2IG0A

Structure of 53bp1/methylated histone peptide complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Methylation State-Specific Recognition of Histone H4-K20 by 53BP1 and Crb2 in DNA Repair.
pubmed doi rcsb
molecule keywords Tumor suppressor p53-binding protein 1
molecule tags Cell cycle
source organism Homo sapiens
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ig0A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ig0A01
3J81E 4IUPA 2HQEA 3OYYA 3DLLA 2R58A 5D6YA 3CC7A 4IUQA 3OYLA 4QW2A 1QVGA 1VQ5T 3UWNA 3M9QA 1S72T 1YI2A 3BDLA 3L42A 2LVMA 1KHCA 1G5VA 3LGFA 5M9OA 1WJRA 2BKDN 3OYEA 1VQLA 3OA6A 1VQOA 3CCEA 3H6ZA 1XTDA 3CMAA 2E5QA 2P0KA 4IKFA 3CCJA 4ZN1A 3G4ST 3OYHA 4E7JA 3LLRA 4EDUA 5A2QE 2LTOA 5IN1A 5FRMA 3OMGA 3DB3A 3LH0A 2EQUA 4IURA 3CMET 3CCLT 4TVRA 3I56T 3CXCA 3OW2S 1JJ2S 2DIQA 3L2WA 1VQNT 1RL2A 3P8BB 4L59A 4FU6A 4BE0A 2RJCA 4IUTA 2QEXT 1K73U 2JNGA 2QQSA 1YJNA 3FDRA 2RHXA 1H3ZA 5FRNA 2L3RA 1XNIA 2GFUA 2RJEA 2X35A 3G6ET 3OYJA 5J3BA 3E9GA 4A4EA 3PMTA 3J80E 2KVQG 1KC8C 3OYNA 1YHQT 2JUFA 1BKBA 1X6OA 2DO3A 5LL6S 3H8ZA 2LQ8A 3CCRT 4ZTJA 2R5MA 2OTJA 1WJSA 3ASKA 2GF7A 2M1HA 1KHIA 1VQPT 1YJWT 2CKKA 1VQ6A 3L2QA 4NS5A 2EFIA 1VQKT 3CD6A 1VQ7A 5KE3A 3O8VA 1OZ2A 3OYDA 3LX7A 1YIJA 3GOXA 4ZN3A 5IT9E 5DM7R 4C5HA 1QVGS 1WJQA 1K73C 2IG0A 1YJ9A 2O4XA 4E7KA 4UC4A 2RJDA 4C5EA 2R57A 1KC8U 5KCOA 4IUUA 3MEAA 4E7IA 1OI1A 3L2VA 4GY5A 3S3NA 3OYCA 3P8DA 2RJFA 3CCST 1VQ5A 1S72A 1M90U 2VYTA 4QVZA 1YI2T 4C5IA 1YITT 3JAME 4OVAA 2K3YA 3MP8A 4BDZA 2HQXA 2X4WA 4QQGA 2E70A 2RO0A 1OYXA 1KQSA 5D6XA 1VQ4T 4LD6A 1WGSA 3CXCS 1Q7YC 2X4YA 2MWPA 3G4SA 2EQMA 2OTLT 3PIPA 3NTHA 2DIGA 3CCMT 2JTFA 2EQJA 4B9WA 3OYAA 2E6ZA 3CMEA 3PIOA 1KD1U 3L2RA 3CCLA 3OS1A 3DLMA 3I56A 3PFSA 4CRIA 2O4XB 3P8HA 1VQNA 2LCCA 1VQ9A 4A4FA 1K9MU 2QEXA 3Q1JA 2RI2A 4A4GA 3FC3A 3KUFA 1YJNT 1M1GA 3OS2A 3CC2T 5J39A 3QIIA 3I55T 5KH6A 3E9FA 3G71T 4N4GA 3MO8A 3NTIA 2KDSA 3OQ5A 3OYFA 1N27A 2K3XA 1IZ6A 3CCQT 1YHQA 3CPWA 1M90C 3CCVT 2B8AA 3S3OA 1SSFA 2RHUA 2X4XA 3PNWC 3CC4A 3OYIA 5D6WA 1N8RC 3NTKA 1Q7YU 3FEOA 2LDMA 1NPRA 3J7AF 4ZTFA 5C6SA 1NZ9A 1VQPA 1YJWA 3CCUA 3MEUA 1Q81U 2XK0A 1VQKA 4QQDA 3L2UA 3OYBA 5FROA 5C0MA 3OS0A 2RI5A 1VQ7T 2LRQA 2EKOA 2MI6A 1VQ8T 3ER0A 3KBGA 1KD1C 4IUVA 3EAEA 2QQRA 2L89A 4X34A 3META 5FLXE 2D9TA 1VQMA 1QVFA 5KE2A 1K9MC 2QA4T 3S3MA 2JVVA 3PMIA 4E7HA 3CC7T 5KCHA 2BUDA 4BE2A 2F5KA 3OYKA 3OMCA 1W2BA 3F70A 3QBYA 4E7LA 2R5AA 2WACA 4BACA 2FHDA 2M16A 4QQ6A 2NLUA 3CCSA 4B9XA 1KQSS 3ME9A 1VQLT 4BE1A 2BIVA 1M1KU 1VQOT 3CCET 2JOYA 2EIFA 1YITA 1N8RU 2PQWA 3UT1A 5DLQE 1OZ3A 3CMAT 4II1A 1NPPA 3CCJT 2RHIA 1Q86C 5HY6A 2LCLA 1VQ4A 3MP6A 1Q81C 3ZEHA 3MEWA 1YBYA 4N4HA 1NJIU 3QKJA 1MHNA 3LGLA 3MEVA 2OTLA 1K8AC 3CCMA 4BDYA 2E6NA 2M0OA 1UEBA 2MWOA 2YRVA 1VQ9T 3OB9A 5J26A 3SD4A 3LYIA 4HCZA 2L8DA 1Q82C 3G6EA 3CPWS 3OW2A 1JJ2A 3OYMA 3CC2A 2EQKA 4FL6A 3I55A 2GFAA 3G71A 5CIUA 3S6WA 3OY9A 2DAQA 2RI3A 2XHCA 3CCRA 3CCQA 1M1KC 3CCVA 2OTJT 4Q5WA 4C5GA 4PLLA 1Q86U 3DB4A 2G3RA 2RHZA 3OYGA 5IAYA 1EIFA 3CEYA 3CC4T 1VQ6T 3TREA 3FLGA 3CPFA 4YTLA 4PL6A 3CD6T 2RHYA 3CCUT 1NJIC 2XDPA 4RG2A 3HKSA 1K8AU 1YIJT 1QVFS 4A4HA 3A5ZB 4PLIA 3QJ6A 1VQ8A 3C4SA 1W2BS 1YJ9T 4BD3A 2JZ2A 1Q82U 4Z02A 1RI0A 1VQMT 3MP1A 2QA4A 4N4IA
chains in the Genus database with same CATH superfamily
1QCNA 2HQEA 4QKUA 3DLLA 2R58A 5D6YA 2LX9A 3DKMA 2DD5A 1VQ5T 2OTJQ 3JSCA 3VS2A 5A0GA 1M3BA 1JRIA 1K9MR 2GCXA 2BZYA 1KHCA 3QSUA 3RKYA 4A4KA 1QQJA 5GAN4 4C92E 4MDWA 1VQLA 1NBEB 4ELZC 5LJ5g 1VQOA 1KQSP 3CCEA 3EG3A 2PU9B 1DJ7B 4NOYA 1FMWA 1YIJQ 1WXBA 3V7CA 2P0KA 2BE9B 3FJ5A 2L0AA 5CKBA 2JM8A 4EDUA 1LOJA 2L3SA 3DB3A 2HQHA 3ZL7C 1RAFB 4TVRA 2J6FA 2ZZDA 1K0SA 4C8QF 3L2WA 1PKSA 3P8BB 3QWYA 4FSSA 5GMKj 4FU6A 4BE0A 2RJCA 2I2LA 2JTEA 1BI1A 5EC7A 2JNGA 1S72Q 2WSEE 4M7AF 2HAXA 3FDRA 3NMZC 2RM4A 4BB7A 2HBWA 1UJYA 2AK5A 5LJ5e 4AFSC 1K76A 1WIEA 3E9GA 4L5GA 3CMAQ 1M8MA 3CPWP 3UDCA 1KC8C 3OYNA 4RUGA 2YSQA 4PFOA 1X6OA 1M8VA 2NUTB 1YCYA 2CDTA 2EKHA 3HRSA 3OS5A 1MMGA 1BI3A 4JRQA 4AFQC 1GXIE 2KRNA 2D0QB 2LMJA 5FWCA 5IHIA 3EFOB 4LUDA 2R5MA 3M55A 2KRSA 2GF7A 2M1HA 1FWZA 3I9QA 3QUIA 3MJXA 3CCLQ 4ATOA 2E12A 2EWNA 2P4TA 1HK9A 2ZPIB 3M53A 2KYMA 2EFIA 1VQKT 4Y28E 1M9SA 1X69A 2CH4A 1LVKA 4LDYA 1VQ7A 1WX6A 5KE3A 1VOMA 2QEXQ 3JB9I 1W6XA 3LX7A 4RTVA 3TSWA 2CP5A 2HKNA 4RTYA 2LJ0A 3I5RA 4JRPA 2DYBA 1K73C 1G83A 1NJIR 4RMOA 3CBPA 1LPLA 2RA2A 1OV3A 2JM9A 2CUBA 1KC8U 2VKNA 4N0AA 3L2VA 2RH2A 4GY5A 2FZKB 3OYCA 1I8FA 1VQ6Q 3P8DA 2RJFA 1NEBA 1OULA 1VQ5A 1X2QA 5KYWB 4RTTA 5GAN7 4RCCA 3CCUQ 4MDXA 2CZ1B 3MP8A 4HVVA 3LW5E 2HQXA 2PUOB 2X4WA 2ZPEB 4QQGA 1ABOA 2E70A 2ECZA 3GNGA 1RAIB 1OYXA 4OGCA 2FRYA 2X3XD 2BZXA 2JJ9A 2M9UA 2J6OA 4JRKA 2OTLT 1UGPB 4EMGA 6AT1B 2AT1B 2M0YA 4AFUC 5CQYA 1ZUUA 3RIRA 3L2RA 3OS1A 1GCQA 3PFSA 1D0YA 2FG0A 2M51A 2KEAA 2LCCA 4PFPA 2DRMA 3VRZA 1SHGA 1C0MA 1PD1A 4A4GA 5J39A 4MZPA 3JCMQ 2CYZB 1YITQ 2M02A 1K4US 3VRYA 3M54A 3NTIA 5IXFA 5I11A 2XICA 3OYFA 1N27A 3EH2A 1IZ6A 1M90C 2VGNA 2P0PA 3G4SQ 3PGGA 4OMOA 3CCVT 2V1QA 2RN8A 2RHUA 2FVUA 3BW1A 4XU2A 4HT9A 1N8RC 1UTIA 1RACB 3EGXB 3TQ7P 4F17A 1V1CA 2LDMA 3J7AF 1TUGB 4ZTFA 5GANd 2DFUA 4M78A 2HSPA 3MEUA 4BI4A 2DBKA 2P4RA 4AMCA 1VQKA 2NUPA 3L2UA 1M2OA 3WVEB 5KYXB 2FRWA 3OS0A 2LRQA 2MK5A 2MI6A 3VS0A 3G6EQ 4E7SA 3RNJA 4CC7A 2L89A 4X34A 3G71Q 1JB0E 1WLPB 3META 1T0JA 1VQMA 1FXXA 1ZA1B 1QVFA 1W1FA 3TVTA 1K9MC 2FYKA 1CKBA 3H9NA 2JVVA 3PMIA 1YCSB 4HCKA 2DL5A 3CC7T 1QVGP 5KCHA 1D1AA 5GAMh 2K3BA 3QBYA 4E7LA 2R5AA 3EH1A 4JDSA 1AD5A 4BACA 3VUBA 2VGMA 1LCKA 2K2MA 4BE1A 1M1KU 2F2VA 2EIFA 1N8RU 1T3SA 2KXDA 5IH2A 2GNCA 3CMAT 1BYMA 1WHMA 1YFNA 2L2PA 3MCAB 2HZYA 3CCJT 3BDUA 1VYTA 2DTHA 1EFNA 1B07A 2K5FA 2LT1A 3ZEHA 4C0DC 3MEWA 2QDLA 2RQRA 1MHNA 2KR3A 4PJOC 3LGLA 3JB9D 2OTLA 1D3BB 1OX9A 2D0NA 4JJCA 2DL8A 1Y7XA 4BDYA 5KYUA 1D09B 4MZMA 3HP9A 4KGZB 4JLIA 1PNJA 2A08A 1ZLMA 1TUCA 3M0QA 4FM4B 3JCMW 5GAN8 1B3QA 2KXCA 2CZ7B 3SD4A 2L8DA 2MPXC 2NUZA 1YP5A 1KK7A 2DX1A 2YUOA 1ARKA 5KYYA 2RB6A 3WVDB 3GF5A 1U8RA 3EG0A 2GFAA 4BY6B 4C92A 5CIUA 1AWWA 1QCOA 5FU6B 2YWWA 1NYFA 3CCVA 4M75G 5LJ5d 1KC8R 4Q5WA 2DL7A 2PNIA 4RCBA 1XQHA 2DETA 1N5ZA 1H641 2XG8D 2QXFA 1VQ6T 2HSEB 1WQWA 2KI7A 4XTZA 4ME7A 1NLOC 3QDRB 5LJ3j 3TREA 4J9IA 3VYHB 2LJ1A 5GMKh 1TS9A 3CCUT 3FJPA 1NJIC 2HCKA 2NWMA 1R0CB 3HKSA 1G3WA 1PD0A 3UPUA 1YJNQ 1UB4A 2DL4A 2XDDA 1QVFS 5GAOl 2F5TX 1VUBA 2K5IA 2ROTA 4PLIA 1GBRA 1Y07A 2JZ2A 1K1ZA 1B34B 1WDXA 2KGTA 1RI0A 5I21A 1TUDA 1RABB 2DMOA 2E3IA 1WHLA 2GTOA 3V8LA 2DXBA 2DLPA 4PJLA 1WXTA 5GAN5 1O75A 3CC7A 4IUQA 4M77C 3M9QA 2QK0A 5CKDA 1Z9QA 1YI2A 2QQAA 3BDLA 3QYGB 4XQ3A 2LVMA 4C8QG 1G5VA 4C0FA 2CP0A 1TOVA 1AVZC 3M58A 1M1FA 1RAHB 1WJRA 3EGUA 4AG2C 2PVGB 1SSHA 3OBYA 2NUTA 1LNXA 3VYGA 3OA6A 4DOVA 4M7AG 3H6ZA 2YXYA 3QDFA 4BY6C 3CMAA 2E5QA 3EFOA 3CCJA 3G4ST 3CXCP 1OU9A 3R6OA 2DVEA 4M7AB 5A2QE 4QT7A 4LDWA 3OMGA 1ACMB 1RAAB 3LH0A 1RAEB 2IIMA 3VU3C 2VVKA 2DF6A 2DPPB 3CXCA 4C8QE 1Q86R 1E6GA 2OAWA 4M75C 1QCFA 1U1SA 2MAMA 1JQQA 2VV5A 4M7AE 2QQSA 3H0HA 1X75C 1XNIA 4J9GA 4M77F 2RJEA 2X35A 3OYJA 5LJ3f 3G6ET 2CP6A 3BY7A 1TXQA 3I35A 4WCIA 1Y0MA 2DO3A 3H8ZA 1UHCA 4GLKA 3X25B 4CC3A 8AT1B 2LNVA 3RESA 4J5YA 4E6RA 3X28B 1H8KA 2RK1A 2DERA 3NFCA 2KROA 5KYWA 5L8RE 2CT3A 4BI3A 3SEMA 2J06A 3CMEQ 1VQPT 1YJWT 2CKKA 1VQ6A 4LE9A 1NM7A 3I56Q 1UGQB 1WZOA 4OB3B 2H3JA 2RF0A 2HDAA 5DLOA 1M1KR 2OI3A 4KRTA 1QMCA 2ED0A 5DY9A 4LN2A 4PNOA 1KJWA 2PVOB 3A8HB 4C8QC 4ZN3A 1SEMA 1SHFA 2EGAA 1JBMA 2Y4YA 1AT1B 2ROLA 4RTWA 1WJQA 2LT4A 2IG0A 1FX7A 4M7AC 3FIFA 1NEGA 1P92A 1M30A 2GQVA 1W2BP 2LX7A 2YRDA 2EJ9A 1QWEA 1G3YA 1QWFA 3VS6A 5CKHA 1HSQA 2EW3A 2LNHB 2CP2A 4QVZA 4RTUA 3JCMP 3LH5A 1N9RA 3CD6Q 1UGSB 1FYNA 1GRIA 2J7IA 2JT4A 2KNBB 3RUXA 4BDZA 4R56A 2EGEA 5D6XA 1KQSA 1WGSA 3PVQA 1GCPA 3CXCS 4Z8AA 1YJ9Q 1UGRB 1E7OA 3G4SA 3EGXA 3FRNA 4JPBW 1OU8A 3C0CA 2DZ9A 5GAMf 1I5OB 4B9WA 2GQIA 1KD1U 3DLMA 3L1AA 2DNUA 5GAMe 4CRIA 2DK3A 4M78F 5KYXA 3M0UA 2YT6A 1LJOA 1VQ9A 1H92A 1ZUYA 1RAGB 1GFDA 2EAYA 1M5Q1 3OW2P 4ZNXA 2JTMA 3KUFA 2XDBA 2Z0WA 5GAOr 1YJNT 1X6BA 3CC2T 4DBHA 3JCMV 3I55T 3JCMb 2DXTA 1FMVA 2IPOB 4J6YA 1UG1A 3OQ5A 2YUNA 3CPWA 1VQ4Q 1SSFA 4FSXA 3VKIA 4MMKA 3CC4A 1TH7A 3VUZA 1IREB 4M7DC 5D6WA 4OMMA 5CKEA 4EMKB 5CK9A 2EYWA 1VQNQ 3RMSA 1W70A 1NPRA 2KAFA 2L3QA 1NZ9A 1VQPA 1YJWA 1Q81U 4KBMB 2HL3A 2XK0A 4PJOD 3EGDB 1GBQA 3V8JA 2W0ZA 1BI0A 4IUVA 4LDUA 2XMFA 1X27A 1E6HA 2ED1A 3G7ZA 1OQKA 2CUDA 1YHQQ 1VYUA 4BUGA 2HL5C 2GTJA 5FLXE 1W4SA 2K57A 2FZCB 2KYBA 2MYSA 3CCRQ 3CCQQ 2DXCA 1MMNA 2BUDA 3OYKA 3JRZA 2ESWA 2DZCA 4XK8E 5CAIA 3F70A 2DTOA 1ZSZA 2WACA 4PJMA 2JMCA 2L5QA 1KQSS 1O9SA 2BIVA 2V26A 5LJ3h 2RQVA 4R55A 1WHJA 5GMKe 2JOYA 3UT1A 4M7DF 4VUBA 2LZ6B 3HRUA 3C94A 4II1A 2DA9A 1B7TA 1Q86C 5HY6A 2LCLA 1HJDA 2PUKB 4LDVA 2FPDA 1YNZA 3C95A 1YBYA 4N4HA 3RKXA 1TSFA 3SHWA 3MEVA 2AZVA 3E2UA 3GNFB 2RNAA 2YUQA 4J6XA 3V8KA 3GPLA 2QA4Q 4J83A 1IHWA 4EMKC 1SPKA 1JJ2P 2O88A 1G8XA 1UDLA 2M0OA 4Y92A 1VA7A 4XU3A 3RMQA 3M4GA 2A28A 4XAXB 3LYIA 4HCZA 1WHGA 3CPWS 5FU7B 2DE0X 1JJ2A 4PJOG 4M77D 4B6MA 3RERA 1UJ0A 3HFNA 3GP8A 3CC2A 1VQLQ 2EQKA 2RK2A 5AT1B 3I55A 3CCEQ 4RTZA 4C0DB 1ZBJA 2EPDA 2HEQA 2O01E 3RBBB 3UA7A 1TWBA 1YWPA 2RI3A 3JB9J 3JCMf 4PJOB 1QKXA 1EZZB 1M1KC 4Z89A 3A98A 2DEQA 4QVCA 2OTJT 1WYXA 2LQWA 4LXCA 4Y91A 1Q86U 1ZSGA 1I07A 2FZGB 2G3RA 3CCMQ 3RDVA 3ZFJA 3JB9H 2X9HA 2ZPBB 3CPFA 4PJOE 3X26B 2DM1A 4PL6A 3CD6T 2RHYA 1X43A 1YIJT 3JCMc 5HCKA 3A5ZB 4XTVA 2E3HA 4DQ2A 3ZBDA 3C4SA 4M75D 3V7SA 1OPLA 4BD3A 1YJ9T 2YDLA 3A8GB 4Z02A 5CR2A 3G1JA 1BU1A 2I0NA 2DJQA 4N4IA 1WQ7A 4X9CA 3J81E 1KD1R 1BIAA 1XJWB 2LQNA 2AIRB 1QVGA 2DJZA 1S72T 2D6FA 2A37A 3L42A 2GBQA 3LGFA 4E47A 5M9OA 2BKDN 5FU7C 3SB2A 1IGUA 2A0FB 3M0RA 2COYA 2CZ6B 1I81A 1JU5C 1VQ7Q 4JS5A 1MGQA 1VQ8Q 4M77G 3QZ9B 3UATA 2IVWA 3IQLA 3RKWA 1X01A 4IKFA 1AZGB 2W10A 4AFZC 1RADB 2CGHA 4NL3A 4E7JA 1U06A 2WSCE 2LTOA 1AWXA 5FRMA 3X20B 2O9VA 4HCBA 4M77B 2EQUA 4IURA 2COWA 3CCLT 1M2VB 4C8QD 1M3CA 1WHHA 1JXMA 1JJ2S 4KUDK 3QPHA 1VQNT 1RL2A 1NG2A 4F7UF 1U1TA 1Q81R 3QO3A 4M7AD 4IUTA 2QEXT 1VQ5Q 4HA8A 2RHXA 5KYNA 5FRNA 4M77E 1NYGA 3GLXA 4ZGJB 4HT8A 4HXJA 1K8AR 4JRIA 4A4EA 5GAMd 3PMTA 1YHQT 2JUFA 1BKBA 1IHVA 5LL6S 2MF2A 1Q82R 2E1HA 1UE9A 3NPFA 3CCRT 2QYZA 2OTJA 1V76A 4XTUA 4M75B 2ZPFB 4C0ZA 2XIDA 1OX8A 3L2QA 3HL8A 3OSSC 5D7UA 1IGQA 1N9SA 3SDZA 4P5NA 3CD6A 4M4ZA 3LWHA 2E5KA 5GANj 2VUBA 1YIJA 1PCXA 4M75E 4IIMA 5CCAA 5IT9E 3MPUB 3JV3A 2O2OA 4AT1B 4AG1C 1MNDA 4JLGA 5GAN2 2OX7A 4C5HA 1QVGS 1Y96B 3CQTA 1YJ9A 2SRCA 3I5SA 2AKLA 2X3WD 2CP7A 2BE7D 1QKWA 2LP5A 4C5EA 2LQKA 2CREA 5GAOn 4O5VA 2QQ9A 5KCOA 2KT1A 4LNPA 4OMNA 2EGCA 3S3NA 1PSEA 2BZ8A 4PK4A 4DOWA 2DRKA 3QHSA 3M5AA 1S72A 4F14A 1GFCA 4WF2A 2CH4W 4C5IA 3M0SA 1YITT 4FYWB 4M78G 3JAME 1S1NA 3E1SA 4OVAA 4C8QB 5GAOp 3HFOA 1VQKQ 2RPNA 5LJ3g 4M7DD 3N5BB 1PG5B 2RO0A 2VXFA 4A54A 1UFFA 1M4ZA 4M78B 3JCMh 4FYXB 1ZA2B 2X4YA 3INZA 2MWPA 4FT2A 2EQMA 1WA7A 5GJVB 1VQMQ 2C06A 2ATCB 3NTHA 3D7SB 1I5LA 3CCMT 4OB1B 1KIKA 1Z9ZA 4OF1A 4J7IA 2E6ZA 3PIOA 1UECA 3CCLA 2J05A 4GLMA 3EGDA 4M78E 2O4XB 4JJDA 3P8HA 3REBB 5EG2A 5I2SA 1VQNA 4LUEA 1MNEA 3O5ZA 4A4FA 2E10A 3VS3A 2NYSA 1AZEA 1C1AA 2QEXA 2RI2A 1M1GA 1RI9A 3BFMA 5HK0A 5LJ3e 3G71T 1HXDA 4A53A 2ENMA 4FCYA 3MO8A 2XKOC 2XU8A 1OOTA 3EG9B 4WTOB 5A0DA 2D1XA 2K3XA 1YHQA 5GANf 2YLBA 4Z88A 4PKCC 3BE3A 4FIBA 1YWOA 3QXEB 3GBQA 3VS4A 2PZ1A 2B86A 2E41A 4O6JA 3PNWC 4EIKA 3M57A 1HYOA 3OYIA 2OTLQ 2A7YA 3SWNB 2CSQA 1UUEA 3FEOA 2VC8A 4DBRA 1AOJA 5LJ5j 2DL3A 3CCUA 1ZUKA 1VIEA 1G3SA 3PVLA 2F1LA 4QQDA 4OB2B 5FROA 5C0MA 2RI5A 1VQ7T 5KYUB 1VQ8T 1KD1C 4M7DG 2QQRA 4M78C 1QP3A 1IO6A 5AYFA 2K9GA 3WXMB 3PTAA 3MKDA 2DBMA 4E7HA 4M7DB 5GAMg 1T3LA 1X6GA 1ZQ1A 2F5KA 3CCVQ 3OMCA 4J9CA 1W2BA 4J6WA 3JCMJ 3OBWA 2VB6A 2O31A 4QQ6A 1PC0A 2DYIA 2NLUA 1D0XA 1PM3A 1WHKA 2Y90A 1JEGA 3AHUA 3EG1A 2KE9A 4M7DE 1YITA 2PQWA 5DLQE 2C0OA 2V8JA 4PJOA 1BCOA 1OZ3A 3URGA 5CVIA 2PVDB 4LD9K 2V1RA 1PRMC 1BB9A 2ZPHB 4J7FA 3MP6A 1Q81C 3ULRB 2DD4A 2QDYB 1SRMA 2H3EB 2QTXA 3EHQA 3M0TA 1IRXA 3JB9F 2QASA 1KG1A 1K8AC 3SWNC 3CCMA 3QYHB 4ZGEB 3CC7Q 3HRTA 2F2XA 3CCSQ 1Q7YR 2VWFA 1UEBA 1WNLA 2YRVA 5A0LA 1YI2Q 3C12A 1Q82C 3G6EA 5HKCA 3OW2A 3VJPA 5LJ5f 2XD0A 5FWBA 3T9NA 4FL6A 5GMKl 4DBQA 2E4HA 4CC4B 3G71A 4OMLA 3S6WA 3A1PA 4IIOA 4JZ4A 1RLPC 3X24B 1QLYA 2WSFE 3CCJQ 1VIFA 2XHCA 1MV3A 4BI8B 1QP2A 2RQUA 5HK3A 5FW9A 3R6NA 4C5GA 4PLLA 2HBPA 3DB4A 2J6KA 3EFSA 2OAUA 4C92C 1F1BB 3CEYA 2ABLA 2G6FX 3UF4A 2DVJA 2C0TA 1UGVA 2COZA 4JJNK 2V8KA 1MMDA 4XTYA 1I4K1 1KSWA 1X2KA 4YTLA 4J9FA 3M0PA 1WI7A 4D8DA 4E2FB 2XDPA 4RG2A 1U3OA 1K8AU 5CKFA 1G3TA 1AHJB 1SRLA 1TTHB 1MUZA 1D3BA 3QJ6A 1M3AA 1VQ8A 4M77A 1SG5A 1JO8A 3KFVA 1W2BS 1M2VA 1KQ1A 4MMLA 1Q82U 5IHNA 1VQMT 2C0IA 2DXUA 1OEBA 1ZHIA 3MP1A 3TCJA 1H3HA 1R77A 4IUPA 3OYYA 3OYLA 4QW2A 3M56A 3UWNA 2JMAA 2HMAA 5CO7A 1BI2A 4ZGDB 4X1VA 3VS5A 4K11A 1IXDA 2E65A 2FPFA 4F7UG 1PSFA 4FT4A 4J9BA 3OYEA 2RD1A 3QWXX 4C92F 2KK4A 3HSBA 1XTDA 3QJYA 2QQBA 1CSKA 1IB8A 4F7UB 5GANh 4ZN1A 1BK2A 1WXUA 3OYHA 3JCMg 3LLRA 1XOVA 2P84A 4M75A 5IN1A 2QG9B 3GIBA 2K4YA 2HD0A 9ATCB 4L6V5 3CMET 4ORZA 2YLCA 3I56T 3H0IA 3AT1B 4MZTA 4DBFA 3OW2S 2DIQA 4JS4A 2KQWA 4F7UE 1UHFA 4L59A 3PE0A 2LJ3A 4FW2A 1K73U 2MCNA 4HKEA 1YJNA 1H3ZA 1B34A 2L3RA 2GFUA 1VQOQ 2AZSA 2EQIA 1KQ2A 2O9SA 2MIOA 1Y96A 5J3BA 1Y71A 2AHJB 7AT1B 5GAOm 3OSVA 1AWJA 5GAN6 2EBPA 3J80E 3LWIA 2KVQG 2YHTA 3M59A 1NLPC 2X4JA 2JW4A 2RQTA 3JCMe 2P0QA 1PHTA 4R0KA 2LQ8A 1TU0B 4OB0B 5LJ3d 4ZTJA 2QTVA 4HVUA 1WJSA 2JN0A 2MOXA 3ASKA 3M4YA 4GBQA 3CBMA 3A8LB 1RLQC 1KHIA 4C8QA 4J9DA 2VASA 5GJWB 4NS5A 2EYQA 3A8MB 1PWTA 2YRCA 4HCCA 3KXTA 1VQ9Q 4M7AA 3O8VA 3QG1A 4F16A 2H8HA 2CSIA 1OZ2A 3VS1A 4ANJA 3OYDA 1K9AA 5I2MA 5IXBA 3GOXA 2JXBA 2ZCFB 5L23A 4XU0A 1KFZA 1QVFP 5DM7R 5GAOq 4RTXA 4FW1A 2BTTA 2O4XA 3NGPA 1NE8A 4E7KA 4UC4A 2RJDA 1PKTA 2DILA 2R57A 3HHTB 1I1JA 2EJGA 4IUUA 3MEAA 4E7IA 1VYVA 1OI1A 1BIBA 3A8OB 1WFWA 3TSZA 3CC4Q 3CCST 1MV0B 2KBTA 2EYZA 1M90U 2VYTA 1YI2T 1TG0A 4FYVB 2MMPA 1VQPQ 1YJWQ 1SKUB 5IHKA 5LJ5h 3EG9A 2K3YA 3H0FA 5GMKi 4KT0E 4LD6A 2AKKA 1VQ4T 2HKQB 4F04B 2JS0A 1EX4A 1Q7YC 5GAN3 2QGGA 3MHXA 3SWNA 2SEMA 4KUIA 3PIPA 2X51A 2DEUA 2DIGA 1YN8A 2JTFA 1RUWA 2EQJA 2QAZA 2KY9A 3OYAA 3SFMA 3REAB 3CMEA 4M78D 2EJFA 3I56A 4DEXA 3CBOA 4J8OA 2K5LA 1K9MU 3Q1JA 3FC3A 1ZX6A 2K7AA 3OS2A 2OJ2A 2LCSA 3QIIA 4C0GA 4OMFB 5KH6A 3E9FA 4OMQA 4N4GA 3VV0A 1ZSZB 3FB9A 2XI9A 2KDSA 5CQXA 4M7DA 2HNIA 2K2VA 3EHRA 4EMHA 4PJJA 3CCQT 2FB7A 3NHNA 1AWOA 1JXOA 1R8OB 2B8AA 1HD3A 3S3OA 1BCMA 2V8IA 2X4XA 4ELYC 4KH1B 2EVRA 3TEEA 2D8HA 2K79A 4RKUE 3RR6A 2CS7A 2RQWA 2F69A 3NTKA 1Q7YU 1FMKA 4J9EA 3THKA 5C6SA 4DEYA 8ATCB 3L2ZA 4FYYB 4KH0B 3OYBA 4V2SA 4PJOF 2EKOA 3ER0A 3KBGA 4QVDA 3EAEA 3CC2Q 2YUPA 3I55Q 2L3PA 1MMAA 5I22A 2D9TA 2KMTA 1D1BA 4HVWA 1R0BG 5KE2A 2KT8A 2QA4T 3S3MA 2QGFB 1Q95G 4XU1A 2GGRA 4BE2A 3E19A 4PJNA 2ZPGB 2CP3A 2RMOA 1CKAA 1K73R 2FHDA 3JB9G 2M16A 2LC4A 4B9XA 3CCSA 4N0AC 3V7RA 3ME9A 1D0ZA 2ZAEA 1ABQA 3VS7A 3TU4K 1VQLT 2EYXA 1VQOT 3CCET 4ESRA 1I0CA 2Y4XA 4C92D 4DA4A 2A3LA 1NPPA 1ZSZC 1A0NB 2JS2A 2RHIA 5ECAA 2NUPB 2QI2A 4EMKA 2CT4A 4RG8A 4OMPA 1VQ4A 3HPWA 5GANg 5GMKm 3U23A 1NJIU 3QKJA 2FL7A 5FU6C 4KULA 1AEYA 1U5SA 1N6AA 2CZ0B 4PFZA 1C6VX 2E6NA 1QVPA 2ZGWA 2MWOA 2KRMA 1VQ9T 3OB9A 4OP0A 5J26A 4E7ZA 2VXEA 1GCQC 3OYMA 1QW1A 4LDXA 2K6DA 2DTIA 4JJBA 3UA6A 4J9HA 1PRLC 3HTRA 2PTKA 1SF9A 1V29B 3OY9A 2D8JA 4CI0C 2DAQA 5GANe 3CCRA 3CCQA 1ZBXA 1K0XA 1BBZA 5GAMj 4XTWA 4D6WA 4X9DA 4XTXA 1G2BA 4CC2A 1D1CA 2RHZA 2FO0A 3OYGA 2FPEA 5IAYA 2FEIA 1EIFA 2A36A 3CC4T 1M90R 1T0HA 3JCMd 2F2WA 3FLGA 3JCMX 1J3TA 1Y57A 4KGXB 4A63B 4JZ3A 4OGEA 4NL2A 1M27C 4F7UA 3EFRA 4A4HA 4JUVA 3PT9A 3EG2A 4EPCA 1N8RR 2EYYA 1OPKA 4C92G 1WPYA 3QZ5B 4D8KA 4KGVB 1GL5A 4M75F 5KYYB 2E64A 2KSSA 3H41A 4C92B 2DKGA 2QA4A
chains in the Genus database with same CATH topology
3J81E 4IUPA 2HQEA 3OYYA 5GAN5 1BIAA 1O75A 2R58A 5D6YA 3DLLA 3CC7A 4IUQA 4M77C 3OYLA 2LX9A 4QW2A 3DKMA 3M56A 2DD5A 3UWNA 1QVGA 1VQ5T 3M9QA 2DJZA 5CO7A 1S72T 2D6FA 1BI2A 3JSCA 5CKDA 4ZGDB 1YI2A 5A0GA 2QQAA 3BDLA 3QYGB 4XQ3A 1JRIA 2LVMA 3L42A 4C8QG 5M9OA 2GCXA 1KHCA 4C0FA 2E65A 1G5VA 3LGFA 3QSUA 3RKYA 4A4KA 4F7UG 4E47A 5GAN4 3M58A 1M1FA 1PSFA 1WJRA 2BKDN 4FT4A 4MDWA 5FU7C 2PVGB 2RD1A 3SB2A 4C92E 3OBYA 4C92F 2KK4A 3HSBA 1VQLA 4ELZC 1LNXA 3VYGA 5LJ5g 3OA6A 1VQOA 2CZ6B 4DOVA 3CCEA 4M7AG 1I81A 3H6ZA 1XTDA 1MGQA 2PU9B 4JS5A 3QJYA 2QQBA 1DJ7B 4M77G 4NOYA 3QZ9B 4BY6C 3CMAA 2IVWA 3V7CA 3RKWA 2E5QA 2P0KA 1X01A 4IKFA 4F7UB 5GANh 3CCJA 4ZN1A 3G4ST 2CGHA 4NL3A 3JCMg 3OYHA 4E7JA 5CKBA 3R6OA 3LLRA 1XOVA 2DVEA 4M75A 4EDUA 1LOJA 2LTOA 2WSCE 5IN1A 4M7AB 4LDWA 5A2QE 5FRMA 3GIBA 3X20B 2K4YA 3OMGA 4HCBA 3DB3A 4M77B 3LH0A 2EQUA 2HD0A 4IURA 4L6V5 3CMET 3CCLT 4TVRA 3VU3C 4C8QD 2YLCA 2DPPB 2ZZDA 3I56T 3CXCA 4MZTA 4C8QE 3OW2S 1JJ2S 2DIQA 4KUDK 4C8QF 3QPHA 3L2WA 1RL2A 1VQNT 3P8BB 4JS4A 2KQWA 4F7UE 5GMKj 4L59A 4FU6A 4BE0A 4F7UF 1U1TA 4M75C 2RJCA 2I2LA 3QO3A 4M7AD 4IUTA 2QEXT 1K73U 1BI1A 2MAMA 2VV5A 1U1SA 4HKEA 4M7AE 2JNGA 2QQSA 2WSEE 1YJNA 4M7AF 1X75C 3FDRA 2RHXA 4HA8A 1B34A 2HAXA 5FRNA 2L3RA 2RM4A 4M77E 1XNIA 4BB7A 2GFUA 3GLXA 4M77F 2RJEA 4ZGJB 1KQ2A 2X35A 4HT8A 3OYJA 5LJ3f 3G6ET 1Y96A 5LJ5e 5J3BA 1Y71A 2AHJB 3E9GA 4JRIA 4A4EA 3OSVA 5GAOm 5GAN6 4L5GA 5GAMd 3BY7A 3PMTA 3J80E 3LWIA 2KVQG 3UDCA 1KC8C 3OYNA 2YHTA 3M59A 1YHQT 2JUFA 1BKBA 1X6OA 1M8VA 2DO3A 2X4JA 5LL6S 1YCYA 3H8ZA 3HRSA 3OS5A 1BI3A 4GLKA 3X25B 3JCMe 2MF2A 2P0QA 4JRQA 1GXIE 2LQ8A 2LNVA 3RESA 2E1HA 2D0QB 4J5YA 3X28B 3CCRT 4OB0B 5LJ3d 4ZTJA 2RK1A 3NFCA 2R5MA 1WJSA 2JN0A 2OTJA 5L8RE 4XTUA 3M55A 3ASKA 4M75B 2GF7A 2M1HA 1FWZA 3M4YA 4BI3A 2ZPFB 3A8LB 3CBMA 3QUIA 4C0ZA 2XIDA 1KHIA 1VQPT 1YJWT 4C8QA 4ATOA 2E12A 2CKKA 3L2QA 2P4TA 2EWNA 1VQ6A 1HK9A 3HL8A 2ZPIB 3OSSC 1N9SA 2EYQA 3M53A 1UGQB 2EFIA 3A8MB 4NS5A 4OB3B 2H3JA 4Y28E 3SDZA 4P5NA 1VQKT 4HCCA 1M9SA 5DLOA 3KXTA 3CD6A 4M7AA 4LDYA 1VQ7A 5DY9A 3O8VA 3QG1A 5KE3A 1OZ2A 3OYDA 3JB9I 4PNOA 5I2MA 3LWHA 2PVOB 3LX7A 5GANj 2VUBA 1YIJA 3A8HB 4M75E 4C8QC 4ZN3A 3GOXA 2ZCFB 5CCAA 5IT9E 4XU0A 1JBMA 2Y4YA 4JLGA 5GAN2 5DM7R 5GAOq 4JRPA 4C5HA 1QVGS 1WJQA 1Y96B 2LT4A 1K73C 2IG0A 1YJ9A 4RMOA 1FX7A 4M7AC 3CBPA 3FIFA 1P92A 2RA2A 2GQVA 2O4XA 1NE8A 4E7KA 4UC4A 2RJDA 4C5EA 2R57A 2LQKA 1KC8U 2EJ9A 3HHTB 4O5VA 2QQ9A 5KCOA 5GAOn 2EJGA 4IUUA 3MEAA 4E7IA 4N0AA 1OI1A 1G3YA 3L2VA 1BIBA 3A8OB 2RH2A 4GY5A 3S3NA 3OYCA 1PSEA 1I8FA 3P8DA 2RJFA 4DOWA 3CCST 1VQ5A 5CKHA 3QHSA 3M5AA 1S72A 1M90U 4WF2A 2VYTA 4QVZA 3JCMP 1YI2T 5GAN7 4C5IA 1N9RA 1YITT 2MMPA 4M78G 1UGSB 3JAME 4RCCA 4MDXA 5LJ5h 2CZ1B 3E1SA 4OVAA 2K3YA 3MP8A 4C8QB 5GAOp 3HFOA 3RUXA 4R56A 3LW5E 2HQXA 2PUOB 2X4WA 2ZPEB 4QQGA 4KT0E 5GMKi 5LJ3g 4M7DD 2E70A 3N5BB 2RO0A 3GNGA 1OYXA 2VXFA 4OGCA 4A54A 5D6XA 1KQSA 1M4ZA 4LD6A 1VQ4T 4M78B 1WGSA 3JCMh 3CXCS 1UGRB 2M9UA 2X4YA 3INZA 1Q7YC 2MWPA 5GAN3 4FT2A 3MHXA 3SWNA 2EQMA 3G4SA 3FRNA 4KUIA 4JRKA 4X9CA 1UGPB 2OTLT 2C06A 3NTHA 2DZ9A 4EMGA 3PIPA 2DIGA 5GAMf 1I5LA 3CCMT 2JTFA 4OB1B 2EQJA 4OF1A 2KY9A 4J7IA 4B9WA 5CQYA 3SFMA 2E6ZA 3OYAA 3PIOA 3RIRA 3L2RA 3OS1A 4M78D 3CMEA 1KD1U 3DLMA 3CCLA 3L1AA 2EJFA 3I56A 5GAMe 4M78E 3PFSA 4CRIA 2DK3A 2O4XB 4M78F 3CBOA 3P8HA 5I2SA 5EG2A 1VQNA 1LJOA 2LCCA 1VQ9A 4A4FA 2E10A 2EAYA 1M5Q1 4J8OA 2JTMA 2K5LA 1K9MU 2QEXA 3Q1JA 2RI2A 4A4GA 3FC3A 3KUFA 2XDBA 5GAOr 1YJNT 1M1GA 3OS2A 3CC2T 5J39A 3QIIA 4C0GA 3JCMV 4OMFB 4MZPA 3BFMA 5KH6A 5HK0A 2CYZB 5LJ3e 3JCMQ 3E9FA 3I55T 3JCMb 2DXTA 3G71T 1HXDA 4A53A 4N4GA 3VV0A 3FB9A 3MO8A 2XI9A 4J6YA 3M54A 3NTIA 2KDSA 2XKOC 2XU8A 5CQXA 4M7DA 2HNIA 2K2VA 3OQ5A 4EMHA 2XICA 5A0DA 1N27A 3OYFA 2K3XA 1IZ6A 3CCQT 2FB7A 2VGNA 3CPWA 1YHQA 2P0PA 5GANf 2YLBA 1M90C 3PGGA 4PKCC 3CCVT 4FIBA 1R8OB 2B8AA 3S3OA 1SSFA 2V8IA 2RHUA 2X4XA 3QXEB 4ELYC 4FSXA 3VKIA 2FVUA 4MMKA 3BW1A 3TEEA 2E41A 4O6JA 4RKUE 3PNWC 3CC4A 1TH7A 2CS7A 3VUZA 4XU2A 1IREB 3M57A 3OYIA 4M7DC 2A7YA 5D6WA 2F69A 5CKEA 3SWNB 1N8RC 3NTKA 4EMKB 5CK9A 1Q7YU 4HT9A 3FEOA 2LDMA 3RMSA 1NPRA 3J7AF 2VC8A 2KAFA 5GANd 4ZTFA 5C6SA 1NZ9A 5LJ5j 4M78A 1VQPA 1YJWA 3CCUA 3MEUA 3L2ZA 4BI4A 1Q81U 4BDZA 1VIEA 4KBMB 1G3SA 2XK0A 4PJOD 1VQKA 4QQDA 3L2UA 4OB2B 3OYBA 4V2SA 3WVEB 4PJOF 5FROA 3V8JA 5C0MA 3OS0A 2RI5A 2LRQA 1VQ7T 2EKOA 2MI6A 1H3ZA 1VQ8T 3ER0A 3KBGA 1KD1C 1BI0A 4IUVA 4LDUA 4QVDA 3EAEA 4M7DG 3G7ZA 2QQRA 4M78C 1QP3A 2L89A 5AYFA 4X34A 1JB0E 3META 4BUGA 5FLXE 2D9TA 2KMTA 1VQMA 1FXXA 1W4SA 1QVFA 5KE2A 2K57A 1K9MC 2QA4T 2FYKA 3WXMB 3PTAA 3S3MA 2JVVA 3PMIA 4E7HA 4M7DB 4XU1A 3CC7T 5GAMg 2DXCA 5KCHA 1ZQ1A 2BUDA 2F5KA 4BE2A 3OYKA 3OMCA 3JRZA 3E19A 5GAMh 4J6WA 2DZCA 2ZPGB 4XK8E 3JCMJ 5CAIA 1W2BA 3F70A 3OBWA 3QBYA 4E7LA 2R5AA 2DTOA 4JDSA 2WACA 4BACA 2FHDA 3JB9G 2M16A 2L5QA 4QQ6A 2NLUA 2LC4A 3VUBA 4B9XA 3CCSA 2VGMA 1KQSS 4N0AC 3V7RA 3ME9A 2Y90A 3TU4K 1VQLT 4BE1A 1O9SA 2BIVA 3AHUA 1M1KU 5LJ3h 1VQOT 4R55A 4M7DE 5GMKe 2JOYA 2EIFA 2PQWA 3UT1A 1YITA 1N8RU 3CCET 4M7DF 2Y4XA 5DLQE 4C92D 4VUBA 2V8JA 3HRUA 3C94A 1OZ3A 3URGA 4DA4A 4PJOA 3CMAT 2A3LA 5CVIA 1BYMA 4II1A 3MCAB 1NPPA 3CCJT 3BDUA 2PVDB 2DTHA 2RHIA 4LD9K 2QI2A 1Q86C 2ZPHB 5HY6A 4EMKA 2LCLA 4RG8A 2PUKB 4J7FA 4LDVA 1VQ4A 3HPWA 2K5FA 2LT1A 3MP6A 5GMKm 3ZEHA 3C95A 4C0DC 5GANg 1Q81C 2DD4A 3MEWA 2QDYB 1YBYA 4N4HA 2QTXA 3RKXA 3QKJA 1NJIU 2FL7A 5FU6C 1MHNA 4PJOC 3LGLA 4KULA 3MEVA 3JB9D 2OTLA 1D3BB 4J6XA 3GNFB 3GPLA 3V8KA 3JB9F 4J83A 1KG1A 1K8AC 3SWNC 3CCMA 4EMKC 1N6AA 1Y7XA 4BDYA 3QYHB 4ZGEB 2CZ0B 3HRTA 2E6NA 3HP9A 2M0OA 4MZMA 4FM4B 4JLIA 1QVPA 4XU3A 1UEBA 2ZGWA 2MWOA 1WNLA 2YRVA 3M4GA 3RMQA 5A0LA 3JCMW 5GAN8 1VQ9T 4XAXB 3OB9A 4OP0A 5J26A 2CZ7B 3SD4A 3LYIA 3C12A 4HCZA 2L8DA 3OYEA 2VXEA 1Q82C 3G6EA 5FU7B 3CPWS 5HKCA 3OW2A 3OYMA 1JJ2A 1QW1A 4PJOG 3TCJA 4LDXA 4M77D 3VJPA 5LJ5f 2XD0A 3RERA 3HFNA 3T9NA 2RB6A 3GP8A 3CC2A 3WVDB 2DTIA 2EQKA 4FL6A 2RK2A 5GMKl 3I55A 3GF5A 1U8RA 2GFAA 4BY6B 4C0DB 5CIUA 4C92A 3G71A 2O01E 1V29B 3S6WA 3OY9A 4CI0C 5FU6B 2DAQA 3X24B 2RI3A 3JB9J 3JCMf 4PJOB 2WSFE 5GANe 1VIFA 2XHCA 4BI8B 3CCRA 3CCQA 1QP2A 1ZBXA 5GAMj 1M1KC 5HK3A 4XTWA 3CCVA 2DEQA 4M75G 4X9DA 4XTXA 4D6WA 4Q5WA 4QVCA 5LJ5d 4C5GA 2OTJT 4PLLA 2HBPA 4Y91A 1Q86U 3DB4A 2RHZA 2G3RA 3OYGA 3EFSA 4RCBA 5IAYA 2OAUA 1XQHA 4C92C 1EIFA 3CEYA 1H641 3ZFJA 3JB9H 3CC4T 2XG8D 2QXFA 1VQ6T 1WQWA 4JJNK 2V8KA 4XTYA 1I4K1 4XTZA 2ZPBB 4ME7A 3QDRB 3JCMd 5LJ3j 3FLGA 3TREA 3JCMX 3CPFA 4PJOE 3X26B 3VYHB 4YTLA 4PL6A 3CD6T 2RHYA 5GMKh 3CCUT 3FJPA 4OGEA 1NJIC 2XDPA 4NL2A 4RG2A 3HKSA 1K8AU 4F7UA 1G3WA 3EFRA 3UPUA 5CKFA 1YIJT 1UB4A 1G3TA 3JCMc 2XDDA 4A4HA 1QVFS 3A5ZB 4JUVA 5GAOl 2F5TX 1VUBA 3PT9A 2K5IA 1AHJB 4XTVA 4EPCA 4PLIA 4DQ2A 1D3BA 4C92G 1Y07A 3QJ6A 3ZBDA 1WPYA 1VQ8A 3QZ5B 3C4SA 4M75D 4M77A 3V7SA 1W2BS 4BD3A 1YJ9T 2JZ2A 3A8GB 1KQ1A 4MMLA 1Q82U 4M75F 4Z02A 1B34B 5CR2A 1RI0A 2E64A 5I21A 2KSSA 1VQMT 2DXUA 1ZHIA 4C92B 2DKGA 3MP1A 2QA4A 4N4IA 3V8LA 2DXBA 1WQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 E;  4IUP A;  2HQE A;  3OYY A;  3DLL A;  2R58 A;  5D6Y A;  3CC7 A;  4IUQ A;  3OYL A;  4QW2 A;  1QVG A;  1VQ5 T;  3UWN A;  3M9Q A;  1S72 T;  1YI2 A;  3BDL A;  3L42 A;  2LVM A;  1KHC A;  1G5V A;  3LGF A;  5M9O A;  1WJR A;  2BKD N;  3OYE A;  1VQL A;  3OA6 A;  1VQO A;  3CCE A;  3H6Z A;  1XTD A;  3CMA A;  2E5Q A;  2P0K A;  4IKF A;  3CCJ A;  4ZN1 A;  3G4S T;  3OYH A;  4E7J A;  3LLR A;  4EDU A;  5A2Q E;  2LTO A;  5IN1 A;  5FRM A;  3OMG A;  3DB3 A;  3LH0 A;  2EQU A;  4IUR A;  3CME T;  3CCL T;  4TVR A;  3I56 T;  3CXC A;  3OW2 S;  1JJ2 S;  2DIQ A;  3L2W A;  1VQN T;  1RL2 A;  3P8B B;  4L59 A;  4FU6 A;  4BE0 A;  2RJC A;  4IUT A;  2QEX T;  1K73 U;  2JNG A;  2QQS A;  1YJN A;  3FDR A;  2RHX A;  1H3Z A;  5FRN A;  2L3R A;  1XNI A;  2GFU A;  2RJE A;  2X35 A;  3G6E T;  3OYJ A;  5J3B A;  3E9G A;  4A4E A;  3PMT A;  3J80 E;  2KVQ G;  1KC8 C;  3OYN A;  1YHQ T;  2JUF A;  1BKB A;  1X6O A;  2DO3 A;  5LL6 S;  3H8Z A;  2LQ8 A;  3CCR T;  4ZTJ A;  2R5M A;  2OTJ A;  1WJS A;  3ASK A;  2GF7 A;  2M1H A;  1KHI A;  1VQP T;  1YJW T;  2CKK A;  1VQ6 A;  3L2Q A;  4NS5 A;  2EFI A;  1VQK T;  3CD6 A;  1VQ7 A;  5KE3 A;  3O8V A;  1OZ2 A;  3OYD A;  3LX7 A;  1YIJ A;  3GOX A;  4ZN3 A;  5IT9 E;  5DM7 R;  4C5H A;  1QVG S;  1WJQ A;  1K73 C;  2IG0 A;  1YJ9 A;  2O4X A;  4E7K A;  4UC4 A;  2RJD A;  4C5E A;  2R57 A;  1KC8 U;  5KCO A;  4IUU A;  3MEA A;  4E7I A;  1OI1 A;  3L2V A;  4GY5 A;  3S3N A;  3OYC A;  3P8D A;  2RJF A;  3CCS T;  1VQ5 A;  1S72 A;  1M90 U;  2VYT A;  4QVZ A;  1YI2 T;  4C5I A;  1YIT T;  3JAM E;  4OVA A;  2K3Y A;  3MP8 A;  4BDZ A;  2HQX A;  2X4W A;  4QQG A;  2E70 A;  2RO0 A;  1OYX A;  1KQS A;  5D6X A;  1VQ4 T;  4LD6 A;  1WGS A;  3CXC S;  1Q7Y C;  2X4Y A;  2MWP A;  3G4S A;  2EQM A;  2OTL T;  3PIP A;  3NTH A;  2DIG A;  3CCM T;  2JTF A;  2EQJ A;  4B9W A;  3OYA A;  2E6Z A;  3CME A;  3PIO A;  1KD1 U;  3L2R A;  3CCL A;  3OS1 A;  3DLM A;  3I56 A;  3PFS A;  4CRI A;  2O4X B;  3P8H A;  1VQN A;  2LCC A;  1VQ9 A;  4A4F A;  1K9M U;  2QEX A;  3Q1J A;  2RI2 A;  4A4G A;  3FC3 A;  3KUF A;  1YJN T;  1M1G A;  3OS2 A;  3CC2 T;  5J39 A;  3QII A;  3I55 T;  5KH6 A;  3E9F A;  3G71 T;  4N4G A;  3MO8 A;  3NTI A;  2KDS A;  3OQ5 A;  3OYF A;  1N27 A;  2K3X A;  1IZ6 A;  3CCQ T;  1YHQ A;  3CPW A;  1M90 C;  3CCV T;  2B8A A;  3S3O A;  1SSF A;  2RHU A;  2X4X A;  3PNW C;  3CC4 A;  3OYI A;  5D6W A;  1N8R C;  3NTK A;  1Q7Y U;  3FEO A;  2LDM A;  1NPR A;  3J7A F;  4ZTF A;  5C6S A;  1NZ9 A;  1VQP A;  1YJW A;  3CCU A;  3MEU A;  1Q81 U;  2XK0 A;  1VQK A;  4QQD A;  3L2U A;  3OYB A;  5FRO A;  5C0M A;  3OS0 A;  2RI5 A;  1VQ7 T;  2LRQ A;  2EKO A;  2MI6 A;  1VQ8 T;  3ER0 A;  3KBG A;  1KD1 C;  4IUV A;  3EAE A;  2QQR A;  2L89 A;  4X34 A;  3MET A;  5FLX E;  2D9T A;  1VQM A;  1QVF A;  5KE2 A;  1K9M C;  2QA4 T;  3S3M A;  2JVV A;  3PMI A;  4E7H A;  3CC7 T;  5KCH A;  2BUD A;  4BE2 A;  2F5K A;  3OYK A;  3OMC A;  1W2B A;  3F70 A;  3QBY A;  4E7L A;  2R5A A;  2WAC A;  4BAC A;  2FHD A;  2M16 A;  4QQ6 A;  2NLU A;  3CCS A;  4B9X A;  1KQS S;  3ME9 A;  1VQL T;  4BE1 A;  2BIV A;  1M1K U;  1VQO T;  3CCE T;  2JOY A;  2EIF A;  1YIT A;  1N8R U;  2PQW A;  3UT1 A;  5DLQ E;  1OZ3 A;  3CMA T;  4II1 A;  1NPP A;  3CCJ T;  2RHI A;  1Q86 C;  5HY6 A;  2LCL A;  1VQ4 A;  3MP6 A;  1Q81 C;  3ZEH A;  3MEW A;  1YBY A;  4N4H A;  1NJI U;  3QKJ A;  1MHN A;  3LGL A;  3MEV A;  2OTL A;  1K8A C;  3CCM A;  4BDY A;  2E6N A;  2M0O A;  1UEB A;  2MWO A;  2YRV A;  1VQ9 T;  3OB9 A;  5J26 A;  3SD4 A;  3LYI A;  4HCZ A;  2L8D A;  1Q82 C;  3G6E A;  3CPW S;  3OW2 A;  1JJ2 A;  3OYM A;  3CC2 A;  2EQK A;  4FL6 A;  3I55 A;  2GFA A;  3G71 A;  5CIU A;  3S6W A;  3OY9 A;  2DAQ A;  2RI3 A;  2XHC A;  3CCR A;  3CCQ A;  1M1K C;  3CCV A;  2OTJ T;  4Q5W A;  4C5G A;  4PLL A;  1Q86 U;  3DB4 A;  2G3R A;  2RHZ A;  3OYG A;  5IAY A;  1EIF A;  3CEY A;  3CC4 T;  1VQ6 T;  3TRE A;  3FLG A;  3CPF A;  4YTL A;  4PL6 A;  3CD6 T;  2RHY A;  3CCU T;  1NJI C;  2XDP A;  4RG2 A;  3HKS A;  1K8A U;  1YIJ T;  1QVF S;  4A4H A;  3A5Z B;  4PLI A;  3QJ6 A;  1VQ8 A;  3C4S A;  1W2B S;  1YJ9 T;  4BD3 A;  2JZ2 A;  1Q82 U;  4Z02 A;  1RI0 A;  1VQM T;  3MP1 A;  2QA4 A;  4N4I A; 
#chains in the Genus database with same CATH topology
 1QCN A;  2HQE A;  4QKU A;  3DLL A;  2R58 A;  5D6Y A;  2LX9 A;  3DKM A;  2DD5 A;  1VQ5 T;  2OTJ Q;  3JSC A;  3VS2 A;  5A0G A;  1M3B A;  1JRI A;  1K9M R;  2GCX A;  2BZY A;  1KHC A;  3QSU A;  3RKY A;  4A4K A;  1QQJ A;  5GAN 4;  4C92 E;  4MDW A;  1VQL A;  1NBE B;  4ELZ C;  5LJ5 g;  1VQO A;  1KQS P;  3CCE A;  3EG3 A;  2PU9 B;  1DJ7 B;  4NOY A;  1FMW A;  1YIJ Q;  1WXB A;  3V7C A;  2P0K A;  2BE9 B;  3FJ5 A;  2L0A A;  5CKB A;  2JM8 A;  4EDU A;  1LOJ A;  2L3S A;  3DB3 A;  2HQH A;  3ZL7 C;  1RAF B;  4TVR A;  2J6F A;  2ZZD A;  1K0S A;  4C8Q F;  3L2W A;  1PKS A;  3P8B B;  3QWY A;  4FSS A;  5GMK j;  4FU6 A;  4BE0 A;  2RJC A;  2I2L A;  2JTE A;  1BI1 A;  5EC7 A;  2JNG A;  1S72 Q;  2WSE E;  4M7A F;  2HAX A;  3FDR A;  3NMZ C;  2RM4 A;  4BB7 A;  2HBW A;  1UJY A;  2AK5 A;  5LJ5 e;  4AFS C;  1K76 A;  1WIE A;  3E9G A;  4L5G A;  3CMA Q;  1M8M A;  3CPW P;  3UDC A;  1KC8 C;  3OYN A;  4RUG A;  2YSQ A;  4PFO A;  1X6O A;  1M8V A;  2NUT B;  1YCY A;  2CDT A;  2EKH A;  3HRS A;  3OS5 A;  1MMG A;  1BI3 A;  4JRQ A;  4AFQ C;  1GXI E;  2KRN A;  2D0Q B;  2LMJ A;  5FWC A;  5IHI A;  3EFO B;  4LUD A;  2R5M A;  3M55 A;  2KRS A;  2GF7 A;  2M1H A;  1FWZ A;  3I9Q A;  3QUI A;  3MJX A;  3CCL Q;  4ATO A;  2E12 A;  2EWN A;  2P4T A;  1HK9 A;  2ZPI B;  3M53 A;  2KYM A;  2EFI A;  1VQK T;  4Y28 E;  1M9S A;  1X69 A;  2CH4 A;  1LVK A;  4LDY A;  1VQ7 A;  1WX6 A;  5KE3 A;  1VOM A;  2QEX Q;  3JB9 I;  1W6X A;  3LX7 A;  4RTV A;  3TSW A;  2CP5 A;  2HKN A;  4RTY A;  2LJ0 A;  3I5R A;  4JRP A;  2DYB A;  1K73 C;  1G83 A;  1NJI R;  4RMO A;  3CBP A;  1LPL A;  2RA2 A;  1OV3 A;  2JM9 A;  2CUB A;  1KC8 U;  2VKN A;  4N0A A;  3L2V A;  2RH2 A;  4GY5 A;  2FZK B;  3OYC A;  1I8F A;  1VQ6 Q;  3P8D A;  2RJF A;  1NEB A;  1OUL A;  1VQ5 A;  1X2Q A;  5KYW B;  4RTT A;  5GAN 7;  4RCC A;  3CCU Q;  4MDX A;  2CZ1 B;  3MP8 A;  4HVV A;  3LW5 E;  2HQX A;  2PUO B;  2X4W A;  2ZPE B;  4QQG A;  1ABO A;  2E70 A;  2ECZ A;  3GNG A;  1RAI B;  1OYX A;  4OGC A;  2FRY A;  2X3X D;  2BZX A;  2JJ9 A;  2M9U A;  2J6O A;  4JRK A;  2OTL T;  1UGP B;  4EMG A;  6AT1 B;  2AT1 B;  2M0Y A;  4AFU C;  5CQY A;  1ZUU A;  3RIR A;  3L2R A;  3OS1 A;  1GCQ A;  3PFS A;  1D0Y A;  2FG0 A;  2M51 A;  2KEA A;  2LCC A;  4PFP A;  2DRM A;  3VRZ A;  1SHG A;  1C0M A;  1PD1 A;  4A4G A;  5J39 A;  4MZP A;  3JCM Q;  2CYZ B;  1YIT Q;  2M02 A;  1K4U S;  3VRY A;  3M54 A;  3NTI A;  5IXF A;  5I11 A;  2XIC A;  3OYF A;  1N27 A;  3EH2 A;  1IZ6 A;  1M90 C;  2VGN A;  2P0P A;  3G4S Q;  3PGG A;  4OMO A;  3CCV T;  2V1Q A;  2RN8 A;  2RHU A;  2FVU A;  3BW1 A;  4XU2 A;  4HT9 A;  1N8R C;  1UTI A;  1RAC B;  3EGX B;  3TQ7 P;  4F17 A;  1V1C A;  2LDM A;  3J7A F;  1TUG B;  4ZTF A;  5GAN d;  2DFU A;  4M78 A;  2HSP A;  3MEU A;  4BI4 A;  2DBK A;  2P4R A;  4AMC A;  1VQK A;  2NUP A;  3L2U A;  1M2O A;  3WVE B;  5KYX B;  2FRW A;  3OS0 A;  2LRQ A;  2MK5 A;  2MI6 A;  3VS0 A;  3G6E Q;  4E7S A;  3RNJ A;  4CC7 A;  2L89 A;  4X34 A;  3G71 Q;  1JB0 E;  1WLP B;  3MET A;  1T0J A;  1VQM A;  1FXX A;  1ZA1 B;  1QVF A;  1W1F A;  3TVT A;  1K9M C;  2FYK A;  1CKB A;  3H9N A;  2JVV A;  3PMI A;  1YCS B;  4HCK A;  2DL5 A;  3CC7 T;  1QVG P;  5KCH A;  1D1A A;  5GAM h;  2K3B A;  3QBY A;  4E7L A;  2R5A A;  3EH1 A;  4JDS A;  1AD5 A;  4BAC A;  3VUB A;  2VGM A;  1LCK A;  2K2M A;  4BE1 A;  1M1K U;  2F2V A;  2EIF A;  1N8R U;  1T3S A;  2KXD A;  5IH2 A;  2GNC A;  3CMA T;  1BYM A;  1WHM A;  1YFN A;  2L2P A;  3MCA B;  2HZY A;  3CCJ T;  3BDU A;  1VYT A;  2DTH A;  1EFN A;  1B07 A;  2K5F A;  2LT1 A;  3ZEH A;  4C0D C;  3MEW A;  2QDL A;  2RQR A;  1MHN A;  2KR3 A;  4PJO C;  3LGL A;  3JB9 D;  2OTL A;  1D3B B;  1OX9 A;  2D0N A;  4JJC A;  2DL8 A;  1Y7X A;  4BDY A;  5KYU A;  1D09 B;  4MZM A;  3HP9 A;  4KGZ B;  4JLI A;  1PNJ A;  2A08 A;  1ZLM A;  1TUC A;  3M0Q A;  4FM4 B;  3JCM W;  5GAN 8;  1B3Q A;  2KXC A;  2CZ7 B;  3SD4 A;  2L8D A;  2MPX C;  2NUZ A;  1YP5 A;  1KK7 A;  2DX1 A;  2YUO A;  1ARK A;  5KYY A;  2RB6 A;  3WVD B;  3GF5 A;  1U8R A;  3EG0 A;  2GFA A;  4BY6 B;  4C92 A;  5CIU A;  1AWW A;  1QCO A;  5FU6 B;  2YWW A;  1NYF A;  3CCV A;  4M75 G;  5LJ5 d;  1KC8 R;  4Q5W A;  2DL7 A;  2PNI A;  4RCB A;  1XQH A;  2DET A;  1N5Z A;  1H64 1;  2XG8 D;  2QXF A;  1VQ6 T;  2HSE B;  1WQW A;  2KI7 A;  4XTZ A;  4ME7 A;  1NLO C;  3QDR B;  5LJ3 j;  3TRE A;  4J9I A;  3VYH B;  2LJ1 A;  5GMK h;  1TS9 A;  3CCU T;  3FJP A;  1NJI C;  2HCK A;  2NWM A;  1R0C B;  3HKS A;  1G3W A;  1PD0 A;  3UPU A;  1YJN Q;  1UB4 A;  2DL4 A;  2XDD A;  1QVF S;  5GAO l;  2F5T X;  1VUB A;  2K5I A;  2ROT A;  4PLI A;  1GBR A;  1Y07 A;  2JZ2 A;  1K1Z A;  1B34 B;  1WDX A;  2KGT A;  1RI0 A;  5I21 A;  1TUD A;  1RAB B;  2DMO A;  2E3I A;  1WHL A;  2GTO A;  3V8L A;  2DXB A;  2DLP A;  4PJL A;  1WXT A;  5GAN 5;  1O75 A;  3CC7 A;  4IUQ A;  4M77 C;  3M9Q A;  2QK0 A;  5CKD A;  1Z9Q A;  1YI2 A;  2QQA A;  3BDL A;  3QYG B;  4XQ3 A;  2LVM A;  4C8Q G;  1G5V A;  4C0F A;  2CP0 A;  1TOV A;  1AVZ C;  3M58 A;  1M1F A;  1RAH B;  1WJR A;  3EGU A;  4AG2 C;  2PVG B;  1SSH A;  3OBY A;  2NUT A;  1LNX A;  3VYG A;  3OA6 A;  4DOV A;  4M7A G;  3H6Z A;  2YXY A;  3QDF A;  4BY6 C;  3CMA A;  2E5Q A;  3EFO A;  3CCJ A;  3G4S T;  3CXC P;  1OU9 A;  3R6O A;  2DVE A;  4M7A B;  5A2Q E;  4QT7 A;  4LDW A;  3OMG A;  1ACM B;  1RAA B;  3LH0 A;  1RAE B;  2IIM A;  3VU3 C;  2VVK A;  2DF6 A;  2DPP B;  3CXC A;  4C8Q E;  1Q86 R;  1E6G A;  2OAW A;  4M75 C;  1QCF A;  1U1S A;  2MAM A;  1JQQ A;  2VV5 A;  4M7A E;  2QQS A;  3H0H A;  1X75 C;  1XNI A;  4J9G A;  4M77 F;  2RJE A;  2X35 A;  3OYJ A;  5LJ3 f;  3G6E T;  2CP6 A;  3BY7 A;  1TXQ A;  3I35 A;  4WCI A;  1Y0M A;  2DO3 A;  3H8Z A;  1UHC A;  4GLK A;  3X25 B;  4CC3 A;  8AT1 B;  2LNV A;  3RES A;  4J5Y A;  4E6R A;  3X28 B;  1H8K A;  2RK1 A;  2DER A;  3NFC A;  2KRO A;  5KYW A;  5L8R E;  2CT3 A;  4BI3 A;  3SEM A;  2J06 A;  3CME Q;  1VQP T;  1YJW T;  2CKK A;  1VQ6 A;  4LE9 A;  1NM7 A;  3I56 Q;  1UGQ B;  1WZO A;  4OB3 B;  2H3J A;  2RF0 A;  2HDA A;  5DLO A;  1M1K R;  2OI3 A;  4KRT A;  1QMC A;  2ED0 A;  5DY9 A;  4LN2 A;  4PNO A;  1KJW A;  2PVO B;  3A8H B;  4C8Q C;  4ZN3 A;  1SEM A;  1SHF A;  2EGA A;  1JBM A;  2Y4Y A;  1AT1 B;  2ROL A;  4RTW A;  1WJQ A;  2LT4 A;  2IG0 A;  1FX7 A;  4M7A C;  3FIF A;  1NEG A;  1P92 A;  1M30 A;  2GQV A;  1W2B P;  2LX7 A;  2YRD A;  2EJ9 A;  1QWE A;  1G3Y A;  1QWF A;  3VS6 A;  5CKH A;  1HSQ A;  2EW3 A;  2LNH B;  2CP2 A;  4QVZ A;  4RTU A;  3JCM P;  3LH5 A;  1N9R A;  3CD6 Q;  1UGS B;  1FYN A;  1GRI A;  2J7I A;  2JT4 A;  2KNB B;  3RUX A;  4BDZ A;  4R56 A;  2EGE A;  5D6X A;  1KQS A;  1WGS A;  3PVQ A;  1GCP A;  3CXC S;  4Z8A A;  1YJ9 Q;  1UGR B;  1E7O A;  3G4S A;  3EGX A;  3FRN A;  4JPB W;  1OU8 A;  3C0C A;  2DZ9 A;  5GAM f;  1I5O B;  4B9W A;  2GQI A;  1KD1 U;  3DLM A;  3L1A A;  2DNU A;  5GAM e;  4CRI A;  2DK3 A;  4M78 F;  5KYX A;  3M0U A;  2YT6 A;  1LJO A;  1VQ9 A;  1H92 A;  1ZUY A;  1RAG B;  1GFD A;  2EAY A;  1M5Q 1;  3OW2 P;  4ZNX A;  2JTM A;  3KUF A;  2XDB A;  2Z0W A;  5GAO r;  1YJN T;  1X6B A;  3CC2 T;  4DBH A;  3JCM V;  3I55 T;  3JCM b;  2DXT A;  1FMV A;  2IPO B;  4J6Y A;  1UG1 A;  3OQ5 A;  2YUN A;  3CPW A;  1VQ4 Q;  1SSF A;  4FSX A;  3VKI A;  4MMK A;  3CC4 A;  1TH7 A;  3VUZ A;  1IRE B;  4M7D C;  5D6W A;  4OMM A;  5CKE A;  4EMK B;  5CK9 A;  2EYW A;  1VQN Q;  3RMS A;  1W70 A;  1NPR A;  2KAF A;  2L3Q A;  1NZ9 A;  1VQP A;  1YJW A;  1Q81 U;  4KBM B;  2HL3 A;  2XK0 A;  4PJO D;  3EGD B;  1GBQ A;  3V8J A;  2W0Z A;  1BI0 A;  4IUV A;  4LDU A;  2XMF A;  1X27 A;  1E6H A;  2ED1 A;  3G7Z A;  1OQK A;  2CUD A;  1YHQ Q;  1VYU A;  4BUG A;  2HL5 C;  2GTJ A;  5FLX E;  1W4S A;  2K57 A;  2FZC B;  2KYB A;  2MYS A;  3CCR Q;  3CCQ Q;  2DXC A;  1MMN A;  2BUD A;  3OYK A;  3JRZ A;  2ESW A;  2DZC A;  4XK8 E;  5CAI A;  3F70 A;  2DTO A;  1ZSZ A;  2WAC A;  4PJM A;  2JMC A;  2L5Q A;  1KQS S;  1O9S A;  2BIV A;  2V26 A;  5LJ3 h;  2RQV A;  4R55 A;  1WHJ A;  5GMK e;  2JOY A;  3UT1 A;  4M7D F;  4VUB A;  2LZ6 B;  3HRU A;  3C94 A;  4II1 A;  2DA9 A;  1B7T A;  1Q86 C;  5HY6 A;  2LCL A;  1HJD A;  2PUK B;  4LDV A;  2FPD A;  1YNZ A;  3C95 A;  1YBY A;  4N4H A;  3RKX A;  1TSF A;  3SHW A;  3MEV A;  2AZV A;  3E2U A;  3GNF B;  2RNA A;  2YUQ A;  4J6X A;  3V8K A;  3GPL A;  2QA4 Q;  4J83 A;  1IHW A;  4EMK C;  1SPK A;  1JJ2 P;  2O88 A;  1G8X A;  1UDL A;  2M0O A;  4Y92 A;  1VA7 A;  4XU3 A;  3RMQ A;  3M4G A;  2A28 A;  4XAX B;  3LYI A;  4HCZ A;  1WHG A;  3CPW S;  5FU7 B;  2DE0 X;  1JJ2 A;  4PJO G;  4M77 D;  4B6M A;  3RER A;  1UJ0 A;  3HFN A;  3GP8 A;  3CC2 A;  1VQL Q;  2EQK A;  2RK2 A;  5AT1 B;  3I55 A;  3CCE Q;  4RTZ A;  4C0D B;  1ZBJ A;  2EPD A;  2HEQ A;  2O01 E;  3RBB B;  3UA7 A;  1TWB A;  1YWP A;  2RI3 A;  3JB9 J;  3JCM f;  4PJO B;  1QKX A;  1EZZ B;  1M1K C;  4Z89 A;  3A98 A;  2DEQ A;  4QVC A;  2OTJ T;  1WYX A;  2LQW A;  4LXC A;  4Y91 A;  1Q86 U;  1ZSG A;  1I07 A;  2FZG B;  2G3R A;  3CCM Q;  3RDV A;  3ZFJ A;  3JB9 H;  2X9H A;  2ZPB B;  3CPF A;  4PJO E;  3X26 B;  2DM1 A;  4PL6 A;  3CD6 T;  2RHY A;  1X43 A;  1YIJ T;  3JCM c;  5HCK A;  3A5Z B;  4XTV A;  2E3H A;  4DQ2 A;  3ZBD A;  3C4S A;  4M75 D;  3V7S A;  1OPL A;  4BD3 A;  1YJ9 T;  2YDL A;  3A8G B;  4Z02 A;  5CR2 A;  3G1J A;  1BU1 A;  2I0N A;  2DJQ A;  4N4I A;  1WQ7 A;  4X9C A;  3J81 E;  1KD1 R;  1BIA A;  1XJW B;  2LQN A;  2AIR B;  1QVG A;  2DJZ A;  1S72 T;  2D6F A;  2A37 A;  3L42 A;  2GBQ A;  3LGF A;  4E47 A;  5M9O A;  2BKD N;  5FU7 C;  3SB2 A;  1IGU A;  2A0F B;  3M0R A;  2COY A;  2CZ6 B;  1I81 A;  1JU5 C;  1VQ7 Q;  4JS5 A;  1MGQ A;  1VQ8 Q;  4M77 G;  3QZ9 B;  3UAT A;  2IVW A;  3IQL A;  3RKW A;  1X01 A;  4IKF A;  1AZG B;  2W10 A;  4AFZ C;  1RAD B;  2CGH A;  4NL3 A;  4E7J A;  1U06 A;  2WSC E;  2LTO A;  1AWX A;  5FRM A;  3X20 B;  2O9V A;  4HCB A;  4M77 B;  2EQU A;  4IUR A;  2COW A;  3CCL T;  1M2V B;  4C8Q D;  1M3C A;  1WHH A;  1JXM A;  1JJ2 S;  4KUD K;  3QPH A;  1VQN T;  1RL2 A;  1NG2 A;  4F7U F;  1U1T A;  1Q81 R;  3QO3 A;  4M7A D;  4IUT A;  2QEX T;  1VQ5 Q;  4HA8 A;  2RHX A;  5KYN A;  5FRN A;  4M77 E;  1NYG A;  3GLX A;  4ZGJ B;  4HT8 A;  4HXJ A;  1K8A R;  4JRI A;  4A4E A;  5GAM d;  3PMT A;  1YHQ T;  2JUF A;  1BKB A;  1IHV A;  5LL6 S;  2MF2 A;  1Q82 R;  2E1H A;  1UE9 A;  3NPF A;  3CCR T;  2QYZ A;  2OTJ A;  1V76 A;  4XTU A;  4M75 B;  2ZPF B;  4C0Z A;  2XID A;  1OX8 A;  3L2Q A;  3HL8 A;  3OSS C;  5D7U A;  1IGQ A;  1N9S A;  3SDZ A;  4P5N A;  3CD6 A;  4M4Z A;  3LWH A;  2E5K A;  5GAN j;  2VUB A;  1YIJ A;  1PCX A;  4M75 E;  4IIM A;  5CCA A;  5IT9 E;  3MPU B;  3JV3 A;  2O2O A;  4AT1 B;  4AG1 C;  1MND A;  4JLG A;  5GAN 2;  2OX7 A;  4C5H A;  1QVG S;  1Y96 B;  3CQT A;  1YJ9 A;  2SRC A;  3I5S A;  2AKL A;  2X3W D;  2CP7 A;  2BE7 D;  1QKW A;  2LP5 A;  4C5E A;  2LQK A;  2CRE A;  5GAO n;  4O5V A;  2QQ9 A;  5KCO A;  2KT1 A;  4LNP A;  4OMN A;  2EGC A;  3S3N A;  1PSE A;  2BZ8 A;  4PK4 A;  4DOW A;  2DRK A;  3QHS A;  3M5A A;  1S72 A;  4F14 A;  1GFC A;  4WF2 A;  2CH4 W;  4C5I A;  3M0S A;  1YIT T;  4FYW B;  4M78 G;  3JAM E;  1S1N A;  3E1S A;  4OVA A;  4C8Q B;  5GAO p;  3HFO A;  1VQK Q;  2RPN A;  5LJ3 g;  4M7D D;  3N5B B;  1PG5 B;  2RO0 A;  2VXF A;  4A54 A;  1UFF A;  1M4Z A;  4M78 B;  3JCM h;  4FYX B;  1ZA2 B;  2X4Y A;  3INZ A;  2MWP A;  4FT2 A;  2EQM A;  1WA7 A;  5GJV B;  1VQM Q;  2C06 A;  2ATC B;  3NTH A;  3D7S B;  1I5L A;  3CCM T;  4OB1 B;  1KIK A;  1Z9Z A;  4OF1 A;  4J7I A;  2E6Z A;  3PIO A;  1UEC A;  3CCL A;  2J05 A;  4GLM A;  3EGD A;  4M78 E;  2O4X B;  4JJD A;  3P8H A;  3REB B;  5EG2 A;  5I2S A;  1VQN A;  4LUE A;  1MNE A;  3O5Z A;  4A4F A;  2E10 A;  3VS3 A;  2NYS A;  1AZE A;  1C1A A;  2QEX A;  2RI2 A;  1M1G A;  1RI9 A;  3BFM A;  5HK0 A;  5LJ3 e;  3G71 T;  1HXD A;  4A53 A;  2ENM A;  4FCY A;  3MO8 A;  2XKO C;  2XU8 A;  1OOT A;  3EG9 B;  4WTO B;  5A0D A;  2D1X A;  2K3X A;  1YHQ A;  5GAN f;  2YLB A;  4Z88 A;  4PKC C;  3BE3 A;  4FIB A;  1YWO A;  3QXE B;  3GBQ A;  3VS4 A;  2PZ1 A;  2B86 A;  2E41 A;  4O6J A;  3PNW C;  4EIK A;  3M57 A;  1HYO A;  3OYI A;  2OTL Q;  2A7Y A;  3SWN B;  2CSQ A;  1UUE A;  3FEO A;  2VC8 A;  4DBR A;  1AOJ A;  5LJ5 j;  2DL3 A;  3CCU A;  1ZUK A;  1VIE A;  1G3S A;  3PVL A;  2F1L A;  4QQD A;  4OB2 B;  5FRO A;  5C0M A;  2RI5 A;  1VQ7 T;  5KYU B;  1VQ8 T;  1KD1 C;  4M7D G;  2QQR A;  4M78 C;  1QP3 A;  1IO6 A;  5AYF A;  2K9G A;  3WXM B;  3PTA A;  3MKD A;  2DBM A;  4E7H A;  4M7D B;  5GAM g;  1T3L A;  1X6G A;  1ZQ1 A;  2F5K A;  3CCV Q;  3OMC A;  4J9C A;  1W2B A;  4J6W A;  3JCM J;  3OBW A;  2VB6 A;  2O31 A;  4QQ6 A;  1PC0 A;  2DYI A;  2NLU A;  1D0X A;  1PM3 A;  1WHK A;  2Y90 A;  1JEG A;  3AHU A;  3EG1 A;  2KE9 A;  4M7D E;  1YIT A;  2PQW A;  5DLQ E;  2C0O A;  2V8J A;  4PJO A;  1BCO A;  1OZ3 A;  3URG A;  5CVI A;  2PVD B;  4LD9 K;  2V1R A;  1PRM C;  1BB9 A;  2ZPH B;  4J7F A;  3MP6 A;  1Q81 C;  3ULR B;  2DD4 A;  2QDY B;  1SRM A;  2H3E B;  2QTX A;  3EHQ A;  3M0T A;  1IRX A;  3JB9 F;  2QAS A;  1KG1 A;  1K8A C;  3SWN C;  3CCM A;  3QYH B;  4ZGE B;  3CC7 Q;  3HRT A;  2F2X A;  3CCS Q;  1Q7Y R;  2VWF A;  1UEB A;  1WNL A;  2YRV A;  5A0L A;  1YI2 Q;  3C12 A;  1Q82 C;  3G6E A;  5HKC A;  3OW2 A;  3VJP A;  5LJ5 f;  2XD0 A;  5FWB A;  3T9N A;  4FL6 A;  5GMK l;  4DBQ A;  2E4H A;  4CC4 B;  3G71 A;  4OML A;  3S6W A;  3A1P A;  4IIO A;  4JZ4 A;  1RLP C;  3X24 B;  1QLY A;  2WSF E;  3CCJ Q;  1VIF A;  2XHC A;  1MV3 A;  4BI8 B;  1QP2 A;  2RQU A;  5HK3 A;  5FW9 A;  3R6N A;  4C5G A;  4PLL A;  2HBP A;  3DB4 A;  2J6K A;  3EFS A;  2OAU A;  4C92 C;  1F1B B;  3CEY A;  2ABL A;  2G6F X;  3UF4 A;  2DVJ A;  2C0T A;  1UGV A;  2COZ A;  4JJN K;  2V8K A;  1MMD A;  4XTY A;  1I4K 1;  1KSW A;  1X2K A;  4YTL A;  4J9F A;  3M0P A;  1WI7 A;  4D8D A;  4E2F B;  2XDP A;  4RG2 A;  1U3O A;  1K8A U;  5CKF A;  1G3T A;  1AHJ B;  1SRL A;  1TTH B;  1MUZ A;  1D3B A;  3QJ6 A;  1M3A A;  1VQ8 A;  4M77 A;  1SG5 A;  1JO8 A;  3KFV A;  1W2B S;  1M2V A;  1KQ1 A;  4MML A;  1Q82 U;  5IHN A;  1VQM T;  2C0I A;  2DXU A;  1OEB A;  1ZHI A;  3MP1 A;  3TCJ A;  1H3H A;  1R77 A;  4IUP A;  3OYY A;  3OYL A;  4QW2 A;  3M56 A;  3UWN A;  2JMA A;  2HMA A;  5CO7 A;  1BI2 A;  4ZGD B;  4X1V A;  3VS5 A;  4K11 A;  1IXD A;  2E65 A;  2FPF A;  4F7U G;  1PSF A;  4FT4 A;  4J9B A;  3OYE A;  2RD1 A;  3QWX X;  4C92 F;  2KK4 A;  3HSB A;  1XTD A;  3QJY A;  2QQB A;  1CSK A;  1IB8 A;  4F7U B;  5GAN h;  4ZN1 A;  1BK2 A;  1WXU A;  3OYH A;  3JCM g;  3LLR A;  1XOV A;  2P84 A;  4M75 A;  5IN1 A;  2QG9 B;  3GIB A;  2K4Y A;  2HD0 A;  9ATC B;  4L6V 5;  3CME T;  4ORZ A;  2YLC A;  3I56 T;  3H0I A;  3AT1 B;  4MZT A;  4DBF A;  3OW2 S;  2DIQ A;  4JS4 A;  2KQW A;  4F7U E;  1UHF A;  4L59 A;  3PE0 A;  2LJ3 A;  4FW2 A;  1K73 U;  2MCN A;  4HKE A;  1YJN A;  1H3Z A;  1B34 A;  2L3R A;  2GFU A;  1VQO Q;  2AZS A;  2EQI A;  1KQ2 A;  2O9S A;  2MIO A;  1Y96 A;  5J3B A;  1Y71 A;  2AHJ B;  7AT1 B;  5GAO m;  3OSV A;  1AWJ A;  5GAN 6;  2EBP A;  3J80 E;  3LWI A;  2KVQ G;  2YHT A;  3M59 A;  1NLP C;  2X4J A;  2JW4 A;  2RQT A;  3JCM e;  2P0Q A;  1PHT A;  4R0K A;  2LQ8 A;  1TU0 B;  4OB0 B;  5LJ3 d;  4ZTJ A;  2QTV A;  4HVU A;  1WJS A;  2JN0 A;  2MOX A;  3ASK A;  3M4Y A;  4GBQ A;  3CBM A;  3A8L B;  1RLQ C;  1KHI A;  4C8Q A;  4J9D A;  2VAS A;  5GJW B;  4NS5 A;  2EYQ A;  3A8M B;  1PWT A;  2YRC A;  4HCC A;  3KXT A;  1VQ9 Q;  4M7A A;  3O8V A;  3QG1 A;  4F16 A;  2H8H A;  2CSI A;  1OZ2 A;  3VS1 A;  4ANJ A;  3OYD A;  1K9A A;  5I2M A;  5IXB A;  3GOX A;  2JXB A;  2ZCF B;  5L23 A;  4XU0 A;  1KFZ A;  1QVF P;  5DM7 R;  5GAO q;  4RTX A;  4FW1 A;  2BTT A;  2O4X A;  3NGP A;  1NE8 A;  4E7K A;  4UC4 A;  2RJD A;  1PKT A;  2DIL A;  2R57 A;  3HHT B;  1I1J A;  2EJG A;  4IUU A;  3MEA A;  4E7I A;  1VYV A;  1OI1 A;  1BIB A;  3A8O B;  1WFW A;  3TSZ A;  3CC4 Q;  3CCS T;  1MV0 B;  2KBT A;  2EYZ A;  1M90 U;  2VYT A;  1YI2 T;  1TG0 A;  4FYV B;  2MMP A;  1VQP Q;  1YJW Q;  1SKU B;  5IHK A;  5LJ5 h;  3EG9 A;  2K3Y A;  3H0F A;  5GMK i;  4KT0 E;  4LD6 A;  2AKK A;  1VQ4 T;  2HKQ B;  4F04 B;  2JS0 A;  1EX4 A;  1Q7Y C;  5GAN 3;  2QGG A;  3MHX A;  3SWN A;  2SEM A;  4KUI A;  3PIP A;  2X51 A;  2DEU A;  2DIG A;  1YN8 A;  2JTF A;  1RUW A;  2EQJ A;  2QAZ A;  2KY9 A;  3OYA A;  3SFM A;  3REA B;  3CME A;  4M78 D;  2EJF A;  3I56 A;  4DEX A;  3CBO A;  4J8O A;  2K5L A;  1K9M U;  3Q1J A;  3FC3 A;  1ZX6 A;  2K7A A;  3OS2 A;  2OJ2 A;  2LCS A;  3QII A;  4C0G A;  4OMF B;  5KH6 A;  3E9F A;  4OMQ A;  4N4G A;  3VV0 A;  1ZSZ B;  3FB9 A;  2XI9 A;  2KDS A;  5CQX A;  4M7D A;  2HNI A;  2K2V A;  3EHR A;  4EMH A;  4PJJ A;  3CCQ T;  2FB7 A;  3NHN A;  1AWO A;  1JXO A;  1R8O B;  2B8A A;  1HD3 A;  3S3O A;  1BCM A;  2V8I A;  2X4X A;  4ELY C;  4KH1 B;  2EVR A;  3TEE A;  2D8H A;  2K79 A;  4RKU E;  3RR6 A;  2CS7 A;  2RQW A;  2F69 A;  3NTK A;  1Q7Y U;  1FMK A;  4J9E A;  3THK A;  5C6S A;  4DEY A;  8ATC B;  3L2Z A;  4FYY B;  4KH0 B;  3OYB A;  4V2S A;  4PJO F;  2EKO A;  3ER0 A;  3KBG A;  4QVD A;  3EAE A;  3CC2 Q;  2YUP A;  3I55 Q;  2L3P A;  1MMA A;  5I22 A;  2D9T A;  2KMT A;  1D1B A;  4HVW A;  1R0B G;  5KE2 A;  2KT8 A;  2QA4 T;  3S3M A;  2QGF B;  1Q95 G;  4XU1 A;  2GGR A;  4BE2 A;  3E19 A;  4PJN A;  2ZPG B;  2CP3 A;  2RMO A;  1CKA A;  1K73 R;  2FHD A;  3JB9 G;  2M16 A;  2LC4 A;  4B9X A;  3CCS A;  4N0A C;  3V7R A;  3ME9 A;  1D0Z A;  2ZAE A;  1ABQ A;  3VS7 A;  3TU4 K;  1VQL T;  2EYX A;  1VQO T;  3CCE T;  4ESR A;  1I0C A;  2Y4X A;  4C92 D;  4DA4 A;  2A3L A;  1NPP A;  1ZSZ C;  1A0N B;  2JS2 A;  2RHI A;  5ECA A;  2NUP B;  2QI2 A;  4EMK A;  2CT4 A;  4RG8 A;  4OMP A;  1VQ4 A;  3HPW A;  5GAN g;  5GMK m;  3U23 A;  1NJI U;  3QKJ A;  2FL7 A;  5FU6 C;  4KUL A;  1AEY A;  1U5S A;  1N6A A;  2CZ0 B;  4PFZ A;  1C6V X;  2E6N A;  1QVP A;  2ZGW A;  2MWO A;  2KRM A;  1VQ9 T;  3OB9 A;  4OP0 A;  5J26 A;  4E7Z A;  2VXE A;  1GCQ C;  3OYM A;  1QW1 A;  4LDX A;  2K6D A;  2DTI A;  4JJB A;  3UA6 A;  4J9H A;  1PRL C;  3HTR A;  2PTK A;  1SF9 A;  1V29 B;  3OY9 A;  2D8J A;  4CI0 C;  2DAQ A;  5GAN e;  3CCR A;  3CCQ A;  1ZBX A;  1K0X A;  1BBZ A;  5GAM j;  4XTW A;  4D6W A;  4X9D A;  4XTX A;  1G2B A;  4CC2 A;  1D1C A;  2RHZ A;  2FO0 A;  3OYG A;  2FPE A;  5IAY A;  2FEI A;  1EIF A;  2A36 A;  3CC4 T;  1M90 R;  1T0H A;  3JCM d;  2F2W A;  3FLG A;  3JCM X;  1J3T A;  1Y57 A;  4KGX B;  4A63 B;  4JZ3 A;  4OGE A;  4NL2 A;  1M27 C;  4F7U A;  3EFR A;  4A4H A;  4JUV A;  3PT9 A;  3EG2 A;  4EPC A;  1N8R R;  2EYY A;  1OPK A;  4C92 G;  1WPY A;  3QZ5 B;  4D8K A;  4KGV B;  1GL5 A;  4M75 F;  5KYY B;  2E64 A;  2KSS A;  3H41 A;  4C92 B;  2DKG A;  2QA4 A; 
#chains in the Genus database with same CATH homology
 3J81 E;  4IUP A;  2HQE A;  3OYY A;  5GAN 5;  1BIA A;  1O75 A;  2R58 A;  5D6Y A;  3DLL A;  3CC7 A;  4IUQ A;  4M77 C;  3OYL A;  2LX9 A;  4QW2 A;  3DKM A;  3M56 A;  2DD5 A;  3UWN A;  1QVG A;  1VQ5 T;  3M9Q A;  2DJZ A;  5CO7 A;  1S72 T;  2D6F A;  1BI2 A;  3JSC A;  5CKD A;  4ZGD B;  1YI2 A;  5A0G A;  2QQA A;  3BDL A;  3QYG B;  4XQ3 A;  1JRI A;  2LVM A;  3L42 A;  4C8Q G;  5M9O A;  2GCX A;  1KHC A;  4C0F A;  2E65 A;  1G5V A;  3LGF A;  3QSU A;  3RKY A;  4A4K A;  4F7U G;  4E47 A;  5GAN 4;  3M58 A;  1M1F A;  1PSF A;  1WJR A;  2BKD N;  4FT4 A;  4MDW A;  5FU7 C;  2PVG B;  2RD1 A;  3SB2 A;  4C92 E;  3OBY A;  4C92 F;  2KK4 A;  3HSB A;  1VQL A;  4ELZ C;  1LNX A;  3VYG A;  5LJ5 g;  3OA6 A;  1VQO A;  2CZ6 B;  4DOV A;  3CCE A;  4M7A G;  1I81 A;  3H6Z A;  1XTD A;  1MGQ A;  2PU9 B;  4JS5 A;  3QJY A;  2QQB A;  1DJ7 B;  4M77 G;  4NOY A;  3QZ9 B;  4BY6 C;  3CMA A;  2IVW A;  3V7C A;  3RKW A;  2E5Q A;  2P0K A;  1X01 A;  4IKF A;  4F7U B;  5GAN h;  3CCJ A;  4ZN1 A;  3G4S T;  2CGH A;  4NL3 A;  3JCM g;  3OYH A;  4E7J A;  5CKB A;  3R6O A;  3LLR A;  1XOV A;  2DVE A;  4M75 A;  4EDU A;  1LOJ A;  2LTO A;  2WSC E;  5IN1 A;  4M7A B;  4LDW A;  5A2Q E;  5FRM A;  3GIB A;  3X20 B;  2K4Y A;  3OMG A;  4HCB A;  3DB3 A;  4M77 B;  3LH0 A;  2EQU A;  2HD0 A;  4IUR A;  4L6V 5;  3CME T;  3CCL T;  4TVR A;  3VU3 C;  4C8Q D;  2YLC A;  2DPP B;  2ZZD A;  3I56 T;  3CXC A;  4MZT A;  4C8Q E;  3OW2 S;  1JJ2 S;  2DIQ A;  4KUD K;  4C8Q F;  3QPH A;  3L2W A;  1RL2 A;  1VQN T;  3P8B B;  4JS4 A;  2KQW A;  4F7U E;  5GMK j;  4L59 A;  4FU6 A;  4BE0 A;  4F7U F;  1U1T A;  4M75 C;  2RJC A;  2I2L A;  3QO3 A;  4M7A D;  4IUT A;  2QEX T;  1K73 U;  1BI1 A;  2MAM A;  2VV5 A;  1U1S A;  4HKE A;  4M7A E;  2JNG A;  2QQS A;  2WSE E;  1YJN A;  4M7A F;  1X75 C;  3FDR A;  2RHX A;  4HA8 A;  1B34 A;  2HAX A;  5FRN A;  2L3R A;  2RM4 A;  4M77 E;  1XNI A;  4BB7 A;  2GFU A;  3GLX A;  4M77 F;  2RJE A;  4ZGJ B;  1KQ2 A;  2X35 A;  4HT8 A;  3OYJ A;  5LJ3 f;  3G6E T;  1Y96 A;  5LJ5 e;  5J3B A;  1Y71 A;  2AHJ B;  3E9G A;  4JRI A;  4A4E A;  3OSV A;  5GAO m;  5GAN 6;  4L5G A;  5GAM d;  3BY7 A;  3PMT A;  3J80 E;  3LWI A;  2KVQ G;  3UDC A;  1KC8 C;  3OYN A;  2YHT A;  3M59 A;  1YHQ T;  2JUF A;  1BKB A;  1X6O A;  1M8V A;  2DO3 A;  2X4J A;  5LL6 S;  1YCY A;  3H8Z A;  3HRS A;  3OS5 A;  1BI3 A;  4GLK A;  3X25 B;  3JCM e;  2MF2 A;  2P0Q A;  4JRQ A;  1GXI E;  2LQ8 A;  2LNV A;  3RES A;  2E1H A;  2D0Q B;  4J5Y A;  3X28 B;  3CCR T;  4OB0 B;  5LJ3 d;  4ZTJ A;  2RK1 A;  3NFC A;  2R5M A;  1WJS A;  2JN0 A;  2OTJ A;  5L8R E;  4XTU A;  3M55 A;  3ASK A;  4M75 B;  2GF7 A;  2M1H A;  1FWZ A;  3M4Y A;  4BI3 A;  2ZPF B;  3A8L B;  3CBM A;  3QUI A;  4C0Z A;  2XID A;  1KHI A;  1VQP T;  1YJW T;  4C8Q A;  4ATO A;  2E12 A;  2CKK A;  3L2Q A;  2P4T A;  2EWN A;  1VQ6 A;  1HK9 A;  3HL8 A;  2ZPI B;  3OSS C;  1N9S A;  2EYQ A;  3M53 A;  1UGQ B;  2EFI A;  3A8M B;  4NS5 A;  4OB3 B;  2H3J A;  4Y28 E;  3SDZ A;  4P5N A;  1VQK T;  4HCC A;  1M9S A;  5DLO A;  3KXT A;  3CD6 A;  4M7A A;  4LDY A;  1VQ7 A;  5DY9 A;  3O8V A;  3QG1 A;  5KE3 A;  1OZ2 A;  3OYD A;  3JB9 I;  4PNO A;  5I2M A;  3LWH A;  2PVO B;  3LX7 A;  5GAN j;  2VUB A;  1YIJ A;  3A8H B;  4M75 E;  4C8Q C;  4ZN3 A;  3GOX A;  2ZCF B;  5CCA A;  5IT9 E;  4XU0 A;  1JBM A;  2Y4Y A;  4JLG A;  5GAN 2;  5DM7 R;  5GAO q;  4JRP A;  4C5H A;  1QVG S;  1WJQ A;  1Y96 B;  2LT4 A;  1K73 C;  2IG0 A;  1YJ9 A;  4RMO A;  1FX7 A;  4M7A C;  3CBP A;  3FIF A;  1P92 A;  2RA2 A;  2GQV A;  2O4X A;  1NE8 A;  4E7K A;  4UC4 A;  2RJD A;  4C5E A;  2R57 A;  2LQK A;  1KC8 U;  2EJ9 A;  3HHT B;  4O5V A;  2QQ9 A;  5KCO A;  5GAO n;  2EJG A;  4IUU A;  3MEA A;  4E7I A;  4N0A A;  1OI1 A;  1G3Y A;  3L2V A;  1BIB A;  3A8O B;  2RH2 A;  4GY5 A;  3S3N A;  3OYC A;  1PSE A;  1I8F A;  3P8D A;  2RJF A;  4DOW A;  3CCS T;  1VQ5 A;  5CKH A;  3QHS A;  3M5A A;  1S72 A;  1M90 U;  4WF2 A;  2VYT A;  4QVZ A;  3JCM P;  1YI2 T;  5GAN 7;  4C5I A;  1N9R A;  1YIT T;  2MMP A;  4M78 G;  1UGS B;  3JAM E;  4RCC A;  4MDX A;  5LJ5 h;  2CZ1 B;  3E1S A;  4OVA A;  2K3Y A;  3MP8 A;  4C8Q B;  5GAO p;  3HFO A;  3RUX A;  4R56 A;  3LW5 E;  2HQX A;  2PUO B;  2X4W A;  2ZPE B;  4QQG A;  4KT0 E;  5GMK i;  5LJ3 g;  4M7D D;  2E70 A;  3N5B B;  2RO0 A;  3GNG A;  1OYX A;  2VXF A;  4OGC A;  4A54 A;  5D6X A;  1KQS A;  1M4Z A;  4LD6 A;  1VQ4 T;  4M78 B;  1WGS A;  3JCM h;  3CXC S;  1UGR B;  2M9U A;  2X4Y A;  3INZ A;  1Q7Y C;  2MWP A;  5GAN 3;  4FT2 A;  3MHX A;  3SWN A;  2EQM A;  3G4S A;  3FRN A;  4KUI A;  4JRK A;  4X9C A;  1UGP B;  2OTL T;  2C06 A;  3NTH A;  2DZ9 A;  4EMG A;  3PIP A;  2DIG A;  5GAM f;  1I5L A;  3CCM T;  2JTF A;  4OB1 B;  2EQJ A;  4OF1 A;  2KY9 A;  4J7I A;  4B9W A;  5CQY A;  3SFM A;  2E6Z A;  3OYA A;  3PIO A;  3RIR A;  3L2R A;  3OS1 A;  4M78 D;  3CME A;  1KD1 U;  3DLM A;  3CCL A;  3L1A A;  2EJF A;  3I56 A;  5GAM e;  4M78 E;  3PFS A;  4CRI A;  2DK3 A;  2O4X B;  4M78 F;  3CBO A;  3P8H A;  5I2S A;  5EG2 A;  1VQN A;  1LJO A;  2LCC A;  1VQ9 A;  4A4F A;  2E10 A;  2EAY A;  1M5Q 1;  4J8O A;  2JTM A;  2K5L A;  1K9M U;  2QEX A;  3Q1J A;  2RI2 A;  4A4G A;  3FC3 A;  3KUF A;  2XDB A;  5GAO r;  1YJN T;  1M1G A;  3OS2 A;  3CC2 T;  5J39 A;  3QII A;  4C0G A;  3JCM V;  4OMF B;  4MZP A;  3BFM A;  5KH6 A;  5HK0 A;  2CYZ B;  5LJ3 e;  3JCM Q;  3E9F A;  3I55 T;  3JCM b;  2DXT A;  3G71 T;  1HXD A;  4A53 A;  4N4G A;  3VV0 A;  3FB9 A;  3MO8 A;  2XI9 A;  4J6Y A;  3M54 A;  3NTI A;  2KDS A;  2XKO C;  2XU8 A;  5CQX A;  4M7D A;  2HNI A;  2K2V A;  3OQ5 A;  4EMH A;  2XIC A;  5A0D A;  1N27 A;  3OYF A;  2K3X A;  1IZ6 A;  3CCQ T;  2FB7 A;  2VGN A;  3CPW A;  1YHQ A;  2P0P A;  5GAN f;  2YLB A;  1M90 C;  3PGG A;  4PKC C;  3CCV T;  4FIB A;  1R8O B;  2B8A A;  3S3O A;  1SSF A;  2V8I A;  2RHU A;  2X4X A;  3QXE B;  4ELY C;  4FSX A;  3VKI A;  2FVU A;  4MMK A;  3BW1 A;  3TEE A;  2E41 A;  4O6J A;  4RKU E;  3PNW C;  3CC4 A;  1TH7 A;  2CS7 A;  3VUZ A;  4XU2 A;  1IRE B;  3M57 A;  3OYI A;  4M7D C;  2A7Y A;  5D6W A;  2F69 A;  5CKE A;  3SWN B;  1N8R C;  3NTK A;  4EMK B;  5CK9 A;  1Q7Y U;  4HT9 A;  3FEO A;  2LDM A;  3RMS A;  1NPR A;  3J7A F;  2VC8 A;  2KAF A;  5GAN d;  4ZTF A;  5C6S A;  1NZ9 A;  5LJ5 j;  4M78 A;  1VQP A;  1YJW A;  3CCU A;  3MEU A;  3L2Z A;  4BI4 A;  1Q81 U;  4BDZ A;  1VIE A;  4KBM B;  1G3S A;  2XK0 A;  4PJO D;  1VQK A;  4QQD A;  3L2U A;  4OB2 B;  3OYB A;  4V2S A;  3WVE B;  4PJO F;  5FRO A;  3V8J A;  5C0M A;  3OS0 A;  2RI5 A;  2LRQ A;  1VQ7 T;  2EKO A;  2MI6 A;  1H3Z A;  1VQ8 T;  3ER0 A;  3KBG A;  1KD1 C;  1BI0 A;  4IUV A;  4LDU A;  4QVD A;  3EAE A;  4M7D G;  3G7Z A;  2QQR A;  4M78 C;  1QP3 A;  2L89 A;  5AYF A;  4X34 A;  1JB0 E;  3MET A;  4BUG A;  5FLX E;  2D9T A;  2KMT A;  1VQM A;  1FXX A;  1W4S A;  1QVF A;  5KE2 A;  2K57 A;  1K9M C;  2QA4 T;  2FYK A;  3WXM B;  3PTA A;  3S3M A;  2JVV A;  3PMI A;  4E7H A;  4M7D B;  4XU1 A;  3CC7 T;  5GAM g;  2DXC A;  5KCH A;  1ZQ1 A;  2BUD A;  2F5K A;  4BE2 A;  3OYK A;  3OMC A;  3JRZ A;  3E19 A;  5GAM h;  4J6W A;  2DZC A;  2ZPG B;  4XK8 E;  3JCM J;  5CAI A;  1W2B A;  3F70 A;  3OBW A;  3QBY A;  4E7L A;  2R5A A;  2DTO A;  4JDS A;  2WAC A;  4BAC A;  2FHD A;  3JB9 G;  2M16 A;  2L5Q A;  4QQ6 A;  2NLU A;  2LC4 A;  3VUB A;  4B9X A;  3CCS A;  2VGM A;  1KQS S;  4N0A C;  3V7R A;  3ME9 A;  2Y90 A;  3TU4 K;  1VQL T;  4BE1 A;  1O9S A;  2BIV A;  3AHU A;  1M1K U;  5LJ3 h;  1VQO T;  4R55 A;  4M7D E;  5GMK e;  2JOY A;  2EIF A;  2PQW A;  3UT1 A;  1YIT A;  1N8R U;  3CCE T;  4M7D F;  2Y4X A;  5DLQ E;  4C92 D;  4VUB A;  2V8J A;  3HRU A;  3C94 A;  1OZ3 A;  3URG A;  4DA4 A;  4PJO A;  3CMA T;  2A3L A;  5CVI A;  1BYM A;  4II1 A;  3MCA B;  1NPP A;  3CCJ T;  3BDU A;  2PVD B;  2DTH A;  2RHI A;  4LD9 K;  2QI2 A;  1Q86 C;  2ZPH B;  5HY6 A;  4EMK A;  2LCL A;  4RG8 A;  2PUK B;  4J7F A;  4LDV A;  1VQ4 A;  3HPW A;  2K5F A;  2LT1 A;  3MP6 A;  5GMK m;  3ZEH A;  3C95 A;  4C0D C;  5GAN g;  1Q81 C;  2DD4 A;  3MEW A;  2QDY B;  1YBY A;  4N4H A;  2QTX A;  3RKX A;  3QKJ A;  1NJI U;  2FL7 A;  5FU6 C;  1MHN A;  4PJO C;  3LGL A;  4KUL A;  3MEV A;  3JB9 D;  2OTL A;  1D3B B;  4J6X A;  3GNF B;  3GPL A;  3V8K A;  3JB9 F;  4J83 A;  1KG1 A;  1K8A C;  3SWN C;  3CCM A;  4EMK C;  1N6A A;  1Y7X A;  4BDY A;  3QYH B;  4ZGE B;  2CZ0 B;  3HRT A;  2E6N A;  3HP9 A;  2M0O A;  4MZM A;  4FM4 B;  4JLI A;  1QVP A;  4XU3 A;  1UEB A;  2ZGW A;  2MWO A;  1WNL A;  2YRV A;  3M4G A;  3RMQ A;  5A0L A;  3JCM W;  5GAN 8;  1VQ9 T;  4XAX B;  3OB9 A;  4OP0 A;  5J26 A;  2CZ7 B;  3SD4 A;  3LYI A;  3C12 A;  4HCZ A;  2L8D A;  3OYE A;  2VXE A;  1Q82 C;  3G6E A;  5FU7 B;  3CPW S;  5HKC A;  3OW2 A;  3OYM A;  1JJ2 A;  1QW1 A;  4PJO G;  3TCJ A;  4LDX A;  4M77 D;  3VJP A;  5LJ5 f;  2XD0 A;  3RER A;  3HFN A;  3T9N A;  2RB6 A;  3GP8 A;  3CC2 A;  3WVD B;  2DTI A;  2EQK A;  4FL6 A;  2RK2 A;  5GMK l;  3I55 A;  3GF5 A;  1U8R A;  2GFA A;  4BY6 B;  4C0D B;  5CIU A;  4C92 A;  3G71 A;  2O01 E;  1V29 B;  3S6W A;  3OY9 A;  4CI0 C;  5FU6 B;  2DAQ A;  3X24 B;  2RI3 A;  3JB9 J;  3JCM f;  4PJO B;  2WSF E;  5GAN e;  1VIF A;  2XHC A;  4BI8 B;  3CCR A;  3CCQ A;  1QP2 A;  1ZBX A;  5GAM j;  1M1K C;  5HK3 A;  4XTW A;  3CCV A;  2DEQ A;  4M75 G;  4X9D A;  4XTX A;  4D6W A;  4Q5W A;  4QVC A;  5LJ5 d;  4C5G A;  2OTJ T;  4PLL A;  2HBP A;  4Y91 A;  1Q86 U;  3DB4 A;  2RHZ A;  2G3R A;  3OYG A;  3EFS A;  4RCB A;  5IAY A;  2OAU A;  1XQH A;  4C92 C;  1EIF A;  3CEY A;  1H64 1;  3ZFJ A;  3JB9 H;  3CC4 T;  2XG8 D;  2QXF A;  1VQ6 T;  1WQW A;  4JJN K;  2V8K A;  4XTY A;  1I4K 1;  4XTZ A;  2ZPB B;  4ME7 A;  3QDR B;  3JCM d;  5LJ3 j;  3FLG A;  3TRE A;  3JCM X;  3CPF A;  4PJO E;  3X26 B;  3VYH B;  4YTL A;  4PL6 A;  3CD6 T;  2RHY A;  5GMK h;  3CCU T;  3FJP A;  4OGE A;  1NJI C;  2XDP A;  4NL2 A;  4RG2 A;  3HKS A;  1K8A U;  4F7U A;  1G3W A;  3EFR A;  3UPU A;  5CKF A;  1YIJ T;  1UB4 A;  1G3T A;  3JCM c;  2XDD A;  4A4H A;  1QVF S;  3A5Z B;  4JUV A;  5GAO l;  2F5T X;  1VUB A;  3PT9 A;  2K5I A;  1AHJ B;  4XTV A;  4EPC A;  4PLI A;  4DQ2 A;  1D3B A;  4C92 G;  1Y07 A;  3QJ6 A;  3ZBD A;  1WPY A;  1VQ8 A;  3QZ5 B;  3C4S A;  4M75 D;  4M77 A;  3V7S A;  1W2B S;  4BD3 A;  1YJ9 T;  2JZ2 A;  3A8G B;  1KQ1 A;  4MML A;  1Q82 U;  4M75 F;  4Z02 A;  1B34 B;  5CR2 A;  1RI0 A;  2E64 A;  5I21 A;  2KSS A;  1VQM T;  2DXU A;  1ZHI A;  4C92 B;  2DKG A;  3MP1 A;  2QA4 A;  4N4I A;  3V8L A;  2DXB A;  1WQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...