2IG0A

Structure of 53bp1/methylated histone peptide complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Structural Basis for the Methylation State-Specific Recognition of Histone H4-K20 by 53BP1 and Crb2 in DNA Repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ig0A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ig0A01
2R57A 3LX7A 3QIIA 2LTOA 2DO3A 1VQKT 5FRMA 3META 1VQ8A 3CCMA 3G4SA 2F5KA 2QA4T 3OYKA 2JUFA 1YJNT 4N4GA 2HQEA 3LGLA 4FU6A 2EQUA 2WACA 2MWOA 4Z02A 2EKOA 5C6SA 2XDPA 2LCLA 2OTLT 5D6YA 1VQ6A 3L42A 4QVZA 4GY5A 1G5VA 3I56T 1K8AU 1VQMA 3CPWS 2RJDA 4QW2A 1XTDA 4TVRA 4QQDA 1VQLT 3JAME 1VQ8T 3CC4A 3OYDA 4IKFA 1Q86U 4FL6A 1M90U 4YTLA 3OS1A 3OYBA 4ZN3A 2X4YA 3KUFA 5FLXE 1S72A 2D9TA 4IUPA 2M1HA 5LL6S 2NLUA 3QKJA 3EAEA 4IUQA 4II1A 2EQMA 5D6WA 1VQ6T 2GFAA 3DLLA 3CCVA 3PFSA 1YBYA 2E5QA 2LRQA 1K8AC 2P0KA 5FRNA 3SD4A 4ZTJA 2RJCA 3F70A 1NPRA 1UEBA 4C5GA 1VQ5A 2RI5A 3OYNA 1MHNA 4QQGA 3CC4T 4PLLA 1KD1U 1M1KU 3CCEA 2X4XA 1Q86C 1KQSA 1YJNA 3MEWA 1M90C 3E9GA 4BE1A 3L2WA 1Q81U 4N4HA 5D6XA 4C5IA 3OYIA 5DM7R 1IZ6A 4C5EA 2O4XB 3S3NA 1VQPA 1VQ4A 3MEUA 3LYIA 2X4WA 3UT1A 4LD6A 4IUUA 3FEOA 2CKKA 3CCVT 2RJEA 1RL2A 2JTFA 5A2QE 2QEXA 5HY6A 4BE0A 1YIJT 1XNIA 3CPFA 4UC4A 1VQ5T 4NS5A 1YHQA 4B9WA 1VQLA 1VQNT 2RHYA 5KCOA 3J81E 1K9MU 2K3YA 1KD1C 5KE2A 1QVFS 2IG0A 4IURA 3OYLA 1YITA 3CCET 3L2RA 1M1KC 2RI2A 3OYMA 4RG2A 3J80E 3OMCA 3CCSA 1Q81C 4ZTFA 3ER0A 1VQPT 3S3OA 1VQ4T 2R5MA 1KQSS 5KH6A 2B8AA 3OYCA 3CCJA 1W2BA 4A4FA 1QVGS 2EIFA 3CCLA 3S6WA 2RHXA 2HQXA 4BDZA 3OA6A 2XHCA 2QEXT 3DLMA 3TREA 3PIPA 2K3XA 2E6NA 1K73U 1Q82U 1YHQT 4A4GA 3PMIA 2LCCA 2RHIA 3OYAA 1K9MC 4EDUA 1YITT 2BUDA 4B9XA 2RO0A 3CCST 3MP1A 1N8RU 3CEYA 3MO8A 1WJRA 3LGFA 2DIGA 2EQJA 3MEVA 1VQ7A 3CCJT 3OY9A 1Q7YU 4PLIA 3CCLT 3OS2A 3CCUT 3L2UA 2JNGA 3GOXA 3E9FA 4PL6A 1W2BS 5IN1A 1QVFA 1OZ2A 1YJWA 1YIJA 3OB9A 4BE2A 3KBGA 1K73C 2R5AA 1Q82C 2KVQG 2GF7A 4ZN1A 1VQNA 3LLRA 1YJ9A 2L89A 4BDYA 2QQRA 1VQ9T 1M1GA 3NTKA 4A4HA 3CCRT 2RJFA 2LQ8A 3DB4A 1QVGA 5IT9E 2L8DA 4A4EA 1N8RC 1VQ7T 1YI2A 2O4XA 1Q7YC 1KC8U 4QQ6A 4Q5WA 1WJQA 3G6EA 3H6ZA 5KE3A 1JJ2S 1YJWT 5KCHA 3QBYA 3CCQT 3OYHA 1KHIA 4E7LA 1YJ9T 2E70A 5M9OA 4E7IA 3OYGA 3CD6T 2KDSA 3CC7A 1X6OA 3OYYA 4HCZA 3FLGA 3HKSA 3H8ZA 1YI2T 2XK0A 3OQ5A 3J7AF 2DIQA 2L3RA 3MP6A 2QQSA 3S3MA 1KC8C 3CCUA 2VYTA 5CIUA 1N27A 2MI6A 3G6ET 1RI0A 2OTJT 3M9QA 3ZEHA 1OI1A 2FHDA 4N4IA 3OYEA 1SSFA 3CMAA 2X35A 3OW2A 5J26A 2LVMA 4E7KA 5J3BA 3I55A 1VQ9A 2JZ2A 2M0OA 3PNWC 4CRIA 3L2QA 1VQOT 5IAYA 2G3RA 4IUVA 2MWPA 3CCRA 3CC7T 2PQWA 1WJSA 4OVAA 3MP8A 1NJIU 2BIVA 3ASKA 2M16A 2YRVA 2DAQA 4E7HA 5DLQE 3CXCS 2RHZA 3CCMT 5C0MA 3G4ST 1JJ2A 3A5ZB 2E6ZA 3P8HA 2RI3A 3OMGA 1EIFA 1NPPA 3C4SA 3G71A 3CMEA 1OYXA 1OZ3A 3PIOA 3Q1JA 2R58A 3CCQA 3L2VA 3CMAT 3CC2A 4BD3A 3I55T 3NTHA 3QJ6A 4L59A 3CD6A 3UWNA 1H3ZA 1VQMT 2GFUA 2JOYA 3OW2S 3NTIA 1NJIC 1KHCA 3P8DA 5FROA 5J39A 1VQKA 3P8BB 4X34A 4C5HA 3OS0A 3FC3A 3OYJA 2QA4A 3OYFA 4IUTA 1NZ9A 1BKBA 3FDRA 3MEAA 3PMTA 3G71T 3CMET 2OTJA 1S72T 2EQKA 2LDMA 2OTLA 3DB3A 2RHUA 3CPWA 2BKDN 3CC2T 1WGSA 3O8VA 1VQOA 3BDLA 2EFIA 3ME9A 3LH0A 4E7JA 3I56A 2JVVA 4BACA 3CXCA
chains in the Genus database with same CATH superfamily
5I21A 3LX7A 2LTOA 1YWPA 1N5ZA 1VQKT 3SWNB 2GBQA 3I5RA 1KQ1A 3QYGB 4DBFA 2E5KA 3G4SA 1FMVA 2QA4T 1YJNT 4FU6A 2ZAEA 1VYUA 2COZA 4OB1B 3FJPA 1UGRB 2E1HA 4ZGDB 3RDVA 4AG2C 4J6XA 5D6YA 1LCKA 4PJOE 4BI8B 1VQ6A 2KRMA 4QVZA 2DEUA 2PZ1A 2DK3A 2F2WA 2WSCE 5IXBA 1NBEB 3BDUA 5DY9A 4C0FA 1RACB 2VC8A 3JB9J 1WHMA 4M7DA 4PK4A 2V1RA 4RMOA 2ESWA 2ZPGB 1Q86U 1B07A 1UGPB 2NYSA 2M02A 4AFQC 3OYBA 4FSXA 5FLXE 1K76A 4PJOC 2VUBA 1KQSP 2BZXA 2JN0A 1GFDA 2EQMA 1VQ6T 1KFZA 3RIRA 1K9AA 1KK7A 3BW1A 4J9BA 3CCVA 2G6FX 4MDWA 3PFSA 1YBYA 2P0KA 2LJ3A 4ZTJA 2LQKA 2DTHA 3HFNA 1NE8A 4XU0A 1MMDA 2F2XA 1VQ5A 3GPLA 1VYTA 2QGFB 4M75A 2CP3A 2DD5A 2VWFA 2F2VA 4O6JA 1WHHA 8ATCB 1KQSA 1SRLA 1T0JA 1M90C 1PM3A 5AT1B 2VXEA 3A8LB 5KYYB 1AHJB 3PVQA 2CZ0B 2K5LA 5KYWA 3LYIA 4QT7A 1SRMA 1NM7A 5LJ5h 3A98A 4LD6A 4JRIA 1SHFA 2CKKA 2L3PA 2DYBA 3CCVT 4OMOA 3EG2A 3EG9A 3VRZA 3JCMe 1YJWQ 2DRMA 4KBMB 5A2QE 1BI3A 5HY6A 1YN8A 2GNCA 5GAOr 1XNIA 3CPFA 1JU5C 1VQ5T 3RKYA 4M77G 1EZZB 3VS0A 2K3YA 1KD1C 1QVFS 2IG0A 3QJYA 3SWNA 1YITA 3L2RA 2CS7A 2HSEB 2RI2A 1M1KC 3UA7A 3OYMA 4HCKA 1B34B 1AD5A 1WIEA 1Q81C 5GAOp 1WHGA 3A8HB 3QO3A 3REAB 1F1BB 1OULA 1N9RA 1KIKA 4AMCA 4HCBA 4GLKA 3A8MB 3H0FA 3CCLA 4BDZA 2W10A 2RK2A 2ZCFB 3TREA 4PJOB 3VUZA 2E6NA 4J7IA 1M3AA 2RHIA 4F7UF 1FXXA 5IHNA 1K9MC 1QVFP 4EDUA 1B3QA 3M58A 1YITT 4K11A 4B9XA 1SSHA 2CGHA 2EKHA 3EHQA 3X25B 3E19A 2DJQA 2O9SA 3X26B 2DYIA 2KYBA 4JZ4A 1BYMA 2DIGA 1OEBA 2EQJA 3LGFA 1IO6A 1QWEA 3OY9A 2XG8D 1V76A 1Y07A 2K79A 3CCLT 1TUCA 4DOWA 1MV0B 3HHTB 3I9QA 2FPDA 3CCUT 3L2UA 7AT1B 3GOXA 1WXTA 4PL6A 1W2BS 2RB6A 3GNGA 5IN1A 1QVFA 3JCMg 1YJWA 2HSPA 4AFZC 1Q82C 1VQ9Q 3PTAA 3LLRA 1UG1A 1WXBA 2HAXA 2DVJA 3ULRB 4A4HA 4M77D 3ZBDA 4C92F 2PU9B 1AWXA 1JXOA 2PVOB 4NL2A 1LJOA 4WF2A 4E7SA 3QPHA 5CK9A 1N8RC 2MAMA 2YRDA 2JTEA 3QHSA 1CKAA 3EG0A 1BU1A 3LW5E 4DEYA 3GLXA 5CKHA 1RAFB 4Q5WA 3TEEA 3LH5A 3H6ZA 4IIMA 1YJWT 1CKBA 2D0QB 4M78D 4OMQA 1M2VB 1RLPC 3C94A 2E70A 2RK1A 4XTWA 1RAEB 2KDSA 1FMKA 3X28B 4LUEA 2D1XA 1GCPA 2F1LA 5GAN6 2NUZA 1Q86R 3HKSA 2DKGA 1WZOA 2EWNA 5CO7A 2DXCA 2C06A 1OPKA 5GMKe 2D0NA 2P4RA 1M8VA 5CIUA 4C8QD 4HKEA 3LWHA 2OTJT 2OTLQ 1I0CA 3OYEA 4RTWA 1M5Q1 1LPLA 2W0ZA 1VQ9A 4PNOA 5LJ5j 1DJ7B 5IAYA 1WI7A 2MWPA 2FZCB 2K7AA 1AOJA 4LDVA 2AHJB 3UATA 4XTXA 3MP8A 2E4HA 2BIVA 4RG8A 3JSCA 5CKDA 1VQ8Q 3CCMQ 5IH2A 2CUDA 5GMKl 2DAQA 4E7HA 5DLQE 2QDYB 3A5ZB 2E6ZA 2RI3A 3V7RA 3OMGA 3RUXA 3NFCA 1NPPA 4M7DC 3CBMA 2ZGWA 1ZBXA 1D1BA 3Q1JA 3QDFA 3M55A 2QTVA 4F16A 4M75E 2VB6A 2NUPA 1VQMQ 4L59A 3KFVA 2CZ1B 1B7TA 3UWNA 2JTMA 3JB9D 2FZKB 2JOYA 2GQIA 1U1SA 3EGUA 3OW2S 3EHRA 4C0DC 3P8DA 5FROA 1NLOC 4L6V5 4RKUE 4X34A 3FC3A 3C12A 1PKSA 2CZ7B 4JLIA 1WNLA 4IUTA 4FYWB 3CMEQ 2F69A 3FDRA 3INZA 2GQVA 4RTXA 4ZGEB 1M30A 3JCMc 2CP5A 2QDLA 4M75C 2EQKA 2LDMA 2QQAA 1IHWA 5GMKi 2OTLA 1W70A 2BKDN 2KE9A 2DRKA 3SFMA 1VIFA 1X75C 3BDLA 2QASA 2X51A 5GANe 2AIRB 3I35A 1HSQA 3UPUA 2LCSA 4CC2A 3NMZC 1TUDA 4JJBA 2RPNA 4EPCA 2E3IA 3CCEQ 3HRTA 1JBMA 1YCYA 3E1SA 1VQ8A 1YJNQ 3CCMA 4N4GA 2QTXA 5GAOm 4A54A 1UHFA 2EQUA 2JT4A 4A4KA 2WACA 2MWOA 4Z02A 1OX9A 5FW9A 2K2MA 3VYHB 4EMKC 4J9HA 2CSQA 5C6SA 2LCLA 2OTLT 5GMKm 4PJOG 3VS5A 2DILA 1MUZA 4BI3A 2AKKA 3VJPA 2QEXQ 5CR2A 4ELYC 1VQMA 4M7DB 1OX8A 1BBZA 1I07A 3QSUA 2FVUA 5GAMj 1WHLA 2AK5A 2WSEE 2A08A 2Z0WA 1PNJA 4X1VA 4LD9K 1VQ8T 4AFUC 4R55A 2CT3A 4IKFA 1QQJA 4E6RA 2I2LA 1M90U 4YTLA 1O75A 4PFPA 4Z89A 4C0DB 4ZN3A 3KUFA 2HL3A 2JM9A 2YUQA 3QKJA 4Y28E 4IUQA 2MPXC 4II1A 5IHIA 1QVGP 2HQHA 3JCMd 2GFAA 1ZLMA 4M4ZA 2P0PA 2FO0A 2AKLA 1K0XA 3SD4A 2KRNA 2RJCA 4M75B 5GANg 4LNPA 4HXJA 3EG3A 2JMCA 2RI5A 1MHNA 4QQGA 3H0IA 3M53A 1HJDA 1KD1U 2Y4XA 1M1KU 2CH4W 2X4XA 3CCEA 2L3QA 5L8RE 2DERA 1YJNA 4BE1A 1JRIA 5KYWB 1Q81U 4N4HA 2CDTA 5DM7R 2ZPEB 4C5EA 2KI7A 3S3NA 1VQ4A 2EGCA 3M0TA 3MEUA 3R6OA 2QQBA 3EG9B 1VYVA 3V7CA 3URGA 2X4WA 3VS6A 4IUUA 4PJOD 2RJEA 4XQ3A 2JTFA 4M77F 1XQHA 1ZHIA 4M7AD 2QEXA 2EPDA 3RNJA 1YIJT 3HRSA 2DL5A 3VS1A 1VQNT 2J6KA 2RHYA 2FG0A 1GBQA 3M4YA 1K9MU 3HFOA 1QWFA 1AZEA 4IURA 3CCET 2DVEA 1D1CA 2ED0A 2PUKB 3S3OA 1VQ4T 1GBRA 2R5MA 1R8OB 1KQSS 5KH6A 3OYCA 4M78F 3CCJA 5GAN8 4J9CA 4XTYA 1XJWB 2DBMA 4XK8E 1BCMA 2QEXT 1WX6A 3CBOA 3PIPA 1QP3A 3HPWA 3MJXA 1V29B 1Q82U 1SF9A 2JW4A 2IIMA 2O2OA 1QLYA 1YITQ 2FPEA 2P84A 4KH0B 3OYAA 2YXYA 2QI2A 5KYXA 2BUDA 1X2QA 4A53A 1BCOA 2V26A 2RQUA 4J7FA 1ZQ1A 3EGXA 3M5AA 2KK4A 4C8QF 3M0SA 1N8RU 3CEYA 3O5ZA 3CBPA 3CCLQ 3CCJT 3V7SA 2ZPHB 1ABOA 3CCUQ 4PLIA 1AWWA 4ATOA 3IQLA 3FJ5A 3D7SB 1KG1A 3HTRA 2EGAA 3VU3C 1K73C 3I55Q 2L89A 4J6YA 1BI2A 3MPUB 3QDRB 1RAHB 2FPFA 4JPBW 1QW1A 4C0GA 5LJ3e 3DB4A 5IT9E 3HSBA 1VUBA 3QWYA 1OV3A 1PCXA 2RF0A 1Q7YC 1UGSB 4QQ6A 4OMPA 1WJQA 2DTIA 4PJJA 5FU7C 3JB9F 5KE3A 3CCQT 3CC2Q 4DQ2A 5GANf 4J83A 4EMKA 1ZSZA 3OYGA 4FYVB 4ME7A 4EIKA 4KH1B 4XTVA 3U23A 3CC7A 4C0ZA 1D3BA 2KNBB 4KT0E 3UF4A 4HCZA 2PUOB 3RKWA 2HMAA 1MNEA 3OQ5A 2FYKA 2DIQA 3MP6A 5GJVB 3S3MA 1HXDA 2OTJQ 3EGDB 5CQYA 1KC8C 1P92A 3EH2A 2LNVA 3CCUA 1N27A 2YRCA 4XTZA 2CZ6B 3ZEHA 5FU6C 1ZSGA 3M0RA 4M7DG 1PRMC 2GTOA 3GF5A 3A1PA 2LNHB 2LVMA 1YCSB 5CKFA 3I55A 2JZ2A 1FX7A 3I56Q 3PNWC 3L2QA 2G3RA 1VOMA 4VUBA 3CC7T 1IB8A 1I5OB 2YDLA 2PQWA 5GAMe 3MKDA 3JCMJ 4DBRA 5LJ3g 2M51A 2HKNA 1M1KR 2YRVA 2D8HA 1YFNA 2RHZA 5GAOq 4L5GA 2KXCA 1D0XA 2XMFA 3JCMh 1M3CA 1Y57A 4RCBA 4F7UA 1OZ3A 2X9HA 3PIOA 2A36A 2NUPB 4ORZA 3L2VA 4LDXA 2NWMA 2VXFA 3A8GB 4OGEA 4M75G 5GANd 4BD3A 3I55T 3NTHA 3CC2A 3MHXA 2B86A 2BTTA 8AT1B 4LUDA 1NEGA 2LX9A 4LXCA 2VGNA 4JDSA 4DBQA 3CPWP 2FRYA 1I4K1 1WPYA 1NJIC 1K9MR 2ZPFB 1HD3A 4O5VA 3CC4Q 3AHUA 1I8FA 3PGGA 1AT1B 1GL5A 2KQWA 3OYJA 4BB7A 3OYFA 1QCOA 2V8KA 1BB9A 4CC3A 2BZ8A 2P4TA 3L1AA 2HL5C 4DBHA 2OTJA 2OAWA 1S72T 4C92A 2KSSA 3N5BB 2XKOC 1S1NA 3DB3A 2RHUA 3CPWA 2K4YA 3CC2T 1TH7A 2PTKA 2EAYA 4PFZA 4M7DD 3M4GA 1Q82R 3LH0A 3H41A 3I56A 2HD0A 3RESA 4E7JA 5FU6B 3QZ9B 4PJNA 1UTIA 2LT4A 2QK0A 2DO3A 3REBB 4N0AA 5GAMg 5FRMA 3META 1UJYA 3TSWA 2ROLA 2CSIA 3HP9A 2F5KA 1BI1A 5KYUA 3OYKA 1ZA1B 2JUFA 4D8DA 1MV3A 1N8RR 2X4JA 3X24B 2OJ2A 3LGLA 4JLGA 4PJOF 4KGZB 2DL7A 2LX7A 4M7AF 3EGDA 2EKOA 1M2OA 4FW2A 2XDPA 3PT9A 1ZBJA 3C95A 3H9NA 1E6HA 2VGMA 3L42A 1BI0A 1KJWA 2EYZA 4HVUA 4M75D 3I56T 2YT6A 4RTUA 1RAIB 4M78E 3TQ7P 3TCJA 4QW2A 4FYXB 1R0CB 4D8KA 4JS4A 1VQLT 2Y4YA 3JAME 3OYDA 1PD0A 3CC4A 4ELZC 1RLQC 3BY7A 4FSSA 3BFMA 4FL6A 3CCSQ 3JCMW 2FRWA 3OS5A 2J05A 3JV3A 3OS1A 1IGQA 4JZ3A 2X4YA 1X6BA 2RQWA 3FIFA 3UDCA 2X3WD 2ZZDA 2D9TA 5LL6S 3QG1A 2XI9A 3EAEA 1U1TA 3SB2A 2KRSA 3GP8A 2MCNA 4M78C 4J9EA 4C8QE 3DLLA 1V1CA 1Y96A 2L5QA 2E5QA 2LRQA 1K8AC 1K4US 4P5NA 3F70A 1NPRA 4CC4B 3OYNA 2AT1B 2DMOA 3QWXX 1M4ZA 3CC4T 5LJ3f 4PLLA 5GJWB 1WHJA 5HK3A 5GMKh 1NG2A 2EYQA 2YUPA 3MEWA 1N6AA 1XOVA 3L2WA 5D6XA 2RD1A 3OBWA 2O4XB 1VQ7Q 4C8QC 1SEMA 3PE0A 2EYWA 2DBKA 1YIJQ 4R0KA 4BE0A 1VQNQ 4HA8A 1C1AA 5KCOA 4Z88A 2VV5A 3J81E 2EYYA 2RQRA 3OYLA 3THKA 1LOJA 1CSKA 2H8HA 3OMCA 1N9SA 1VQ4Q 3CCSA 4ZTFA 1U06A 9ATCB 2YLBA 1ZSZC 4GLMA 2YSQA 2PVDB 4A4FA 1Y7XA 1QVGS 3C0CA 1I5LA 3S6WA 2HQXA 1G2BA 3OA6A 4CI0C 4PJLA 1AWJA 1ARKA 4KUDK 4PFOA 1TSFA 2XDDA 4KGVB 1FWZA 2K3XA 2JM8A 1K73U 2JS0A 4A4GA 3PMIA 4A63B 5KYXB 1H92A 1M27C 3M57A 2LCCA 1NEBA 1H8KA 4RTYA 1U5SA 5LJ3d 5GAMf 3EGXB 2FEIA 1FMWA 2RO0A 2FB7A 5EC7A 2MF2A 2HEQA 3CCST 1D09B 4F7UE 3CCJQ 1W4SA 4RUGA 2V8IA 3ZL7C 1WJRA 1VQ7A 4MDXA 2K2VA 4J6WA 1Q7YU 3OS2A 5GANh 1M8MA 1WQWA 2JMAA 3DKMA 3JB9I 1OZ2A 4EMHA 3CMAQ 3OB9A 1OOTA 4BE2A 3VRYA 4C8QB 1YIJA 2M9UA 2R5AA 4JUVA 1Y0MA 2GF7A 2DL3A 2KVQG 4ZN1A 1VQNA 2FZGB 4AFSC 2QQRA 3NTKA 2LQWA 3CCRT 1TTHB 2ZPIB 2LQ8A 4DOVA 2HNIA 1HYOA 1QVGA 2L8DA 2HKQB 1G3WA 4E47A 1O9SA 4C92E 1R77A 1WLPB 3QYHB 4ANJA 2KMTA 4F17A 4F14A 3RR6A 1VQ7T 4XAXB 1VIEA 1RABB 2O4XA 2KBTA 4ZGJB 4HCCA 1QKWA 5A0LA 2A7YA 4NOYA 1X2KA 3G71Q 4MMKA 1KC8U 2LMJA 1TS9A 2LQNA 5GAN4 2C0OA 3CCQQ 1ZUKA 2L2PA 4EMKB 2O88A 4Z8AA 3V8KA 3QBYA 4GBQA 1ZSZB 2RMOA 4B6MA 3OYHA 5GAN2 1KHIA 4E7LA 4J9FA 5M9OA 2EJGA 5KYNA 4JRQA 2DEQA 1D3BB 1PSFA 3CD6T 3MCAB 5CAIA 5GAMd 4C92C 1JEGA 1G3TA 3OYYA 4FT4A 1G3SA 3KXTA 4HT9A 4M77A 3H8ZA 1PKTA 5GAN5 4BY6C 2ROTA 3G1JA 4KGXB 2E3HA 3EFSA 3M0PA 2L3RA 3J7AF 1I81A 2QQSA 1H3HA 5GMKj 2FL7A 1IREB 2DXUA 2EJ9A 4M7DF 1SG5A 2MI6A 4ESRA 2WSFE 1GXIE 1OPLA 1R0BG 3M9QA 4N0AC 2FHDA 2DZCA 1FYNA 2K57A 3JCMV 3HL8A 2L3SA 1SSFA 1VA7A 3CMAA 5J26A 3VV0A 4FIBA 2QGGA 2COWA 2LC4A 5LJ5e 2M0OA 3CC7Q 2DNUA 4M7AE 3RBBB 1VQOT 1G3YA 4IUVA 4M78A 1YNZA 2DX1A 2E64A 4FM4B 1WJSA 1KSWA 4OVAA 1NJIU 2DL8A 4E7ZA 2F5TX 3OSVA 2A0FB 2JS2A 3CXCS 5C0MA 2H3JA 1MGQA 3RMSA 3G4ST 4F7UB 2CP7A 5I11A 4J9DA 2HBPA 4HT8A 2OX7A 3E2UA 1EIFA 1AVZC 4M75F 1OYXA 1UJ0A 2HCKA 3G71A 1JB0E 2NUTB 3CCQA 2ED1A 2K6DA 5GAOn 4M7AC 3CMAT 5CVIA 2KT1A 5A0DA 5HK0A 4C8QA 4WTOB 1TUGB 1H3ZA 2O9VA 2PNIA 1ZUUA 3NGPA 4JRPA 1HK9A 2O31A 4DA4A 1NYGA 5J39A 1RADB 2D8JA 3CXCP 4C5HA 1QP2A 5CQXA 1RAGB 1T3SA 4C92B 2QYZA 4LDYA 2DTOA 1S72Q 1GCQA 3MEAA 2MOXA 3PMTA 3G71T 1EFNA 3I5SA 4RTVA 2M0YA 1K1ZA 2KGTA 2SRCA 2EJFA 2CREA 4BY6B 1MMAA 4J9GA 3JCMX 3O8VA 2JXBA 2D6FA 1K73R 3ME9A 5ECAA 5LJ5g 5GANj 1SHGA 3CXCA 1Z9ZA 2R57A 2RA2A 2J6OA 3QIIA 5KYUB 2RH2A 3CQTA 3RMQA 3EFOB 1M90R 4OMNA 4J8OA 1RUWA 2KR3A 2DLPA 1GRIA 4KULA 1QCFA 1UB4A 1TWBA 2HQEA 1QMCA 2DXBA 2MIOA 1VQPQ 1Q7YR 2QG9B 2CUBA 3M59A 3V8JA 1UGQB 2V1QA 2EBPA 1QKXA 2LZ6B 2CYZB 4MMLA 4GY5A 1MMGA 1PRLC 4ZNXA 1G5VA 1K8AU 2RNAA 5LJ3h 3AT1B 4M78G 3CPWS 2E10A 1YHQQ 1UE9A 4F04B 2RJDA 1VQLQ 1KD1R 4M7AB 1XTDA 1C6VX 1A0NB 4TVRA 4XU3A 1BK2A 1ZX6A 3TVTA 2OI3A 4JS5A 4QQDA 2LP5A 1ABQA 4BI4A 3BE3A 1Q81R 2E65A 1JO8A 5FWCA 2KT8A 2DM1A 3M56A 5GAN3 3HRUA 4OP0A 1S72A 4IUPA 4OB0B 2M1HA 3JCMQ 4JJNK 2ABLA 2NLUA 2DF6A 2ECZA 1SPKA 1KC8R 1Y96B 4Y92A 2Y90A 3OBYA 2NUTA 5D6WA 1UGVA 1WQ7A 4C8QG 1JXMA 3WXMB 2MMPA 5FU7B 5FRNA 3NPFA 1AEYA 4MZTA 1T3LA 1WHKA 4PKCC 1D1AA 1X43A 1UEBA 4C5GA 2XICA 1G8XA 3FRNA 4J9IA 1SKUB 3GIBA 1J3TA 2XIDA 3EH1A 2EVRA 1TOVA 1Q86C 2V8JA 3E9GA 1U3OA 4LDUA 2CP2A 2E41A 4C5IA 1WDXA 3OYIA 1IZ6A 2QAZA 2YUOA 2DA9A 2PVGB 1VQPA 4KRTA 3JCMb 2GCXA 4MZPA 2KEAA 1PSEA 5KYYA 3UT1A 3FEOA 1X27A 1UDLA 3UA6A 1RL2A 2EQIA 5DLOA 2K5IA 3JCMP 1IGUA 5GAMh 1W2BP 4RCCA 3G7ZA 1YJ9Q 4UC4A 3A8OB 4NS5A 4B9WA 1YHQA 1VQLA 2AZSA 4M77E 3R6NA 3JB9G 4FW1A 1E7OA 2LJ1A 2DFUA 5KE2A 1NJIR 4JJDA 1PG5B 3EFOA 5FWBA 4NL3A 4RG2A 2KY9A 3J80E 2IPOB 5I22A 6AT1B 2A3LA 3ER0A 4OGCA 1VQPT 1NLPC 1X69A 1YI2Q 4FYYB 1B34A 1IHVA 2B8AA 1C0MA 1W2BA 2EIFA 4Y91A 3G6EQ 2EYXA 2RN8A 2RHXA 2VASA 1EX4A 1WA7A 5I2SA 1WFWA 3TU4K 2XD0A 2XHCA 2GTJA 3DLMA 4M77C 2DETA 1UHCA 2C0TA 1NYFA 1ZA2B 5LJ5f 4WCIA 1YHQT 4M7DE 4PJOA 2K3BA 2COYA 3VKIA 2XDBA 4M7AA 2YWWA 2IVWA 1AWOA 3VS4A 2LT1A 1LVKA 1OU9A 2K5FA 3JB9H 3SEMA 5GAOl 3M54A 1MNDA 4F7UG 4E2FB 3MP1A 1Y71A 2RQTA 2K9GA 3MO8A 4RTZA 2A28A 5CKBA 3WVDB 4AT1B 4LE9A 3MEVA 4JJCA 3SHWA 4D6WA 1MMNA 2YUNA 5HCKA 1D0ZA 3WVEB 2KXDA 2JNGA 2BE7D 3E9FA 2KROA 3JRZA 3KBGA 2P0QA 1RI9A 4JRKA 2MK5A 1YJ9A 4OB2B 2AZVA 3CCRQ 4BDYA 1VQ9T 3H0HA 3SDZA 4LDWA 3T9NA 1QCNA 1M1GA 2CT4A 1Q95G 4OMFB 3X20B 2RJFA 2ZPBB 2MYSA 5LJ3j 1K0SA 1WYXA 3M0UA 4A4EA 4C92G 2VVKA 4BUGA 3VYGA 2DL4A 2XU8A 2SEMA 1YI2A 4DEXA 3NHNA 2ENMA 3GBQA 4FT2A 2A37A 1OQKA 3G6EA 2X3XD 2EGEA 1JJ2S 5KCHA 5LJ5d 5GAN7 1K8AR 1YJ9T 3CD6Q 4E7IA 3JCMf 4QVCA 1M3BA 5HKCA 1GCQC 1U8RA 4XTUA 4XU2A 1M9SA 1M2VA 2HDAA 1W1FA 1IXDA 1LNXA 1H641 1IRXA 3OW2P 1X6OA 4M77B 1VQKQ 5IXFA 3FLGA 4R56A 5IHKA 1Z9QA 2HBWA 1G83A 2DZ9A 2GGRA 2QA4Q 3RERA 1YI2T 2XK0A 3VS7A 4CC7A 1X01A 4X9CA 3M0QA 2YLCA 5D7UA 1RAAB 1UECA 2VYTA 3G6ET 2DXTA 1KQ2A 1RI0A 1JJ2P 1OI1A 4N4IA 4EMGA 1X6GA 2QQ9A 2X35A 2I0NA 5EG2A 3LWIA 5CKEA 3OW2A 3SWNC 1VQOQ 2JJ9A 4M78B 5J3BA 4E7KA 4M7AG 1AZGB 1W6XA 4CRIA 1UFFA 3CCRA 2DD4A 3QXEB 1ZUYA 3ZFJA 4HVVA 5CCAA 3GNFB 4OMLA 1QVPA 2VKNA 5L23A 4IIOA 5AYFA 2J7IA 1TXQA 3ASKA 3OSSC 2HZYA 2E12A 2M16A 3G4SQ 5A0GA 1ACMB 2CH4A 4OF1A 1PHTA 3FB9A 3CCMT 1JJ2A 4C92D 1D0YA 2L0AA 3P8HA 3V8LA 3PVLA 3VS3A 5I2MA 1JQQA 1T0HA 1TU0B 2O01E 4OB3B 4J5YA 4AG1C 4V2SA 2BZYA 2C0IA 3C4SA 3CMEA 1UUEA 2CP0A 3VS2A 2R58A 2CP6A 1E6GA 1YWOA 1VQ6Q 1OU8A 4QKUA 2ATCB 2EW3A 3QJ6A 1GFCA 3QZ5B 3CD6A 4OMMA 2GFUA 1VQMT 1BIAA 4HVWA 1M1FA 3NTIA 2BE9B 1KHCA 2J6FA 1YP5A 2LJ0A 1VQKA 3P8BB 4QVDA 2KAFA 2YHTA 3OS0A 2RQVA 2QA4A 3EG1A 1NZ9A 1BKBA 2KYMA 4MZMA 4PJMA 1PD1A 1WXUA 3CMET 3RKXA 2DJZA 2DPPB 4LN2A 1I1JA 2RM4A 4FCYA 3QUIA 1PWTA 2DE0X 1TG0A 3EFRA 3CCVQ 2OAUA 1WGSA 4RTTA 4KUIA 1VQOA 3VUBA 1PC0A 2EFIA 2H3EB 2QXFA 3L2ZA 3TSZA 2JVVA 4BACA 2J06A 4X9DA 4XU1A 1VQ5Q 1BIBA
chains in the Genus database with same CATH topology
2R57A 2RA2A 5I21A 3LX7A 3QIIA 2LT4A 2LTOA 2DO3A 4N0AA 5GAMg 2RH2A 3SWNB 3META 4EPCA 1VQKT 5FRMA 3RMQA 3HRTA 1JBMA 1KQ1A 1YCYA 3E1SA 3HP9A 3QYGB 4J8OA 3G4SA 2F5KA 3CCMA 1BI1A 4KULA 2QA4T 3OYKA 2JUFA 1YJNT 4N4GA 2QTXA 2X4JA 3X24B 1UB4A 2HQEA 3LGLA 4FU6A 4JLGA 2DXBA 5GAOm 4A54A 4PJOF 2EQUA 4A4KA 2WACA 2MWOA 4Z02A 4M7AF 4OB1B 3VYHB 3FJPA 4EMKC 1UGRB 2E1HA 2EKOA 5C6SA 2LCLA 2XDPA 3PT9A 4ZGDB 3M59A 3C95A 3V8JA 5GMKm 2OTLT 4J6XA 4PJOG 5D6YA 4PJOE 1UGQB 4BI8B 1VQ6A 2VGMA 3L42A 4QVZA 4BI3A 3VJPA 1BI0A 2CYZB 4MMLA 4GY5A 5CR2A 2DK3A 2WSCE 4M75D 4ELYC 3I56T 1K8AU 1G5VA 5LJ3h 1VQMA 4M7DB 3BDUA 5DY9A 4M78G 4C0FA 3CPWS 2E10A 2VC8A 4M78E 3JB9J 3TCJA 2RJDA 3QSUA 2FVUA 5GAMj 4M7AB 4QW2A 1XTDA 4M7DA 4TVRA 4XU3A 2WSEE 4JS5A 4QQDA 4JS4A 1VQLT 2Y4YA 3JAME 4RMOA 4LD9K 1VQ8T 3OYDA 3CC4A 4BI4A 4ELZC 3BY7A 4R55A 2ZPGB 3BFMA 4IKFA 4FL6A 1Q86U 3JCMW 2E65A 1UGPB 2I2LA 3OS5A 4YTLA 1M90U 1O75A 3M56A 5GAN3 3OS1A 3OYBA 4C0DB 4FSXA 4ZN3A 2X4YA 3KUFA 3FIFA 5FLXE 3HRUA 3UDCA 4OP0A 2ZZDA 4PJOC 1S72A 2D9TA 4IUPA 4OB0B 2M1HA 5LL6S 3QG1A 3JCMQ 2NLUA 4JJNK 2VUBA 2XI9A 3QKJA 2JN0A 1Y96B 1U1TA 2Y90A 3EAEA 4IUQA 4II1A 4Y28E 3OBYA 2EQMA 3SB2A 5D6WA 3GP8A 1VQ6T 1WQ7A 4C8QG 2GFAA 4M78C 3RIRA 3JCMd 4C8QE 3WXMB 3DLLA 2P0PA 3BW1A 1Y96A 2L5QA 3CCVA 4MDWA 2MMPA 3PFSA 1YBYA 2E5QA 2LRQA 2P0KA 5FU7B 4MZTA 3SD4A 1K8AC 5FRNA 4P5NA 4ZTJA 2LQKA 2DTHA 3HFNA 2RJCA 1NE8A 3F70A 1NPRA 4M75B 4PKCC 5GANg 1UEBA 4C5GA 2XICA 4XU0A 1VQ5A 3GPLA 3FRNA 2RI5A 3OYNA 3GIBA 1MHNA 4M75A 4QQGA 2DD5A 1M4ZA 3CC4T 2XIDA 3M53A 5LJ3f 4O6JA 4PLLA 1KD1U 5GMKh 5HK3A 2Y4XA 1M1KU 2X4XA 3CCEA 2EYQA 5L8RE 1Q86C 1KQSA 1YJNA 3MEWA 1N6AA 2V8JA 3E9GA 4LDUA 1XOVA 4BE1A 1M90C 1JRIA 3L2WA 2E41A 4C5IA 4N4HA 5D6XA 1Q81U 3OYIA 2RD1A 3OBWA 5DM7R 1IZ6A 2VXEA 2ZPEB 3A8LB 2O4XB 4C5EA 3OW2A 3S3NA 2PVGB 1VQPA 1AHJB 2CZ0B 1VQ4A 2K5LA 4C8QC 3JCMb 1QVFA 2GCXA 3MEUA 3R6OA 2QQBA 3LYIA 4MZPA 1PSEA 3V7CA 5LJ5h 3URGA 2X4WA 3UT1A 4LD6A 4JRIA 4IUUA 3FEOA 2CKKA 3CCVT 4PJOD 2RJEA 1RL2A 3JCMe 4XQ3A 2JTFA 2K5IA 4KBMB 1XQHA 4M77F 1ZHIA 5DLOA 5A2QE 4M7AD 1BI3A 5GAMh 2QEXA 3JCMP 4RCCA 5HY6A 4BE0A 5GAOr 1YIJT 1XNIA 3CPFA 3G7ZA 4HA8A 4UC4A 1VQ5T 3HRSA 3A8OB 4NS5A 4B9WA 1YHQA 3RKYA 4M77G 1VQLA 1VQNT 2RHYA 5KCOA 4M77E 2VV5A 3JB9G 3J81E 3M4YA 1K9MU 2K3YA 3HFOA 1KD1C 4M7DC 5KE2A 1QVFS 2IG0A 4IURA 3QJYA 3SWNA 1LOJA 3OYLA 2CS7A 2RI2A 3L2RA 1YITA 1M1KC 3CCET 2DVEA 4NL3A 3OYMA 4RG2A 2KY9A 3J80E 3OMCA 1N9SA 1B34B 3CCSA 5GAOp 3A8HB 4ZTFA 1Q81C 2A3LA 3ER0A 2PUKB 3QO3A 4OGCA 1VQPT 2YLBA 1N9RA 3S3OA 1VQ4T 2R5MA 1R8OB 1B34A 1KQSS 5KH6A 2B8AA 4HCBA 4GLKA 3OYCA 4M78F 2PVDB 3CCJA 3A8MB 4A4FA 1W2BA 1Y7XA 1QVGS 2EIFA 1I5LA 5GAN8 4Y91A 4XTYA 3S6WA 3CCLA 2RHXA 4XK8E 2HQXA 4BDZA 2RK2A 5I2SA 3OA6A 4CI0C 3TU4K 2XD0A 2XHCA 2QEXT 3DLMA 4KUDK 2ZCFB 3CBOA 3TREA 4PJOB 3VUZA 4M77C 2XDDA 1FWZA 3PIPA 1QP3A 2E6NA 2K3XA 3HPWA 1K73U 5LJ5f 1V29B 1Q82U 4J7IA 1YHQT 4A4GA 3PMIA 4M7DE 4PJOA 3M57A 3VKIA 2LCCA 2XDBA 2RHIA 3OYAA 4M7AA 4F7UF 1FXXA 2IVWA 2QI2A 1K9MC 5GAMf 5LJ3d 4EDUA 3M58A 1YITT 2LT1A 2BUDA 4B9XA 2K5FA 2RO0A 3JB9H 2FB7A 4A53A 2CGHA 5GAOl 3M54A 4J7FA 2MF2A 3CCST 4F7UG 1ZQ1A 3X25B 3M5AA 4F7UE 2KK4A 3MP1A 4C8QF 3E19A 1Y71A 1N8RU 3CEYA 1W4SA 3MO8A 2V8IA 3X26B 3CBPA 1WJRA 5CKBA 1BYMA 3WVDB 2DIGA 2EQJA 3LGFA 3MEVA 1VQ7A 4MDXA 3OY9A 3CCJT 2K2VA 3V7SA 2XG8D 2ZPHB 4J6WA 4D6WA 1Y07A 1Q7YU 4PLIA 3CCLT 3OS2A 4DOWA 4ATOA 3WVEB 5GANh 3HHTB 3CCUT 3L2UA 1KG1A 1WQWA 3DKMA 2JNGA 3GOXA 3E9FA 4PL6A 1W2BS 2RB6A 3GNGA 3JB9I 5IN1A 1OZ2A 3JRZA 3VU3C 4EMHA 3OB9A 3JCMg 4BE2A 4C8QB 1YIJA 1YJWA 3KBGA 2M9UA 1K73C 2R5AA 4JUVA 1Q82C 2P0QA 4JRKA 2GF7A 2KVQG 4ZN1A 3PTAA 3LLRA 1VQNA 1YJ9A 4OB2B 2L89A 4BDYA 2QQRA 1VQ9T 4J6YA 3SDZA 2HAXA 4LDWA 3T9NA 1BI2A 1M1GA 3QDRB 3NTKA 4A4HA 4M77D 4OMFB 3ZBDA 3X20B 4C92F 1QW1A 2RJFA 2PU9B 2ZPIB 2LQ8A 4DOVA 2HNIA 4C0GA 3CCRT 5LJ3e 2ZPBB 3DB4A 1QVGA 5LJ3j 5IT9E 2L8DA 4A4EA 1G3WA 2PVOB 4NL2A 1LJOA 4WF2A 3QPHA 3HSBA 5CK9A 4C92G 4E47A 1O9SA 1VUBA 1N8RC 4C92E 4BUGA 2MAMA 3QYHB 2KMTA 3VYGA 1VQ7T 4XAXB 1VIEA 2XU8A 2O4XA 3QHSA 1YI2A 3LW5E 4ZGJB 1Q7YC 1UGSB 4HCCA 5A0LA 2A7YA 4FT2A 4NOYA 1KC8U 3GLXA 4MMKA 4QQ6A 5CKHA 5GAN4 4Q5WA 3TEEA 1WJQA 2DTIA 3G6EA 3H6ZA 5FU7C 3JB9F 4EMKB 5KE3A 1JJ2S 3V8KA 5KCHA 3QBYA 1YJWT 3CCQT 2D0QB 3OYHA 4DQ2A 4M78D 5GAN2 1KHIA 5LJ5d 4E7LA 5GAN7 5GANf 4J83A 3C94A 1YJ9T 2E70A 4EMKA 2RK1A 3JCMf 2EJGA 4QVCA 5M9OA 4E7IA 3OYGA 4XTWA 2DEQA 5HKCA 4JRQA 4ME7A 1D3BB 1PSFA 1U8RA 2KDSA 3CD6T 4XTUA 4XU2A 1M9SA 3MCAB 4XTVA 5CAIA 5GAMd 1LNXA 3X28B 1H641 4C92C 3CC7A 1X6OA 4M77B 4C0ZA 1D3BA 1G3TA 3OYYA 4KT0E 4FT4A 1G3SA 4HCZA 2PUOB 3RKWA 5GAN6 3FLGA 4R56A 3KXTA 4HT9A 4M77A 2DZ9A 3H8ZA 3HKSA 3RERA 5GAN5 2DKGA 1YI2T 2XK0A 2EWNA 3OQ5A 5CO7A 2FYKA 2DXCA 4BY6C 1X01A 4X9CA 2C06A 3EFSA 2DIQA 5GMKe 2L3RA 3J7AF 1I81A 2QQSA 2YLCA 1HXDA 3MP6A 2FL7A 1IREB 5GMKj 3S3MA 1M8VA 2DXUA 2EJ9A 5CQYA 1KC8C 1P92A 2VYTA 2LNVA 5CIUA 1N27A 3CCUA 2MI6A 3G6ET 4M7DF 2DXTA 2WSFE 4HKEA 4C8QD 3LWHA 1KQ2A 1RI0A 2OTJT 1GXIE 3M9QA 4N0AC 4XTZA 2CZ6B 3ZEHA 1OI1A 2FHDA 2DZCA 4N4IA 2K57A 5FU6C 3JCMV 3HL8A 3OYEA 4EMGA 1SSFA 2QQ9A 4M7DG 2X35A 3CMAA 3GF5A 5EG2A 5CKEA 5J26A 1M5Q1 3SWNC 4FIBA 2LVMA 3VV0A 3LWIA 4M78B 5CKFA 5J3BA 4E7KA 3I55A 1VQ9A 2LC4A 2JZ2A 1FX7A 4PNOA 5LJ5e 4M7AG 2M0OA 3PNWC 4M7AE 4CRIA 5LJ5j 3L2QA 1VQOT 1DJ7B 5IAYA 2G3RA 1G3YA 4IUVA 2MWPA 3CCRA 4M78A 4VUBA 2DD4A 3CC7T 4LDVA 2AHJB 3QXEB 2E64A 2PQWA 3ZFJA 3GNFB 1WJSA 4FM4B 4OVAA 1QVPA 4XTXA 3MP8A 5GAMe 1NJIU 5AYFA 3JCMJ 2F5TX 3OSVA 2BIVA 3ASKA 3OSSC 4RG8A 3JSCA 5CKDA 5LJ3g 2E12A 2M16A 2YRVA 5A0GA 5GMKl 2DAQA 4OF1A 4E7HA 5DLQE 3FB9A 2RHZA 5C0MA 2H3JA 1MGQA 3RMSA 4C92D 5GAOq 3G4ST 3CXCS 3CCMT 1JJ2A 2QDYB 3A5ZB 2E6ZA 3P8HA 4L5GA 4F7UB 2RI3A 3V7RA 3OMGA 3V8LA 3RUXA 3JCMh 3NFCA 2HBPA 5I2MA 4HT8A 4RCBA 2O01E 4OB3B 4V2SA 4J5YA 1EIFA 1NPPA 4F7UA 4M75F 3CBMA 3C4SA 1OYXA 1OZ3A 2ZGWA 3G71A 3PIOA 1ZBXA 3CMEA 1JB0E 3Q1JA 2R58A 3CCQA 5GAOn 4M7AC 3L2VA 4LDXA 3CMAT 2VXFA 3A8GB 3M55A 5CVIA 4OGEA 4M75G 5A0DA 5HK0A 4M75E 4BD3A 4C8QA 3NTHA 3QJ6A 5GANd 3I55T 3MHXA 3CC2A 4L59A 2CZ1B 3QZ5B 3CD6A 2LX9A 3UWNA 2VGNA 2JTMA 4JDSA 3JB9D 1H3ZA 2GFUA 1VQMT 1BIAA 2JOYA 1U1SA 3OW2S 1I4K1 1VQ8A 1M1FA 3NTIA 4C0DC 1KHCA 1WPYA 4JRPA 1HK9A 1NJIC 2ZPFB 4DA4A 3P8DA 4O5VA 5FROA 3AHUA 5J39A 1VQKA 3P8BB 1I8FA 4QVDA 3PGGA 5CCAA 4L6V5 4RKUE 2KAFA 4X34A 2YHTA 4C5HA 3OS0A 1QP2A 3FC3A 3C12A 5CQXA 2KQWA 3OYJA 2CZ7B 4JLIA 2QA4A 4BB7A 1WNLA 4IUTA 3OYFA 1NZ9A 4C92B 2F69A 2V8KA 1BKBA 4LDYA 3FDRA 2DTOA 3INZA 4MZMA 2GQVA 3MEAA 4ZGEB 3PMTA 2P4TA 3L1AA 3G71T 3CMET 3RKXA 2DJZA 2OTJA 3JCMc 2DPPB 1S72T 4C92A 4M75C 2KSSA 3N5BB 2RM4A 2EQKA 2LDMA 2XKOC 2QQAA 5GMKi 2OTLA 3DB3A 3QUIA 2RHUA 2EJFA 2BKDN 3CPWA 4BY6B 3EFRA 2K4YA 3CC2T 1TH7A 2OAUA 1WGSA 2EAYA 3SFMA 3JCMX 3O8VA 1VIFA 4KUIA 4M7DD 1X75C 3BDLA 1VQOA 3M4GA 3VUBA 2D6FA 2EFIA 5GANe 3ME9A 2QXFA 3L2ZA 3LH0A 3I56A 2HD0A 2JVVA 3RESA 5LJ5g 4X9DA 4BACA 4E7JA 4XU1A 5GANj 3CXCA 1BIBA 5FU6B 3QZ9B 3UPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R57 A;  3LX7 A;  3QII A;  2LTO A;  2DO3 A;  1VQK T;  5FRM A;  3MET A;  1VQ8 A;  3CCM A;  3G4S A;  2F5K A;  2QA4 T;  3OYK A;  2JUF A;  1YJN T;  4N4G A;  2HQE A;  3LGL A;  4FU6 A;  2EQU A;  2WAC A;  2MWO A;  4Z02 A;  2EKO A;  5C6S A;  2XDP A;  2LCL A;  2OTL T;  5D6Y A;  1VQ6 A;  3L42 A;  4QVZ A;  4GY5 A;  1G5V A;  3I56 T;  1K8A U;  1VQM A;  3CPW S;  2RJD A;  4QW2 A;  1XTD A;  4TVR A;  4QQD A;  1VQL T;  3JAM E;  1VQ8 T;  3CC4 A;  3OYD A;  4IKF A;  1Q86 U;  4FL6 A;  1M90 U;  4YTL A;  3OS1 A;  3OYB A;  4ZN3 A;  2X4Y A;  3KUF A;  5FLX E;  1S72 A;  2D9T A;  4IUP A;  2M1H A;  5LL6 S;  2NLU A;  3QKJ A;  3EAE A;  4IUQ A;  4II1 A;  2EQM A;  5D6W A;  1VQ6 T;  2GFA A;  3DLL A;  3CCV A;  3PFS A;  1YBY A;  2E5Q A;  2LRQ A;  1K8A C;  2P0K A;  5FRN A;  3SD4 A;  4ZTJ A;  2RJC A;  3F70 A;  1NPR A;  1UEB A;  4C5G A;  1VQ5 A;  2RI5 A;  3OYN A;  1MHN A;  4QQG A;  3CC4 T;  4PLL A;  1KD1 U;  1M1K U;  3CCE A;  2X4X A;  1Q86 C;  1KQS A;  1YJN A;  3MEW A;  1M90 C;  3E9G A;  4BE1 A;  3L2W A;  1Q81 U;  4N4H A;  5D6X A;  4C5I A;  3OYI A;  5DM7 R;  1IZ6 A;  4C5E A;  2O4X B;  3S3N A;  1VQP A;  1VQ4 A;  3MEU A;  3LYI A;  2X4W A;  3UT1 A;  4LD6 A;  4IUU A;  3FEO A;  2CKK A;  3CCV T;  2RJE A;  1RL2 A;  2JTF A;  5A2Q E;  2QEX A;  5HY6 A;  4BE0 A;  1YIJ T;  1XNI A;  3CPF A;  4UC4 A;  1VQ5 T;  4NS5 A;  1YHQ A;  4B9W A;  1VQL A;  1VQN T;  2RHY A;  5KCO A;  3J81 E;  1K9M U;  2K3Y A;  1KD1 C;  5KE2 A;  1QVF S;  2IG0 A;  4IUR A;  3OYL A;  1YIT A;  3CCE T;  3L2R A;  1M1K C;  2RI2 A;  3OYM A;  4RG2 A;  3J80 E;  3OMC A;  3CCS A;  1Q81 C;  4ZTF A;  3ER0 A;  1VQP T;  3S3O A;  1VQ4 T;  2R5M A;  1KQS S;  5KH6 A;  2B8A A;  3OYC A;  3CCJ A;  1W2B A;  4A4F A;  1QVG S;  2EIF A;  3CCL A;  3S6W A;  2RHX A;  2HQX A;  4BDZ A;  3OA6 A;  2XHC A;  2QEX T;  3DLM A;  3TRE A;  3PIP A;  2K3X A;  2E6N A;  1K73 U;  1Q82 U;  1YHQ T;  4A4G A;  3PMI A;  2LCC A;  2RHI A;  3OYA A;  1K9M C;  4EDU A;  1YIT T;  2BUD A;  4B9X A;  2RO0 A;  3CCS T;  3MP1 A;  1N8R U;  3CEY A;  3MO8 A;  1WJR A;  3LGF A;  2DIG A;  2EQJ A;  3MEV A;  1VQ7 A;  3CCJ T;  3OY9 A;  1Q7Y U;  4PLI A;  3CCL T;  3OS2 A;  3CCU T;  3L2U A;  2JNG A;  3GOX A;  3E9F A;  4PL6 A;  1W2B S;  5IN1 A;  1QVF A;  1OZ2 A;  1YJW A;  1YIJ A;  3OB9 A;  4BE2 A;  3KBG A;  1K73 C;  2R5A A;  1Q82 C;  2KVQ G;  2GF7 A;  4ZN1 A;  1VQN A;  3LLR A;  1YJ9 A;  2L89 A;  4BDY A;  2QQR A;  1VQ9 T;  1M1G A;  3NTK A;  4A4H A;  3CCR T;  2RJF A;  2LQ8 A;  3DB4 A;  1QVG A;  5IT9 E;  2L8D A;  4A4E A;  1N8R C;  1VQ7 T;  1YI2 A;  2O4X A;  1Q7Y C;  1KC8 U;  4QQ6 A;  4Q5W A;  1WJQ A;  3G6E A;  3H6Z A;  5KE3 A;  1JJ2 S;  1YJW T;  5KCH A;  3QBY A;  3CCQ T;  3OYH A;  1KHI A;  4E7L A;  1YJ9 T;  2E70 A;  5M9O A;  4E7I A;  3OYG A;  3CD6 T;  2KDS A;  3CC7 A;  1X6O A;  3OYY A;  4HCZ A;  3FLG A;  3HKS A;  3H8Z A;  1YI2 T;  2XK0 A;  3OQ5 A;  3J7A F;  2DIQ A;  2L3R A;  3MP6 A;  2QQS A;  3S3M A;  1KC8 C;  3CCU A;  2VYT A;  5CIU A;  1N27 A;  2MI6 A;  3G6E T;  1RI0 A;  2OTJ T;  3M9Q A;  3ZEH A;  1OI1 A;  2FHD A;  4N4I A;  3OYE A;  1SSF A;  3CMA A;  2X35 A;  3OW2 A;  5J26 A;  2LVM A;  4E7K A;  5J3B A;  3I55 A;  1VQ9 A;  2JZ2 A;  2M0O A;  3PNW C;  4CRI A;  3L2Q A;  1VQO T;  5IAY A;  2G3R A;  4IUV A;  2MWP A;  3CCR A;  3CC7 T;  2PQW A;  1WJS A;  4OVA A;  3MP8 A;  1NJI U;  2BIV A;  3ASK A;  2M16 A;  2YRV A;  2DAQ A;  4E7H A;  5DLQ E;  3CXC S;  2RHZ A;  3CCM T;  5C0M A;  3G4S T;  1JJ2 A;  3A5Z B;  2E6Z A;  3P8H A;  2RI3 A;  3OMG A;  1EIF A;  1NPP A;  3C4S A;  3G71 A;  3CME A;  1OYX A;  1OZ3 A;  3PIO A;  3Q1J A;  2R58 A;  3CCQ A;  3L2V A;  3CMA T;  3CC2 A;  4BD3 A;  3I55 T;  3NTH A;  3QJ6 A;  4L59 A;  3CD6 A;  3UWN A;  1H3Z A;  1VQM T;  2GFU A;  2JOY A;  3OW2 S;  3NTI A;  1NJI C;  1KHC A;  3P8D A;  5FRO A;  5J39 A;  1VQK A;  3P8B B;  4X34 A;  4C5H A;  3OS0 A;  3FC3 A;  3OYJ A;  2QA4 A;  3OYF A;  4IUT A;  1NZ9 A;  1BKB A;  3FDR A;  3MEA A;  3PMT A;  3G71 T;  3CME T;  2OTJ A;  1S72 T;  2EQK A;  2LDM A;  2OTL A;  3DB3 A;  2RHU A;  3CPW A;  2BKD N;  3CC2 T;  1WGS A;  3O8V A;  1VQO A;  3BDL A;  2EFI A;  3ME9 A;  3LH0 A;  4E7J A;  3I56 A;  2JVV A;  4BAC A;  3CXC A; 
#chains in the Genus database with same CATH topology
 5I21 A;  3LX7 A;  2LTO A;  1YWP A;  1N5Z A;  1VQK T;  3SWN B;  2GBQ A;  3I5R A;  1KQ1 A;  3QYG B;  4DBF A;  2E5K A;  3G4S A;  1FMV A;  2QA4 T;  1YJN T;  4FU6 A;  2ZAE A;  1VYU A;  2COZ A;  4OB1 B;  3FJP A;  1UGR B;  2E1H A;  4ZGD B;  3RDV A;  4AG2 C;  4J6X A;  5D6Y A;  1LCK A;  4PJO E;  4BI8 B;  1VQ6 A;  2KRM A;  4QVZ A;  2DEU A;  2PZ1 A;  2DK3 A;  2F2W A;  2WSC E;  5IXB A;  1NBE B;  3BDU A;  5DY9 A;  4C0F A;  1RAC B;  2VC8 A;  3JB9 J;  1WHM A;  4M7D A;  4PK4 A;  2V1R A;  4RMO A;  2ESW A;  2ZPG B;  1Q86 U;  1B07 A;  1UGP B;  2NYS A;  2M02 A;  4AFQ C;  3OYB A;  4FSX A;  5FLX E;  1K76 A;  4PJO C;  2VUB A;  1KQS P;  2BZX A;  2JN0 A;  1GFD A;  2EQM A;  1VQ6 T;  1KFZ A;  3RIR A;  1K9A A;  1KK7 A;  3BW1 A;  4J9B A;  3CCV A;  2G6F X;  4MDW A;  3PFS A;  1YBY A;  2P0K A;  2LJ3 A;  4ZTJ A;  2LQK A;  2DTH A;  3HFN A;  1NE8 A;  4XU0 A;  1MMD A;  2F2X A;  1VQ5 A;  3GPL A;  1VYT A;  2QGF B;  4M75 A;  2CP3 A;  2DD5 A;  2VWF A;  2F2V A;  4O6J A;  1WHH A;  8ATC B;  1KQS A;  1SRL A;  1T0J A;  1M90 C;  1PM3 A;  5AT1 B;  2VXE A;  3A8L B;  5KYY B;  1AHJ B;  3PVQ A;  2CZ0 B;  2K5L A;  5KYW A;  3LYI A;  4QT7 A;  1SRM A;  1NM7 A;  5LJ5 h;  3A98 A;  4LD6 A;  4JRI A;  1SHF A;  2CKK A;  2L3P A;  2DYB A;  3CCV T;  4OMO A;  3EG2 A;  3EG9 A;  3VRZ A;  3JCM e;  1YJW Q;  2DRM A;  4KBM B;  5A2Q E;  1BI3 A;  5HY6 A;  1YN8 A;  2GNC A;  5GAO r;  1XNI A;  3CPF A;  1JU5 C;  1VQ5 T;  3RKY A;  4M77 G;  1EZZ B;  3VS0 A;  2K3Y A;  1KD1 C;  1QVF S;  2IG0 A;  3QJY A;  3SWN A;  1YIT A;  3L2R A;  2CS7 A;  2HSE B;  2RI2 A;  1M1K C;  3UA7 A;  3OYM A;  4HCK A;  1B34 B;  1AD5 A;  1WIE A;  1Q81 C;  5GAO p;  1WHG A;  3A8H B;  3QO3 A;  3REA B;  1F1B B;  1OUL A;  1N9R A;  1KIK A;  4AMC A;  4HCB A;  4GLK A;  3A8M B;  3H0F A;  3CCL A;  4BDZ A;  2W10 A;  2RK2 A;  2ZCF B;  3TRE A;  4PJO B;  3VUZ A;  2E6N A;  4J7I A;  1M3A A;  2RHI A;  4F7U F;  1FXX A;  5IHN A;  1K9M C;  1QVF P;  4EDU A;  1B3Q A;  3M58 A;  1YIT T;  4K11 A;  4B9X A;  1SSH A;  2CGH A;  2EKH A;  3EHQ A;  3X25 B;  3E19 A;  2DJQ A;  2O9S A;  3X26 B;  2DYI A;  2KYB A;  4JZ4 A;  1BYM A;  2DIG A;  1OEB A;  2EQJ A;  3LGF A;  1IO6 A;  1QWE A;  3OY9 A;  2XG8 D;  1V76 A;  1Y07 A;  2K79 A;  3CCL T;  1TUC A;  4DOW A;  1MV0 B;  3HHT B;  3I9Q A;  2FPD A;  3CCU T;  3L2U A;  7AT1 B;  3GOX A;  1WXT A;  4PL6 A;  1W2B S;  2RB6 A;  3GNG A;  5IN1 A;  1QVF A;  3JCM g;  1YJW A;  2HSP A;  4AFZ C;  1Q82 C;  1VQ9 Q;  3PTA A;  3LLR A;  1UG1 A;  1WXB A;  2HAX A;  2DVJ A;  3ULR B;  4A4H A;  4M77 D;  3ZBD A;  4C92 F;  2PU9 B;  1AWX A;  1JXO A;  2PVO B;  4NL2 A;  1LJO A;  4WF2 A;  4E7S A;  3QPH A;  5CK9 A;  1N8R C;  2MAM A;  2YRD A;  2JTE A;  3QHS A;  1CKA A;  3EG0 A;  1BU1 A;  3LW5 E;  4DEY A;  3GLX A;  5CKH A;  1RAF B;  4Q5W A;  3TEE A;  3LH5 A;  3H6Z A;  4IIM A;  1YJW T;  1CKB A;  2D0Q B;  4M78 D;  4OMQ A;  1M2V B;  1RLP C;  3C94 A;  2E70 A;  2RK1 A;  4XTW A;  1RAE B;  2KDS A;  1FMK A;  3X28 B;  4LUE A;  2D1X A;  1GCP A;  2F1L A;  5GAN 6;  2NUZ A;  1Q86 R;  3HKS A;  2DKG A;  1WZO A;  2EWN A;  5CO7 A;  2DXC A;  2C06 A;  1OPK A;  5GMK e;  2D0N A;  2P4R A;  1M8V A;  5CIU A;  4C8Q D;  4HKE A;  3LWH A;  2OTJ T;  2OTL Q;  1I0C A;  3OYE A;  4RTW A;  1M5Q 1;  1LPL A;  2W0Z A;  1VQ9 A;  4PNO A;  5LJ5 j;  1DJ7 B;  5IAY A;  1WI7 A;  2MWP A;  2FZC B;  2K7A A;  1AOJ A;  4LDV A;  2AHJ B;  3UAT A;  4XTX A;  3MP8 A;  2E4H A;  2BIV A;  4RG8 A;  3JSC A;  5CKD A;  1VQ8 Q;  3CCM Q;  5IH2 A;  2CUD A;  5GMK l;  2DAQ A;  4E7H A;  5DLQ E;  2QDY B;  3A5Z B;  2E6Z A;  2RI3 A;  3V7R A;  3OMG A;  3RUX A;  3NFC A;  1NPP A;  4M7D C;  3CBM A;  2ZGW A;  1ZBX A;  1D1B A;  3Q1J A;  3QDF A;  3M55 A;  2QTV A;  4F16 A;  4M75 E;  2VB6 A;  2NUP A;  1VQM Q;  4L59 A;  3KFV A;  2CZ1 B;  1B7T A;  3UWN A;  2JTM A;  3JB9 D;  2FZK B;  2JOY A;  2GQI A;  1U1S A;  3EGU A;  3OW2 S;  3EHR A;  4C0D C;  3P8D A;  5FRO A;  1NLO C;  4L6V 5;  4RKU E;  4X34 A;  3FC3 A;  3C12 A;  1PKS A;  2CZ7 B;  4JLI A;  1WNL A;  4IUT A;  4FYW B;  3CME Q;  2F69 A;  3FDR A;  3INZ A;  2GQV A;  4RTX A;  4ZGE B;  1M30 A;  3JCM c;  2CP5 A;  2QDL A;  4M75 C;  2EQK A;  2LDM A;  2QQA A;  1IHW A;  5GMK i;  2OTL A;  1W70 A;  2BKD N;  2KE9 A;  2DRK A;  3SFM A;  1VIF A;  1X75 C;  3BDL A;  2QAS A;  2X51 A;  5GAN e;  2AIR B;  3I35 A;  1HSQ A;  3UPU A;  2LCS A;  4CC2 A;  3NMZ C;  1TUD A;  4JJB A;  2RPN A;  4EPC A;  2E3I A;  3CCE Q;  3HRT A;  1JBM A;  1YCY A;  3E1S A;  1VQ8 A;  1YJN Q;  3CCM A;  4N4G A;  2QTX A;  5GAO m;  4A54 A;  1UHF A;  2EQU A;  2JT4 A;  4A4K A;  2WAC A;  2MWO A;  4Z02 A;  1OX9 A;  5FW9 A;  2K2M A;  3VYH B;  4EMK C;  4J9H A;  2CSQ A;  5C6S A;  2LCL A;  2OTL T;  5GMK m;  4PJO G;  3VS5 A;  2DIL A;  1MUZ A;  4BI3 A;  2AKK A;  3VJP A;  2QEX Q;  5CR2 A;  4ELY C;  1VQM A;  4M7D B;  1OX8 A;  1BBZ A;  1I07 A;  3QSU A;  2FVU A;  5GAM j;  1WHL A;  2AK5 A;  2WSE E;  2A08 A;  2Z0W A;  1PNJ A;  4X1V A;  4LD9 K;  1VQ8 T;  4AFU C;  4R55 A;  2CT3 A;  4IKF A;  1QQJ A;  4E6R A;  2I2L A;  1M90 U;  4YTL A;  1O75 A;  4PFP A;  4Z89 A;  4C0D B;  4ZN3 A;  3KUF A;  2HL3 A;  2JM9 A;  2YUQ A;  3QKJ A;  4Y28 E;  4IUQ A;  2MPX C;  4II1 A;  5IHI A;  1QVG P;  2HQH A;  3JCM d;  2GFA A;  1ZLM A;  4M4Z A;  2P0P A;  2FO0 A;  2AKL A;  1K0X A;  3SD4 A;  2KRN A;  2RJC A;  4M75 B;  5GAN g;  4LNP A;  4HXJ A;  3EG3 A;  2JMC A;  2RI5 A;  1MHN A;  4QQG A;  3H0I A;  3M53 A;  1HJD A;  1KD1 U;  2Y4X A;  1M1K U;  2CH4 W;  2X4X A;  3CCE A;  2L3Q A;  5L8R E;  2DER A;  1YJN A;  4BE1 A;  1JRI A;  5KYW B;  1Q81 U;  4N4H A;  2CDT A;  5DM7 R;  2ZPE B;  4C5E A;  2KI7 A;  3S3N A;  1VQ4 A;  2EGC A;  3M0T A;  3MEU A;  3R6O A;  2QQB A;  3EG9 B;  1VYV A;  3V7C A;  3URG A;  2X4W A;  3VS6 A;  4IUU A;  4PJO D;  2RJE A;  4XQ3 A;  2JTF A;  4M77 F;  1XQH A;  1ZHI A;  4M7A D;  2QEX A;  2EPD A;  3RNJ A;  1YIJ T;  3HRS A;  2DL5 A;  3VS1 A;  1VQN T;  2J6K A;  2RHY A;  2FG0 A;  1GBQ A;  3M4Y A;  1K9M U;  3HFO A;  1QWF A;  1AZE A;  4IUR A;  3CCE T;  2DVE A;  1D1C A;  2ED0 A;  2PUK B;  3S3O A;  1VQ4 T;  1GBR A;  2R5M A;  1R8O B;  1KQS S;  5KH6 A;  3OYC A;  4M78 F;  3CCJ A;  5GAN 8;  4J9C A;  4XTY A;  1XJW B;  2DBM A;  4XK8 E;  1BCM A;  2QEX T;  1WX6 A;  3CBO A;  3PIP A;  1QP3 A;  3HPW A;  3MJX A;  1V29 B;  1Q82 U;  1SF9 A;  2JW4 A;  2IIM A;  2O2O A;  1QLY A;  1YIT Q;  2FPE A;  2P84 A;  4KH0 B;  3OYA A;  2YXY A;  2QI2 A;  5KYX A;  2BUD A;  1X2Q A;  4A53 A;  1BCO A;  2V26 A;  2RQU A;  4J7F A;  1ZQ1 A;  3EGX A;  3M5A A;  2KK4 A;  4C8Q F;  3M0S A;  1N8R U;  3CEY A;  3O5Z A;  3CBP A;  3CCL Q;  3CCJ T;  3V7S A;  2ZPH B;  1ABO A;  3CCU Q;  4PLI A;  1AWW A;  4ATO A;  3IQL A;  3FJ5 A;  3D7S B;  1KG1 A;  3HTR A;  2EGA A;  3VU3 C;  1K73 C;  3I55 Q;  2L89 A;  4J6Y A;  1BI2 A;  3MPU B;  3QDR B;  1RAH B;  2FPF A;  4JPB W;  1QW1 A;  4C0G A;  5LJ3 e;  3DB4 A;  5IT9 E;  3HSB A;  1VUB A;  3QWY A;  1OV3 A;  1PCX A;  2RF0 A;  1Q7Y C;  1UGS B;  4QQ6 A;  4OMP A;  1WJQ A;  2DTI A;  4PJJ A;  5FU7 C;  3JB9 F;  5KE3 A;  3CCQ T;  3CC2 Q;  4DQ2 A;  5GAN f;  4J83 A;  4EMK A;  1ZSZ A;  3OYG A;  4FYV B;  4ME7 A;  4EIK A;  4KH1 B;  4XTV A;  3U23 A;  3CC7 A;  4C0Z A;  1D3B A;  2KNB B;  4KT0 E;  3UF4 A;  4HCZ A;  2PUO B;  3RKW A;  2HMA A;  1MNE A;  3OQ5 A;  2FYK A;  2DIQ A;  3MP6 A;  5GJV B;  3S3M A;  1HXD A;  2OTJ Q;  3EGD B;  5CQY A;  1KC8 C;  1P92 A;  3EH2 A;  2LNV A;  3CCU A;  1N27 A;  2YRC A;  4XTZ A;  2CZ6 B;  3ZEH A;  5FU6 C;  1ZSG A;  3M0R A;  4M7D G;  1PRM C;  2GTO A;  3GF5 A;  3A1P A;  2LNH B;  2LVM A;  1YCS B;  5CKF A;  3I55 A;  2JZ2 A;  1FX7 A;  3I56 Q;  3PNW C;  3L2Q A;  2G3R A;  1VOM A;  4VUB A;  3CC7 T;  1IB8 A;  1I5O B;  2YDL A;  2PQW A;  5GAM e;  3MKD A;  3JCM J;  4DBR A;  5LJ3 g;  2M51 A;  2HKN A;  1M1K R;  2YRV A;  2D8H A;  1YFN A;  2RHZ A;  5GAO q;  4L5G A;  2KXC A;  1D0X A;  2XMF A;  3JCM h;  1M3C A;  1Y57 A;  4RCB A;  4F7U A;  1OZ3 A;  2X9H A;  3PIO A;  2A36 A;  2NUP B;  4ORZ A;  3L2V A;  4LDX A;  2NWM A;  2VXF A;  3A8G B;  4OGE A;  4M75 G;  5GAN d;  4BD3 A;  3I55 T;  3NTH A;  3CC2 A;  3MHX A;  2B86 A;  2BTT A;  8AT1 B;  4LUD A;  1NEG A;  2LX9 A;  4LXC A;  2VGN A;  4JDS A;  4DBQ A;  3CPW P;  2FRY A;  1I4K 1;  1WPY A;  1NJI C;  1K9M R;  2ZPF B;  1HD3 A;  4O5V A;  3CC4 Q;  3AHU A;  1I8F A;  3PGG A;  1AT1 B;  1GL5 A;  2KQW A;  3OYJ A;  4BB7 A;  3OYF A;  1QCO A;  2V8K A;  1BB9 A;  4CC3 A;  2BZ8 A;  2P4T A;  3L1A A;  2HL5 C;  4DBH A;  2OTJ A;  2OAW A;  1S72 T;  4C92 A;  2KSS A;  3N5B B;  2XKO C;  1S1N A;  3DB3 A;  2RHU A;  3CPW A;  2K4Y A;  3CC2 T;  1TH7 A;  2PTK A;  2EAY A;  4PFZ A;  4M7D D;  3M4G A;  1Q82 R;  3LH0 A;  3H41 A;  3I56 A;  2HD0 A;  3RES A;  4E7J A;  5FU6 B;  3QZ9 B;  4PJN A;  1UTI A;  2LT4 A;  2QK0 A;  2DO3 A;  3REB B;  4N0A A;  5GAM g;  5FRM A;  3MET A;  1UJY A;  3TSW A;  2ROL A;  2CSI A;  3HP9 A;  2F5K A;  1BI1 A;  5KYU A;  3OYK A;  1ZA1 B;  2JUF A;  4D8D A;  1MV3 A;  1N8R R;  2X4J A;  3X24 B;  2OJ2 A;  3LGL A;  4JLG A;  4PJO F;  4KGZ B;  2DL7 A;  2LX7 A;  4M7A F;  3EGD A;  2EKO A;  1M2O A;  4FW2 A;  2XDP A;  3PT9 A;  1ZBJ A;  3C95 A;  3H9N A;  1E6H A;  2VGM A;  3L42 A;  1BI0 A;  1KJW A;  2EYZ A;  4HVU A;  4M75 D;  3I56 T;  2YT6 A;  4RTU A;  1RAI B;  4M78 E;  3TQ7 P;  3TCJ A;  4QW2 A;  4FYX B;  1R0C B;  4D8K A;  4JS4 A;  1VQL T;  2Y4Y A;  3JAM E;  3OYD A;  1PD0 A;  3CC4 A;  4ELZ C;  1RLQ C;  3BY7 A;  4FSS A;  3BFM A;  4FL6 A;  3CCS Q;  3JCM W;  2FRW A;  3OS5 A;  2J05 A;  3JV3 A;  3OS1 A;  1IGQ A;  4JZ3 A;  2X4Y A;  1X6B A;  2RQW A;  3FIF A;  3UDC A;  2X3W D;  2ZZD A;  2D9T A;  5LL6 S;  3QG1 A;  2XI9 A;  3EAE A;  1U1T A;  3SB2 A;  2KRS A;  3GP8 A;  2MCN A;  4M78 C;  4J9E A;  4C8Q E;  3DLL A;  1V1C A;  1Y96 A;  2L5Q A;  2E5Q A;  2LRQ A;  1K8A C;  1K4U S;  4P5N A;  3F70 A;  1NPR A;  4CC4 B;  3OYN A;  2AT1 B;  2DMO A;  3QWX X;  1M4Z A;  3CC4 T;  5LJ3 f;  4PLL A;  5GJW B;  1WHJ A;  5HK3 A;  5GMK h;  1NG2 A;  2EYQ A;  2YUP A;  3MEW A;  1N6A A;  1XOV A;  3L2W A;  5D6X A;  2RD1 A;  3OBW A;  2O4X B;  1VQ7 Q;  4C8Q C;  1SEM A;  3PE0 A;  2EYW A;  2DBK A;  1YIJ Q;  4R0K A;  4BE0 A;  1VQN Q;  4HA8 A;  1C1A A;  5KCO A;  4Z88 A;  2VV5 A;  3J81 E;  2EYY A;  2RQR A;  3OYL A;  3THK A;  1LOJ A;  1CSK A;  2H8H A;  3OMC A;  1N9S A;  1VQ4 Q;  3CCS A;  4ZTF A;  1U06 A;  9ATC B;  2YLB A;  1ZSZ C;  4GLM A;  2YSQ A;  2PVD B;  4A4F A;  1Y7X A;  1QVG S;  3C0C A;  1I5L A;  3S6W A;  2HQX A;  1G2B A;  3OA6 A;  4CI0 C;  4PJL A;  1AWJ A;  1ARK A;  4KUD K;  4PFO A;  1TSF A;  2XDD A;  4KGV B;  1FWZ A;  2K3X A;  2JM8 A;  1K73 U;  2JS0 A;  4A4G A;  3PMI A;  4A63 B;  5KYX B;  1H92 A;  1M27 C;  3M57 A;  2LCC A;  1NEB A;  1H8K A;  4RTY A;  1U5S A;  5LJ3 d;  5GAM f;  3EGX B;  2FEI A;  1FMW A;  2RO0 A;  2FB7 A;  5EC7 A;  2MF2 A;  2HEQ A;  3CCS T;  1D09 B;  4F7U E;  3CCJ Q;  1W4S A;  4RUG A;  2V8I A;  3ZL7 C;  1WJR A;  1VQ7 A;  4MDX A;  2K2V A;  4J6W A;  1Q7Y U;  3OS2 A;  5GAN h;  1M8M A;  1WQW A;  2JMA A;  3DKM A;  3JB9 I;  1OZ2 A;  4EMH A;  3CMA Q;  3OB9 A;  1OOT A;  4BE2 A;  3VRY A;  4C8Q B;  1YIJ A;  2M9U A;  2R5A A;  4JUV A;  1Y0M A;  2GF7 A;  2DL3 A;  2KVQ G;  4ZN1 A;  1VQN A;  2FZG B;  4AFS C;  2QQR A;  3NTK A;  2LQW A;  3CCR T;  1TTH B;  2ZPI B;  2LQ8 A;  4DOV A;  2HNI A;  1HYO A;  1QVG A;  2L8D A;  2HKQ B;  1G3W A;  4E47 A;  1O9S A;  4C92 E;  1R77 A;  1WLP B;  3QYH B;  4ANJ A;  2KMT A;  4F17 A;  4F14 A;  3RR6 A;  1VQ7 T;  4XAX B;  1VIE A;  1RAB B;  2O4X A;  2KBT A;  4ZGJ B;  4HCC A;  1QKW A;  5A0L A;  2A7Y A;  4NOY A;  1X2K A;  3G71 Q;  4MMK A;  1KC8 U;  2LMJ A;  1TS9 A;  2LQN A;  5GAN 4;  2C0O A;  3CCQ Q;  1ZUK A;  2L2P A;  4EMK B;  2O88 A;  4Z8A A;  3V8K A;  3QBY A;  4GBQ A;  1ZSZ B;  2RMO A;  4B6M A;  3OYH A;  5GAN 2;  1KHI A;  4E7L A;  4J9F A;  5M9O A;  2EJG A;  5KYN A;  4JRQ A;  2DEQ A;  1D3B B;  1PSF A;  3CD6 T;  3MCA B;  5CAI A;  5GAM d;  4C92 C;  1JEG A;  1G3T A;  3OYY A;  4FT4 A;  1G3S A;  3KXT A;  4HT9 A;  4M77 A;  3H8Z A;  1PKT A;  5GAN 5;  4BY6 C;  2ROT A;  3G1J A;  4KGX B;  2E3H A;  3EFS A;  3M0P A;  2L3R A;  3J7A F;  1I81 A;  2QQS A;  1H3H A;  5GMK j;  2FL7 A;  1IRE B;  2DXU A;  2EJ9 A;  4M7D F;  1SG5 A;  2MI6 A;  4ESR A;  2WSF E;  1GXI E;  1OPL A;  1R0B G;  3M9Q A;  4N0A C;  2FHD A;  2DZC A;  1FYN A;  2K57 A;  3JCM V;  3HL8 A;  2L3S A;  1SSF A;  1VA7 A;  3CMA A;  5J26 A;  3VV0 A;  4FIB A;  2QGG A;  2COW A;  2LC4 A;  5LJ5 e;  2M0O A;  3CC7 Q;  2DNU A;  4M7A E;  3RBB B;  1VQO T;  1G3Y A;  4IUV A;  4M78 A;  1YNZ A;  2DX1 A;  2E64 A;  4FM4 B;  1WJS A;  1KSW A;  4OVA A;  1NJI U;  2DL8 A;  4E7Z A;  2F5T X;  3OSV A;  2A0F B;  2JS2 A;  3CXC S;  5C0M A;  2H3J A;  1MGQ A;  3RMS A;  3G4S T;  4F7U B;  2CP7 A;  5I11 A;  4J9D A;  2HBP A;  4HT8 A;  2OX7 A;  3E2U A;  1EIF A;  1AVZ C;  4M75 F;  1OYX A;  1UJ0 A;  2HCK A;  3G71 A;  1JB0 E;  2NUT B;  3CCQ A;  2ED1 A;  2K6D A;  5GAO n;  4M7A C;  3CMA T;  5CVI A;  2KT1 A;  5A0D A;  5HK0 A;  4C8Q A;  4WTO B;  1TUG B;  1H3Z A;  2O9V A;  2PNI A;  1ZUU A;  3NGP A;  4JRP A;  1HK9 A;  2O31 A;  4DA4 A;  1NYG A;  5J39 A;  1RAD B;  2D8J A;  3CXC P;  4C5H A;  1QP2 A;  5CQX A;  1RAG B;  1T3S A;  4C92 B;  2QYZ A;  4LDY A;  2DTO A;  1S72 Q;  1GCQ A;  3MEA A;  2MOX A;  3PMT A;  3G71 T;  1EFN A;  3I5S A;  4RTV A;  2M0Y A;  1K1Z A;  2KGT A;  2SRC A;  2EJF A;  2CRE A;  4BY6 B;  1MMA A;  4J9G A;  3JCM X;  3O8V A;  2JXB A;  2D6F A;  1K73 R;  3ME9 A;  5ECA A;  5LJ5 g;  5GAN j;  1SHG A;  3CXC A;  1Z9Z A;  2R57 A;  2RA2 A;  2J6O A;  3QII A;  5KYU B;  2RH2 A;  3CQT A;  3RMQ A;  3EFO B;  1M90 R;  4OMN A;  4J8O A;  1RUW A;  2KR3 A;  2DLP A;  1GRI A;  4KUL A;  1QCF A;  1UB4 A;  1TWB A;  2HQE A;  1QMC A;  2DXB A;  2MIO A;  1VQP Q;  1Q7Y R;  2QG9 B;  2CUB A;  3M59 A;  3V8J A;  1UGQ B;  2V1Q A;  2EBP A;  1QKX A;  2LZ6 B;  2CYZ B;  4MML A;  4GY5 A;  1MMG A;  1PRL C;  4ZNX A;  1G5V A;  1K8A U;  2RNA A;  5LJ3 h;  3AT1 B;  4M78 G;  3CPW S;  2E10 A;  1YHQ Q;  1UE9 A;  4F04 B;  2RJD A;  1VQL Q;  1KD1 R;  4M7A B;  1XTD A;  1C6V X;  1A0N B;  4TVR A;  4XU3 A;  1BK2 A;  1ZX6 A;  3TVT A;  2OI3 A;  4JS5 A;  4QQD A;  2LP5 A;  1ABQ A;  4BI4 A;  3BE3 A;  1Q81 R;  2E65 A;  1JO8 A;  5FWC A;  2KT8 A;  2DM1 A;  3M56 A;  5GAN 3;  3HRU A;  4OP0 A;  1S72 A;  4IUP A;  4OB0 B;  2M1H A;  3JCM Q;  4JJN K;  2ABL A;  2NLU A;  2DF6 A;  2ECZ A;  1SPK A;  1KC8 R;  1Y96 B;  4Y92 A;  2Y90 A;  3OBY A;  2NUT A;  5D6W A;  1UGV A;  1WQ7 A;  4C8Q G;  1JXM A;  3WXM B;  2MMP A;  5FU7 B;  5FRN A;  3NPF A;  1AEY A;  4MZT A;  1T3L A;  1WHK A;  4PKC C;  1D1A A;  1X43 A;  1UEB A;  4C5G A;  2XIC A;  1G8X A;  3FRN A;  4J9I A;  1SKU B;  3GIB A;  1J3T A;  2XID A;  3EH1 A;  2EVR A;  1TOV A;  1Q86 C;  2V8J A;  3E9G A;  1U3O A;  4LDU A;  2CP2 A;  2E41 A;  4C5I A;  1WDX A;  3OYI A;  1IZ6 A;  2QAZ A;  2YUO A;  2DA9 A;  2PVG B;  1VQP A;  4KRT A;  3JCM b;  2GCX A;  4MZP A;  2KEA A;  1PSE A;  5KYY A;  3UT1 A;  3FEO A;  1X27 A;  1UDL A;  3UA6 A;  1RL2 A;  2EQI A;  5DLO A;  2K5I A;  3JCM P;  1IGU A;  5GAM h;  1W2B P;  4RCC A;  3G7Z A;  1YJ9 Q;  4UC4 A;  3A8O B;  4NS5 A;  4B9W A;  1YHQ A;  1VQL A;  2AZS A;  4M77 E;  3R6N A;  3JB9 G;  4FW1 A;  1E7O A;  2LJ1 A;  2DFU A;  5KE2 A;  1NJI R;  4JJD A;  1PG5 B;  3EFO A;  5FWB A;  4NL3 A;  4RG2 A;  2KY9 A;  3J80 E;  2IPO B;  5I22 A;  6AT1 B;  2A3L A;  3ER0 A;  4OGC A;  1VQP T;  1NLP C;  1X69 A;  1YI2 Q;  4FYY B;  1B34 A;  1IHV A;  2B8A A;  1C0M A;  1W2B A;  2EIF A;  4Y91 A;  3G6E Q;  2EYX A;  2RN8 A;  2RHX A;  2VAS A;  1EX4 A;  1WA7 A;  5I2S A;  1WFW A;  3TU4 K;  2XD0 A;  2XHC A;  2GTJ A;  3DLM A;  4M77 C;  2DET A;  1UHC A;  2C0T A;  1NYF A;  1ZA2 B;  5LJ5 f;  4WCI A;  1YHQ T;  4M7D E;  4PJO A;  2K3B A;  2COY A;  3VKI A;  2XDB A;  4M7A A;  2YWW A;  2IVW A;  1AWO A;  3VS4 A;  2LT1 A;  1LVK A;  1OU9 A;  2K5F A;  3JB9 H;  3SEM A;  5GAO l;  3M54 A;  1MND A;  4F7U G;  4E2F B;  3MP1 A;  1Y71 A;  2RQT A;  2K9G A;  3MO8 A;  4RTZ A;  2A28 A;  5CKB A;  3WVD B;  4AT1 B;  4LE9 A;  3MEV A;  4JJC A;  3SHW A;  4D6W A;  1MMN A;  2YUN A;  5HCK A;  1D0Z A;  3WVE B;  2KXD A;  2JNG A;  2BE7 D;  3E9F A;  2KRO A;  3JRZ A;  3KBG A;  2P0Q A;  1RI9 A;  4JRK A;  2MK5 A;  1YJ9 A;  4OB2 B;  2AZV A;  3CCR Q;  4BDY A;  1VQ9 T;  3H0H A;  3SDZ A;  4LDW A;  3T9N A;  1QCN A;  1M1G A;  2CT4 A;  1Q95 G;  4OMF B;  3X20 B;  2RJF A;  2ZPB B;  2MYS A;  5LJ3 j;  1K0S A;  1WYX A;  3M0U A;  4A4E A;  4C92 G;  2VVK A;  4BUG A;  3VYG A;  2DL4 A;  2XU8 A;  2SEM A;  1YI2 A;  4DEX A;  3NHN A;  2ENM A;  3GBQ A;  4FT2 A;  2A37 A;  1OQK A;  3G6E A;  2X3X D;  2EGE A;  1JJ2 S;  5KCH A;  5LJ5 d;  5GAN 7;  1K8A R;  1YJ9 T;  3CD6 Q;  4E7I A;  3JCM f;  4QVC A;  1M3B A;  5HKC A;  1GCQ C;  1U8R A;  4XTU A;  4XU2 A;  1M9S A;  1M2V A;  2HDA A;  1W1F A;  1IXD A;  1LNX A;  1H64 1;  1IRX A;  3OW2 P;  1X6O A;  4M77 B;  1VQK Q;  5IXF A;  3FLG A;  4R56 A;  5IHK A;  1Z9Q A;  2HBW A;  1G83 A;  2DZ9 A;  2GGR A;  2QA4 Q;  3RER A;  1YI2 T;  2XK0 A;  3VS7 A;  4CC7 A;  1X01 A;  4X9C A;  3M0Q A;  2YLC A;  5D7U A;  1RAA B;  1UEC A;  2VYT A;  3G6E T;  2DXT A;  1KQ2 A;  1RI0 A;  1JJ2 P;  1OI1 A;  4N4I A;  4EMG A;  1X6G A;  2QQ9 A;  2X35 A;  2I0N A;  5EG2 A;  3LWI A;  5CKE A;  3OW2 A;  3SWN C;  1VQO Q;  2JJ9 A;  4M78 B;  5J3B A;  4E7K A;  4M7A G;  1AZG B;  1W6X A;  4CRI A;  1UFF A;  3CCR A;  2DD4 A;  3QXE B;  1ZUY A;  3ZFJ A;  4HVV A;  5CCA A;  3GNF B;  4OML A;  1QVP A;  2VKN A;  5L23 A;  4IIO A;  5AYF A;  2J7I A;  1TXQ A;  3ASK A;  3OSS C;  2HZY A;  2E12 A;  2M16 A;  3G4S Q;  5A0G A;  1ACM B;  2CH4 A;  4OF1 A;  1PHT A;  3FB9 A;  3CCM T;  1JJ2 A;  4C92 D;  1D0Y A;  2L0A A;  3P8H A;  3V8L A;  3PVL A;  3VS3 A;  5I2M A;  1JQQ A;  1T0H A;  1TU0 B;  2O01 E;  4OB3 B;  4J5Y A;  4AG1 C;  4V2S A;  2BZY A;  2C0I A;  3C4S A;  3CME A;  1UUE A;  2CP0 A;  3VS2 A;  2R58 A;  2CP6 A;  1E6G A;  1YWO A;  1VQ6 Q;  1OU8 A;  4QKU A;  2ATC B;  2EW3 A;  3QJ6 A;  1GFC A;  3QZ5 B;  3CD6 A;  4OMM A;  2GFU A;  1VQM T;  1BIA A;  4HVW A;  1M1F A;  3NTI A;  2BE9 B;  1KHC A;  2J6F A;  1YP5 A;  2LJ0 A;  1VQK A;  3P8B B;  4QVD A;  2KAF A;  2YHT A;  3OS0 A;  2RQV A;  2QA4 A;  3EG1 A;  1NZ9 A;  1BKB A;  2KYM A;  4MZM A;  4PJM A;  1PD1 A;  1WXU A;  3CME T;  3RKX A;  2DJZ A;  2DPP B;  4LN2 A;  1I1J A;  2RM4 A;  4FCY A;  3QUI A;  1PWT A;  2DE0 X;  1TG0 A;  3EFR A;  3CCV Q;  2OAU A;  1WGS A;  4RTT A;  4KUI A;  1VQO A;  3VUB A;  1PC0 A;  2EFI A;  2H3E B;  2QXF A;  3L2Z A;  3TSZ A;  2JVV A;  4BAC A;  2J06 A;  4X9D A;  4XU1 A;  1VQ5 Q;  1BIB A; 
#chains in the Genus database with same CATH homology
 2R57 A;  2RA2 A;  5I21 A;  3LX7 A;  3QII A;  2LT4 A;  2LTO A;  2DO3 A;  4N0A A;  5GAM g;  2RH2 A;  3SWN B;  3MET A;  4EPC A;  1VQK T;  5FRM A;  3RMQ A;  3HRT A;  1JBM A;  1KQ1 A;  1YCY A;  3E1S A;  3HP9 A;  3QYG B;  4J8O A;  3G4S A;  2F5K A;  3CCM A;  1BI1 A;  4KUL A;  2QA4 T;  3OYK A;  2JUF A;  1YJN T;  4N4G A;  2QTX A;  2X4J A;  3X24 B;  1UB4 A;  2HQE A;  3LGL A;  4FU6 A;  4JLG A;  2DXB A;  5GAO m;  4A54 A;  4PJO F;  2EQU A;  4A4K A;  2WAC A;  2MWO A;  4Z02 A;  4M7A F;  4OB1 B;  3VYH B;  3FJP A;  4EMK C;  1UGR B;  2E1H A;  2EKO A;  5C6S A;  2LCL A;  2XDP A;  3PT9 A;  4ZGD B;  3M59 A;  3C95 A;  3V8J A;  5GMK m;  2OTL T;  4J6X A;  4PJO G;  5D6Y A;  4PJO E;  1UGQ B;  4BI8 B;  1VQ6 A;  2VGM A;  3L42 A;  4QVZ A;  4BI3 A;  3VJP A;  1BI0 A;  2CYZ B;  4MML A;  4GY5 A;  5CR2 A;  2DK3 A;  2WSC E;  4M75 D;  4ELY C;  3I56 T;  1K8A U;  1G5V A;  5LJ3 h;  1VQM A;  4M7D B;  3BDU A;  5DY9 A;  4M78 G;  4C0F A;  3CPW S;  2E10 A;  2VC8 A;  4M78 E;  3JB9 J;  3TCJ A;  2RJD A;  3QSU A;  2FVU A;  5GAM j;  4M7A B;  4QW2 A;  1XTD A;  4M7D A;  4TVR A;  4XU3 A;  2WSE E;  4JS5 A;  4QQD A;  4JS4 A;  1VQL T;  2Y4Y A;  3JAM E;  4RMO A;  4LD9 K;  1VQ8 T;  3OYD A;  3CC4 A;  4BI4 A;  4ELZ C;  3BY7 A;  4R55 A;  2ZPG B;  3BFM A;  4IKF A;  4FL6 A;  1Q86 U;  3JCM W;  2E65 A;  1UGP B;  2I2L A;  3OS5 A;  4YTL A;  1M90 U;  1O75 A;  3M56 A;  5GAN 3;  3OS1 A;  3OYB A;  4C0D B;  4FSX A;  4ZN3 A;  2X4Y A;  3KUF A;  3FIF A;  5FLX E;  3HRU A;  3UDC A;  4OP0 A;  2ZZD A;  4PJO C;  1S72 A;  2D9T A;  4IUP A;  4OB0 B;  2M1H A;  5LL6 S;  3QG1 A;  3JCM Q;  2NLU A;  4JJN K;  2VUB A;  2XI9 A;  3QKJ A;  2JN0 A;  1Y96 B;  1U1T A;  2Y90 A;  3EAE A;  4IUQ A;  4II1 A;  4Y28 E;  3OBY A;  2EQM A;  3SB2 A;  5D6W A;  3GP8 A;  1VQ6 T;  1WQ7 A;  4C8Q G;  2GFA A;  4M78 C;  3RIR A;  3JCM d;  4C8Q E;  3WXM B;  3DLL A;  2P0P A;  3BW1 A;  1Y96 A;  2L5Q A;  3CCV A;  4MDW A;  2MMP A;  3PFS A;  1YBY A;  2E5Q A;  2LRQ A;  2P0K A;  5FU7 B;  4MZT A;  3SD4 A;  1K8A C;  5FRN A;  4P5N A;  4ZTJ A;  2LQK A;  2DTH A;  3HFN A;  2RJC A;  1NE8 A;  3F70 A;  1NPR A;  4M75 B;  4PKC C;  5GAN g;  1UEB A;  4C5G A;  2XIC A;  4XU0 A;  1VQ5 A;  3GPL A;  3FRN A;  2RI5 A;  3OYN A;  3GIB A;  1MHN A;  4M75 A;  4QQG A;  2DD5 A;  1M4Z A;  3CC4 T;  2XID A;  3M53 A;  5LJ3 f;  4O6J A;  4PLL A;  1KD1 U;  5GMK h;  5HK3 A;  2Y4X A;  1M1K U;  2X4X A;  3CCE A;  2EYQ A;  5L8R E;  1Q86 C;  1KQS A;  1YJN A;  3MEW A;  1N6A A;  2V8J A;  3E9G A;  4LDU A;  1XOV A;  4BE1 A;  1M90 C;  1JRI A;  3L2W A;  2E41 A;  4C5I A;  4N4H A;  5D6X A;  1Q81 U;  3OYI A;  2RD1 A;  3OBW A;  5DM7 R;  1IZ6 A;  2VXE A;  2ZPE B;  3A8L B;  2O4X B;  4C5E A;  3OW2 A;  3S3N A;  2PVG B;  1VQP A;  1AHJ B;  2CZ0 B;  1VQ4 A;  2K5L A;  4C8Q C;  3JCM b;  1QVF A;  2GCX A;  3MEU A;  3R6O A;  2QQB A;  3LYI A;  4MZP A;  1PSE A;  3V7C A;  5LJ5 h;  3URG A;  2X4W A;  3UT1 A;  4LD6 A;  4JRI A;  4IUU A;  3FEO A;  2CKK A;  3CCV T;  4PJO D;  2RJE A;  1RL2 A;  3JCM e;  4XQ3 A;  2JTF A;  2K5I A;  4KBM B;  1XQH A;  4M77 F;  1ZHI A;  5DLO A;  5A2Q E;  4M7A D;  1BI3 A;  5GAM h;  2QEX A;  3JCM P;  4RCC A;  5HY6 A;  4BE0 A;  5GAO r;  1YIJ T;  1XNI A;  3CPF A;  3G7Z A;  4HA8 A;  4UC4 A;  1VQ5 T;  3HRS A;  3A8O B;  4NS5 A;  4B9W A;  1YHQ A;  3RKY A;  4M77 G;  1VQL A;  1VQN T;  2RHY A;  5KCO A;  4M77 E;  2VV5 A;  3JB9 G;  3J81 E;  3M4Y A;  1K9M U;  2K3Y A;  3HFO A;  1KD1 C;  4M7D C;  5KE2 A;  1QVF S;  2IG0 A;  4IUR A;  3QJY A;  3SWN A;  1LOJ A;  3OYL A;  2CS7 A;  2RI2 A;  3L2R A;  1YIT A;  1M1K C;  3CCE T;  2DVE A;  4NL3 A;  3OYM A;  4RG2 A;  2KY9 A;  3J80 E;  3OMC A;  1N9S A;  1B34 B;  3CCS A;  5GAO p;  3A8H B;  4ZTF A;  1Q81 C;  2A3L A;  3ER0 A;  2PUK B;  3QO3 A;  4OGC A;  1VQP T;  2YLB A;  1N9R A;  3S3O A;  1VQ4 T;  2R5M A;  1R8O B;  1B34 A;  1KQS S;  5KH6 A;  2B8A A;  4HCB A;  4GLK A;  3OYC A;  4M78 F;  2PVD B;  3CCJ A;  3A8M B;  4A4F A;  1W2B A;  1Y7X A;  1QVG S;  2EIF A;  1I5L A;  5GAN 8;  4Y91 A;  4XTY A;  3S6W A;  3CCL A;  2RHX A;  4XK8 E;  2HQX A;  4BDZ A;  2RK2 A;  5I2S A;  3OA6 A;  4CI0 C;  3TU4 K;  2XD0 A;  2XHC A;  2QEX T;  3DLM A;  4KUD K;  2ZCF B;  3CBO A;  3TRE A;  4PJO B;  3VUZ A;  4M77 C;  2XDD A;  1FWZ A;  3PIP A;  1QP3 A;  2E6N A;  2K3X A;  3HPW A;  1K73 U;  5LJ5 f;  1V29 B;  1Q82 U;  4J7I A;  1YHQ T;  4A4G A;  3PMI A;  4M7D E;  4PJO A;  3M57 A;  3VKI A;  2LCC A;  2XDB A;  2RHI A;  3OYA A;  4M7A A;  4F7U F;  1FXX A;  2IVW A;  2QI2 A;  1K9M C;  5GAM f;  5LJ3 d;  4EDU A;  3M58 A;  1YIT T;  2LT1 A;  2BUD A;  4B9X A;  2K5F A;  2RO0 A;  3JB9 H;  2FB7 A;  4A53 A;  2CGH A;  5GAO l;  3M54 A;  4J7F A;  2MF2 A;  3CCS T;  4F7U G;  1ZQ1 A;  3X25 B;  3M5A A;  4F7U E;  2KK4 A;  3MP1 A;  4C8Q F;  3E19 A;  1Y71 A;  1N8R U;  3CEY A;  1W4S A;  3MO8 A;  2V8I A;  3X26 B;  3CBP A;  1WJR A;  5CKB A;  1BYM A;  3WVD B;  2DIG A;  2EQJ A;  3LGF A;  3MEV A;  1VQ7 A;  4MDX A;  3OY9 A;  3CCJ T;  2K2V A;  3V7S A;  2XG8 D;  2ZPH B;  4J6W A;  4D6W A;  1Y07 A;  1Q7Y U;  4PLI A;  3CCL T;  3OS2 A;  4DOW A;  4ATO A;  3WVE B;  5GAN h;  3HHT B;  3CCU T;  3L2U A;  1KG1 A;  1WQW A;  3DKM A;  2JNG A;  3GOX A;  3E9F A;  4PL6 A;  1W2B S;  2RB6 A;  3GNG A;  3JB9 I;  5IN1 A;  1OZ2 A;  3JRZ A;  3VU3 C;  4EMH A;  3OB9 A;  3JCM g;  4BE2 A;  4C8Q B;  1YIJ A;  1YJW A;  3KBG A;  2M9U A;  1K73 C;  2R5A A;  4JUV A;  1Q82 C;  2P0Q A;  4JRK A;  2GF7 A;  2KVQ G;  4ZN1 A;  3PTA A;  3LLR A;  1VQN A;  1YJ9 A;  4OB2 B;  2L89 A;  4BDY A;  2QQR A;  1VQ9 T;  4J6Y A;  3SDZ A;  2HAX A;  4LDW A;  3T9N A;  1BI2 A;  1M1G A;  3QDR B;  3NTK A;  4A4H A;  4M77 D;  4OMF B;  3ZBD A;  3X20 B;  4C92 F;  1QW1 A;  2RJF A;  2PU9 B;  2ZPI B;  2LQ8 A;  4DOV A;  2HNI A;  4C0G A;  3CCR T;  5LJ3 e;  2ZPB B;  3DB4 A;  1QVG A;  5LJ3 j;  5IT9 E;  2L8D A;  4A4E A;  1G3W A;  2PVO B;  4NL2 A;  1LJO A;  4WF2 A;  3QPH A;  3HSB A;  5CK9 A;  4C92 G;  4E47 A;  1O9S A;  1VUB A;  1N8R C;  4C92 E;  4BUG A;  2MAM A;  3QYH B;  2KMT A;  3VYG A;  1VQ7 T;  4XAX B;  1VIE A;  2XU8 A;  2O4X A;  3QHS A;  1YI2 A;  3LW5 E;  4ZGJ B;  1Q7Y C;  1UGS B;  4HCC A;  5A0L A;  2A7Y A;  4FT2 A;  4NOY A;  1KC8 U;  3GLX A;  4MMK A;  4QQ6 A;  5CKH A;  5GAN 4;  4Q5W A;  3TEE A;  1WJQ A;  2DTI A;  3G6E A;  3H6Z A;  5FU7 C;  3JB9 F;  4EMK B;  5KE3 A;  1JJ2 S;  3V8K A;  5KCH A;  3QBY A;  1YJW T;  3CCQ T;  2D0Q B;  3OYH A;  4DQ2 A;  4M78 D;  5GAN 2;  1KHI A;  5LJ5 d;  4E7L A;  5GAN 7;  5GAN f;  4J83 A;  3C94 A;  1YJ9 T;  2E70 A;  4EMK A;  2RK1 A;  3JCM f;  2EJG A;  4QVC A;  5M9O A;  4E7I A;  3OYG A;  4XTW A;  2DEQ A;  5HKC A;  4JRQ A;  4ME7 A;  1D3B B;  1PSF A;  1U8R A;  2KDS A;  3CD6 T;  4XTU A;  4XU2 A;  1M9S A;  3MCA B;  4XTV A;  5CAI A;  5GAM d;  1LNX A;  3X28 B;  1H64 1;  4C92 C;  3CC7 A;  1X6O A;  4M77 B;  4C0Z A;  1D3B A;  1G3T A;  3OYY A;  4KT0 E;  4FT4 A;  1G3S A;  4HCZ A;  2PUO B;  3RKW A;  5GAN 6;  3FLG A;  4R56 A;  3KXT A;  4HT9 A;  4M77 A;  2DZ9 A;  3H8Z A;  3HKS A;  3RER A;  5GAN 5;  2DKG A;  1YI2 T;  2XK0 A;  2EWN A;  3OQ5 A;  5CO7 A;  2FYK A;  2DXC A;  4BY6 C;  1X01 A;  4X9C A;  2C06 A;  3EFS A;  2DIQ A;  5GMK e;  2L3R A;  3J7A F;  1I81 A;  2QQS A;  2YLC A;  1HXD A;  3MP6 A;  2FL7 A;  1IRE B;  5GMK j;  3S3M A;  1M8V A;  2DXU A;  2EJ9 A;  5CQY A;  1KC8 C;  1P92 A;  2VYT A;  2LNV A;  5CIU A;  1N27 A;  3CCU A;  2MI6 A;  3G6E T;  4M7D F;  2DXT A;  2WSF E;  4HKE A;  4C8Q D;  3LWH A;  1KQ2 A;  1RI0 A;  2OTJ T;  1GXI E;  3M9Q A;  4N0A C;  4XTZ A;  2CZ6 B;  3ZEH A;  1OI1 A;  2FHD A;  2DZC A;  4N4I A;  2K57 A;  5FU6 C;  3JCM V;  3HL8 A;  3OYE A;  4EMG A;  1SSF A;  2QQ9 A;  4M7D G;  2X35 A;  3CMA A;  3GF5 A;  5EG2 A;  5CKE A;  5J26 A;  1M5Q 1;  3SWN C;  4FIB A;  2LVM A;  3VV0 A;  3LWI A;  4M78 B;  5CKF A;  5J3B A;  4E7K A;  3I55 A;  1VQ9 A;  2LC4 A;  2JZ2 A;  1FX7 A;  4PNO A;  5LJ5 e;  4M7A G;  2M0O A;  3PNW C;  4M7A E;  4CRI A;  5LJ5 j;  3L2Q A;  1VQO T;  1DJ7 B;  5IAY A;  2G3R A;  1G3Y A;  4IUV A;  2MWP A;  3CCR A;  4M78 A;  4VUB A;  2DD4 A;  3CC7 T;  4LDV A;  2AHJ B;  3QXE B;  2E64 A;  2PQW A;  3ZFJ A;  3GNF B;  1WJS A;  4FM4 B;  4OVA A;  1QVP A;  4XTX A;  3MP8 A;  5GAM e;  1NJI U;  5AYF A;  3JCM J;  2F5T X;  3OSV A;  2BIV A;  3ASK A;  3OSS C;  4RG8 A;  3JSC A;  5CKD A;  5LJ3 g;  2E12 A;  2M16 A;  2YRV A;  5A0G A;  5GMK l;  2DAQ A;  4OF1 A;  4E7H A;  5DLQ E;  3FB9 A;  2RHZ A;  5C0M A;  2H3J A;  1MGQ A;  3RMS A;  4C92 D;  5GAO q;  3G4S T;  3CXC S;  3CCM T;  1JJ2 A;  2QDY B;  3A5Z B;  2E6Z A;  3P8H A;  4L5G A;  4F7U B;  2RI3 A;  3V7R A;  3OMG A;  3V8L A;  3RUX A;  3JCM h;  3NFC A;  2HBP A;  5I2M A;  4HT8 A;  4RCB A;  2O01 E;  4OB3 B;  4V2S A;  4J5Y A;  1EIF A;  1NPP A;  4F7U A;  4M75 F;  3CBM A;  3C4S A;  1OYX A;  1OZ3 A;  2ZGW A;  3G71 A;  3PIO A;  1ZBX A;  3CME A;  1JB0 E;  3Q1J A;  2R58 A;  3CCQ A;  5GAO n;  4M7A C;  3L2V A;  4LDX A;  3CMA T;  2VXF A;  3A8G B;  3M55 A;  5CVI A;  4OGE A;  4M75 G;  5A0D A;  5HK0 A;  4M75 E;  4BD3 A;  4C8Q A;  3NTH A;  3QJ6 A;  5GAN d;  3I55 T;  3MHX A;  3CC2 A;  4L59 A;  2CZ1 B;  3QZ5 B;  3CD6 A;  2LX9 A;  3UWN A;  2VGN A;  2JTM A;  4JDS A;  3JB9 D;  1H3Z A;  2GFU A;  1VQM T;  1BIA A;  2JOY A;  1U1S A;  3OW2 S;  1I4K 1;  1VQ8 A;  1M1F A;  3NTI A;  4C0D C;  1KHC A;  1WPY A;  4JRP A;  1HK9 A;  1NJI C;  2ZPF B;  4DA4 A;  3P8D A;  4O5V A;  5FRO A;  3AHU A;  5J39 A;  1VQK A;  3P8B B;  1I8F A;  4QVD A;  3PGG A;  5CCA A;  4L6V 5;  4RKU E;  2KAF A;  4X34 A;  2YHT A;  4C5H A;  3OS0 A;  1QP2 A;  3FC3 A;  3C12 A;  5CQX A;  2KQW A;  3OYJ A;  2CZ7 B;  4JLI A;  2QA4 A;  4BB7 A;  1WNL A;  4IUT A;  3OYF A;  1NZ9 A;  4C92 B;  2F69 A;  2V8K A;  1BKB A;  4LDY A;  3FDR A;  2DTO A;  3INZ A;  4MZM A;  2GQV A;  3MEA A;  4ZGE B;  3PMT A;  2P4T A;  3L1A A;  3G71 T;  3CME T;  3RKX A;  2DJZ A;  2OTJ A;  3JCM c;  2DPP B;  1S72 T;  4C92 A;  4M75 C;  2KSS A;  3N5B B;  2RM4 A;  2EQK A;  2LDM A;  2XKO C;  2QQA A;  5GMK i;  2OTL A;  3DB3 A;  3QUI A;  2RHU A;  2EJF A;  2BKD N;  3CPW A;  4BY6 B;  3EFR A;  2K4Y A;  3CC2 T;  1TH7 A;  2OAU A;  1WGS A;  2EAY A;  3SFM A;  3JCM X;  3O8V A;  1VIF A;  4KUI A;  4M7D D;  1X75 C;  3BDL A;  1VQO A;  3M4G A;  3VUB A;  2D6F A;  2EFI A;  5GAN e;  3ME9 A;  2QXF A;  3L2Z A;  3LH0 A;  3I56 A;  2HD0 A;  2JVV A;  3RES A;  5LJ5 g;  4X9D A;  4BAC A;  4E7J A;  4XU1 A;  5GAN j;  3CXC A;  1BIB A;  5FU6 B;  3QZ9 B;  3UPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...