2IG0A

Structure of 53bp1/methylated histone peptide complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Methylation State-Specific Recognition of Histone H4-K20 by 53BP1 and Crb2 in DNA Repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Tumor suppressor p53-binding protein 1
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ig0A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ig0A01
2P0KA 2RI5A 1YJNT 5C0MA 1W2BS 2E6ZA 1QVFS 3E9FA 4QQ6A 5LL6S 2RI2A 3QKJA 2L8DA 3PFSA 2B8AA 2M16A 2LQ8A 1VQNT 2RHXA 2R57A 2LCCA 2EKOA 1NJIU 2R5MA 3CPWS 3OS2A 4Z02A 1YJ9T 4IURA 3OYCA 4RG2A 3CCJT 1QVGA 3FLGA 1SSFA 2KDSA 1Q7YU 3LGLA 3LYIA 3OYBA 3MP6A 4BE2A 2RJFA 3CMAA 3KUFA 1Q82C 4QVZA 2L3RA 2YRVA 3OW2S 3CCET 2JVVA 2M1HA 3CD6A 3PIPA 4BDZA 1YHQA 3NTIA 4A4FA 1KC8C 5KH6A 5J39A 3CCJA 1KD1C 3OYJA 3OYFA 1UEBA 3CCST 2HQXA 2O4XA 1JJ2S 4TVRA 1VQOA 3CD6T 1YBYA 2BUDA 1OYXA 4BD3A 3OB9A 4YTLA 2GF7A 1Q81C 4N4IA 3CC2A 1YITA 3PNWC 3OYIA 2QQSA 3NTKA 4C5EA 3L2QA 3OYKA 5KE3A 3G6EA 1KQSA 1KHIA 3DB4A 2JUFA 4IUVA 3CCRT 3CCVT 3CPFA 4OVAA 3I56A 5FLXE 3CCEA 1M1KC 1QVFA 4ZTFA 2EQJA 5DM7R 5IT9E 1VQ9A 4PLIA 3OYAA 3J7AF 2DO3A 3M9QA 3S3MA 4PL6A 2E70A 1YJNA 1MHNA 4IUTA 3QJ6A 1KQSS 2X4WA 3CCUT 4C5GA 3I55A 1WGSA 3CC4A 1X6OA 4C5IA 2OTLA 4N4HA 3HKSA 5DLQE 2FHDA 1YIJT 3ER0A 4LD6A 1VQNA 2GFUA 1Q86C 2QEXA 3ME9A 3L42A 3PIOA 4X34A 4IUUA 3KBGA 1RI0A 1WJQA 3P8DA 3S6WA 4A4GA 1VQ8T 2D9TA 1Q81U 1VQPT 2OTLT 1YJWA 2RHZA 1YJWT 2RJDA 3OYYA 3CCLA 1K73U 1VQ5A 3OMCA 2QEXT 1WJSA 3I56T 2R58A 3S3NA 1KC8U 3OQ5A 3OYNA 3QBYA 4E7LA 5D6XA 2BKDN 2R5AA 2RHYA 1Q82U 3CCRA 3CCVA 1VQPA 2EQUA 4EDUA 2G3RA 1YI2T 2E5QA 3G4ST 1VQ6A 5KCOA 2RO0A 3FDRA 1N27A 3PMTA 4A4HA 1Q7YC 3CCUA 2GFAA 4IUQA 2LVMA 1VQ4A 4B9XA 3OYLA 3DB3A 5HY6A 2PQWA 4CRIA 3SD4A 1OZ2A 2E6NA 3P8HA 5M9OA 1VQ5T 3F70A 2DIGA 3META 4QQGA 1VQMT 2M0OA 3G71T 1K9MC 3L2RA 3CC4T 1K8AU 3E9GA 5FRMA 3NTHA 2JTFA 1VQLT 3OW2A 4E7JA 4ZN3A 3MEVA 2K3XA 3MEWA 3J81E 3L2WA 3CCQT 3FEOA 3I55T 1S72T 1YJ9A 2NLUA 3G71A 3P8BB 1YITT 1M1KU 2LRQA 1OI1A 2XHCA 3OMGA 4PLLA 2RHUA 1YI2A 2LTOA 1QVGS 5KE2A 1KHCA 2XK0A 2DAQA 4FU6A 3UWNA 5C6SA 1M90U 2RI3A 4A4EA 4E7IA 3H6ZA 4L59A 3QIIA 3J80E 1KD1U 4QW2A 3CEYA 2DIQA 1N8RC 1VQ4T 3OYMA 3CCSA 1NZ9A 4UC4A 3DLMA 4E7KA 1VQMA 1K73C 3MEAA 3CC2T 1JJ2A 2OTJT 3ZEHA 4FL6A 3CCQA 1VQ7T 3CMEA 1VQ9T 1WJRA 4BACA 1VQKT 4IUPA 4BDYA 4ZTJA 3UT1A 3CC7T 3CXCS 2LCLA 3S3OA 1XNIA 3PMIA 3OYGA 2QA4T 3H8ZA 1VQOT 3A5ZB 1M1GA 1Q86U 1EIFA 3MP1A 1S72A 1XTDA 5A2QE 3CPWA 4II1A 3ASKA 3CCMT 2IG0A 3L2VA 5J3BA 1BKBA 3CMET 3OYDA 4E7HA 4GY5A 2WACA 3OA6A 3DLLA 3L2UA 5D6YA 3OS1A 1RL2A 2EFIA 1K8AC 2QA4A 5KCHA 4Q5WA 4HCZA 1K9MU 2RJCA 2F5KA 3GOXA 3O8VA 3MP8A 3CCMA 4IKFA 3MEUA 2OTJA 2MI6A 3LX7A 2L89A 3C4SA 5FRNA 3G6ET 2JOYA 2O4XB 3CC7A 4BE1A 3OS0A 3OYHA 1G5VA 2MWOA 1IZ6A 5D6WA 3CMAT 4ZN1A 3EAEA 1W2BA 3LLRA 3CCLT 3LGFA 2BIVA 4NS5A 4BE0A 3Q1JA 2JNGA 1N8RU 5FROA 2X4XA 2XDPA 4B9WA 2LDMA 1NPPA 2QQRA 2RJEA 3FC3A 2X35A 5IN1A 4C5HA 2MWPA 3OY9A 1VQ7A 2HQEA 1M90C 3LH0A 1YIJA 1YHQT 4QQDA 1VQLA 3BDLA 2VYTA 2CKKA 3CXCA 5IAYA 2K3YA 3OYEA 2KVQG 2X4YA 1NJIC 3G4SA 1VQ6T 1NPRA 5CIUA 3MO8A 3JAME 4N4GA 2RHIA 1H3ZA 1VQ8A 2EQKA 5J26A 3TREA 1VQKA 2JZ2A 1OZ3A 2EQMA 2EIFA
chains in the Genus database with same CATH superfamily
2EGCA 1GL5A 2RI5A 5C0MA 3INZA 4D8DA 3JCMP 2ZAEA 1QVFS 4QQ6A 5LJ5h 1X43A 1ZSZC 1UGVA 1N6AA 3QKJA 1OOTA 1W70A 4J7FA 1X01A 2L8DA 2QQ9A 1D09B 3CBMA 2QQBA 4LD9K 1JXOA 2KXCA 2P84A 2R57A 4V2SA 2O88A 4O6JA 3G4SQ 3VV0A 4OMOA 4M78A 2R5MA 4AFUC 1R77A 1YJ9T 2XD0A 3MJXA 4PJOF 1HYOA 4OMQA 3JCMX 1E6GA 2P4RA 2X4JA 1SSFA 4J9CA 4OMLA 2WSFE 2PUOB 1Y7XA 2K5LA 2RMOA 3HTRA 2E3HA 1QKWA 3OYBA 1YJNQ 3VS2A 4OGEA 2KYMA 1UHFA 2KRSA 4MDXA 1UHCA 3CCRQ 1Q82C 1FXXA 2V8KA 5CQYA 3M5AA 1K0XA 2CP3A 3PIPA 2IVWA 1C0MA 2IPOB 4BDZA 1YHQA 3PVLA 5KH6A 1KC8C 1Q7YR 1KD1C 4DOWA 1K8AR 3CCST 2O4XA 2A37A 4KH1B 2YLBA 1JJ2S 4XQ3A 1VQOA 3JCMW 1OYXA 4PFZA 5AYFA 3VS1A 5FU7B 5LJ3d 2V1QA 3QSUA 2KEAA 3NTKA 1M1KR 5GAN6 3OYKA 3UA7A 2HCKA 5KE3A 4FT4A 3JB9J 1U8RA 4M7AG 2DL7A 2J6KA 4RTUA 1WPYA 3QDRB 1T3SA 4XU3A 1V76A 3CCVT 4J5YA 3CPFA 3CCLQ 5FLXE 3EG9A 4ZTFA 5GMKh 2EQJA 2DEQA 4F17A 4F7UA 3M9QA 4FW2A 2D0NA 1SHFA 1IGUA 1WQ7A 2DD5A 2VV5A 2X4WA 4QT7A 1X27A 3CCUT 1PNJA 2CP6A 2QDYB 3I55A 1WHMA 5CKHA 2DILA 4M7AF 2DBKA 5DLQE 1VQ4Q 1LVKA 2DYIA 4RTVA 2FHDA 4PJOA 2DRKA 2DMOA 3UA6A 2GQVA 3RIRA 1KIKA 4M77B 3VRYA 5CK9A 2ZCFB 3JCMh 2QEXA 3VKIA 1M9SA 3BDUA 3BFMA 3FJPA 1Z9QA 1X2QA 1QVGP 1PSEA 1BYMA 1RI0A 3HHTB 1UECA 1VQ8T 2D9TA 1ZSZA 1E7OA 1YJWT 1Y57A 4FCYA 1M2OA 3CCLA 3SEMA 2VASA 2AHJB 2CS7A 3M0SA 1G8XA 2NUTA 4XTZA 3OMCA 1BI2A 1WJSA 2R58A 3S3NA 3REBB 4E7LA 5A0LA 1ZA1B 2CUDA 1TTHB 3EFRA 4HXJA 2R5AA 5D7UA 2RHYA 4XTVA 1Q82U 4M75F 3CCVA 2EQUA 4J9FA 4M7DA 2E5QA 2DL8A 3G4ST 5KCOA 3HRUA 5CCAA 1QW1A 1Q7YC 1RUWA 1XQHA 1KD1R 4IUQA 2KAFA 2BZXA 1KG1A 3DB3A 5HY6A 2PQWA 1IHVA 4D8KA 2E6NA 3P8HA 4MZMA 2P4TA 1OX8A 2DIGA 1UTIA 4AFZC 1VQMT 3N5BB 5LJ3f 1FWZA 1SF9A 2ZGWA 2EPDA 3CCEQ 3NTHA 4EPCA 2JTFA 2QGFB 2ROTA 4EMGA 2KROA 4MMKA 2VGMA 1WA7A 1MMGA 5GAN5 1AD5A 1X75C 3JCMg 2D6FA 1KQ2A 2PU9B 3E1SA 4EMKC 2QTXA 3J81E 3L2WA 2YLCA 1QKXA 2K2MA 5LJ5e 2KK4A 2E4HA 1BU1A 2QASA 1K4US 1YI2A 2ECZA 2GBQA 1FX7A 5KE2A 1I8FA 3GNFB 2XK0A 3JCMJ 1YCYA 5C6SA 3L2ZA 3EG0A 3CQTA 4M7DB 3AHUA 4E7IA 4PNOA 1JRIA 3VS6A 1KD1U 3I9QA 2DIQA 2NUTB 3OYMA 5KYWB 1I0CA 2RQVA 1NZ9A 1OPKA 2X9HA 9ATCB 2Y90A 3I35A 1K73C 2HSEB 4DBFA 3ZEHA 5GAOm 3CCQA 3CMEA 1NJIR 1HJDA 3JCMc 1VQ8Q 1V29B 3CXCS 2EYQA 3S3OA 1ACMB 2C0IA 1RABB 4A63B 3H8ZA 2LQNA 2VVKA 3A5ZB 3H0HA 1YJ9Q 1S72A 2DL4A 4PJJA 4X1VA 1AWXA 2QTVA 2KT1A 3CPWA 2ZPIB 1Q95G 2FPEA 5GAMh 3X24B 4AFQC 1X6GA 1AVZC 4JZ4A 1YFNA 2H3EB 2CT4A 2DETA 5GAOl 3QJYA 3L2VA 1ZUYA 3JCMf 3UF4A 3OYDA 4E7HA 4PFOA 4GY5A 1M3AA 1H92A 2L5QA 3DLLA 2F5TX 1I4K1 1VQKQ 3QUIA 1MNEA 2RJCA 3JCMV 4C8QA 3HFOA 2V26A 2RQTA 4RTZA 3RKWA 4JLIA 3ZBDA 4IKFA 4M75C 2EJGA 2KI7A 4C92F 3GLXA 1WDXA 2RM4A 2LQKA 2VWFA 2ED0A 4XU2A 4Z89A 2O4XB 4OMFB 3SB2A 4XU0A 3EG9B 3CCMQ 6AT1B 2MWOA 1IZ6A 5D6WA 1WYXA 4OF1A 1R0CB 3LGFA 2FEIA 1WI7A 4BE0A 4C92G 1T3LA 2V1RA 3VRZA 2CREA 2X4XA 4B9WA 1QLYA 2KMTA 1BIAA 3RR6A 2QQRA 3ULRB 3JB9I 2MWPA 5CKFA 1AWJA 3H0IA 2CZ0B 2EVRA 3CXCA 5IAYA 5GAN2 3AT1B 2YUNA 2HAXA 2AZVA 2X4YA 1NJIC 2DLPA 1TS9A 3GP8A 3EGDA 3G4SA 1O9SA 1SHGA 3MO8A 4Y28E 1R8OB 1H3ZA 2JT4A 2XKOC 4FSXA 2A08A 1OZ3A 2EQMA 4JJDA 2BE7D 1H8KA 1I5OB 2KT8A 5KYUB 3X25B 1JU5C 3H0FA 4BUGA 1NEBA 1PD0A 5LL6S 1E6HA 2RI2A 2GTJA 3EGDB 2OTJQ 4M77C 3LH5A 3PFSA 5I21A 2K79A 4DA4A 2M16A 1X6BA 2NWMA 3HP9A 4C92D 2FYKA 3CC7Q 1ABQA 2RHXA 1MMDA 3FJ5A 1QP3A 5LJ5f 1NEGA 1NJIU 2D8JA 2K5IA 3OS2A 4Z02A 2RA2A 1WXUA 1AZEA 1GCQA 4RG2A 2JJ9A 2KGTA 4PK4A 2KDSA 2H8HA 3LGLA 4F7UE 3M55A 4RG8A 3QZ5B 5LJ3h 2YRCA 4XAXB 2RJFA 4BI8B 3OSSC 1WHHA 1YNZA 4QVZA 2L3RA 1M1FA 2YRVA 3CC4Q 1IHWA 3VS3A 2JVVA 1UFFA 4FM4B 4C8QC 3NPFA 3NTIA 4E6RA 1H641 3JB9G 5GAMe 1IRXA 2HQXA 4J7IA 4JJBA 4EIKA 1YBYA 2BUDA 3OB9A 4YTLA 5GAN4 4J9BA 4HT9A 3OYIA 3VYGA 2QQSA 4C5EA 2CSIA 3L2QA 1WHJA 2LMJA 4FSSA 3G6EQ 4JDSA 2MPXC 3G6EA 1KQSA 1KHIA 4PJMA 1BK2A 3RBBB 2D0QB 1UGPB 2LZ6B 2QXFA 1M3BA 3CCEA 1M1KC 2DBMA 3RMSA 3RERA 1U06A 1HXDA 2YXYA 4AT1B 1SRMA 1VQ9A 2Y4XA 4L6V5 1K76A 1NE8A 1XJWB 4PL6A 1GCQC 5CQXA 2E70A 1YJNA 1BBZA 1MHNA 1KSWA 4LXCA 2DTIA 2RQUA 2A0FB 2DRMA 3QYHB 1RAAB 3EFOA 2XU8A 4C5GA 1WGSA 4C0DC 3EG3A 4N4HA 2HZYA 5IH2A 2DTOA 1PHTA 1VQNA 2GFUA 2EYWA 2K6DA 5HK3A 3G1JA 1BCMA 4CC2A 4PJOG 2SRCA 4IUUA 4OMNA 2MF2A 4JS4A 1B34B 1AWWA 4CC7A 2KSSA 2OI3A 3QHSA 3KBGA 3P8DA 2MCNA 3S6WA 5LJ3j 2COWA 3RNJA 1J3TA 4LDYA 1BI1A 2OTLT 1CKAA 1NG2A 2RHZA 1PKTA 4WF2A 2RJDA 4RCBA 1SKUB 3EG2A 4KGXB 2EW3A 4LDXA 4J6WA 1K9MR 4M78B 2AZSA 1Q82R 3QWXX 2E5KA 3M58A 3LW5E 4LE9A 2LX9A 3CCRA 4EDUA 3V8LA 1VQ6A 1Y96A 1NLPC 3WXMB 4A4HA 4J9EA 4C8QB 2LVMA 3THKA 1VQ4A 3OYLA 1UG1A 2C06A 4N0AC 1YITQ 2WSEE 4CRIA 3PGGA 1OQKA 1B7TA 4HCBA 1OZ2A 1VYTA 2RB6A 1ZUKA 5M9OA 1G3TA 3GBQA 1I5LA 1VQ5T 4DEXA 2F2WA 3META 1LOJA 1PD1A 1WHKA 2JS0A 4C0DB 3ZL7C 4RMOA 2F1LA 3M4GA 1K9MC 5KYXA 3L2RA 3E9GA 5FRMA 1RAIB 1IXDA 1BCOA 2DEUA 1C1AA 3E19A 3MEVA 2K3XA 5CKBA 1M4ZA 2Y4YA 1YN8A 1BI0A 3RUXA 1JO8A 2QAZA 1YITT 1WXTA 3C95A 1M1KU 1OI1A 1WIEA 4QKUA 4J9DA 4PJLA 1D3BA 2E41A 2AKLA 3CC2Q 2HL5C 4NOYA 2LTOA 1ZBJA 1QCFA 2BE9B 1YCSB 2KNBB 2JMAA 1RACB 2CP7A 2COYA 3EHQA 4F14A 1M90U 2RI3A 4M7AD 1IO6A 4VUBA 4A4EA 2QA4Q 4M77A 2LJ3A 2EBPA 3R6NA 4PJOB 4JLGA 5FU7C 2FZCB 2OJ2A 2ZPBB 4FW1A 1VQ4T 4QVCA 4E7SA 3QPHA 1ZSZB 4HVWA 3DLMA 5KYXB 1VQMA 2HBPA 2O01E 4ORZA 4HVUA 4ELYC 4R56A 4M78E 2VXEA 4BACA 4IUPA 3JB9H 3QZ9B 3UT1A 3QG1A 4KUDK 2D1XA 4KBMB 1XNIA 1B07A 2W0ZA 4LDVA 1T0HA 4MMLA 1Q86U 5GMKm 1EIFA 2DXBA 5IXFA 3QWYA 1S1NA 2FZGB 3GF5A 1R0BG 2DYBA 1CSKA 4II1A 2FB7A 1M8MA 3A98A 2VGNA 2XMFA 3CCMT 2DX1A 3M59A 2M9UA 1TUGB 1BKBA 4N0AA 5FU6C 5CO7A 2ED1A 2PZ1A 3GNGA 5GAOq 3MKDA 3T9NA 2CP5A 2WACA 1VQ7Q 1KC8R 2XDDA 2HQHA 3L2UA 2LX7A 5D6YA 1RL2A 4FIBA 1W1FA 1PG5B 1K8AC 1ZSGA 4Q5WA 5GANf 3H9NA 1K9MU 4KUIA 4FYYB 3O8VA 1VQOQ 3E2UA 3I5SA 1IREB 2JXBA 3TSZA 1ZHIA 2OX7A 1GBRA 3MEUA 5GAN3 3FIFA 2PVDB 3GPLA 2LP5A 3LX7A 3CBOA 4J9HA 1MUZA 3RMQA 2LJ1A 5FRNA 3JV3A 2DVJA 4HT8A 3EHRA 1M2VB 3EGXB 4JRQA 1NYGA 4FYXB 3LLRA 3CCQQ 3CCLT 1KJWA 2BIVA 5FU6B 4M77G 2HEQA 3TVTA 2D8HA 5FROA 1FMKA 1MGQA 3UPUA 3VYHB 1TOVA 2LDMA 1D0XA 3X28B 1TU0B 3WVDB 2YUOA 3FC3A 1JEGA 2X35A 4C5HA 2O9SA 2EGEA 2XDBA 2HQEA 3VU3C 3M0UA 3LH0A 3JCMe 4QQDA 1K73R 1VQLA 2JTEA 2J6FA 3BDLA 1NBEB 2VKNA 4R0KA 2C0TA 1U3OA 5HKCA 5CIUA 5GAN7 3CMAQ 1VYUA 1Y96B 3JAME 1QMCA 2RHIA 2EJFA 1VQ8A 2O2OA 2HL3A 2EQKA 2CP0A 1VQKA 2JZ2A 3EGXA 4F7UB 3PT9A 2MYSA 4M75A 3V7SA 5KYNA 2L3QA 2EJ9A 1PSFA 3RESA 1EZZB 1X69A 2E1HA 1OV3A 2JN0A 3E9FA 4XTUA 2LJ0A 4MZPA 1Q86R 3I56Q 2B8AA 1XOVA 1YHQQ 2ZPHB 1M90R 4C8QE 2LQ8A 5GAMd 2E65A 2YHTA 1VQNT 1QVFP 2LCCA 4KGZB 4F7UG 2EKOA 5KYUA 2CZ6B 4FYWB 4DBRA 4HCCA 2K5FA 2CZ1B 4IURA 4CI0C 2VB6A 2V8IA 2FVUA 5EG2A 1MMAA 2EYXA 4WCIA 2J06A 4AG2C 2MMPA 1Q7YU 3LYIA 5A0DA 5LJ3g 4BE2A 1SEMA 3KUFA 1AOJA 2HDAA 3URGA 3X20B 1G3YA 2YRDA 3CCET 2M1HA 2GQIA 3CD6A 3VS7A 3SDZA 4LDWA 3VS0A 4ZNXA 5J39A 1JBMA 2YT6A 2DERA 3OYFA 1YWPA 5I2MA 4TVRA 1MNDA 3CD6T 1GBQA 3LWIA 2DTHA 4M78F 3I55Q 1H3HA 3JSCA 2BZ8A 4Y92A 2ATCB 5GAOr 1Q81C 4OGCA 4M7DD 3IQLA 4N4IA 1U5SA 2DNUA 3CC2A 1YITA 3PNWC 4LN2A 2KR3A 2HKNA 4J9IA 2LNVA 1OPLA 5I22A 1RAHB 2QQAA 1Z9ZA 1TUCA 1RLQC 4R55A 2JUFA 5GAOp 2ABLA 2M02A 2QK0A 3C0CA 4OVAA 3JCMQ 2MK5A 1QWFA 1I81A 4DOVA 2QG9B 4CC4B 2PTKA 1LJOA 5IT9E 4DEYA 4PLIA 2CH4A 4X9CA 4QVDA 3OYAA 1W2BP 3V7RA 3J7AF 2OTLQ 2QDLA 3C94A 3S3MA 1B3QA 4IUTA 3QJ6A 1KQSS 3CD6Q 2K9GA 4M75G 4JJNK 3CC4A 3SWNC 4E47A 1X6OA 2RK2A 4HCKA 4C5IA 4PJOE 2CZ7B 3HKSA 4BY6C 3A8OB 1AEYA 3X26B 1YIJT 3ER0A 2JMCA 2VUBA 5HK0A 4Z8AA 1Q86C 1DJ7B 2RPNA 3HFNA 4AFSC 4C92A 1FMWA 4BI3A 2GTOA 1ZUUA 3EG1A 4X34A 3PIOA 3OS5A 4NL3A 5LJ5j 4A4GA 3PVQA 1Q81U 1JQQA 1YJWA 2OAWA 1OX9A 3H41A 3OYYA 2EQIA 1VQ5A 4A54A 2DL3A 1GXIE 3KFVA 2QEXT 2FRYA 4KT0E 3SWNB 1KC8U 3TSWA 1HD3A 4JUVA 3OYNA 3QBYA 4M7AA 2MIOA 4M7DE 2JTMA 3RDVA 1KQSP 1VQPA 1WZOA 2G3RA 1YI2T 3SFMA 4C0FA 1N27A 2KQWA 3QXEB 1OEBA 2GNCA 1UUEA 3CCUA 4RTYA 2GFAA 5KYYB 1BIBA 2RQWA 2DXTA 3MCAB 2L0AA 4KH0B 3SD4A 1UGSB 4KGVB 3OBYA 2DKGA 4C0GA 3QYGB 2CYZB 1BB9A 3R6OA 4M77E 3G71T 4OB2B 1PKSA 4E2FB 8ATCB 4BB7A 4M7DC 5CKEA 2K57A 3OW2A 4E7JA 4ZN3A 2RNAA 2FPDA 8AT1B 1YI2Q 2DFUA 1SPKA 2KBTA 3FEOA 5FWCA 3I55T 2F2XA 2NLUA 2GGRA 1YJ9A 4RTXA 3G71A 1NYFA 1MV0B 3MHXA 3O5ZA 3FRNA 4BY6B 3QO3A 2BTTA 2XHCA 2O9VA 1IGQA 3V7CA 3V8KA 3CBPA 4PLLA 2RHUA 2ZZDA 3JRZA 3NFCA 1K0SA 3HPWA 2A36A 1FYNA 3VUBA 1TG0A 2DAQA 4FU6A 2NUPB 3UWNA 4OB3B 3PTAA 1AZGB 5GMKj 1K1ZA 4F16A 4JPBW 4LUEA 1V1CA 3H6ZA 5GAMf 2RF0A 2E3IA 5HCKA 3D7SB 4M7AB 3J80E 3VJPA 1MV3A 1S72Q 4C8QG 3TCJA 3CEYA 4KULA 1N8RC 4KRTA 1ZQ1A 2F2VA 2KRNA 4M78G 2L3SA 3CCSA 4D6WA 1AWOA 1P92A 1FMVA 1YIJQ 5GAMg 2RK1A 1WHLA 2VC8A 4UC4A 2K7AA 3MEAA 2HD0A 2VXFA 2OTJT 1M2VA 2FRWA 3NMZC 2YDLA 1WJRA 4RTTA 1VQ9T 1VQKT 2XIDA 3RKXA 3SWNA 2LCLA 2K4YA 2M51A 1UB4A 2QA4T 2EAYA 1YP5A 1M1GA 1JXMA 1PWTA 3U23A 1ARKA 5CKDA 1G83A 4XU1A 1D3BB 1WLPB 2NYSA 5A2QE 1D1BA 3M53A 1UJYA 4M78C 2HSPA 1A0NB 1JB0E 2AT1B 1UGRB 2ZPGB 2CDTA 2IG0A 5J3BA 4OB1B 1SRLA 3CMET 4XTWA 2ZPFB 2DD4A 2YWWA 4M4ZA 2X3XD 4GLMA 4C8QD 4RTWA 3OS1A 2EFIA 2LT4A 2KE9A 3OSVA 4ATOA 1IB8A 1O75A 1SG5A 1VQMQ 3G71Q 3HL8A 2DPPB 3TEEA 4LUDA 5GMKi 1D1AA 2L89A 1VQLQ 1D1CA 3REAB 3ZFJA 1G3WA 2JOYA 5GANd 1N9RA 4BE1A 3OYHA 1G5VA 4XTYA 4M75E 4JRKA 4ZN1A 3OW2P 1M30A 3CMEQ 1OU8A 4K11A 2AKKA 2HBWA 3TU4K 2P0PA 1W4SA 2JNGA 1C6VX 4EMHA 5AT1B 1NPPA 5CAIA 1TWBA 5IN1A 3BW1A 3MPUB 1PCXA 1JJ2P 3CPWP 3OY9A 1VQ7A 4X9DA 3L1AA 1M90C 1YHQT 2VYTA 2QI2A 1UGQB 4ESRA 2JM9A 2K3YA 3OYEA 3EFOB 3OBWA 1WQWA 4CC3A 1X2KA 1NPRA 4MDWA 1CKBA 2I0NA 2L2PA 5J26A 3TREA 4M7DG 2EGAA 1ABOA 2EIFA 1WNLA 3VS4A 2P0KA 1YJNT 1W2BS 1OU9A 2E6ZA 1QCOA 2MOXA 2FO0A 4M75B 2ENMA 2J05A 4M75D 2ROLA 3FB9A 4A4KA 4GBQA 2FL7A 4XTXA 4Z88A 1PC0A 2CUBA 2DJZA 1QP2A 4RKUE 2OAUA 1K9AA 4J9GA 2C0OA 3UATA 2DZ9A 1ZBXA 1GFDA 1KFZA 5I11A 4BI4A 1U1TA 1VQ6Q 4ANJA 2EYYA 2LQWA 3CPWS 4JRPA 3OYCA 1LCKA 4IIMA 2K2VA 1LNXA 3CCJT 1QVGA 3FLGA 3M4YA 4C8QF 1VA7A 5GANj 5GJVB 3MP6A 2JW4A 2G6FX 2RH2A 2E12A 4OB0B 5LJ5g 3CMAA 3CCVQ 1RAEB 2NUZA 3OW2S 2QYZA 2LC4A 2AIRB 4A4FA 1NLOC 3CCJA 3OYJA 1RAGB 2B86A 1UEBA 2KXDA 5GANh 2CSQA 1G3SA 1D0YA 3EH2A 4BD3A 1ZA2B 2GF7A 3C12A 1M8VA 3A8HB 2DJQA 2EKHA 4PJNA 2J7IA 4OMMA 3NHNA 1QQJA 3A8GB 1B34A 2SEMA 3DB4A 2DVEA 1NM7A 4IUVA 1MMNA 3M0TA 3CCRT 3I56A 2IIMA 2DK3A 2XG8D 1QVFA 5DM7R 2A7YA 3BE3A 3NGPA 1Y07A 3M56A 2DO3A 1WHGA 4AMCA 1YJWQ 4HVVA 2H3JA 2W10A 5DLOA 2GCXA 3CCSQ 2CGHA 1AT1B 1UJ0A 4O5VA 5GAN8 3DKMA 2QEXQ 2OTLA 4XK8E 4ZGEB 3M57A 1N8RR 1WX6A 1EX4A 4ZGJB 2J6OA 1N5ZA 4LD6A 5FW9A 2PUKB 1Y71A 3ME9A 2EWNA 3L42A 1EFNA 4F04B 3G7ZA 4L5GA 4HKEA 1WJQA 2DXUA 1N9SA 1VUBA 4EMKA 1VQPT 2A28A 4PJOD 1VIFA 1QWEA 2KRMA 3UDCA 3BY7A 1K73U 3A1PA 1T0JA 5GJWB 5ECAA 4MZTA 3V8JA 5L23A 3HRSA 3I56T 2K3BA 3OQ5A 4WTOB 5D6XA 4C92C 2BKDN 1VOMA 5CR2A 1VQNQ 1TH7A 1KQ1A 4FT2A 1SSHA 5I2SA 2RO0A 3FDRA 3PMTA 5GAMj 1G2BA 3HSBA 1YWOA 1PRMC 4B9XA 3CCJQ 2I2LA 2DXCA 4ELZC 1VQPQ 1D0ZA 5FWBA 1TSFA 2LT1A 3F70A 2M0YA 2PVOB 4QQGA 2XI9A 3VS5A 2M0OA 2O31A 3JCMb 4P5NA 4J6YA 3CC4T 1K8AU 3WVEB 4A53A 1VQLT 2DE0X 3EGUA 5IHKA 1ZX6A 2LCSA 2JM8A 1I07A 1PM3A 3SHWA 3MEWA 1U1SA 2XICA 4M77F 2F69A 1RAFB 4LDUA 3CCQT 4LNPA 4JRIA 2AK5A 1S72T 1RI9A 3P8BB 3LWHA 4JS5A 1M5Q1 3HRTA 2KY9A 2LRQA 2FG0A 5GAOn 4ZGDB 3OMGA 4GLKA 2HNIA 1QVGS 2DZCA 2E10A 1RADB 5A0GA 1KHCA 4OMPA 1VQ9Q 5EC7A 5LJ5d 4J6XA 2YUPA 2MAMA 2YSQA 2CT3A 4L59A 5CVIA 3EFSA 3QIIA 2DL5A 1VYVA 3CCUQ 4M7AE 4QW2A 5GANe 5IHNA 2JS2A 5GMKl 1RLPC 1QVPA 1W6XA 2NUPA 4J8OA 4F7UF 3PE0A 2L3PA 1GFCA 3A8MB 2V8JA 2Z0WA 3JB9F 4E7KA 1OULA 2PNIA 3CC2T 2QGGA 2KYBA 1JJ2A 4C0ZA 4FL6A 1VQ7T 2DM1A 2FPFA 4ME7A 1AHJB 4HA8A 3EH1A 5IXBA 3RKYA 4BDYA 1BI3A 4ZTJA 4M7DF 3CC7T 1WXBA 3PMIA 3OYGA 2FZKB 3M0QA 4M78D 3QDFA 4M7AC 1VQOT 1M27C 1GCPA 4NL2A 1Y0MA 4PFPA 4IIOA 2CP2A 2E64A 3MP1A 1WFWA 1F1BB 1XTDA 2A3LA 1LPLA 3VUZA 3A8LB 3ASKA 4OP0A 2RQRA 4E7ZA 2ESWA 1TXQA 1QCNA 2DA9A 3JB9D 4DBHA 3GIBA 1ZLMA 1M3CA 4JZ3A 4PKCC 3OA6A 2RN8A 3M0RA 2LNHB 4EMKB 2QA4A 5KCHA 1HK9A 4HCZA 3I5RA 5KYYA 1VQ5Q 2F5KA 3GOXA 3MP8A 4RUGA 3CCMA 1TUDA 4B6MA 1Q81R 2BZYA 5GMKe 2OTJA 2MI6A 4Y91A 3C4SA 1UDLA 2P0QA 3M0PA 3G6ET 4DBQA 2COZA 4JJCA 5IHIA 3CC7A 3OS0A 4J83A 4DQ2A 3M54A 2EYZA 3CMAT 3EAEA 1W2BA 5GANg 4NS5A 2PVGB 2HMAA 3Q1JA 3JCMd 1N8RU 2CH4W 2XDPA 2HKQB 5KYWA 1PRLC 4RCCA 4M77D 2RJEA 4C92E 4C92B 2ZPEB 1UE9A 2RD1A 1YIJA 2WSCE 3CXCP 2X3WD 4FYVB 2CKKA 2YUQA 1I1JA 2KVQG 2X51A 7AT1B 1VIEA 3KXTA 4AG1C 1HSQA 1VQ6T 1GRIA 4PJOC 3TQ7P 4N4GA 5DY9A 2DF6A 1KK7A 5L8RE 5LJ3e
chains in the Genus database with same CATH topology
1WNLA 4F7UB 3PT9A 4M75A 3V7SA 2P0KA 2EJ9A 2RI5A 1PSFA 3RESA 3INZA 3X25B 5C0MA 1YJNT 1W2BS 2E6ZA 2E1HA 2JN0A 4M75B 3JCMP 3E9FA 1QVFS 4QQ6A 4BUGA 5LJ5h 4XTUA 4M75D 5LL6S 1N6AA 4MZPA 2RI2A 3QKJA 3FB9A 4A4KA 2FL7A 4XTXA 4J7FA 4M77C 1X01A 2L8DA 3PFSA 2B8AA 5I21A 4DA4A 2M16A 2QQ9A 1XOVA 2DJZA 1QP2A 2ZPHB 4RKUE 2OAUA 3CBMA 4C8QE 3HP9A 2LQ8A 2QQBA 4C92D 2FYKA 5GAMd 4LD9K 2E65A 2YHTA 2DZ9A 1VQNT 1ZBXA 2RHXA 2R57A 4V2SA 2LCCA 4O6JA 1QP3A 3VV0A 4BI4A 5LJ5f 4F7UG 1U1TA 2EKOA 2CZ6B 1NJIU 4M78A 2R5MA 3CPWS 4JRPA 4HCCA 2K5IA 2K5FA 3OS2A 2CZ1B 4Z02A 1YJ9T 4IURA 2RA2A 4CI0C 2XD0A 4PJOF 3OYCA 4RG2A 2K2VA 1LNXA 3JCMX 3CCJT 2V8IA 2FVUA 5EG2A 1QVGA 3FLGA 3M4YA 2X4JA 1SSFA 4C8QF 2KDSA 2WSFE 2PUOB 1Y7XA 2K5LA 5GANj 2MMPA 1Q7YU 3LGLA 3LYIA 3OYBA 4F7UE 3M55A 3MP6A 4RG8A 3QZ5B 5A0DA 4OGEA 5LJ3h 2RH2A 5LJ3g 4XAXB 4BE2A 2RJFA 2E12A 4OB0B 5LJ5g 3CMAA 4MDXA 3KUFA 3OSSC 4BI8B 1Q82C 4QVZA 3URGA 3X20B 1G3YA 2L3RA 1FXXA 1M1FA 2V8KA 2YRVA 5CQYA 3OW2S 3M5AA 2JVVA 3CCET 2M1HA 2LC4A 4FM4B 4C8QC 3CD6A 3PIPA 2IVWA 4BDZA 1YHQA 3NTIA 3SDZA 4A4FA 4LDWA 5KH6A 1KC8C 5J39A 3CCJA 1JBMA 1H641 1KD1C 3OYJA 3JB9G 5GAMe 4DOWA 3OYFA 1UEBA 2HQXA 4J7IA 5GANh 2O4XA 3CCST 1JJ2S 1G3SA 2YLBA 4TVRA 5I2MA 4XQ3A 1VQOA 3CD6T 1YBYA 3JCMW 2BUDA 1OYXA 3LWIA 2DTHA 4M78F 4BD3A 3JSCA 3OB9A 4YTLA 5AYFA 2GF7A 3C12A 5GAN4 5GAOr 1Q81C 4OGCA 4M7DD 1M8VA 3A8HB 4N4IA 3CC2A 5FU7B 5LJ3d 1YITA 4HT9A 3QSUA 3PNWC 3OYIA 3VYGA 2QQSA 3NTKA 4C5EA 3L2QA 5GAN6 4JDSA 3OYKA 5KE3A 3G6EA 2LNVA 4FT4A 3JB9J 1U8RA 1KHIA 3A8GB 1B34A 1KQSA 4M7AG 3DB4A 2QQAA 1WPYA 3QDRB 4R55A 2DVEA 2D0QB 2JUFA 5GAOp 1UGPB 4XU3A 2QXFA 4IUVA 3CCRT 4J5YA 3CPFA 4OVAA 3JCMQ 3I56A 3CCVT 5FLXE 3CCEA 1M1KC 2DK3A 2XG8D 3RMSA 1QVFA 3RERA 4ZTFA 1I81A 4DOVA 1HXDA 2DEQA 2EQJA 2A7YA 5GMKh 5DM7R 1LJOA 5IT9E 1VQ9A 4PLIA 2Y4XA 4QVDA 4X9CA 4L6V5 3OYAA 3J7AF 3V7RA 1NE8A 1Y07A 2DO3A 3M56A 4F7UA 3M9QA 3C94A 3S3MA 4PL6A 5CQXA 2H3JA 2E70A 1YJNA 5DLOA 1MHNA 2GCXA 4IUTA 1WQ7A 3QJ6A 2CGHA 2DD5A 2DTIA 2VV5A 3QYHB 1KQSS 2X4WA 2XU8A 3CCUT 4O5VA 4C5GA 2QDYB 4M75G 5LJ3j 1WGSA 3I55A 4JJNK 5GAN8 3SWNC 5CKHA 1X6OA 2RK2A 3DKMA 4C0DC 4C5IA 4E47A 3CC4A 4PJOE 2CZ7B 4N4HA 3HKSA 5DLQE 3A8OB 4XK8E 4BY6C 2OTLA 4M7AF 4ZGEB 3X26B 3M57A 2DTOA 2FHDA 4PJOA 4ZGJB 1YIJT 3ER0A 2VUBA 5HK0A 4LD6A 1VQNA 2GFUA 2GQVA 1Q86C 3RIRA 1DJ7B 3HFNA 4M77B 5CK9A 4C92A 2ZCFB 2PUKB 3JCMh 5HK3A 1Y71A 3ME9A 2EWNA 4BI3A 3L42A 4PJOG 3VKIA 2QEXA 1M9SA 3G7ZA 3BDUA 4IUUA 3BFMA 4L5GA 3FJPA 4X34A 3PIOA 3OS5A 4HKEA 2MF2A 4JS4A 1B34B 1PSEA 2KSSA 4NL3A 1BYMA 3QHSA 1RI0A 3KBGA 1WJQA 3P8DA 3HHTB 2DXUA 1N9SA 1VUBA 3S6WA 2D9TA 4A4GA 4LDYA 4EMKA 1BI1A 5LJ5j 1VQPT 1YJWA 1Q81U 2OTLT 1VIFA 2RHZA 4WF2A 4PJOD 1YJWT 2RJDA 3UDCA 3OYYA 3BY7A 4RCBA 3CCLA 1K73U 2AHJB 2CS7A 1VQ5A 4LDXA 4MZTA 3V8JA 4A54A 3HRSA 4XTZA 4J6WA 1GXIE 3OMCA 1BI2A 4M78B 1WJSA 2QEXT 3I56T 2R58A 4KT0E 3SWNB 3S3NA 1KC8U 3OQ5A 4JUVA 3OYNA 4M7AA 3QBYA 4E7LA 5D6XA 4C92C 5A0LA 3EFRA 2BKDN 3M58A 4M7DE 3LW5E 2JTMA 2LX9A 2R5AA 5CR2A 2RHYA 4XTVA 1TH7A 1KQ1A 4FT2A 4M75F 3CCRA 3CCVA 1Q82U 1VQPA 2EQUA 4EDUA 4M7DA 2G3RA 1YI2T 2E5QA 3V8LA 5I2SA 3G4ST 3SFMA 5KCOA 1VQ6A 2RO0A 3FDRA 3HRUA 4C0FA 1N27A 1Y96A 2KQWA 3PMTA 3QXEB 5CCAA 3WXMB 4A4HA 1QW1A 5GAMj 1Q7YC 3HSBA 1XQHA 3CCUA 4C8QB 2GFAA 4IUQA 1BIBA 2LVMA 2KAFA 4B9XA 1VQ4A 2I2LA 2DXCA 2DXTA 3DB3A 3OYLA 5HY6A 2C06A 2PQWA 4N0AC 1KG1A 3MCAB 2WSEE 4CRIA 3PGGA 4ELZC 3SD4A 4HCBA 1UGSB 2LT1A 1OZ2A 2E6NA 2RB6A 3P8HA 4MZMA 5M9OA 3OBYA 1G3TA 2DKGA 2P4TA 4C0GA 3F70A 1I5LA 1VQ5T 3QYGB 2CYZB 2DIGA 3META 1LOJA 2PVOB 4QQGA 2XI9A 3R6OA 4C0DB 1VQMT 3N5BB 5LJ3f 1FWZA 2M0OA 4M77E 4RMOA 3G71T 3JCMb 3M4GA 4OB2B 4P5NA 1K9MC 2ZGWA 4J6YA 3L2RA 3CC4T 3E9GA 1K8AU 5FRMA 3NTHA 3WVEB 4A53A 4EPCA 2JTFA 1VQLT 4BB7A 4M7DC 4EMGA 4MMKA 3E19A 5CKEA 2K57A 3OW2A 2VGMA 4E7JA 4ZN3A 3MEVA 2K3XA 5GAN5 1X75C 5CKBA 1VQ8T 3JCMg 2D6FA 3MEWA 1M4ZA 1U1SA 2XICA 1KQ2A 4M77F 2F69A 2PU9B 2Y4YA 2QTXA 3E1SA 4LDUA 4EMKC 3J81E 3L2WA 1BI0A 3FEOA 3CCQT 4JRIA 3I55T 3RUXA 1S72T 2YLCA 2NLUA 1YJ9A 3G71A 3P8BB 3MHXA 3LWHA 4JS5A 5LJ5e 2KK4A 1M5Q1 1YITT 3HRTA 3C95A 2KY9A 1M1KU 2LRQA 1OI1A 3FRNA 3QO3A 4BY6B 2XHCA 3V7CA 4ZGDB 5GAOn 3OMGA 1D3BA 3CBPA 4GLKA 2E41A 2RHUA 4PLLA 3V8KA 2ZZDA 3JRZA 1YI2A 2HNIA 3NFCA 3HPWA 2LTOA 4NOYA 1QVGS 2DZCA 2E10A 1FX7A 5KE2A 3VUBA 5A0GA 1I8FA 1KHCA 3GNFB 2XK0A 2DAQA 4FU6A 3JCMJ 3UWNA 5LJ5d 4OB3B 1YCYA 4J6XA 5C6SA 3PTAA 3L2ZA 5GMKj 2MAMA 1M90U 2RI3A 4M7AD 4M7DB 4VUBA 4A4EA 3AHUA 4E7IA 3H6ZA 5GAMf 4M77A 4PNOA 4L59A 5CVIA 3EFSA 3QIIA 1JRIA 4PJOB 4M7AE 4M7AB 3J80E 4JLGA 5FU7C 3VJPA 1KD1U 4C8QG 4QW2A 3TCJA 3CEYA 2ZPBB 5GANe 4KULA 2DIQA 1N8RC 1VQ4T 3OYMA 4QVCA 1ZQ1A 4M78G 5GMKl 3CCSA 4D6WA 1QVPA 3QPHA 1P92A 5GAMg 2RK1A 4J8OA 4F7UF 1NZ9A 2VC8A 4UC4A 3A8MB 2V8JA 3DLMA 3JB9F 4E7KA 2Y90A 1VQMA 2HBPA 1K73C 3MEAA 3CC2T 2O01E 2HD0A 1JJ2A 2VXFA 4C0ZA 2OTJT 4ELYC 3ZEHA 4FL6A 5GAOm 3CCQA 1VQ7T 3CMEA 4R56A 4M78E 2VXEA 3JB9H 4ME7A 3JCMc 1AHJB 4HA8A 1WJRA 1VQ9T 4BACA 1VQKT 2XIDA 4IUPA 3RKYA 4BDYA 1BI3A 3RKXA 1V29B 3QZ9B 3UT1A 4ZTJA 3CC7T 3QG1A 3CXCS 2EYQA 3SWNA 4KUDK 4M7DF 2LCLA 4KBMB 1XNIA 3S3OA 3PMIA 2K4YA 3OYGA 4LDVA 1UB4A 4M78D 3H8ZA 2QA4T 2EAYA 4M7AC 1VQOT 4MMLA 3A5ZB 1M1GA 4NL2A 1Q86U 5GMKm 2E64A 1EIFA 3MP1A 2DXBA 5CKDA 1S72A 1XTDA 2A3LA 4XU1A 1D3BB 5A2QE 3VUZA 3A8LB 3M53A 3GF5A 4M78C 3CPWA 2ZPIB 4II1A 2FB7A 1JB0E 1UGRB 3ASKA 4OP0A 3X24B 5GAMh 2VGNA 3CCMT 3M59A 2ZPGB 5GAOl 3QJYA 2IG0A 3L2VA 5J3BA 3JCMf 3JB9D 4OB1B 2M9UA 3GIBA 1BKBA 4N0AA 5FU6C 5CO7A 3OYDA 3CMET 3GNGA 4XTWA 2ZPFB 5GAOq 2DD4A 4E7HA 4GY5A 3T9NA 2WACA 4PKCC 3OA6A 2L5QA 3DLLA 2F5TX 2XDDA 4C8QD 3L2UA 1I4K1 3QUIA 5D6YA 3OS1A 1RL2A 2EFIA 4FIBA 4EMKB 1K8AC 2QA4A 2LT4A 5KCHA 4Q5WA 1HK9A 4HCZA 5GANf 2RJCA 3OSVA 1K9MU 4KUIA 3JCMV 4C8QA 4ATOA 1O75A 2F5KA 3HFOA 3GOXA 3O8VA 3MP8A 3CCMA 3RKWA 1IREB 4JLIA 3ZBDA 1ZHIA 4IKFA 3HL8A 2DPPB 3MEUA 4M75C 3TEEA 2EJGA 5GAN3 5GMKe 2OTJA 3FIFA 5GMKi 2PVDB 4C92F 3GLXA 2MI6A 3GPLA 3LX7A 2L89A 2RM4A 3C4SA 3CBOA 2P0QA 4Y91A 2LQKA 3RMQA 3ZFJA 5FRNA 4XU2A 3G6ET 1G3WA 2JOYA 2O4XB 1N9RA 4OMFB 5GANd 3SB2A 4XU0A 3CC7A 4BE1A 3OS0A 3OYHA 4J83A 4DQ2A 4XTYA 4HT8A 2MWOA 4M75E 1G5VA 1IZ6A 3M54A 5D6WA 4JRKA 3CMAT 4ZN1A 4JRQA 3EAEA 4OF1A 1W2BA 5GANg 3LLRA 3CCLT 2BIVA 3LGFA 5FU6B 4NS5A 2PVGB 4M77G 4BE0A 4C92G 3TU4K 3Q1JA 3JCMd 2P0PA 1W4SA 2JNGA 1N8RU 5FROA 1MGQA 3UPUA 3VYHB 2X4XA 2XDPA 4B9WA 2LDMA 3X28B 2KMTA 4RCCA 4EMHA 1BIAA 4M77D 1NPPA 2QQRA 5CAIA 2RJEA 3WVDB 3FC3A 2X35A 5IN1A 4C5HA 4C92E 4C92B 2MWPA 3BW1A 3JB9I 2ZPEB 5CKFA 3OY9A 1VQ7A 4X9DA 3L1AA 2CZ0B 2RD1A 2HQEA 3VU3C 1M90C 2XDBA 3LH0A 1YIJA 2WSCE 3JCMe 1YHQT 4QQDA 1VQLA 3BDLA 2VYTA 2QI2A 1UGQB 2CKKA 3CXCA 5IAYA 2K3YA 5GAN2 3OYEA 2KVQG 3OBWA 2HAXA 2X4YA 1NJIC 3KXTA 1VIEA 1WQWA 3GP8A 5HKCA 3G4SA 1VQ6T 1NPRA 1O9SA 3MO8A 4MDWA 5CIUA 5GAN7 1Y96B 4PJOC 5LJ3e 4N4GA 3JAME 4Y28E 2RHIA 5DY9A 1R8OB 2EJFA 1H3ZA 1VQ8A 2EQKA 5J26A 3TREA 4M7DG 1VQKA 5L8RE 2JZ2A 2XKOC 4FSXA 1OZ3A 2EQMA 2EIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0K A;  2RI5 A;  1YJN T;  5C0M A;  1W2B S;  2E6Z A;  1QVF S;  3E9F A;  4QQ6 A;  5LL6 S;  2RI2 A;  3QKJ A;  2L8D A;  3PFS A;  2B8A A;  2M16 A;  2LQ8 A;  1VQN T;  2RHX A;  2R57 A;  2LCC A;  2EKO A;  1NJI U;  2R5M A;  3CPW S;  3OS2 A;  4Z02 A;  1YJ9 T;  4IUR A;  3OYC A;  4RG2 A;  3CCJ T;  1QVG A;  3FLG A;  1SSF A;  2KDS A;  1Q7Y U;  3LGL A;  3LYI A;  3OYB A;  3MP6 A;  4BE2 A;  2RJF A;  3CMA A;  3KUF A;  1Q82 C;  4QVZ A;  2L3R A;  2YRV A;  3OW2 S;  3CCE T;  2JVV A;  2M1H A;  3CD6 A;  3PIP A;  4BDZ A;  1YHQ A;  3NTI A;  4A4F A;  1KC8 C;  5KH6 A;  5J39 A;  3CCJ A;  1KD1 C;  3OYJ A;  3OYF A;  1UEB A;  3CCS T;  2HQX A;  2O4X A;  1JJ2 S;  4TVR A;  1VQO A;  3CD6 T;  1YBY A;  2BUD A;  1OYX A;  4BD3 A;  3OB9 A;  4YTL A;  2GF7 A;  1Q81 C;  4N4I A;  3CC2 A;  1YIT A;  3PNW C;  3OYI A;  2QQS A;  3NTK A;  4C5E A;  3L2Q A;  3OYK A;  5KE3 A;  3G6E A;  1KQS A;  1KHI A;  3DB4 A;  2JUF A;  4IUV A;  3CCR T;  3CCV T;  3CPF A;  4OVA A;  3I56 A;  5FLX E;  3CCE A;  1M1K C;  1QVF A;  4ZTF A;  2EQJ A;  5DM7 R;  5IT9 E;  1VQ9 A;  4PLI A;  3OYA A;  3J7A F;  2DO3 A;  3M9Q A;  3S3M A;  4PL6 A;  2E70 A;  1YJN A;  1MHN A;  4IUT A;  3QJ6 A;  1KQS S;  2X4W A;  3CCU T;  4C5G A;  3I55 A;  1WGS A;  3CC4 A;  1X6O A;  4C5I A;  2OTL A;  4N4H A;  3HKS A;  5DLQ E;  2FHD A;  1YIJ T;  3ER0 A;  4LD6 A;  1VQN A;  2GFU A;  1Q86 C;  2QEX A;  3ME9 A;  3L42 A;  3PIO A;  4X34 A;  4IUU A;  3KBG A;  1RI0 A;  1WJQ A;  3P8D A;  3S6W A;  4A4G A;  1VQ8 T;  2D9T A;  1Q81 U;  1VQP T;  2OTL T;  1YJW A;  2RHZ A;  1YJW T;  2RJD A;  3OYY A;  3CCL A;  1K73 U;  1VQ5 A;  3OMC A;  2QEX T;  1WJS A;  3I56 T;  2R58 A;  3S3N A;  1KC8 U;  3OQ5 A;  3OYN A;  3QBY A;  4E7L A;  5D6X A;  2BKD N;  2R5A A;  2RHY A;  1Q82 U;  3CCR A;  3CCV A;  1VQP A;  2EQU A;  4EDU A;  2G3R A;  1YI2 T;  2E5Q A;  3G4S T;  1VQ6 A;  5KCO A;  2RO0 A;  3FDR A;  1N27 A;  3PMT A;  4A4H A;  1Q7Y C;  3CCU A;  2GFA A;  4IUQ A;  2LVM A;  1VQ4 A;  4B9X A;  3OYL A;  3DB3 A;  5HY6 A;  2PQW A;  4CRI A;  3SD4 A;  1OZ2 A;  2E6N A;  3P8H A;  5M9O A;  1VQ5 T;  3F70 A;  2DIG A;  3MET A;  4QQG A;  1VQM T;  2M0O A;  3G71 T;  1K9M C;  3L2R A;  3CC4 T;  1K8A U;  3E9G A;  5FRM A;  3NTH A;  2JTF A;  1VQL T;  3OW2 A;  4E7J A;  4ZN3 A;  3MEV A;  2K3X A;  3MEW A;  3J81 E;  3L2W A;  3CCQ T;  3FEO A;  3I55 T;  1S72 T;  1YJ9 A;  2NLU A;  3G71 A;  3P8B B;  1YIT T;  1M1K U;  2LRQ A;  1OI1 A;  2XHC A;  3OMG A;  4PLL A;  2RHU A;  1YI2 A;  2LTO A;  1QVG S;  5KE2 A;  1KHC A;  2XK0 A;  2DAQ A;  4FU6 A;  3UWN A;  5C6S A;  1M90 U;  2RI3 A;  4A4E A;  4E7I A;  3H6Z A;  4L59 A;  3QII A;  3J80 E;  1KD1 U;  4QW2 A;  3CEY A;  2DIQ A;  1N8R C;  1VQ4 T;  3OYM A;  3CCS A;  1NZ9 A;  4UC4 A;  3DLM A;  4E7K A;  1VQM A;  1K73 C;  3MEA A;  3CC2 T;  1JJ2 A;  2OTJ T;  3ZEH A;  4FL6 A;  3CCQ A;  1VQ7 T;  3CME A;  1VQ9 T;  1WJR A;  4BAC A;  1VQK T;  4IUP A;  4BDY A;  4ZTJ A;  3UT1 A;  3CC7 T;  3CXC S;  2LCL A;  3S3O A;  1XNI A;  3PMI A;  3OYG A;  2QA4 T;  3H8Z A;  1VQO T;  3A5Z B;  1M1G A;  1Q86 U;  1EIF A;  3MP1 A;  1S72 A;  1XTD A;  5A2Q E;  3CPW A;  4II1 A;  3ASK A;  3CCM T;  2IG0 A;  3L2V A;  5J3B A;  1BKB A;  3CME T;  3OYD A;  4E7H A;  4GY5 A;  2WAC A;  3OA6 A;  3DLL A;  3L2U A;  5D6Y A;  3OS1 A;  1RL2 A;  2EFI A;  1K8A C;  2QA4 A;  5KCH A;  4Q5W A;  4HCZ A;  1K9M U;  2RJC A;  2F5K A;  3GOX A;  3O8V A;  3MP8 A;  3CCM A;  4IKF A;  3MEU A;  2OTJ A;  2MI6 A;  3LX7 A;  2L89 A;  3C4S A;  5FRN A;  3G6E T;  2JOY A;  2O4X B;  3CC7 A;  4BE1 A;  3OS0 A;  3OYH A;  1G5V A;  2MWO A;  1IZ6 A;  5D6W A;  3CMA T;  4ZN1 A;  3EAE A;  1W2B A;  3LLR A;  3CCL T;  3LGF A;  2BIV A;  4NS5 A;  4BE0 A;  3Q1J A;  2JNG A;  1N8R U;  5FRO A;  2X4X A;  2XDP A;  4B9W A;  2LDM A;  1NPP A;  2QQR A;  2RJE A;  3FC3 A;  2X35 A;  5IN1 A;  4C5H A;  2MWP A;  3OY9 A;  1VQ7 A;  2HQE A;  1M90 C;  3LH0 A;  1YIJ A;  1YHQ T;  4QQD A;  1VQL A;  3BDL A;  2VYT A;  2CKK A;  3CXC A;  5IAY A;  2K3Y A;  3OYE A;  2KVQ G;  2X4Y A;  1NJI C;  3G4S A;  1VQ6 T;  1NPR A;  5CIU A;  3MO8 A;  3JAM E;  4N4G A;  2RHI A;  1H3Z A;  1VQ8 A;  2EQK A;  5J26 A;  3TRE A;  1VQK A;  2JZ2 A;  1OZ3 A;  2EQM A;  2EIF A; 
#chains in the Genus database with same CATH topology
 2EGC A;  1GL5 A;  2RI5 A;  5C0M A;  3INZ A;  4D8D A;  3JCM P;  2ZAE A;  1QVF S;  4QQ6 A;  5LJ5 h;  1X43 A;  1ZSZ C;  1UGV A;  1N6A A;  3QKJ A;  1OOT A;  1W70 A;  4J7F A;  1X01 A;  2L8D A;  2QQ9 A;  1D09 B;  3CBM A;  2QQB A;  4LD9 K;  1JXO A;  2KXC A;  2P84 A;  2R57 A;  4V2S A;  2O88 A;  4O6J A;  3G4S Q;  3VV0 A;  4OMO A;  4M78 A;  2R5M A;  4AFU C;  1R77 A;  1YJ9 T;  2XD0 A;  3MJX A;  4PJO F;  1HYO A;  4OMQ A;  3JCM X;  1E6G A;  2P4R A;  2X4J A;  1SSF A;  4J9C A;  4OML A;  2WSF E;  2PUO B;  1Y7X A;  2K5L A;  2RMO A;  3HTR A;  2E3H A;  1QKW A;  3OYB A;  1YJN Q;  3VS2 A;  4OGE A;  2KYM A;  1UHF A;  2KRS A;  4MDX A;  1UHC A;  3CCR Q;  1Q82 C;  1FXX A;  2V8K A;  5CQY A;  3M5A A;  1K0X A;  2CP3 A;  3PIP A;  2IVW A;  1C0M A;  2IPO B;  4BDZ A;  1YHQ A;  3PVL A;  5KH6 A;  1KC8 C;  1Q7Y R;  1KD1 C;  4DOW A;  1K8A R;  3CCS T;  2O4X A;  2A37 A;  4KH1 B;  2YLB A;  1JJ2 S;  4XQ3 A;  1VQO A;  3JCM W;  1OYX A;  4PFZ A;  5AYF A;  3VS1 A;  5FU7 B;  5LJ3 d;  2V1Q A;  3QSU A;  2KEA A;  3NTK A;  1M1K R;  5GAN 6;  3OYK A;  3UA7 A;  2HCK A;  5KE3 A;  4FT4 A;  3JB9 J;  1U8R A;  4M7A G;  2DL7 A;  2J6K A;  4RTU A;  1WPY A;  3QDR B;  1T3S A;  4XU3 A;  1V76 A;  3CCV T;  4J5Y A;  3CPF A;  3CCL Q;  5FLX E;  3EG9 A;  4ZTF A;  5GMK h;  2EQJ A;  2DEQ A;  4F17 A;  4F7U A;  3M9Q A;  4FW2 A;  2D0N A;  1SHF A;  1IGU A;  1WQ7 A;  2DD5 A;  2VV5 A;  2X4W A;  4QT7 A;  1X27 A;  3CCU T;  1PNJ A;  2CP6 A;  2QDY B;  3I55 A;  1WHM A;  5CKH A;  2DIL A;  4M7A F;  2DBK A;  5DLQ E;  1VQ4 Q;  1LVK A;  2DYI A;  4RTV A;  2FHD A;  4PJO A;  2DRK A;  2DMO A;  3UA6 A;  2GQV A;  3RIR A;  1KIK A;  4M77 B;  3VRY A;  5CK9 A;  2ZCF B;  3JCM h;  2QEX A;  3VKI A;  1M9S A;  3BDU A;  3BFM A;  3FJP A;  1Z9Q A;  1X2Q A;  1QVG P;  1PSE A;  1BYM A;  1RI0 A;  3HHT B;  1UEC A;  1VQ8 T;  2D9T A;  1ZSZ A;  1E7O A;  1YJW T;  1Y57 A;  4FCY A;  1M2O A;  3CCL A;  3SEM A;  2VAS A;  2AHJ B;  2CS7 A;  3M0S A;  1G8X A;  2NUT A;  4XTZ A;  3OMC A;  1BI2 A;  1WJS A;  2R58 A;  3S3N A;  3REB B;  4E7L A;  5A0L A;  1ZA1 B;  2CUD A;  1TTH B;  3EFR A;  4HXJ A;  2R5A A;  5D7U A;  2RHY A;  4XTV A;  1Q82 U;  4M75 F;  3CCV A;  2EQU A;  4J9F A;  4M7D A;  2E5Q A;  2DL8 A;  3G4S T;  5KCO A;  3HRU A;  5CCA A;  1QW1 A;  1Q7Y C;  1RUW A;  1XQH A;  1KD1 R;  4IUQ A;  2KAF A;  2BZX A;  1KG1 A;  3DB3 A;  5HY6 A;  2PQW A;  1IHV A;  4D8K A;  2E6N A;  3P8H A;  4MZM A;  2P4T A;  1OX8 A;  2DIG A;  1UTI A;  4AFZ C;  1VQM T;  3N5B B;  5LJ3 f;  1FWZ A;  1SF9 A;  2ZGW A;  2EPD A;  3CCE Q;  3NTH A;  4EPC A;  2JTF A;  2QGF B;  2ROT A;  4EMG A;  2KRO A;  4MMK A;  2VGM A;  1WA7 A;  1MMG A;  5GAN 5;  1AD5 A;  1X75 C;  3JCM g;  2D6F A;  1KQ2 A;  2PU9 B;  3E1S A;  4EMK C;  2QTX A;  3J81 E;  3L2W A;  2YLC A;  1QKX A;  2K2M A;  5LJ5 e;  2KK4 A;  2E4H A;  1BU1 A;  2QAS A;  1K4U S;  1YI2 A;  2ECZ A;  2GBQ A;  1FX7 A;  5KE2 A;  1I8F A;  3GNF B;  2XK0 A;  3JCM J;  1YCY A;  5C6S A;  3L2Z A;  3EG0 A;  3CQT A;  4M7D B;  3AHU A;  4E7I A;  4PNO A;  1JRI A;  3VS6 A;  1KD1 U;  3I9Q A;  2DIQ A;  2NUT B;  3OYM A;  5KYW B;  1I0C A;  2RQV A;  1NZ9 A;  1OPK A;  2X9H A;  9ATC B;  2Y90 A;  3I35 A;  1K73 C;  2HSE B;  4DBF A;  3ZEH A;  5GAO m;  3CCQ A;  3CME A;  1NJI R;  1HJD A;  3JCM c;  1VQ8 Q;  1V29 B;  3CXC S;  2EYQ A;  3S3O A;  1ACM B;  2C0I A;  1RAB B;  4A63 B;  3H8Z A;  2LQN A;  2VVK A;  3A5Z B;  3H0H A;  1YJ9 Q;  1S72 A;  2DL4 A;  4PJJ A;  4X1V A;  1AWX A;  2QTV A;  2KT1 A;  3CPW A;  2ZPI B;  1Q95 G;  2FPE A;  5GAM h;  3X24 B;  4AFQ C;  1X6G A;  1AVZ C;  4JZ4 A;  1YFN A;  2H3E B;  2CT4 A;  2DET A;  5GAO l;  3QJY A;  3L2V A;  1ZUY A;  3JCM f;  3UF4 A;  3OYD A;  4E7H A;  4PFO A;  4GY5 A;  1M3A A;  1H92 A;  2L5Q A;  3DLL A;  2F5T X;  1I4K 1;  1VQK Q;  3QUI A;  1MNE A;  2RJC A;  3JCM V;  4C8Q A;  3HFO A;  2V26 A;  2RQT A;  4RTZ A;  3RKW A;  4JLI A;  3ZBD A;  4IKF A;  4M75 C;  2EJG A;  2KI7 A;  4C92 F;  3GLX A;  1WDX A;  2RM4 A;  2LQK A;  2VWF A;  2ED0 A;  4XU2 A;  4Z89 A;  2O4X B;  4OMF B;  3SB2 A;  4XU0 A;  3EG9 B;  3CCM Q;  6AT1 B;  2MWO A;  1IZ6 A;  5D6W A;  1WYX A;  4OF1 A;  1R0C B;  3LGF A;  2FEI A;  1WI7 A;  4BE0 A;  4C92 G;  1T3L A;  2V1R A;  3VRZ A;  2CRE A;  2X4X A;  4B9W A;  1QLY A;  2KMT A;  1BIA A;  3RR6 A;  2QQR A;  3ULR B;  3JB9 I;  2MWP A;  5CKF A;  1AWJ A;  3H0I A;  2CZ0 B;  2EVR A;  3CXC A;  5IAY A;  5GAN 2;  3AT1 B;  2YUN A;  2HAX A;  2AZV A;  2X4Y A;  1NJI C;  2DLP A;  1TS9 A;  3GP8 A;  3EGD A;  3G4S A;  1O9S A;  1SHG A;  3MO8 A;  4Y28 E;  1R8O B;  1H3Z A;  2JT4 A;  2XKO C;  4FSX A;  2A08 A;  1OZ3 A;  2EQM A;  4JJD A;  2BE7 D;  1H8K A;  1I5O B;  2KT8 A;  5KYU B;  3X25 B;  1JU5 C;  3H0F A;  4BUG A;  1NEB A;  1PD0 A;  5LL6 S;  1E6H A;  2RI2 A;  2GTJ A;  3EGD B;  2OTJ Q;  4M77 C;  3LH5 A;  3PFS A;  5I21 A;  2K79 A;  4DA4 A;  2M16 A;  1X6B A;  2NWM A;  3HP9 A;  4C92 D;  2FYK A;  3CC7 Q;  1ABQ A;  2RHX A;  1MMD A;  3FJ5 A;  1QP3 A;  5LJ5 f;  1NEG A;  1NJI U;  2D8J A;  2K5I A;  3OS2 A;  4Z02 A;  2RA2 A;  1WXU A;  1AZE A;  1GCQ A;  4RG2 A;  2JJ9 A;  2KGT A;  4PK4 A;  2KDS A;  2H8H A;  3LGL A;  4F7U E;  3M55 A;  4RG8 A;  3QZ5 B;  5LJ3 h;  2YRC A;  4XAX B;  2RJF A;  4BI8 B;  3OSS C;  1WHH A;  1YNZ A;  4QVZ A;  2L3R A;  1M1F A;  2YRV A;  3CC4 Q;  1IHW A;  3VS3 A;  2JVV A;  1UFF A;  4FM4 B;  4C8Q C;  3NPF A;  3NTI A;  4E6R A;  1H64 1;  3JB9 G;  5GAM e;  1IRX A;  2HQX A;  4J7I A;  4JJB A;  4EIK A;  1YBY A;  2BUD A;  3OB9 A;  4YTL A;  5GAN 4;  4J9B A;  4HT9 A;  3OYI A;  3VYG A;  2QQS A;  4C5E A;  2CSI A;  3L2Q A;  1WHJ A;  2LMJ A;  4FSS A;  3G6E Q;  4JDS A;  2MPX C;  3G6E A;  1KQS A;  1KHI A;  4PJM A;  1BK2 A;  3RBB B;  2D0Q B;  1UGP B;  2LZ6 B;  2QXF A;  1M3B A;  3CCE A;  1M1K C;  2DBM A;  3RMS A;  3RER A;  1U06 A;  1HXD A;  2YXY A;  4AT1 B;  1SRM A;  1VQ9 A;  2Y4X A;  4L6V 5;  1K76 A;  1NE8 A;  1XJW B;  4PL6 A;  1GCQ C;  5CQX A;  2E70 A;  1YJN A;  1BBZ A;  1MHN A;  1KSW A;  4LXC A;  2DTI A;  2RQU A;  2A0F B;  2DRM A;  3QYH B;  1RAA B;  3EFO A;  2XU8 A;  4C5G A;  1WGS A;  4C0D C;  3EG3 A;  4N4H A;  2HZY A;  5IH2 A;  2DTO A;  1PHT A;  1VQN A;  2GFU A;  2EYW A;  2K6D A;  5HK3 A;  3G1J A;  1BCM A;  4CC2 A;  4PJO G;  2SRC A;  4IUU A;  4OMN A;  2MF2 A;  4JS4 A;  1B34 B;  1AWW A;  4CC7 A;  2KSS A;  2OI3 A;  3QHS A;  3KBG A;  3P8D A;  2MCN A;  3S6W A;  5LJ3 j;  2COW A;  3RNJ A;  1J3T A;  4LDY A;  1BI1 A;  2OTL T;  1CKA A;  1NG2 A;  2RHZ A;  1PKT A;  4WF2 A;  2RJD A;  4RCB A;  1SKU B;  3EG2 A;  4KGX B;  2EW3 A;  4LDX A;  4J6W A;  1K9M R;  4M78 B;  2AZS A;  1Q82 R;  3QWX X;  2E5K A;  3M58 A;  3LW5 E;  4LE9 A;  2LX9 A;  3CCR A;  4EDU A;  3V8L A;  1VQ6 A;  1Y96 A;  1NLP C;  3WXM B;  4A4H A;  4J9E A;  4C8Q B;  2LVM A;  3THK A;  1VQ4 A;  3OYL A;  1UG1 A;  2C06 A;  4N0A C;  1YIT Q;  2WSE E;  4CRI A;  3PGG A;  1OQK A;  1B7T A;  4HCB A;  1OZ2 A;  1VYT A;  2RB6 A;  1ZUK A;  5M9O A;  1G3T A;  3GBQ A;  1I5L A;  1VQ5 T;  4DEX A;  2F2W A;  3MET A;  1LOJ A;  1PD1 A;  1WHK A;  2JS0 A;  4C0D B;  3ZL7 C;  4RMO A;  2F1L A;  3M4G A;  1K9M C;  5KYX A;  3L2R A;  3E9G A;  5FRM A;  1RAI B;  1IXD A;  1BCO A;  2DEU A;  1C1A A;  3E19 A;  3MEV A;  2K3X A;  5CKB A;  1M4Z A;  2Y4Y A;  1YN8 A;  1BI0 A;  3RUX A;  1JO8 A;  2QAZ A;  1YIT T;  1WXT A;  3C95 A;  1M1K U;  1OI1 A;  1WIE A;  4QKU A;  4J9D A;  4PJL A;  1D3B A;  2E41 A;  2AKL A;  3CC2 Q;  2HL5 C;  4NOY A;  2LTO A;  1ZBJ A;  1QCF A;  2BE9 B;  1YCS B;  2KNB B;  2JMA A;  1RAC B;  2CP7 A;  2COY A;  3EHQ A;  4F14 A;  1M90 U;  2RI3 A;  4M7A D;  1IO6 A;  4VUB A;  4A4E A;  2QA4 Q;  4M77 A;  2LJ3 A;  2EBP A;  3R6N A;  4PJO B;  4JLG A;  5FU7 C;  2FZC B;  2OJ2 A;  2ZPB B;  4FW1 A;  1VQ4 T;  4QVC A;  4E7S A;  3QPH A;  1ZSZ B;  4HVW A;  3DLM A;  5KYX B;  1VQM A;  2HBP A;  2O01 E;  4ORZ A;  4HVU A;  4ELY C;  4R56 A;  4M78 E;  2VXE A;  4BAC A;  4IUP A;  3JB9 H;  3QZ9 B;  3UT1 A;  3QG1 A;  4KUD K;  2D1X A;  4KBM B;  1XNI A;  1B07 A;  2W0Z A;  4LDV A;  1T0H A;  4MML A;  1Q86 U;  5GMK m;  1EIF A;  2DXB A;  5IXF A;  3QWY A;  1S1N A;  2FZG B;  3GF5 A;  1R0B G;  2DYB A;  1CSK A;  4II1 A;  2FB7 A;  1M8M A;  3A98 A;  2VGN A;  2XMF A;  3CCM T;  2DX1 A;  3M59 A;  2M9U A;  1TUG B;  1BKB A;  4N0A A;  5FU6 C;  5CO7 A;  2ED1 A;  2PZ1 A;  3GNG A;  5GAO q;  3MKD A;  3T9N A;  2CP5 A;  2WAC A;  1VQ7 Q;  1KC8 R;  2XDD A;  2HQH A;  3L2U A;  2LX7 A;  5D6Y A;  1RL2 A;  4FIB A;  1W1F A;  1PG5 B;  1K8A C;  1ZSG A;  4Q5W A;  5GAN f;  3H9N A;  1K9M U;  4KUI A;  4FYY B;  3O8V A;  1VQO Q;  3E2U A;  3I5S A;  1IRE B;  2JXB A;  3TSZ A;  1ZHI A;  2OX7 A;  1GBR A;  3MEU A;  5GAN 3;  3FIF A;  2PVD B;  3GPL A;  2LP5 A;  3LX7 A;  3CBO A;  4J9H A;  1MUZ A;  3RMQ A;  2LJ1 A;  5FRN A;  3JV3 A;  2DVJ A;  4HT8 A;  3EHR A;  1M2V B;  3EGX B;  4JRQ A;  1NYG A;  4FYX B;  3LLR A;  3CCQ Q;  3CCL T;  1KJW A;  2BIV A;  5FU6 B;  4M77 G;  2HEQ A;  3TVT A;  2D8H A;  5FRO A;  1FMK A;  1MGQ A;  3UPU A;  3VYH B;  1TOV A;  2LDM A;  1D0X A;  3X28 B;  1TU0 B;  3WVD B;  2YUO A;  3FC3 A;  1JEG A;  2X35 A;  4C5H A;  2O9S A;  2EGE A;  2XDB A;  2HQE A;  3VU3 C;  3M0U A;  3LH0 A;  3JCM e;  4QQD A;  1K73 R;  1VQL A;  2JTE A;  2J6F A;  3BDL A;  1NBE B;  2VKN A;  4R0K A;  2C0T A;  1U3O A;  5HKC A;  5CIU A;  5GAN 7;  3CMA Q;  1VYU A;  1Y96 B;  3JAM E;  1QMC A;  2RHI A;  2EJF A;  1VQ8 A;  2O2O A;  2HL3 A;  2EQK A;  2CP0 A;  1VQK A;  2JZ2 A;  3EGX A;  4F7U B;  3PT9 A;  2MYS A;  4M75 A;  3V7S A;  5KYN A;  2L3Q A;  2EJ9 A;  1PSF A;  3RES A;  1EZZ B;  1X69 A;  2E1H A;  1OV3 A;  2JN0 A;  3E9F A;  4XTU A;  2LJ0 A;  4MZP A;  1Q86 R;  3I56 Q;  2B8A A;  1XOV A;  1YHQ Q;  2ZPH B;  1M90 R;  4C8Q E;  2LQ8 A;  5GAM d;  2E65 A;  2YHT A;  1VQN T;  1QVF P;  2LCC A;  4KGZ B;  4F7U G;  2EKO A;  5KYU A;  2CZ6 B;  4FYW B;  4DBR A;  4HCC A;  2K5F A;  2CZ1 B;  4IUR A;  4CI0 C;  2VB6 A;  2V8I A;  2FVU A;  5EG2 A;  1MMA A;  2EYX A;  4WCI A;  2J06 A;  4AG2 C;  2MMP A;  1Q7Y U;  3LYI A;  5A0D A;  5LJ3 g;  4BE2 A;  1SEM A;  3KUF A;  1AOJ A;  2HDA A;  3URG A;  3X20 B;  1G3Y A;  2YRD A;  3CCE T;  2M1H A;  2GQI A;  3CD6 A;  3VS7 A;  3SDZ A;  4LDW A;  3VS0 A;  4ZNX A;  5J39 A;  1JBM A;  2YT6 A;  2DER A;  3OYF A;  1YWP A;  5I2M A;  4TVR A;  1MND A;  3CD6 T;  1GBQ A;  3LWI A;  2DTH A;  4M78 F;  3I55 Q;  1H3H A;  3JSC A;  2BZ8 A;  4Y92 A;  2ATC B;  5GAO r;  1Q81 C;  4OGC A;  4M7D D;  3IQL A;  4N4I A;  1U5S A;  2DNU A;  3CC2 A;  1YIT A;  3PNW C;  4LN2 A;  2KR3 A;  2HKN A;  4J9I A;  2LNV A;  1OPL A;  5I22 A;  1RAH B;  2QQA A;  1Z9Z A;  1TUC A;  1RLQ C;  4R55 A;  2JUF A;  5GAO p;  2ABL A;  2M02 A;  2QK0 A;  3C0C A;  4OVA A;  3JCM Q;  2MK5 A;  1QWF A;  1I81 A;  4DOV A;  2QG9 B;  4CC4 B;  2PTK A;  1LJO A;  5IT9 E;  4DEY A;  4PLI A;  2CH4 A;  4X9C A;  4QVD A;  3OYA A;  1W2B P;  3V7R A;  3J7A F;  2OTL Q;  2QDL A;  3C94 A;  3S3M A;  1B3Q A;  4IUT A;  3QJ6 A;  1KQS S;  3CD6 Q;  2K9G A;  4M75 G;  4JJN K;  3CC4 A;  3SWN C;  4E47 A;  1X6O A;  2RK2 A;  4HCK A;  4C5I A;  4PJO E;  2CZ7 B;  3HKS A;  4BY6 C;  3A8O B;  1AEY A;  3X26 B;  1YIJ T;  3ER0 A;  2JMC A;  2VUB A;  5HK0 A;  4Z8A A;  1Q86 C;  1DJ7 B;  2RPN A;  3HFN A;  4AFS C;  4C92 A;  1FMW A;  4BI3 A;  2GTO A;  1ZUU A;  3EG1 A;  4X34 A;  3PIO A;  3OS5 A;  4NL3 A;  5LJ5 j;  4A4G A;  3PVQ A;  1Q81 U;  1JQQ A;  1YJW A;  2OAW A;  1OX9 A;  3H41 A;  3OYY A;  2EQI A;  1VQ5 A;  4A54 A;  2DL3 A;  1GXI E;  3KFV A;  2QEX T;  2FRY A;  4KT0 E;  3SWN B;  1KC8 U;  3TSW A;  1HD3 A;  4JUV A;  3OYN A;  3QBY A;  4M7A A;  2MIO A;  4M7D E;  2JTM A;  3RDV A;  1KQS P;  1VQP A;  1WZO A;  2G3R A;  1YI2 T;  3SFM A;  4C0F A;  1N27 A;  2KQW A;  3QXE B;  1OEB A;  2GNC A;  1UUE A;  3CCU A;  4RTY A;  2GFA A;  5KYY B;  1BIB A;  2RQW A;  2DXT A;  3MCA B;  2L0A A;  4KH0 B;  3SD4 A;  1UGS B;  4KGV B;  3OBY A;  2DKG A;  4C0G A;  3QYG B;  2CYZ B;  1BB9 A;  3R6O A;  4M77 E;  3G71 T;  4OB2 B;  1PKS A;  4E2F B;  8ATC B;  4BB7 A;  4M7D C;  5CKE A;  2K57 A;  3OW2 A;  4E7J A;  4ZN3 A;  2RNA A;  2FPD A;  8AT1 B;  1YI2 Q;  2DFU A;  1SPK A;  2KBT A;  3FEO A;  5FWC A;  3I55 T;  2F2X A;  2NLU A;  2GGR A;  1YJ9 A;  4RTX A;  3G71 A;  1NYF A;  1MV0 B;  3MHX A;  3O5Z A;  3FRN A;  4BY6 B;  3QO3 A;  2BTT A;  2XHC A;  2O9V A;  1IGQ A;  3V7C A;  3V8K A;  3CBP A;  4PLL A;  2RHU A;  2ZZD A;  3JRZ A;  3NFC A;  1K0S A;  3HPW A;  2A36 A;  1FYN A;  3VUB A;  1TG0 A;  2DAQ A;  4FU6 A;  2NUP B;  3UWN A;  4OB3 B;  3PTA A;  1AZG B;  5GMK j;  1K1Z A;  4F16 A;  4JPB W;  4LUE A;  1V1C A;  3H6Z A;  5GAM f;  2RF0 A;  2E3I A;  5HCK A;  3D7S B;  4M7A B;  3J80 E;  3VJP A;  1MV3 A;  1S72 Q;  4C8Q G;  3TCJ A;  3CEY A;  4KUL A;  1N8R C;  4KRT A;  1ZQ1 A;  2F2V A;  2KRN A;  4M78 G;  2L3S A;  3CCS A;  4D6W A;  1AWO A;  1P92 A;  1FMV A;  1YIJ Q;  5GAM g;  2RK1 A;  1WHL A;  2VC8 A;  4UC4 A;  2K7A A;  3MEA A;  2HD0 A;  2VXF A;  2OTJ T;  1M2V A;  2FRW A;  3NMZ C;  2YDL A;  1WJR A;  4RTT A;  1VQ9 T;  1VQK T;  2XID A;  3RKX A;  3SWN A;  2LCL A;  2K4Y A;  2M51 A;  1UB4 A;  2QA4 T;  2EAY A;  1YP5 A;  1M1G A;  1JXM A;  1PWT A;  3U23 A;  1ARK A;  5CKD A;  1G83 A;  4XU1 A;  1D3B B;  1WLP B;  2NYS A;  5A2Q E;  1D1B A;  3M53 A;  1UJY A;  4M78 C;  2HSP A;  1A0N B;  1JB0 E;  2AT1 B;  1UGR B;  2ZPG B;  2CDT A;  2IG0 A;  5J3B A;  4OB1 B;  1SRL A;  3CME T;  4XTW A;  2ZPF B;  2DD4 A;  2YWW A;  4M4Z A;  2X3X D;  4GLM A;  4C8Q D;  4RTW A;  3OS1 A;  2EFI A;  2LT4 A;  2KE9 A;  3OSV A;  4ATO A;  1IB8 A;  1O75 A;  1SG5 A;  1VQM Q;  3G71 Q;  3HL8 A;  2DPP B;  3TEE A;  4LUD A;  5GMK i;  1D1A A;  2L89 A;  1VQL Q;  1D1C A;  3REA B;  3ZFJ A;  1G3W A;  2JOY A;  5GAN d;  1N9R A;  4BE1 A;  3OYH A;  1G5V A;  4XTY A;  4M75 E;  4JRK A;  4ZN1 A;  3OW2 P;  1M30 A;  3CME Q;  1OU8 A;  4K11 A;  2AKK A;  2HBW A;  3TU4 K;  2P0P A;  1W4S A;  2JNG A;  1C6V X;  4EMH A;  5AT1 B;  1NPP A;  5CAI A;  1TWB A;  5IN1 A;  3BW1 A;  3MPU B;  1PCX A;  1JJ2 P;  3CPW P;  3OY9 A;  1VQ7 A;  4X9D A;  3L1A A;  1M90 C;  1YHQ T;  2VYT A;  2QI2 A;  1UGQ B;  4ESR A;  2JM9 A;  2K3Y A;  3OYE A;  3EFO B;  3OBW A;  1WQW A;  4CC3 A;  1X2K A;  1NPR A;  4MDW A;  1CKB A;  2I0N A;  2L2P A;  5J26 A;  3TRE A;  4M7D G;  2EGA A;  1ABO A;  2EIF A;  1WNL A;  3VS4 A;  2P0K A;  1YJN T;  1W2B S;  1OU9 A;  2E6Z A;  1QCO A;  2MOX A;  2FO0 A;  4M75 B;  2ENM A;  2J05 A;  4M75 D;  2ROL A;  3FB9 A;  4A4K A;  4GBQ A;  2FL7 A;  4XTX A;  4Z88 A;  1PC0 A;  2CUB A;  2DJZ A;  1QP2 A;  4RKU E;  2OAU A;  1K9A A;  4J9G A;  2C0O A;  3UAT A;  2DZ9 A;  1ZBX A;  1GFD A;  1KFZ A;  5I11 A;  4BI4 A;  1U1T A;  1VQ6 Q;  4ANJ A;  2EYY A;  2LQW A;  3CPW S;  4JRP A;  3OYC A;  1LCK A;  4IIM A;  2K2V A;  1LNX A;  3CCJ T;  1QVG A;  3FLG A;  3M4Y A;  4C8Q F;  1VA7 A;  5GAN j;  5GJV B;  3MP6 A;  2JW4 A;  2G6F X;  2RH2 A;  2E12 A;  4OB0 B;  5LJ5 g;  3CMA A;  3CCV Q;  1RAE B;  2NUZ A;  3OW2 S;  2QYZ A;  2LC4 A;  2AIR B;  4A4F A;  1NLO C;  3CCJ A;  3OYJ A;  1RAG B;  2B86 A;  1UEB A;  2KXD A;  5GAN h;  2CSQ A;  1G3S A;  1D0Y A;  3EH2 A;  4BD3 A;  1ZA2 B;  2GF7 A;  3C12 A;  1M8V A;  3A8H B;  2DJQ A;  2EKH A;  4PJN A;  2J7I A;  4OMM A;  3NHN A;  1QQJ A;  3A8G B;  1B34 A;  2SEM A;  3DB4 A;  2DVE A;  1NM7 A;  4IUV A;  1MMN A;  3M0T A;  3CCR T;  3I56 A;  2IIM A;  2DK3 A;  2XG8 D;  1QVF A;  5DM7 R;  2A7Y A;  3BE3 A;  3NGP A;  1Y07 A;  3M56 A;  2DO3 A;  1WHG A;  4AMC A;  1YJW Q;  4HVV A;  2H3J A;  2W10 A;  5DLO A;  2GCX A;  3CCS Q;  2CGH A;  1AT1 B;  1UJ0 A;  4O5V A;  5GAN 8;  3DKM A;  2QEX Q;  2OTL A;  4XK8 E;  4ZGE B;  3M57 A;  1N8R R;  1WX6 A;  1EX4 A;  4ZGJ B;  2J6O A;  1N5Z A;  4LD6 A;  5FW9 A;  2PUK B;  1Y71 A;  3ME9 A;  2EWN A;  3L42 A;  1EFN A;  4F04 B;  3G7Z A;  4L5G A;  4HKE A;  1WJQ A;  2DXU A;  1N9S A;  1VUB A;  4EMK A;  1VQP T;  2A28 A;  4PJO D;  1VIF A;  1QWE A;  2KRM A;  3UDC A;  3BY7 A;  1K73 U;  3A1P A;  1T0J A;  5GJW B;  5ECA A;  4MZT A;  3V8J A;  5L23 A;  3HRS A;  3I56 T;  2K3B A;  3OQ5 A;  4WTO B;  5D6X A;  4C92 C;  2BKD N;  1VOM A;  5CR2 A;  1VQN Q;  1TH7 A;  1KQ1 A;  4FT2 A;  1SSH A;  5I2S A;  2RO0 A;  3FDR A;  3PMT A;  5GAM j;  1G2B A;  3HSB A;  1YWO A;  1PRM C;  4B9X A;  3CCJ Q;  2I2L A;  2DXC A;  4ELZ C;  1VQP Q;  1D0Z A;  5FWB A;  1TSF A;  2LT1 A;  3F70 A;  2M0Y A;  2PVO B;  4QQG A;  2XI9 A;  3VS5 A;  2M0O A;  2O31 A;  3JCM b;  4P5N A;  4J6Y A;  3CC4 T;  1K8A U;  3WVE B;  4A53 A;  1VQL T;  2DE0 X;  3EGU A;  5IHK A;  1ZX6 A;  2LCS A;  2JM8 A;  1I07 A;  1PM3 A;  3SHW A;  3MEW A;  1U1S A;  2XIC A;  4M77 F;  2F69 A;  1RAF B;  4LDU A;  3CCQ T;  4LNP A;  4JRI A;  2AK5 A;  1S72 T;  1RI9 A;  3P8B B;  3LWH A;  4JS5 A;  1M5Q 1;  3HRT A;  2KY9 A;  2LRQ A;  2FG0 A;  5GAO n;  4ZGD B;  3OMG A;  4GLK A;  2HNI A;  1QVG S;  2DZC A;  2E10 A;  1RAD B;  5A0G A;  1KHC A;  4OMP A;  1VQ9 Q;  5EC7 A;  5LJ5 d;  4J6X A;  2YUP A;  2MAM A;  2YSQ A;  2CT3 A;  4L59 A;  5CVI A;  3EFS A;  3QII A;  2DL5 A;  1VYV A;  3CCU Q;  4M7A E;  4QW2 A;  5GAN e;  5IHN A;  2JS2 A;  5GMK l;  1RLP C;  1QVP A;  1W6X A;  2NUP A;  4J8O A;  4F7U F;  3PE0 A;  2L3P A;  1GFC A;  3A8M B;  2V8J A;  2Z0W A;  3JB9 F;  4E7K A;  1OUL A;  2PNI A;  3CC2 T;  2QGG A;  2KYB A;  1JJ2 A;  4C0Z A;  4FL6 A;  1VQ7 T;  2DM1 A;  2FPF A;  4ME7 A;  1AHJ B;  4HA8 A;  3EH1 A;  5IXB A;  3RKY A;  4BDY A;  1BI3 A;  4ZTJ A;  4M7D F;  3CC7 T;  1WXB A;  3PMI A;  3OYG A;  2FZK B;  3M0Q A;  4M78 D;  3QDF A;  4M7A C;  1VQO T;  1M27 C;  1GCP A;  4NL2 A;  1Y0M A;  4PFP A;  4IIO A;  2CP2 A;  2E64 A;  3MP1 A;  1WFW A;  1F1B B;  1XTD A;  2A3L A;  1LPL A;  3VUZ A;  3A8L B;  3ASK A;  4OP0 A;  2RQR A;  4E7Z A;  2ESW A;  1TXQ A;  1QCN A;  2DA9 A;  3JB9 D;  4DBH A;  3GIB A;  1ZLM A;  1M3C A;  4JZ3 A;  4PKC C;  3OA6 A;  2RN8 A;  3M0R A;  2LNH B;  4EMK B;  2QA4 A;  5KCH A;  1HK9 A;  4HCZ A;  3I5R A;  5KYY A;  1VQ5 Q;  2F5K A;  3GOX A;  3MP8 A;  4RUG A;  3CCM A;  1TUD A;  4B6M A;  1Q81 R;  2BZY A;  5GMK e;  2OTJ A;  2MI6 A;  4Y91 A;  3C4S A;  1UDL A;  2P0Q A;  3M0P A;  3G6E T;  4DBQ A;  2COZ A;  4JJC A;  5IHI A;  3CC7 A;  3OS0 A;  4J83 A;  4DQ2 A;  3M54 A;  2EYZ A;  3CMA T;  3EAE A;  1W2B A;  5GAN g;  4NS5 A;  2PVG B;  2HMA A;  3Q1J A;  3JCM d;  1N8R U;  2CH4 W;  2XDP A;  2HKQ B;  5KYW A;  1PRL C;  4RCC A;  4M77 D;  2RJE A;  4C92 E;  4C92 B;  2ZPE B;  1UE9 A;  2RD1 A;  1YIJ A;  2WSC E;  3CXC P;  2X3W D;  4FYV B;  2CKK A;  2YUQ A;  1I1J A;  2KVQ G;  2X51 A;  7AT1 B;  1VIE A;  3KXT A;  4AG1 C;  1HSQ A;  1VQ6 T;  1GRI A;  4PJO C;  3TQ7 P;  4N4G A;  5DY9 A;  2DF6 A;  1KK7 A;  5L8R E;  5LJ3 e; 
#chains in the Genus database with same CATH homology
 1WNL A;  4F7U B;  3PT9 A;  4M75 A;  3V7S A;  2P0K A;  2EJ9 A;  2RI5 A;  1PSF A;  3RES A;  3INZ A;  3X25 B;  5C0M A;  1YJN T;  1W2B S;  2E6Z A;  2E1H A;  2JN0 A;  4M75 B;  3JCM P;  3E9F A;  1QVF S;  4QQ6 A;  4BUG A;  5LJ5 h;  4XTU A;  4M75 D;  5LL6 S;  1N6A A;  4MZP A;  2RI2 A;  3QKJ A;  3FB9 A;  4A4K A;  2FL7 A;  4XTX A;  4J7F A;  4M77 C;  1X01 A;  2L8D A;  3PFS A;  2B8A A;  5I21 A;  4DA4 A;  2M16 A;  2QQ9 A;  1XOV A;  2DJZ A;  1QP2 A;  2ZPH B;  4RKU E;  2OAU A;  3CBM A;  4C8Q E;  3HP9 A;  2LQ8 A;  2QQB A;  4C92 D;  2FYK A;  5GAM d;  4LD9 K;  2E65 A;  2YHT A;  2DZ9 A;  1VQN T;  1ZBX A;  2RHX A;  2R57 A;  4V2S A;  2LCC A;  4O6J A;  1QP3 A;  3VV0 A;  4BI4 A;  5LJ5 f;  4F7U G;  1U1T A;  2EKO A;  2CZ6 B;  1NJI U;  4M78 A;  2R5M A;  3CPW S;  4JRP A;  4HCC A;  2K5I A;  2K5F A;  3OS2 A;  2CZ1 B;  4Z02 A;  1YJ9 T;  4IUR A;  2RA2 A;  4CI0 C;  2XD0 A;  4PJO F;  3OYC A;  4RG2 A;  2K2V A;  1LNX A;  3JCM X;  3CCJ T;  2V8I A;  2FVU A;  5EG2 A;  1QVG A;  3FLG A;  3M4Y A;  2X4J A;  1SSF A;  4C8Q F;  2KDS A;  2WSF E;  2PUO B;  1Y7X A;  2K5L A;  5GAN j;  2MMP A;  1Q7Y U;  3LGL A;  3LYI A;  3OYB A;  4F7U E;  3M55 A;  3MP6 A;  4RG8 A;  3QZ5 B;  5A0D A;  4OGE A;  5LJ3 h;  2RH2 A;  5LJ3 g;  4XAX B;  4BE2 A;  2RJF A;  2E12 A;  4OB0 B;  5LJ5 g;  3CMA A;  4MDX A;  3KUF A;  3OSS C;  4BI8 B;  1Q82 C;  4QVZ A;  3URG A;  3X20 B;  1G3Y A;  2L3R A;  1FXX A;  1M1F A;  2V8K A;  2YRV A;  5CQY A;  3OW2 S;  3M5A A;  2JVV A;  3CCE T;  2M1H A;  2LC4 A;  4FM4 B;  4C8Q C;  3CD6 A;  3PIP A;  2IVW A;  4BDZ A;  1YHQ A;  3NTI A;  3SDZ A;  4A4F A;  4LDW A;  5KH6 A;  1KC8 C;  5J39 A;  3CCJ A;  1JBM A;  1H64 1;  1KD1 C;  3OYJ A;  3JB9 G;  5GAM e;  4DOW A;  3OYF A;  1UEB A;  2HQX A;  4J7I A;  5GAN h;  2O4X A;  3CCS T;  1JJ2 S;  1G3S A;  2YLB A;  4TVR A;  5I2M A;  4XQ3 A;  1VQO A;  3CD6 T;  1YBY A;  3JCM W;  2BUD A;  1OYX A;  3LWI A;  2DTH A;  4M78 F;  4BD3 A;  3JSC A;  3OB9 A;  4YTL A;  5AYF A;  2GF7 A;  3C12 A;  5GAN 4;  5GAO r;  1Q81 C;  4OGC A;  4M7D D;  1M8V A;  3A8H B;  4N4I A;  3CC2 A;  5FU7 B;  5LJ3 d;  1YIT A;  4HT9 A;  3QSU A;  3PNW C;  3OYI A;  3VYG A;  2QQS A;  3NTK A;  4C5E A;  3L2Q A;  5GAN 6;  4JDS A;  3OYK A;  5KE3 A;  3G6E A;  2LNV A;  4FT4 A;  3JB9 J;  1U8R A;  1KHI A;  3A8G B;  1B34 A;  1KQS A;  4M7A G;  3DB4 A;  2QQA A;  1WPY A;  3QDR B;  4R55 A;  2DVE A;  2D0Q B;  2JUF A;  5GAO p;  1UGP B;  4XU3 A;  2QXF A;  4IUV A;  3CCR T;  4J5Y A;  3CPF A;  4OVA A;  3JCM Q;  3I56 A;  3CCV T;  5FLX E;  3CCE A;  1M1K C;  2DK3 A;  2XG8 D;  3RMS A;  1QVF A;  3RER A;  4ZTF A;  1I81 A;  4DOV A;  1HXD A;  2DEQ A;  2EQJ A;  2A7Y A;  5GMK h;  5DM7 R;  1LJO A;  5IT9 E;  1VQ9 A;  4PLI A;  2Y4X A;  4QVD A;  4X9C A;  4L6V 5;  3OYA A;  3J7A F;  3V7R A;  1NE8 A;  1Y07 A;  2DO3 A;  3M56 A;  4F7U A;  3M9Q A;  3C94 A;  3S3M A;  4PL6 A;  5CQX A;  2H3J A;  2E70 A;  1YJN A;  5DLO A;  1MHN A;  2GCX A;  4IUT A;  1WQ7 A;  3QJ6 A;  2CGH A;  2DD5 A;  2DTI A;  2VV5 A;  3QYH B;  1KQS S;  2X4W A;  2XU8 A;  3CCU T;  4O5V A;  4C5G A;  2QDY B;  4M75 G;  5LJ3 j;  1WGS A;  3I55 A;  4JJN K;  5GAN 8;  3SWN C;  5CKH A;  1X6O A;  2RK2 A;  3DKM A;  4C0D C;  4C5I A;  4E47 A;  3CC4 A;  4PJO E;  2CZ7 B;  4N4H A;  3HKS A;  5DLQ E;  3A8O B;  4XK8 E;  4BY6 C;  2OTL A;  4M7A F;  4ZGE B;  3X26 B;  3M57 A;  2DTO A;  2FHD A;  4PJO A;  4ZGJ B;  1YIJ T;  3ER0 A;  2VUB A;  5HK0 A;  4LD6 A;  1VQN A;  2GFU A;  2GQV A;  1Q86 C;  3RIR A;  1DJ7 B;  3HFN A;  4M77 B;  5CK9 A;  4C92 A;  2ZCF B;  2PUK B;  3JCM h;  5HK3 A;  1Y71 A;  3ME9 A;  2EWN A;  4BI3 A;  3L42 A;  4PJO G;  3VKI A;  2QEX A;  1M9S A;  3G7Z A;  3BDU A;  4IUU A;  3BFM A;  4L5G A;  3FJP A;  4X34 A;  3PIO A;  3OS5 A;  4HKE A;  2MF2 A;  4JS4 A;  1B34 B;  1PSE A;  2KSS A;  4NL3 A;  1BYM A;  3QHS A;  1RI0 A;  3KBG A;  1WJQ A;  3P8D A;  3HHT B;  2DXU A;  1N9S A;  1VUB A;  3S6W A;  2D9T A;  4A4G A;  4LDY A;  4EMK A;  1BI1 A;  5LJ5 j;  1VQP T;  1YJW A;  1Q81 U;  2OTL T;  1VIF A;  2RHZ A;  4WF2 A;  4PJO D;  1YJW T;  2RJD A;  3UDC A;  3OYY A;  3BY7 A;  4RCB A;  3CCL A;  1K73 U;  2AHJ B;  2CS7 A;  1VQ5 A;  4LDX A;  4MZT A;  3V8J A;  4A54 A;  3HRS A;  4XTZ A;  4J6W A;  1GXI E;  3OMC A;  1BI2 A;  4M78 B;  1WJS A;  2QEX T;  3I56 T;  2R58 A;  4KT0 E;  3SWN B;  3S3N A;  1KC8 U;  3OQ5 A;  4JUV A;  3OYN A;  4M7A A;  3QBY A;  4E7L A;  5D6X A;  4C92 C;  5A0L A;  3EFR A;  2BKD N;  3M58 A;  4M7D E;  3LW5 E;  2JTM A;  2LX9 A;  2R5A A;  5CR2 A;  2RHY A;  4XTV A;  1TH7 A;  1KQ1 A;  4FT2 A;  4M75 F;  3CCR A;  3CCV A;  1Q82 U;  1VQP A;  2EQU A;  4EDU A;  4M7D A;  2G3R A;  1YI2 T;  2E5Q A;  3V8L A;  5I2S A;  3G4S T;  3SFM A;  5KCO A;  1VQ6 A;  2RO0 A;  3FDR A;  3HRU A;  4C0F A;  1N27 A;  1Y96 A;  2KQW A;  3PMT A;  3QXE B;  5CCA A;  3WXM B;  4A4H A;  1QW1 A;  5GAM j;  1Q7Y C;  3HSB A;  1XQH A;  3CCU A;  4C8Q B;  2GFA A;  4IUQ A;  1BIB A;  2LVM A;  2KAF A;  4B9X A;  1VQ4 A;  2I2L A;  2DXC A;  2DXT A;  3DB3 A;  3OYL A;  5HY6 A;  2C06 A;  2PQW A;  4N0A C;  1KG1 A;  3MCA B;  2WSE E;  4CRI A;  3PGG A;  4ELZ C;  3SD4 A;  4HCB A;  1UGS B;  2LT1 A;  1OZ2 A;  2E6N A;  2RB6 A;  3P8H A;  4MZM A;  5M9O A;  3OBY A;  1G3T A;  2DKG A;  2P4T A;  4C0G A;  3F70 A;  1I5L A;  1VQ5 T;  3QYG B;  2CYZ B;  2DIG A;  3MET A;  1LOJ A;  2PVO B;  4QQG A;  2XI9 A;  3R6O A;  4C0D B;  1VQM T;  3N5B B;  5LJ3 f;  1FWZ A;  2M0O A;  4M77 E;  4RMO A;  3G71 T;  3JCM b;  3M4G A;  4OB2 B;  4P5N A;  1K9M C;  2ZGW A;  4J6Y A;  3L2R A;  3CC4 T;  3E9G A;  1K8A U;  5FRM A;  3NTH A;  3WVE B;  4A53 A;  4EPC A;  2JTF A;  1VQL T;  4BB7 A;  4M7D C;  4EMG A;  4MMK A;  3E19 A;  5CKE A;  2K57 A;  3OW2 A;  2VGM A;  4E7J A;  4ZN3 A;  3MEV A;  2K3X A;  5GAN 5;  1X75 C;  5CKB A;  1VQ8 T;  3JCM g;  2D6F A;  3MEW A;  1M4Z A;  1U1S A;  2XIC A;  1KQ2 A;  4M77 F;  2F69 A;  2PU9 B;  2Y4Y A;  2QTX A;  3E1S A;  4LDU A;  4EMK C;  3J81 E;  3L2W A;  1BI0 A;  3FEO A;  3CCQ T;  4JRI A;  3I55 T;  3RUX A;  1S72 T;  2YLC A;  2NLU A;  1YJ9 A;  3G71 A;  3P8B B;  3MHX A;  3LWH A;  4JS5 A;  5LJ5 e;  2KK4 A;  1M5Q 1;  1YIT T;  3HRT A;  3C95 A;  2KY9 A;  1M1K U;  2LRQ A;  1OI1 A;  3FRN A;  3QO3 A;  4BY6 B;  2XHC A;  3V7C A;  4ZGD B;  5GAO n;  3OMG A;  1D3B A;  3CBP A;  4GLK A;  2E41 A;  2RHU A;  4PLL A;  3V8K A;  2ZZD A;  3JRZ A;  1YI2 A;  2HNI A;  3NFC A;  3HPW A;  2LTO A;  4NOY A;  1QVG S;  2DZC A;  2E10 A;  1FX7 A;  5KE2 A;  3VUB A;  5A0G A;  1I8F A;  1KHC A;  3GNF B;  2XK0 A;  2DAQ A;  4FU6 A;  3JCM J;  3UWN A;  5LJ5 d;  4OB3 B;  1YCY A;  4J6X A;  5C6S A;  3PTA A;  3L2Z A;  5GMK j;  2MAM A;  1M90 U;  2RI3 A;  4M7A D;  4M7D B;  4VUB A;  4A4E A;  3AHU A;  4E7I A;  3H6Z A;  5GAM f;  4M77 A;  4PNO A;  4L59 A;  5CVI A;  3EFS A;  3QII A;  1JRI A;  4PJO B;  4M7A E;  4M7A B;  3J80 E;  4JLG A;  5FU7 C;  3VJP A;  1KD1 U;  4C8Q G;  4QW2 A;  3TCJ A;  3CEY A;  2ZPB B;  5GAN e;  4KUL A;  2DIQ A;  1N8R C;  1VQ4 T;  3OYM A;  4QVC A;  1ZQ1 A;  4M78 G;  5GMK l;  3CCS A;  4D6W A;  1QVP A;  3QPH A;  1P92 A;  5GAM g;  2RK1 A;  4J8O A;  4F7U F;  1NZ9 A;  2VC8 A;  4UC4 A;  3A8M B;  2V8J A;  3DLM A;  3JB9 F;  4E7K A;  2Y90 A;  1VQM A;  2HBP A;  1K73 C;  3MEA A;  3CC2 T;  2O01 E;  2HD0 A;  1JJ2 A;  2VXF A;  4C0Z A;  2OTJ T;  4ELY C;  3ZEH A;  4FL6 A;  5GAO m;  3CCQ A;  1VQ7 T;  3CME A;  4R56 A;  4M78 E;  2VXE A;  3JB9 H;  4ME7 A;  3JCM c;  1AHJ B;  4HA8 A;  1WJR A;  1VQ9 T;  4BAC A;  1VQK T;  2XID A;  4IUP A;  3RKY A;  4BDY A;  1BI3 A;  3RKX A;  1V29 B;  3QZ9 B;  3UT1 A;  4ZTJ A;  3CC7 T;  3QG1 A;  3CXC S;  2EYQ A;  3SWN A;  4KUD K;  4M7D F;  2LCL A;  4KBM B;  1XNI A;  3S3O A;  3PMI A;  2K4Y A;  3OYG A;  4LDV A;  1UB4 A;  4M78 D;  3H8Z A;  2QA4 T;  2EAY A;  4M7A C;  1VQO T;  4MML A;  3A5Z B;  1M1G A;  4NL2 A;  1Q86 U;  5GMK m;  2E64 A;  1EIF A;  3MP1 A;  2DXB A;  5CKD A;  1S72 A;  1XTD A;  2A3L A;  4XU1 A;  1D3B B;  5A2Q E;  3VUZ A;  3A8L B;  3M53 A;  3GF5 A;  4M78 C;  3CPW A;  2ZPI B;  4II1 A;  2FB7 A;  1JB0 E;  1UGR B;  3ASK A;  4OP0 A;  3X24 B;  5GAM h;  2VGN A;  3CCM T;  3M59 A;  2ZPG B;  5GAO l;  3QJY A;  2IG0 A;  3L2V A;  5J3B A;  3JCM f;  3JB9 D;  4OB1 B;  2M9U A;  3GIB A;  1BKB A;  4N0A A;  5FU6 C;  5CO7 A;  3OYD A;  3CME T;  3GNG A;  4XTW A;  2ZPF B;  5GAO q;  2DD4 A;  4E7H A;  4GY5 A;  3T9N A;  2WAC A;  4PKC C;  3OA6 A;  2L5Q A;  3DLL A;  2F5T X;  2XDD A;  4C8Q D;  3L2U A;  1I4K 1;  3QUI A;  5D6Y A;  3OS1 A;  1RL2 A;  2EFI A;  4FIB A;  4EMK B;  1K8A C;  2QA4 A;  2LT4 A;  5KCH A;  4Q5W A;  1HK9 A;  4HCZ A;  5GAN f;  2RJC A;  3OSV A;  1K9M U;  4KUI A;  3JCM V;  4C8Q A;  4ATO A;  1O75 A;  2F5K A;  3HFO A;  3GOX A;  3O8V A;  3MP8 A;  3CCM A;  3RKW A;  1IRE B;  4JLI A;  3ZBD A;  1ZHI A;  4IKF A;  3HL8 A;  2DPP B;  3MEU A;  4M75 C;  3TEE A;  2EJG A;  5GAN 3;  5GMK e;  2OTJ A;  3FIF A;  5GMK i;  2PVD B;  4C92 F;  3GLX A;  2MI6 A;  3GPL A;  3LX7 A;  2L89 A;  2RM4 A;  3C4S A;  3CBO A;  2P0Q A;  4Y91 A;  2LQK A;  3RMQ A;  3ZFJ A;  5FRN A;  4XU2 A;  3G6E T;  1G3W A;  2JOY A;  2O4X B;  1N9R A;  4OMF B;  5GAN d;  3SB2 A;  4XU0 A;  3CC7 A;  4BE1 A;  3OS0 A;  3OYH A;  4J83 A;  4DQ2 A;  4XTY A;  4HT8 A;  2MWO A;  4M75 E;  1G5V A;  1IZ6 A;  3M54 A;  5D6W A;  4JRK A;  3CMA T;  4ZN1 A;  4JRQ A;  3EAE A;  4OF1 A;  1W2B A;  5GAN g;  3LLR A;  3CCL T;  2BIV A;  3LGF A;  5FU6 B;  4NS5 A;  2PVG B;  4M77 G;  4BE0 A;  4C92 G;  3TU4 K;  3Q1J A;  3JCM d;  2P0P A;  1W4S A;  2JNG A;  1N8R U;  5FRO A;  1MGQ A;  3UPU A;  3VYH B;  2X4X A;  2XDP A;  4B9W A;  2LDM A;  3X28 B;  2KMT A;  4RCC A;  4EMH A;  1BIA A;  4M77 D;  1NPP A;  2QQR A;  5CAI A;  2RJE A;  3WVD B;  3FC3 A;  2X35 A;  5IN1 A;  4C5H A;  4C92 E;  4C92 B;  2MWP A;  3BW1 A;  3JB9 I;  2ZPE B;  5CKF A;  3OY9 A;  1VQ7 A;  4X9D A;  3L1A A;  2CZ0 B;  2RD1 A;  2HQE A;  3VU3 C;  1M90 C;  2XDB A;  3LH0 A;  1YIJ A;  2WSC E;  3JCM e;  1YHQ T;  4QQD A;  1VQL A;  3BDL A;  2VYT A;  2QI2 A;  1UGQ B;  2CKK A;  3CXC A;  5IAY A;  2K3Y A;  5GAN 2;  3OYE A;  2KVQ G;  3OBW A;  2HAX A;  2X4Y A;  1NJI C;  3KXT A;  1VIE A;  1WQW A;  3GP8 A;  5HKC A;  3G4S A;  1VQ6 T;  1NPR A;  1O9S A;  3MO8 A;  4MDW A;  5CIU A;  5GAN 7;  1Y96 B;  4PJO C;  5LJ3 e;  4N4G A;  3JAM E;  4Y28 E;  2RHI A;  5DY9 A;  1R8O B;  2EJF A;  1H3Z A;  1VQ8 A;  2EQK A;  5J26 A;  3TRE A;  4M7D G;  1VQK A;  5L8R E;  2JZ2 A;  2XKO C;  4FSX A;  1OZ3 A;  2EQM A;  2EIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...