;  3TKS E;  3F0I A;  3QR6 A;  4QL7 A;  5B6M A;  4OCE A;  1GSD A;  4MLY A;  1M99 A;  3TRX A;  3BD2 A;  4OD7 A;  2LTK A;  1S3A A;  3EPT A;  2C3N A;  3IHQ A;  5F8B A;  4XRD A;  2KP1 A;  1LBK A;  3M0F A;  2VL2 C;  3CXG A;  1SKS B;  4KE3 A;  2GSS A;  2FGX A;  4IQ1 A;  4WR5 A;  3GH9 A;  1BX9 A;  1TXX A;  4JU5 A;  3HZ4 A;  4AGS A;  4TXO B;  3C7M A;  1MDI A;  4F03 A;  3HJM A;  1A23 A;  1A2L A;  1SJI A;  1XW6 A;  3KMO A;  3LG6 A;  2O89 A;  2MYG A;  2LJA A;  4FO5 A;  4K5R A;  3LGC A;  1AW9 A;  2JL4 A;  1WP0 A;  2CAQ A;  4JRR A;  5B7C A;  4EIP A;  4I2T A;  1YZX A;  4HQZ A;  3KZQ A;  3HHV A;  3EC3 A;  2RII A;  3MAK A;  2NTO A;  2C8U A;  2IFQ B;  1GLP A;  2LQO A;  2QSI A;  2R3X A;  5J4U A;  1TRV A;  3I6A A;  3C73 A;  1M2B A;  3FY7 A;  2H6Z A;  5KEJ A;  4G2E A;  4FH8 A;  1Q98 A;  3UL3 A;  1VF1 A;  1OC3 A;  2YN1 A;  2YPM A;  2F8F A;  2AV4 A;  4HI7 A;  5JWQ B;  2PWJ A;  1JZW A;  2DJ0 A;  1W89 A;  1BED A;  4ICY A;  1UA5 A;  4CY6 A;  6GST A;  1K3L A;  2AAW A;  3MWH A;  1I9D A;  3KP8 A;  3KD0 A;  2XHF A;  2O8V B;  1YJ6 A;  3DKS A;  3EWL A;  4DEJ A;  1VRS D;  2EC4 A;  2O7K A;  5B8B A;  3ZFB A;  3PGT A;  1DBY A;  4PUF C;  4XS6 A;  3WT1 A;  3ED3 A;  4XIH A;  4MF5 A;  1DUG A;  6GSY A;  2O87 A;  2GSR A;  5DCG A;  3VI7 A;  1C72 A;  4E8E A;  1M2A A;  4QL9 A;  4KUN A;  1JHB A;  3ERF A;  4O5Q A;  4HJ2 A;  4ZL9 A;  4TR4 A;  2DSA A;  3A3T A;  5IPG A;  1N2A A;  4IN0 A;  1B4P A;  2B5E A;  4PQ1 A;  4DSQ A;  1GUL A;  3UBL A;  2KUC A;  3GFK A;  4X4J A;  1Z3E A;  3KM6 A;  1M9A A;  1ZL9 A;  2E2G A;  4BWQ A;  4GWR A;  2AB6 A;  2CX4 A;  1V40 A;  4AJ7 A;  1XWA A;  3H4K A;  2L6C A;  2FLS A;  4KA0 A;  2WZ9 A;  2DJ2 A;  1T3B A;  3LSZ A;  5GAN D;  3S9F A;  2YV7 A;  2LS5 A;  1Z9H A;  3R3E A;  5KOX A;  2EIR A;  3FKF A;  1ERT A;  2LEG A;  1PD2 1;  3WGD A;  3KTB A;  3M1G A;  4I8B A;  2H76 A;  2PVQ A;  3APO A;  1MDK A;  2CX3 A;  1SKW B;  5J9B A;  4ZBA A;  2H1G A;  3H93 A;  1TU7 A;  3M9K A;  5A5K A;  2GZP A;  2VOC A;  2LNS A;  4GQF A;  1BAY A;  4POM A;  2FCH A;  2A4H A;  2L4Q A;  3QDN A;  1K0A A;  4N30 A;  5DAL A;  1T8E B;  1TRW A;  2UZ8 A;  4ZXG A;  4Q5R A;  5HFI A;  3G7J A;  5BRT A;  2VCT A;  3W8J A;  2XPE A;  1Z6M A;  2I3Y A;  2OBK A;  5GST A;  4ACS A;  1GH2 A;  1SJ6 A;  5F07 A;  5A4U A;  4ECI A;  5HR0 A;  3RHC A;  4A5P A;  5IO0 A;  3IK9 A;  4G19 A;  4POB A;  1OE8 A;  4YAP A;  1AXD A;  3WGX A;  1JZO A;  3GRX A;  3IAM 2;  2H6Y A;  3GL5 A;  4OWY A;  3IC8 A;  1Z7R A;  3LYP A;  1T1V A;  3ERG A;  4USS A;  1FOH A;  2GQL A;  2DIY A;  1QXH A;  3D4T A;  4PTS A;  4OFT A;  4V1A g;  3V1W A;  3A2X A;  3FYG A;  2MBS A;  1THX A;  1TK5 B;  2YZU A;  3FRC A;  2ES7 A;  3W6G A;  2V6O A;  5J9C A;  1XZO A;  4ECB A;  3KEB A;  4LL1 B;  2B5X A;  1GTB A;  1GL8 A;  3HVX A;  2AHE A;  4D73 A;  5H5S A;  3NIV A;  2FWG A;  3GTU A;  1E6B A;  2H1D A;  22GS A;  3CSI A;  1J08 A;  5H5R A;  3DVX A;  1PA3 A;  3KXO A;  4BL7 A;  3HKR A;  3C1S A;  4MJE A;  3UMA A;  1URM A;  4F82 A;  4O5R A;  1WIK A;  2BTO T;  5J41 A;  1GUK A;  4MH3 A;  2VL3 A;  2ZCT A;  1XIY A;  2PN8 A;  3DGQ A;  3TB2 A;  1TK8 B;  3APS A;  2DML A;  5B6N A;  5DBQ A;  3I9V 2;  5ECN B;  3LYK A;  4FQU A;  3VPQ A;  3DRN A;  1XW9 A;  4OFN A;  2VCZ A;  4PNF A;  5D93 A;  1PX7 A;  1PX6 A;  1HNB A;  5CNW A;  2H71 A;  3ZIT A;  2JZR A;  4I5Q A;  4CW9 A;  4LLR A;  1ON4 A;  1PMT A;  5CAX A;  3IA1 A;  3F63 A;  6GSX A;  1OYJ A;  4QQ7 A;  3F3Q A;  1TDI A;  4JR4 A;  3MNG A;  3A2W A;  3LXZ A;  3KTL A;  2A4V A;  3M3M A;  5D96 A;  4I2U A;  4KCE A;  3P7X A;  4CDO A;  2V41 A;  1XOA A;  3GIX A;  5GAP D;  1IYH A;  3VUR A;  1ERV A;  5ECP B;  3UJ1 A;  5CRD A;  4IS0 A;  4AJ6 A;  4NAX A;  2L4C A;  2OE0 A;  3H79 A;  5DAL B;  1EZK A;  3GA4 A;  1SYR A;  3HDC A;  1YEX A;  1M0U A;  2H1A A;  1SL0 B;  1V2A A;  2FA8 A;  3VPT A;  4ZB8 A;  1GP1 A;  4FYU A;  2QA2 A;  4MF6 A;  2FWE A;  2YJ7 A;  2V2G A;  2IMK A;  5D9X A;  2G0F A;  3FZA A;  1G7E A;  5IQY A;  1PSQ A;  3M9J A;  2NVL A;  1A0F A;  3C8E A;  1GSS A;  17GS A;  2C3Q A;  5AIV A;  3J7Y b;  1T4Y A;  2CZ2 A;  18GS A;  4XTS A;  1G6W A;  4RUV A;  3ZRD A;  2VCV A;  2DBC A;  1I5G A;  3A5I A;  2WCI A;  2R6K A;  1YKC A;  1SK1 A;  1Y25 A;  2VL2 A;  4K7N A;  2C0D A;  8GSS A;  2ZNM A;  1SL1 B;  2HZF A;  4GCI A;  2YNX A;  3LWA A;  2GLR A;  3MDK A;  1EWX A;  4X0X A;  3TKQ A;  4D73 B;  1A8L A;  3C1R A;  4OO5 A;  3GTU B;  1VF3 A;  2YV9 A;  16GS A;  4G10 A;  3TDG A;  5KN3 A;  1USB A;  5JCW A;  5DVB A;  4BL7 B;  2VO4 A;  3VFI A;  1FHE A;  1U3A A;  1K0B A;  2H0G A;  2L57 A;  2ON7 A;  1M7T A;  3F9U A;  5FT3 A;  2OJL A;  4GLT A;  2X8G A;  4WR4 A;  4GQC A;  5HFK A;  4IKH A;  2V6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...