2IG0A

Structure of 53bp1/methylated histone peptide complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Structural Basis for the Methylation State-Specific Recognition of Histone H4-K20 by 53BP1 and Crb2 in DNA Repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ig0A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ig0A01
4C5HA 4EDUA 4N4HA 3S3MA 3CCEA 3HKSA 4Z02A 4A4FA 5FLXE 2MWPA 3OS1A 3PFSA 3CC4T 3CCET 4TVRA 3QIIA 3L2UA 2VYTA 2RHZA 1JJ2S 4CRIA 2E6ZA 4BE1A 2RHYA 1IZ6A 3C4SA 3UT1A 3CCMA 4Q5WA 3LGFA 3BDLA 3OYBA 4BE0A 2HQEA 2L3RA 3H6ZA 1X6OA 3PIOA 3CC2A 2L89A 1N27A 1WJSA 5KCHA 3OS2A 1YITA 1N8RU 2RHUA 3I55T 3CC2T 3KUFA 5KE3A 3CMAA 2JVVA 1YITT 4ZN1A 4IUPA 5CIUA 4LD6A 2LQ8A 3LYIA 2BKDN 3CMAT 2E5QA 3FEOA 3CXCA 2K3YA 4ZN3A 3OYNA 3OW2A 4OVAA 1W2BS 3S3OA 1YBYA 4BDYA 2CKKA 1M1KC 3CC7A 2QA4A 3DLLA 1VQNA 1YI2T 4A4EA 3OYYA 3MO8A 2PQWA 3CD6A 2LDMA 1M1GA 1G5VA 2QA4T 1VQNT 5KE2A 3OYLA 4PL6A 1Q81U 4IUUA 3CD6T 2EFIA 3P8HA 3E9GA 4E7LA 2RI3A 3H8ZA 2RI5A 3CCJA 2RHIA 3KBGA 2LRQA 3MEWA 3MP1A 1YJNA 3PMTA 2EQMA 5D6YA 1QVFS 1N8RC 4A4GA 3CCJT 2X4XA 1KD1U 3OYJA 4YTLA 1Q7YU 2JUFA 1YJNT 4IUVA 4C5IA 2EQUA 3G71A 1VQ7T 3LLRA 4FL6A 2OTLA 4UC4A 3OYCA 1NZ9A 4E7IA 1VQKA 1VQLA 3G71T 1WGSA 3MP6A 2GFUA 2NLUA 3I56A 4E7KA 3CPWA 2OTLT 4QQDA 1VQLT 3OMGA 2R57A 3UWNA 1WJQA 4QVZA 3QJ6A 2OTJA 3I56T 2GF7A 2LTOA 3OY9A 4IUTA 2RJCA 1NJIC 1K73U 3OYKA 1XNIA 2G3RA 3S6WA 3OS0A 1VQPA 2OTJT 3CMEA 2GFAA 4C5EA 2IG0A 2YRVA 2X35A 4PLLA 1KC8U 1Q81C 3FC3A 2EKOA 1K9MU 3OYHA 1YHQA 3CCMT 4FU6A 1QVGS 1OI1A 1SSFA 1VQPT 2M1HA 3E9FA 3CMET 1YIJA 1WJRA 3Q1JA 2DIQA 3OYAA 5J39A 3F70A 3OA6A 1YHQT 1M90C 1OZ3A 4PLIA 1S72A 1JJ2A 2LCLA 4ZTJA 2M16A 2JNGA 2RHXA 1VQ8A 2K3XA 3MEUA 2RJEA 4NS5A 3MEAA 1Q7YC 3OYMA 2RJFA 2L8DA 1VQMA 3J80E 3ER0A 4QQ6A 3G4SA 4A4HA 1VQ8T 2HQXA 2JOYA 3DB3A 3PNWC 1XTDA 3NTIA 4E7JA 2D9TA 5FRNA 3QKJA 4BE2A 4RG2A 3CCRA 4IURA 2EIFA 3L42A 2LCCA 3L2RA 2RJDA 3FDRA 3CC7T 3CCRT 2DIGA 3NTKA 2XHCA 2XDPA 3OYGA 3L2VA 2JZ2A 4BACA 3L2QA 1YJ9A 1W2BA 1H3ZA 5C0MA 3FLGA 3MEVA 5FRMA 2RO0A 2F5KA 3CCSA 1Q82U 4BDZA 1Q86U 1YJ9T 3J81E 5IAYA 2R5MA 1EIFA 2X4WA 4C5GA 3CCLA 1KHIA 4HCZA 1OZ2A 5KCOA 2LVMA 4N4IA 2EQKA 3LGLA 3QBYA 5A2QE 5IN1A 5FROA 3PIPA 3META 4B9WA 1BKBA 1VQKT 2KDSA 2E70A 4II1A 3CCQA 3CC4A 4N4GA 1QVFA 1M1KU 5J3BA 5J26A 3CCQT 3OQ5A 3O8VA 2DAQA 1VQ9A 3OYIA 3OYFA 1VQ5A 5M9OA 2O4XB 3A5ZB 2BIVA 1NPPA 3G6EA 3CEYA 3P8DA 3CXCS 1VQ9T 1VQ5T 2P0KA 3OW2S 3PMIA 2E6NA 3JAME 4IUQA 3G6ET 1K8AU 3MP8A 3I55A 5KH6A 3LX7A 1YIJT 1Q82C 3OYDA 1Q86C 2EQJA 1KD1C 4QQGA 3EAEA 3CPFA 4X34A 2QQRA 1S72T 3OMCA 3CCVA 1VQ6A 4GY5A 4QW2A 2R5AA 2WACA 4L59A 3LH0A 4E7HA 5D6WA 1VQMT 1KQSS 3CCUA 3CCVT 3G4ST 1QVGA 1VQ6T 3ZEHA 2BUDA 5DLQE 5IT9E 3SD4A 3NTHA 3ME9A 2QEXA 2FHDA 1YI2A 3CCUT 1UEBA 2M0OA 3DB4A 2KVQG 5C6SA 2XK0A 5DM7R 3OYEA 2JTFA 2RI2A 1VQOA 2QEXT 1K73C 5HY6A 1NJIU 1YJWA 2MI6A 5LL6S 1VQOT 1KC8C 1VQ4A 3M9QA 1K9MC 5D6XA 2B8AA 1YJWT 1RI0A 3S3NA 2QQSA 3J7AF 1KQSA 2R58A 2X4YA 4ZTFA 3GOXA 2MWOA 4B9XA 3L2WA 2DO3A 1VQ4T 3CCST 3OB9A 3CPWS 2O4XA 1K8AC 1M90U 3DLMA 3ASKA 1MHNA 1RL2A 3CCLT 4IKFA 1KHCA 1NPRA 1VQ7A 4BD3A 1OYXA 3TREA 3P8BB
chains in the Genus database with same CATH superfamily
1RAFB 3ZFJA 4C5HA 2KR3A 5CK9A 3QUIA 4QVCA 3CCEA 1M2VA 3HKSA 5FWCA 5FWBA 4HVVA 4A4FA 2M9UA 1QVGP 3PE0A 2L3QA 3LWIA 5KYYA 1PSEA 1RLQC 3CCET 1BIAA 1UE9A 4PJJA 2LP5A 2A28A 1GFCA 1WFWA 2RHZA 4F04B 4BE1A 1I5OB 4M78C 2EYXA 2RHYA 3E1SA 1MNEA 1B34B 4HVWA 3UT1A 2AZSA 4F7UB 1SSHA 2H8HA 1OX8A 4BE0A 1WLPB 2P0QA 3EG0A 3HFNA 2RF0A 3M0RA 5GMKl 2KROA 1WJSA 4F7UF 2P0PA 3RDVA 2OAUA 4M78D 4PJOA 3VS5A 4JJNK 2IPOB 2XIDA 1KQSP 2CT3A 3KUFA 1PCXA 4VUBA 1LCKA 4RTYA 2JN0A 2D8JA 1M8MA 4IUPA 1RAAB 3M57A 1ABQA 5CIUA 4LD6A 1TWBA 1LNXA 2BE7D 2BKDN 3RESA 3JB9H 3THKA 1Q81R 3CCQQ 2HMAA 2K3YA 5CQXA 3G1JA 4ORZA 3RKYA 2GTOA 2DL4A 4DBRA 2RNAA 1W2BS 4QVDA 3S3OA 3JCMQ 2HKQB 3HSBA 4M77B 2CS7A 1WDXA 3M0PA 3X20B 4C8QC 1PRLC 2CP3A 4BDYA 3M58A 1M1KC 2CH4A 1YI2T 2DE0X 2E3IA 2PQWA 3VUBA 2VKNA 1Q7YR 1G5VA 5KE2A 3EGUA 4C8QD 2MMPA 4GLMA 3V7RA 4MZMA 2AZVA 2DBKA 4A54A 3H8ZA 1UGRB 3A8LB 4E6RA 1V76A 1BI0A 5FU6B 1QCNA 3RNJA 2EYWA 4KUIA 4PFOA 4AG1C 4B6MA 4E2FB 1VQ6Q 4KH0B 1SG5A 2HDAA 2E1HA 3OYJA 4IUVA 4C5IA 3EGXA 2EQUA 4PK4A 3G71A 3TQ7P 2MPXC 1VQ7T 4DBQA 4HVUA 4NOYA 5GANd 4FL6A 4OGCA 4KT0E 4UC4A 5LJ5e 2L3PA 4J9CA 2E64A 5HCKA 3G71T 2HSPA 2RMOA 2KAFA 3G7ZA 1FX7A 1UUEA 2KT8A 2DLPA 2K2MA 1NYFA 4Y92A 2CZ7B 2BZYA 2V8KA 2RK1A 3VS6A 1H641 1YFNA 3FJ5A 1RAHB 3UWNA 1ABOA 2HD0A 2GF7A 2LTOA 2PZ1A 4M77G 2CP6A 2L0AA 2RJCA 3X25B 1K73U 2CP7A 2E12A 4M78E 2W0ZA 2FRYA 2NWMA 3S6WA 1GCQC 1VQPA 3EG9A 2EYQA 1T0HA 2YRVA 4XAXB 3FC3A 4M78A 1K9MU 4ZGJB 3AHUA 2M1HA 1VQPT 3E9FA 4FT4A 2BE9B 2NUPA 3Q1JA 1QQJA 1X69A 3F70A 2DD5A 3OA6A 1CKBA 2D1XA 1U06A 3M56A 4FYWB 4X9DA 2WSCE 2RHXA 5GAOn 1YCYA 4PJMA 3MEAA 1X2QA 3OYMA 4FYYB 4ME7A 4QQ6A 2QI2A 5CKHA 3ULRB 3A8OB 2SRCA 1XTDA 4IIMA 1BI3A 4OGEA 1W70A 1GCPA 3RMSA 4RG2A 2DL5A 2AKLA 1Q86R 2XD0A 5GAN2 3GBQA 2LJ1A 4C8QA 2Z0WA 4CC3A 2KBTA 3CCMQ 1MMAA 1TUCA 2DIGA 3JCMV 5L23A 2XHCA 1AOJA 1XOVA 2XDPA 3QG1A 3CMEQ 3EG3A 1XQHA 4BI3A 5I21A 2JZ2A 2MIOA 3M4YA 5IXFA 4C0FA 2CDTA 3C94A 1W2BA 4DA4A 2HNIA 2F5KA 1X2KA 1CKAA 4BDZA 3UPUA 3J81E 2ZPHB 4ZNXA 4HKEA 1TOVA 1K73R 1KHIA 4XQ3A 1UHCA 1E6GA 4C0DB 2HSEB 1JXOA 4HCZA 2LVMA 3X28B 5GAMh 2C0IA 2EQKA 5A2QE 5I2MA 1NLOC 1XJWB 4J5YA 1K9MR 2DM1A 1OULA 3A98A 2JS2A 4JJCA 2VVKA 3CCQA 5GMKe 3M54A 2KRNA 3EH2A 1KK7A 2F1LA 1ARKA 1M27C 5J3BA 4Z89A 5LJ5d 1IHVA 3CCQT 2FVUA 1WHKA 2DX1A 3PGGA 1NEGA 1C1AA 2O4XB 1X43A 3QDRB 3VUZA 2COZA 2O2OA 2F2XA 1QVPA 2P0KA 1KSWA 3PMIA 4JS4A 3JAME 1GCQA 2VUBA 1ZHIA 4MDWA 1PSFA 1K8AU 1RAGB 3H0IA 4A53A 2DPPB 5KH6A 3JB9I 1W2BP 3LX7A 1SRMA 1QMCA 4K11A 2Y4XA 2KT1A 3RMQA 3MCAB 3JSCA 2QQBA 2Y4YA 2QQRA 1S72T 3OMCA 3KXTA 1VQ6A 4GY5A 2GBQA 5FU6C 2WACA 3E19A 2DZCA 2ESWA 1E6HA 2YSQA 1IGQA 2LMJA 4E7HA 5D6WA 2DKGA 1KQSS 3RUXA 3ZEHA 1VQ6T 4LDYA 4MDXA 3NTHA 3ME9A 2FHDA 3VV0A 4A63B 3EHQA 1UEBA 3CBMA 3OBWA 4EMKB 2K57A 1QP2A 4CI0C 5DM7R 2D0NA 3JCMP 2LQKA 2YUOA 1B07A 1I81A 2COWA 3VYHB 3VS3A 1YIJQ 3NGPA 3M9QA 1MV3A 1MMDA 1RI0A 3QWYA 4AFZC 4NL3A 2QTVA 1TTHB 5CKFA 4ZTFA 1U8RA 3RIRA 8ATCB 5CKDA 2DO3A 2LT4A 1AWWA 1K8AC 4XU3A 1IHWA 4J83A 1VQ8Q 2DYIA 4F7UE 5GAN3 1QCFA 1VQMQ 5A0GA 1MHNA 3CCLT 1KHCA 4RKUE 1ZX6A 4FW2A 1B34A 2RQRA 4F7UA 3HHTB 1WXUA 3P8BB 4LN2A 5AT1B 3CCRQ 4N4HA 2QK0A 5GAMg 3HRSA 4Z02A 2X3XD 2KY9A 5FLXE 3OS1A 3JCMh 3CC4T 2FZGB 1BYMA 3RR6A 5EC7A 2E6ZA 1UFFA 4M77E 2ROTA 2DJQA 2CYZB 3CCSQ 3CCMA 3LGFA 1KQ2A 3BDLA 3SDZA 1QW1A 3H6ZA 2PNIA 2PVDB 5KYUB 5KCHA 2ZPBB 3I55T 2DXCA 2DTIA 3SHWA 4JJBA 4LUEA 5CVIA 4HCKA 2MAMA 4WF2A 2LNHB 5GANj 2EWNA 1MGQA 3FEOA 1PG5B 1ZUUA 2QXFA 1M1FA 1WNLA 1UTIA 4ZN3A 3OYNA 3L2ZA 4PKCC 4M7DG 4C0DC 2F69A 2LC4A 4PNOA 1BCOA 1YBYA 1SEMA 2CKKA 2CT4A 4LUDA 1AVZC 2DL3A 2ZCFB 1PKSA 2K3BA 2EJ9A 2KGTA 2K5FA 4KH1B 2COYA 5DY9A 5KYWA 2E5KA 1Q81U 3D7SB 2XI9A 1M30A 3NPFA 2FPDA 1KQ1A 1YWOA 3EFOB 3E9GA 2JT4A 1TG0A 1QCOA 2AKKA 2RI3A 3QYGB 2RI5A 1HYOA 1M2OA 1W6XA 2EGEA 3MP1A 4XTYA 1WHLA 1RACB 2EQMA 4QT7A 1KG1A 2DVEA 2KMTA 2CZ0B 2D8HA 3HTRA 5CCAA 4X9CA 2X4XA 2LQWA 1X75C 1Q7YU 3OSVA 1OV3A 4XU1A 3CQTA 1WXTA 4RTUA 1NZ9A 1I07A 3HFOA 2O88A 1G3YA 2FYKA 2LNVA 1TUGB 4AFSC 3BE3A 4QVZA 2I0NA 3EHRA 3QJ6A 4ELZC 2QDLA 1Q95G 4LXCA 4PFZA 2G3RA 2EYZA 3JCMg 3HP9A 4C5EA 3OSSC 2IG0A 4EMKC 1KC8U 1Q81C 2EKOA 2DXUA 2ED1A 2CGHA 4FU6A 2DERA 1NYGA 3ZBDA 5HK0A 3UA6A 2WSFE 4O6JA 1ZUKA 1YIJA 4M7AG 2DIQA 3OYAA 4J7FA 4J6YA 3PVLA 2GNCA 5GAMd 4RTVA 2A37A 2VGNA 1D0XA 1AT1B 2FZKB 1OX9A 4DEYA 2M16A 1BK2A 2CUDA 1VQ8A 4J6WA 2BZ8A 4LDVA 2RJEA 3VS1A 4NS5A 3VJPA 2DK3A 1Q7YC 1Y0MA 1B7TA 1WX6A 1VQMA 2RN8A 2J05A 2X9HA 3BY7A 4XU0A 4A4HA 1VQ8T 1OQKA 2RA2A 2F2VA 2JOYA 3PNWC 4JRIA 3X26B 3NTIA 2DA9A 1FMVA 3SWNB 2D9TA 5FRNA 4V2SA 3QKJA 4AT1B 3CCRA 1TU0B 2KE9A 4M77F 1WHJA 5I11A 5LJ5j 5AYFA 4R55A 4IURA 2EIFA 3L42A 4OB0B 1D1CA 2E4HA 1JU5C 1TUDA 2K6DA 3CCRT 3NTKA 1IGUA 1WXBA 1AZEA 1O75A 2D0QB 3OYGA 2DD4A 4JJDA 3WVDB 3EH1A 1EZZB 4CC7A 5C0MA 3MEVA 3CCSA 1RADB 2X3WD 3A8HB 3CMAQ 1G8XA 2F2WA 1Q86U 3MHXA 1QLYA 2JS0A 4DEXA 2QTXA 2R5MA 1I0CA 1EIFA 1FYNA 1NM7A 3UA7A 1WA7A 1V29B 4N4IA 3QBYA 5IN1A 3GPLA 3M0UA 5FROA 1WYXA 3JB9J 3M59A 1VYTA 1KC8R 4HT9A 3META 2EJFA 1JO8A 2K5LA 1PC0A 3JCMc 3CC7Q 5IXBA 1VQNQ 1BKBA 1G3SA 2CUBA 3H9NA 4M75G 1X01A 4RTZA 1ZA2B 4GBQA 2C06A 3CD6Q 4IIOA 4N4GA 2YLCA 2HL5C 1SPKA 1BU1A 4A4KA 1KIKA 4BB7A 3OQ5A 1HSQA 2LCSA 3OYIA 3OYFA 2CREA 4R0KA 3A5ZB 2GCXA 3UDCA 1NPPA 4E47A 1I4K1 2KEAA 3CXCS 4J6XA 1LPLA 1YJNQ 1VIEA 4JZ3A 1BI1A 3JB9G 2HL3A 4EMKA 2JM8A 2CP5A 4XK8E 1DJ7B 3V8JA 2GQIA 3JCMX 1HJDA 5GAMf 4ZGDB 3M4GA 1Q86C 1U1TA 2FZCB 1W4SA 2RQTA 1E7OA 3REBB 2EKHA 3CPFA 2OTLQ 1WHGA 4OMMA 4X34A 1WHHA 1VQKQ 2V8JA 4QW2A 1ZA1B 2R5AA 2MOXA 1BCMA 4L59A 1M5Q1 3LH0A 2PTKA 1YN8A 2BUDA 5DLQE 3JCMd 4C92G 5IT9E 1CSKA 2HBWA 1UJYA 1QWEA 3O5ZA 1NLPC 3A8MB 3GLXA 2M0OA 2YRCA 2KYMA 3R6NA 3DB4A 2HBPA 4JRKA 3WXMB 2W10A 3RBBB 3QWXX 1K73C 5GMKj 3VYGA 4PJOB 1MMNA 1NJIU 1M3AA 1OPLA 1YHQQ 2DL8A 1WHMA 2HQHA 2XICA 1JRIA 2EVRA 1UGVA 1K9MC 4PJOF 1PD0A 4D6WA 5D6XA 3V7CA 3WVEB 3J7AF 3SFMA 2R58A 2X4YA 4RTXA 2Y90A 2MWOA 2FEIA 2JM9A 4AG2C 5KYNA 3ZL7C 2KNBB 1M90U 2YUPA 3DLMA 3G4SQ 5FW9A 2O01E 3HRTA 4J9FA 2K7AA 1I1JA 2ABLA 1K9AA 1UG1A 4BD3A 1OYXA 3L1AA 2A3LA 3MKDA 2AT1B 2IIMA 2BZXA 1K0XA 2EJGA 4JRPA 2FG0A 2A7YA 1BB9A 1PRMC 3EFRA 2O9VA 2JTMA 3GF5A 1NG2A 2MWPA 5LJ3j 1SKUB 2RQWA 4JLIA 1J3TA 2H3JA 2KRMA 1N8RR 3OW2P 2ZAEA 4JUVA 5GAOp 2VYTA 4M77C 4LDWA 1X27A 2NUZA 3MJXA 2FB7A 4CC2A 1JJ2S 4CRIA 1YJ9Q 4FW1A 2DTHA 1GBQA 4GLKA 1G3TA 2KI7A 3A8GB 1MV0B 1Y96A 2KK4A 4Q5WA 3OYBA 2HQEA 2VASA 2DXBA 4FYVB 4PJOG 4M77D 1X6OA 2L89A 4E7ZA 2VC8A 5CKBA 1ZSZB 1WPYA 1V1CA 1BI2A 2NUTB 2ZZDA 5KE3A 3CMAA 1NJIR 4F16A 2JVVA 2MF2A 3A1PA 4ZN1A 4KUDK 3LH5A 1D09B 1Y7XA 3LYIA 2RQVA 3EFOA 3QO3A 4HCCA 3CMAT 2SEMA 3CXCA 2E10A 1O9SA 2DTOA 2JW4A 2VXFA 2DEUA 1FXXA 1VOMA 1GXIE 4OVAA 4DBFA 2KSSA 1D1AA 3JCMf 2DNUA 3EG1A 2YDLA 5GANh 1VQ9Q 1VQ5Q 1Z9QA 2EAYA 3CC7A 1M90R 3DLLA 1VQNA 4MMKA 4OMNA 3G6EQ 3OYYA 4XU2A 3MO8A 4EMGA 2PU9B 1AWJA 3SB2A 3CD6A 2LDMA 3RERA 4C0GA 1VQNT 3OYLA 1U5SA 1M3BA 3OS5A 4IUUA 3URGA 2RH2A 4F17A 3CD6T 4OB3B 2EFIA 3P8HA 4E7LA 1PD1A 2DF6A 2AIRB 4J9IA 4PFPA 4XTVA 1JB0E 1AHJB 2JXBA 2LRQA 5GAN7 3PMTA 1YJNA 4Y28E 4CC4B 3R6OA 1OEBA 4M7DB 1I5LA 1NEBA 1KD1U 4RTTA 1N5ZA 4YTLA 1YJNT 3CCUQ 4OB1B 2H3EB 3QZ9B 4M7DF 3LLRA 2QEXQ 1WQWA 4BUGA 4C8QB 5GAN4 2OTLA 2K4YA 2PVGB 2WSEE 2XU8A 3IQLA 4ELYC 1YI2Q 1VQKA 3PVQA 2DYBA 1WGSA 3CXCP 1G2BA 1UGSB 1HXDA 2P4TA 4OF1A 1VQOQ 4LD9K 4LDUA 4E7KA 2OTLT 1PWTA 2EGCA 4M75E 3BW1A 5I2SA 1YJWQ 5ECAA 1QP3A 1RAIB 2QQ9A 1WJQA 1KJWA 3TSZA 4HA8A 3OY9A 5KYXB 4IUTA 1T3LA 3I35A 2V26A 3OYKA 5GAMe 1YCSB 4HXJA 2ATCB 3GNFB 1XNIA 4C0ZA 4M78G 4M77A 3TVTA 3CMEA 2GFAA 3M55A 4DOVA 2XMFA 5GAN6 3TU4K 3OYHA 1YHQA 3CCMT 1R0CB 1ZBJA 1ACMB 1OI1A 1SSFA 3OBYA 3CMET 1EX4A 3FIFA 2E65A 3QSUA 2LJ3A 1YHQT 1VQ7Q 2CZ1B 5CKEA 4MZTA 1U3OA 1OZ3A 4PLIA 3V8LA 4DBHA 2LCLA 1JJ2A 2JNGA 4JLGA 4HCBA 1VUBA 2YT6A 4PJOD 1K76A 2RJFA 3QXEB 2L8DA 2OJ2A 3HPWA 4XTWA 3G4SA 3GP8A 1D1BA 5IHKA 1AEYA 3EGDB 2HQXA 3DB3A 1R0BG 4N0AC 1Q82R 4ATOA 4C92E 4FIBA 3FJPA 4C8QG 2L5QA 2LCCA 3L2RA 1KD1R 3FDRA 2YUNA 2J6KA 1NE8A 2CP2A 4M7AB 7AT1B 2MK5A 5D7UA 4D8KA 5GANg 3L2VA 3CC2Q 3VS4A 2J6OA 2ENMA 4OMLA 4FCYA 2HAXA 5LJ5h 4BACA 4M7AF 1YITQ 3JCMJ 1YJ9A 3VKIA 1T3SA 1H3ZA 1MMGA 2LQNA 3INZA 3VU3C 4Z8AA 4J7IA 3I5SA 2VWFA 1YJ9T 2EPDA 4O5VA 5GAN5 5IAYA 1N6AA 2X4WA 1ZLMA 4C5GA 2VB6A 1D3BB 5KCOA 2ZPIB 1G83A 2EYYA 1UECA 2X4JA 3FB9A 1JJ2P 1ZSZC 5HKCA 4B9WA 2HZYA 1GL5A 1JXMA 2HCKA 2GGRA 2QA4Q 5GAOr 2E70A 4II1A 4D8DA 2DRKA 4J9DA 1IREB 1M1KU 2LZ6B 5J26A 2KXCA 1SRLA 1Y57A 1VIFA 3HL8A 3O8VA 4AMCA 2DAQA 1VQ9A 1VQ5A 2P4RA 3G6EA 4AFQC 2MCNA 1KFZA 3CCJQ 1YNZA 3N5BB 3P8DA 2KRSA 1VQ9T 1VQ5T 2DJZA 4OMOA 4JZ4A 2NYSA 4EPCA 2YLBA 3QPHA 2E6NA 3OW2S 4OB2B 1RAEB 3UF4A 3M53A 2KQWA 3G6ET 3MP8A 2C0OA 4PJOE 2VV5A 2DILA 1YIJT 1I8FA 3JCMe 1H3HA 3C95A 1M8VA 4M75B 4QQGA 1F1BB 4XTUA 1VYVA 5GAOq 2C0TA 2HKNA 1VQLQ 5I22A 2G6FX 4M75F 5EG2A 2A0FB 3I56Q 2XKOC 1VQMT 3CCUA 4OMFB 4M7DC 2K5IA 1TSFA 1B3QA 2HEQA 3SD4A 2CZ6B 4XTXA 2QEXA 2OTJQ 2M0YA 4LNPA 1YI2A 3CCUT 4RG8A 2X51A 2RD1A 2KVQG 4N0AA 3TSWA 3NHNA 3OYEA 1VQOA 4EIKA 1N9SA 2QEXT 4M7DD 2XDDA 2YWWA 5HY6A 4EMHA 2CH4W 1YJWA 5FU7B 2RK2A 2DRMA 2LT1A 3JB9F 1GBRA 2MI6A 5LL6S 1VQOT 1KC8C 5LJ3f 4KGZB 2GQVA 2B8AA 1YJWT 2QQSA 3BDUA 3GOXA 1IO6A 4JS5A 3NFCA 5GMKh 1S72Q 1K1ZA 4B9XA 3L2WA 1M1KR 2JJ9A 1IRXA 3CCST 3CPWS 2O4XA 1M3CA 5LJ5g 4WTOB 3H0HA 4ANJA 4XTZA 1EFNA 4C92B 4F7UG 1P92A 1RL2A 1NPRA 1VQ7A 4ZGEB 5L8RE 3TREA 2ZPGB 4C92F 1OU9A 3PT9A 4EDUA 1BIBA 3S3MA 3MPUB 1ZSZA 4FSXA 5KYWB 5CR2A 1N9RA 1ZQ1A 2DBMA 2OI3A 2NUTA 2YHTA 3QHSA 2KYBA 2ZPEB 3PTAA 2CSIA 3PFSA 2JMAA 2V1RA 4TVRA 3QIIA 3L2UA 1OPKA 3SEMA 1LVKA 4WCIA 2EBPA 1IZ6A 3VRYA 3C4SA 5LJ3h 3GNGA 3M0SA 2VGMA 2L3RA 3CC2A 3PIOA 4M7AC 1N27A 1UJ0A 2E41A 3CCLQ 2BTTA 1IB8A 5A0DA 1C0MA 1M2VB 2QGGA 5CQYA 3OS2A 1YITA 3DKMA 1N8RU 5GAN8 2RHUA 2OX7A 1T0JA 3CC2T 1MNDA 2DMOA 1JQQA 3V8KA 1TH7A 5KYYB 4BY6B 1YITT 1QKXA 4J9BA 4E7SA 5GAOm 4M7AD 5IHIA 2LQ8A 1TXQA 3VS7A 8AT1B 1WQ7A 1Z9ZA 2E5QA 1D0YA 2RQUA 1ZBXA 3CC4Q 2AHJB 1D0ZA 3OW2A 4M7DE 3C12A 2ECZA 1M4ZA 3T9NA 5GJWB 4DQ2A 1M9SA 2J7IA 3VS0A 2DFUA 2MYSA 4RUGA 4OMPA 4M7DA 4R56A 2QA4A 2RM4A 4A4EA 4C8QE 1UGPB 1M1GA 2QA4T 3V7SA 2J6FA 4PL6A 2FO0A 1U1SA 5IH2A 4AFUC 4LDXA 1Y71A 2A36A 3I55Q 4PJLA 4KBMB 5DLOA 4F14A 4RTWA 3CCJA 3NMZC 4FM4B 2RHIA 3KBGA 3MEWA 2PUKB 2LX9A 1YWPA 5D6YA 3M0TA 3CCVQ 1QVFS 5KYXA 2FPEA 3I5RA 2L3SA 1N8RC 4A4GA 1AZGB 2DETA 3CCJT 1JBMA 2FL7A 1A0NB 3TEEA 2JUFA 2M51A 1R8OB 1NBEB 1Y07A 2LJ0A 5KYUA 1X6BA 3OYCA 4E7IA 1VQLA 1QWFA 4M75C 4RMOA 1HD3A 5GANf 3MP6A 2GFUA 2YRDA 2NLUA 2QASA 2F5TX 4L6V5 3I56A 1WZOA 2VXEA 3CPWA 1FMKA 4QQDA 2FPFA 3LW5E 5HK3A 1VQLT 4RCBA 3OMGA 3CBOA 1QKWA 3RKXA 2R57A 3VRZA 3SWNC 4MMLA 4OMQA 2OTJA 3I56T 1RABB 2O9SA 1JEGA 2QAZA 1VQ4Q 2XG8D 4M75D 1NJIC 3JRZA 4DOWA 2J06A 3JCMW 1VA7A 3OS0A 2OTJT 3EGXB 3EGDA 1RUWA 5IHNA 2X35A 4PLLA 1W1FA 3H0FA 1QVGS 2RPNA 1OU8A 2GTJA 9ATCB 4M7AE 1RLPC 1WJRA 1WIEA 5FU7C 5J39A 1H8KA 3I9QA 1FMWA 5LJ3g 1H92A 4M7AA 1PM3A 1M90C 2YUQA 2OAWA 1S72A 4P5NA 3AT1B 1FWZA 3JB9D 4ZTJA 1ZSGA 5CO7A 2V8IA 5GAOl 2K3XA 3MEUA 3CCEQ 1AWOA 4RCCA 3J80E 3ER0A 3QJYA 2YXYA 4C92C 2ZPFB 3EG9B 1C6VX 4JPBW 1K0SA 4E7JA 5LJ3e 4M78B 4BE2A 1SHGA 4FSSA 2I2LA 1PNJA 1D3BA 2NUPB 2ROLA 2RJDA 2EQIA 3CPWP 3CC7T 4M78F 5GJVB 1VYUA 2AK5A 2E3HA 2QG9B 2PVOB 4C92D 3CBPA 3VS2A 2K9GA 1UHFA 3BFMA 4JDSA 1G3WA 3TCJA 2O31A 1TS9A 3L2QA 5A0LA 5GAMj 3FLGA 4J9GA 5FRMA 2RO0A 4KGXB 4X1VA 4OP0A 1Q82U 1K4US 3RKWA 1SF9A 3CCLA 2K79A 1AD5A 3EFSA 1S1NA 3M5AA 2EW3A 3REAB 1OZ2A 2EGAA 2IVWA 3LGLA 1MUZA 3PIPA 3KFVA 3M0QA 4KRTA 1LJOA 4LE9A 1UB4A 2DEQA 4C8QF 4ESRA 4JRQA 4BY6C 1VQKT 2KDSA 1PHTA 5CAIA 4MZPA 1K8AR 3CC4A 2B86A 3E2UA 2M02A 1YP5A 4M75A 1QVFA 4KULA 2DVJA 4L5GA 1LOJA 3LWHA 3X24B 5M9OA 3H41A 5LJ5f 2CP0A 2BIVA 3SWNA 4J9HA 1GFDA 3CEYA 2KXDA 2LX7A 2JMCA 3EG2A 4NL2A 4PJOC 2QQAA 2DXTA 1ZUYA 4QKUA 4IUQA 4FYXB 5GMKm 2CSQA 1RI9A 3I55A 2L2PA 1Q82C 2ZGWA 3OYDA 3G71Q 2EQJA 1PKTA 1KD1C 2FRWA 2QDYB 3EAEA 1SHFA 4PJNA 4Y91A 2DZ9A 4FT2A 3CCVA 1BBZA 1UDLA 2ED0A 3CCVT 2P84A 3G4ST 1QVGA 4M4ZA 2A08A 1IXDA 2QYZA 3UATA 1Y96B 3JCMb 4J9EA 4C92A 3QZ5B 1HK9A 2D6FA 3U23A 2DL7A 2XK0A 5C6SA 2JTFA 2RI2A 2V1QA 3QDFA 1VQPQ 1QVFP 1WI7A 5LJ3d 3FRNA 2JTEA 5GMKi 3HRUA 3C0CA 1UGQB 2RB6A 1VQ4A 4KGVB 1AWXA 3S3NA 6AT1B 3QYHB 4Z88A 2K2VA 4BI8B 1KQSA 3GIBA 1X6GA 1VQ4T 3OB9A 4J8OA 5GANe 1R77A 2QGFB 1GRIA 2XDBA 3JV3A 2PUOB 3ASKA 4IKFA 1OOTA 4HT8A 4BI4A
chains in the Genus database with same CATH topology
3ZFJA 4C5HA 3PT9A 4EDUA 5CK9A 2EJGA 1BIBA 3QUIA 4JRPA 4N4HA 4QVCA 3S3MA 3CCEA 2A7YA 3HKSA 5GAMg 3HRSA 4FSXA 4Z02A 5CR2A 1N9RA 1ZQ1A 3EFRA 2JTMA 4A4FA 2KY9A 2YHTA 2M9UA 3GF5A 3QHSA 5FLXE 2ZPEB 3LWIA 2MWPA 3OS1A 3JCMh 4JLIA 5LJ3j 3PTAA 1PSEA 3PFSA 2H3JA 3CC4T 3CCET 4TVRA 1BIAA 4JUVA 3QIIA 3L2UA 5GAOp 2VYTA 4M77C 4LDWA 1BYMA 2RHZA 2FB7A 1JJ2S 4CRIA 2E6ZA 4BE1A 2DTHA 4M78C 4GLKA 1G3TA 4M77E 2RHYA 1IZ6A 3A8GB 2CYZB 3E1SA 1B34B 3C4SA 3UT1A 1Y96A 4F7UB 5LJ3h 3GNGA 3CCMA 2KK4A 4Q5WA 3LGFA 1KQ2A 3BDLA 3OYBA 2VGMA 3SDZA 1QW1A 2HQEA 2L3RA 3H6ZA 4BE0A 2DXBA 1VQPT 2P0QA 4PJOG 4M77D 3HFNA 1X6OA 2L89A 3PIOA 3CC2A 2PVDB 4M7AC 1N27A 5GMKl 2E41A 1WJSA 4F7UF 5A0DA 2P0PA 5KCHA 2OAUA 2VC8A 2ZPBB 4M78D 5CQYA 3OS2A 3DKMA 5CKBA 4JJNK 1YITA 1N8RU 5GAN8 2XIDA 1WPYA 2RHUA 3I55T 1BI2A 2DTIA 2DXCA 2ZZDA 3CC2T 3KUFA 5KE3A 5CVIA 3V8KA 3CMAA 1TH7A 4VUBA 4BY6B 2JN0A 2JVVA 2MAMA 1YITT 2MF2A 4ZN1A 4WF2A 4IUPA 4KUDK 3M57A 5GAOm 1Y7XA 4M7AD 5GANj 5CIUA 4LD6A 2LQ8A 3LYIA 3QO3A 1LNXA 2BKDN 1MGQA 2EWNA 4HCCA 1WQ7A 3RESA 3JB9H 3CMAT 2E5QA 3FEOA 1ZBXA 2QXFA 1M1FA 1WNLA 2E10A 3CXCA 2K3YA 5CQXA 1O9SA 4ZN3A 2AHJB 3OYNA 3OW2A 2DTOA 2VXFA 3L2ZA 4M7DE 3C12A 3RKYA 1FXXA 1M4ZA 4PKCC 4M7DG 4OVAA 4C0DC 3T9NA 1W2BS 1GXIE 4QVDA 2KSSA 3S3OA 3JCMf 3JCMQ 2F69A 2LC4A 4PNOA 3HSBA 4M77B 2CS7A 4DQ2A 1M9SA 3X20B 4C8QC 5GANh 4M7DA 1YBYA 4BDYA 2CKKA 3M58A 1M1KC 2EAYA 4R56A 3CC7A 3DLLA 2QA4A 1VQNA 2ZCFB 2RM4A 1YI2T 4MMKA 4A4EA 4C8QE 3OYYA 4XU2A 1UGPB 3MO8A 4EMGA 2PU9B 2PQWA 2EJ9A 3SB2A 3CD6A 2LDMA 3VUBA 2K5FA 3RERA 1M1GA 4C0GA 1G5VA 2QA4T 3V7SA 5KE2A 1VQNT 5DY9A 3OYLA 4PL6A 4C8QD 1U1SA 1Q81U 3OS5A 2MMPA 4IUUA 3URGA 2RH2A 2XI9A 4LDXA 1Y71A 3V7RA 1KQ1A 3CD6T 4OB3B 2EFIA 4MZMA 3P8HA 3E9GA 4E7LA 4A54A 2RI3A 4KBMB 3H8ZA 5DLOA 3QYGB 2RI5A 4XTVA 1JB0E 3CCJA 1AHJB 2RHIA 4FM4B 1UGRB 2LRQA 3A8LB 3KBGA 3MEWA 3MP1A 5GAN7 2PUKB 1BI0A 2LX9A 3PMTA 4XTYA 5FU6B 1YJNA 4Y28E 2EQMA 1KG1A 5D6YA 3R6OA 4KUIA 2DVEA 2KMTA 1QVFS 2CZ0B 1N8RC 4M7DB 4A4GA 5CCAA 3CCJT 2E1HA 4X9CA 1JBMA 2FL7A 1I5LA 2X4XA 1KD1U 3OYJA 1X75C 4YTLA 3TEEA 1Q7YU 2JUFA 3OSVA 4IUVA 4C5IA 1YJNT 4OB1B 2EQUA 3G71A 1R8OB 3QZ9B 4XU1A 4M7DF 1VQ7T 1Y07A 3LLRA 4NOYA 5GANd 4FL6A 4OGCA 1WQWA 4KT0E 4UC4A 4BUGA 4C8QB 5LJ5e 5GAN4 3OYCA 2OTLA 1NZ9A 4E7IA 2K4YA 2PVGB 2WSEE 2XU8A 4ELYC 1VQLA 1VQKA 2E64A 3G71T 4M75C 4RMOA 1WGSA 2KAFA 5GANf 3G7ZA 3MP6A 1FX7A 3HFOA 2GFUA 1UGSB 1HXDA 2NLUA 2P4TA 2F5TX 1G3YA 4L6V5 4OF1A 2VXEA 4LDUA 3I56A 3CPWA 2FYKA 4E7KA 2OTLT 2LNVA 4QQDA 4M75E 2CZ7B 5HK3A 3LW5E 2V8KA 2RK1A 3BW1A 1VQLT 4RCBA 1H641 3OMGA 3CBOA 5I2SA 3RKXA 2R57A 3UWNA 1QP3A 2QQ9A 1WJQA 4QVZA 3QJ6A 3SWNC 4MMLA 2HD0A 2OTJA 3I56T 2GF7A 2LTOA 4HA8A 4ELZC 3OY9A 4M77G 2XG8D 2RJCA 4IUTA 3JRZA 4M75D 3X25B 4DOWA 3OYKA 5GAMe 1K73U 1NJIC 3JCMW 2E12A 4M78E 3GNFB 1XNIA 2G3RA 4C0ZA 4M78G 3S6WA 4M77A 3JCMg 3OS0A 1VQPA 3HP9A 4C5EA 3CMEA 2GFAA 3OSSC 3M55A 2IG0A 2OTJT 2EYQA 2YRVA 4EMKC 4DOVA 2X35A 4PLLA 1KC8U 4XAXB 1Q81C 3FC3A 4M78A 2EKOA 5GAN6 2DXUA 3TU4K 1K9MU 3OYHA 1YHQA 2CGHA 3CCMT 4FU6A 4ZGJB 1QVGS 1OI1A 3ZBDA 5HK0A 1SSFA 3AHUA 4M7AE 2M1HA 2WSFE 3E9FA 3OBYA 4FT4A 1WJRA 3Q1JA 4O6JA 3CMET 1YIJA 4M7AG 2DIQA 3OYAA 3FIFA 4J7FA 5FU7C 5J39A 2E65A 4J6YA 3F70A 2DD5A 3OA6A 3QSUA 1YHQT 5GAMd 5LJ3g 2CZ1B 4M7AA 5CKEA 1M90C 2VGNA 4MZTA 1OZ3A 3M56A 4PLIA 1S72A 4P5NA 3V8LA 4X9DA 1FWZA 3JB9D 4ZTJA 2LCLA 2WSCE 1JJ2A 2M16A 2JNGA 2V8IA 4JLGA 2RHXA 5CO7A 5GAOl 5GAOn 2K3XA 4J6WA 1VQ8A 4HCBA 1YCYA 1VUBA 3MEUA 4LDVA 2RJEA 4PJOD 4NS5A 3MEAA 3VJPA 2DK3A 1Q7YC 3OYMA 2RJFA 4ME7A 4RCCA 3QXEB 2L8DA 4QQ6A 3J80E 3ER0A 3QJYA 1VQMA 2QI2A 3HPWA 4XTWA 3G4SA 3GP8A 5CKHA 3BY7A 4XU0A 4A4HA 1VQ8T 4C92C 3A8OB 2RA2A 2HQXA 2ZPFB 2JOYA 3DB3A 3PNWC 1XTDA 4JRIA 3X26B 3NTIA 4N0AC 4E7JA 5LJ3e 4M78B 3SWNB 2D9TA 1BI3A 4OGEA 5FRNA 4V2SA 3QKJA 3RMSA 4BE2A 4RG2A 4ATOA 4C92E 3CCRA 5LJ5j 4M77F 4FIBA 3FJPA 5AYFA 2L5QA 4C8QG 4IURA 2EIFA 2I2LA 4R55A 3L42A 2LCCA 1D3BA 3L2RA 2XD0A 2RJDA 3FDRA 4OB0B 5GAN2 3CC7T 4M78F 4C8QA 2PVOB 4C92D 1NE8A 3CCRT 3CBPA 4M7AB 2DIGA 3NTKA 3JCMV 3BFMA 2XHCA 4JDSA 1XOVA 1G3WA 1O75A 2D0QB 2XDPA 3QG1A 3TCJA 2DD4A 1XQHA 5GANg 3OYGA 4BI3A 3L2VA 4PJOA 2HAXA 5LJ5h 5I21A 2JZ2A 4BACA 4M7AF 3L2QA 3JCMJ 3M4YA 1YJ9A 5A0LA 3VKIA 4C0FA 5GAMj 3WVDB 3C94A 1W2BA 5C0MA 1H3ZA 3FLGA 3MEVA 4DA4A 5FRMA 2RO0A 2HNIA 2F5KA 3CCSA 3INZA 3A8HB 4OP0A 3VU3C 1Q82U 4BDZA 4J7IA 3UPUA 1Q86U 3MHXA 3RKWA 1YJ9T 4O5VA 3J81E 2QTXA 2ZPHB 2R5MA 5IAYA 5GAN5 4LD9K 1N6AA 1EIFA 2X4WA 4HKEA 4C5GA 3CCLA 1KHIA 4XQ3A 3EFSA 3M5AA 4C0DB 1D3BB 4HCZA 1OZ2A 5KCOA 2LVMA 2ZPIB 3X28B 1V29B 2IVWA 5GAMh 4N4IA 2EQKA 3LGLA 3QBYA 5A2QE 5I2MA 5IN1A 3GPLA 5FROA 3PIPA 2X4JA 3FB9A 3JB9J 3M59A 4J5YA 5HKCA 4HT9A 3META 4B9WA 2EJFA 2K5LA 1LJOA 1UB4A 3JCMc 2DEQA 4C8QF 4JRQA 1BKBA 1G3SA 5GAOr 4BY6C 1VQKT 2KDSA 4M75G 2E70A 1X01A 4II1A 5CAIA 3CCQA 4MZPA 5GMKe 3CC4A 3M54A 2C06A 4N4GA 1IREB 2YLCA 4M75A 1QVFA 4KULA 4A4KA 1M1KU 4L5GA 5J3BA 5LJ5d 1LOJA 5J26A 3CCQT 2FVUA 4BB7A 3OQ5A 1VIFA 3HL8A 3O8VA 3LWHA 3X24B 2DAQA 3PGGA 3OYIA 3OYFA 1VQ5A 1VQ9A 5M9OA 5LJ5f 2O4XB 3A5ZB 2GCXA 3UDCA 3QDRB 2BIVA 3SWNA 1NPPA 3VUZA 4E47A 3G6EA 1I4K1 3CEYA 3N5BB 3P8DA 3CXCS 1VQ9T 1QVPA 1VQ5T 2DJZA 2P0KA 4J6XA 2QQAA 4NL2A 4PJOC 2DXTA 3PMIA 1VIEA 2YLBA 3QPHA 2E6NA 4EPCA 4JS4A 3OW2S 3JAME 1BI1A 2VUBA 3JB9G 1ZHIA 4IUQA 4MDWA 1PSFA 4OB2B 3G6ET 3M53A 2KQWA 1K8AU 3MP8A 5GMKm 4EMKA 4PJOE 2VV5A 3I55A 4A53A 4XK8E 2DPPB 1DJ7B 3V8JA 5KH6A 3JB9I 3LX7A 3JCMX 1YIJT 1Q82C 2ZGWA 1I8FA 3JCMe 3OYDA 3C95A 5GAMf 4ZGDB 3M4GA 1Q86C 1U1TA 2Y4XA 2EQJA 1W4SA 1M8VA 3RMQA 1KD1C 3MCAB 3JSCA 2QQBA 2QDYB 3EAEA 4M75B 4QQGA 4XTUA 4Y91A 5GAOq 3CPFA 2DZ9A 2Y4YA 4FT2A 2QQRA 4X34A 1S72T 3OMCA 3CCVA 3KXTA 2V8JA 1VQ6A 4GY5A 4QW2A 2R5AA 4M75F 2WACA 3E19A 5FU6C 5EG2A 2DZCA 4L59A 1M5Q1 3LH0A 2XKOC 5D6WA 2DKGA 4E7HA 1VQMT 3CCUA 4OMFB 3RUXA 1KQSS 4M7DC 3CCVT 3G4ST 2K5IA 3ZEHA 1QVGA 4LDYA 1VQ6T 4MDXA 2BUDA 5DLQE 3JCMd 4C92G 5IT9E 3SD4A 3NTHA 2CZ6B 3ME9A 4XTXA 2QEXA 2FHDA 1Y96B 3VV0A 3JCMb 4C92A 1YI2A 3CCUT 1UEBA 3A8MB 3GLXA 3QZ5B 2M0OA 3CBMA 3OBWA 4RG8A 1HK9A 4EMKB 2K57A 2RD1A 3DB4A 2KVQG 2HBPA 4JRKA 4N0AA 2D6FA 3WXMB 5C6SA 2XK0A 1QP2A 4CI0C 5DM7R 3OYEA 2JTFA 2RI2A 1VQOA 1N9SA 2QEXT 4M7DD 1K73C 2XDDA 5HY6A 5GMKj 3VYGA 5LJ3d 4EMHA 4PJOB 1NJIU 3JCMP 1YJWA 3FRNA 5FU7B 2LQKA 2RK2A 5GMKi 2LT1A 3HRUA 3JB9F 2XICA 1I81A 1JRIA 2MI6A 5LL6S 1UGQB 2RB6A 3VYHB 1VQOT 1KC8C 1VQ4A 5LJ3f 2GQVA 3M9QA 1K9MC 4PJOF 4D6WA 5D6XA 2B8AA 3V7CA 1YJWT 1RI0A 3S3NA 2QQSA 3BDUA 3WVEB 3J7AF 3QYHB 2K2VA 4NL3A 4BI8B 3SFMA 1KQSA 2R58A 2X4YA 5CKFA 4ZTFA 3GOXA 1U8RA 4JS5A 2Y90A 2MWOA 3NFCA 3RIRA 5GMKh 4B9XA 5CKDA 2DO3A 2LT4A 3L2WA 1VQ4T 3GIBA 3CCST 3OB9A 3CPWS 2O4XA 4J8OA 1K8AC 4XU3A 5GANe 4J83A 5LJ5g 4XTZA 4F7UE 5GAN3 4C92B 4F7UG 1M90U 2XDBA 1P92A 2PUOB 3ASKA 3DLMA 1MHNA 5A0GA 1RL2A 2O01E 3CCLT 3HRTA 1KHCA 4RKUE 4IKFA 1B34A 1NPRA 1VQ7A 4BD3A 4F7UA 3HHTB 1OYXA 4ZGEB 5L8RE 3L1AA 2A3LA 3TREA 2ZPGB 4HT8A 4C92F 3P8BB 4BI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5H A;  4EDU A;  4N4H A;  3S3M A;  3CCE A;  3HKS A;  4Z02 A;  4A4F A;  5FLX E;  2MWP A;  3OS1 A;  3PFS A;  3CC4 T;  3CCE T;  4TVR A;  3QII A;  3L2U A;  2VYT A;  2RHZ A;  1JJ2 S;  4CRI A;  2E6Z A;  4BE1 A;  2RHY A;  1IZ6 A;  3C4S A;  3UT1 A;  3CCM A;  4Q5W A;  3LGF A;  3BDL A;  3OYB A;  4BE0 A;  2HQE A;  2L3R A;  3H6Z A;  1X6O A;  3PIO A;  3CC2 A;  2L89 A;  1N27 A;  1WJS A;  5KCH A;  3OS2 A;  1YIT A;  1N8R U;  2RHU A;  3I55 T;  3CC2 T;  3KUF A;  5KE3 A;  3CMA A;  2JVV A;  1YIT T;  4ZN1 A;  4IUP A;  5CIU A;  4LD6 A;  2LQ8 A;  3LYI A;  2BKD N;  3CMA T;  2E5Q A;  3FEO A;  3CXC A;  2K3Y A;  4ZN3 A;  3OYN A;  3OW2 A;  4OVA A;  1W2B S;  3S3O A;  1YBY A;  4BDY A;  2CKK A;  1M1K C;  3CC7 A;  2QA4 A;  3DLL A;  1VQN A;  1YI2 T;  4A4E A;  3OYY A;  3MO8 A;  2PQW A;  3CD6 A;  2LDM A;  1M1G A;  1G5V A;  2QA4 T;  1VQN T;  5KE2 A;  3OYL A;  4PL6 A;  1Q81 U;  4IUU A;  3CD6 T;  2EFI A;  3P8H A;  3E9G A;  4E7L A;  2RI3 A;  3H8Z A;  2RI5 A;  3CCJ A;  2RHI A;  3KBG A;  2LRQ A;  3MEW A;  3MP1 A;  1YJN A;  3PMT A;  2EQM A;  5D6Y A;  1QVF S;  1N8R C;  4A4G A;  3CCJ T;  2X4X A;  1KD1 U;  3OYJ A;  4YTL A;  1Q7Y U;  2JUF A;  1YJN T;  4IUV A;  4C5I A;  2EQU A;  3G71 A;  1VQ7 T;  3LLR A;  4FL6 A;  2OTL A;  4UC4 A;  3OYC A;  1NZ9 A;  4E7I A;  1VQK A;  1VQL A;  3G71 T;  1WGS A;  3MP6 A;  2GFU A;  2NLU A;  3I56 A;  4E7K A;  3CPW A;  2OTL T;  4QQD A;  1VQL T;  3OMG A;  2R57 A;  3UWN A;  1WJQ A;  4QVZ A;  3QJ6 A;  2OTJ A;  3I56 T;  2GF7 A;  2LTO A;  3OY9 A;  4IUT A;  2RJC A;  1NJI C;  1K73 U;  3OYK A;  1XNI A;  2G3R A;  3S6W A;  3OS0 A;  1VQP A;  2OTJ T;  3CME A;  2GFA A;  4C5E A;  2IG0 A;  2YRV A;  2X35 A;  4PLL A;  1KC8 U;  1Q81 C;  3FC3 A;  2EKO A;  1K9M U;  3OYH A;  1YHQ A;  3CCM T;  4FU6 A;  1QVG S;  1OI1 A;  1SSF A;  1VQP T;  2M1H A;  3E9F A;  3CME T;  1YIJ A;  1WJR A;  3Q1J A;  2DIQ A;  3OYA A;  5J39 A;  3F70 A;  3OA6 A;  1YHQ T;  1M90 C;  1OZ3 A;  4PLI A;  1S72 A;  1JJ2 A;  2LCL A;  4ZTJ A;  2M16 A;  2JNG A;  2RHX A;  1VQ8 A;  2K3X A;  3MEU A;  2RJE A;  4NS5 A;  3MEA A;  1Q7Y C;  3OYM A;  2RJF A;  2L8D A;  1VQM A;  3J80 E;  3ER0 A;  4QQ6 A;  3G4S A;  4A4H A;  1VQ8 T;  2HQX A;  2JOY A;  3DB3 A;  3PNW C;  1XTD A;  3NTI A;  4E7J A;  2D9T A;  5FRN A;  3QKJ A;  4BE2 A;  4RG2 A;  3CCR A;  4IUR A;  2EIF A;  3L42 A;  2LCC A;  3L2R A;  2RJD A;  3FDR A;  3CC7 T;  3CCR T;  2DIG A;  3NTK A;  2XHC A;  2XDP A;  3OYG A;  3L2V A;  2JZ2 A;  4BAC A;  3L2Q A;  1YJ9 A;  1W2B A;  1H3Z A;  5C0M A;  3FLG A;  3MEV A;  5FRM A;  2RO0 A;  2F5K A;  3CCS A;  1Q82 U;  4BDZ A;  1Q86 U;  1YJ9 T;  3J81 E;  5IAY A;  2R5M A;  1EIF A;  2X4W A;  4C5G A;  3CCL A;  1KHI A;  4HCZ A;  1OZ2 A;  5KCO A;  2LVM A;  4N4I A;  2EQK A;  3LGL A;  3QBY A;  5A2Q E;  5IN1 A;  5FRO A;  3PIP A;  3MET A;  4B9W A;  1BKB A;  1VQK T;  2KDS A;  2E70 A;  4II1 A;  3CCQ A;  3CC4 A;  4N4G A;  1QVF A;  1M1K U;  5J3B A;  5J26 A;  3CCQ T;  3OQ5 A;  3O8V A;  2DAQ A;  1VQ9 A;  3OYI A;  3OYF A;  1VQ5 A;  5M9O A;  2O4X B;  3A5Z B;  2BIV A;  1NPP A;  3G6E A;  3CEY A;  3P8D A;  3CXC S;  1VQ9 T;  1VQ5 T;  2P0K A;  3OW2 S;  3PMI A;  2E6N A;  3JAM E;  4IUQ A;  3G6E T;  1K8A U;  3MP8 A;  3I55 A;  5KH6 A;  3LX7 A;  1YIJ T;  1Q82 C;  3OYD A;  1Q86 C;  2EQJ A;  1KD1 C;  4QQG A;  3EAE A;  3CPF A;  4X34 A;  2QQR A;  1S72 T;  3OMC A;  3CCV A;  1VQ6 A;  4GY5 A;  4QW2 A;  2R5A A;  2WAC A;  4L59 A;  3LH0 A;  4E7H A;  5D6W A;  1VQM T;  1KQS S;  3CCU A;  3CCV T;  3G4S T;  1QVG A;  1VQ6 T;  3ZEH A;  2BUD A;  5DLQ E;  5IT9 E;  3SD4 A;  3NTH A;  3ME9 A;  2QEX A;  2FHD A;  1YI2 A;  3CCU T;  1UEB A;  2M0O A;  3DB4 A;  2KVQ G;  5C6S A;  2XK0 A;  5DM7 R;  3OYE A;  2JTF A;  2RI2 A;  1VQO A;  2QEX T;  1K73 C;  5HY6 A;  1NJI U;  1YJW A;  2MI6 A;  5LL6 S;  1VQO T;  1KC8 C;  1VQ4 A;  3M9Q A;  1K9M C;  5D6X A;  2B8A A;  1YJW T;  1RI0 A;  3S3N A;  2QQS A;  3J7A F;  1KQS A;  2R58 A;  2X4Y A;  4ZTF A;  3GOX A;  2MWO A;  4B9X A;  3L2W A;  2DO3 A;  1VQ4 T;  3CCS T;  3OB9 A;  3CPW S;  2O4X A;  1K8A C;  1M90 U;  3DLM A;  3ASK A;  1MHN A;  1RL2 A;  3CCL T;  4IKF A;  1KHC A;  1NPR A;  1VQ7 A;  4BD3 A;  1OYX A;  3TRE A;  3P8B B; 
#chains in the Genus database with same CATH topology
 1RAF B;  3ZFJ A;  4C5H A;  2KR3 A;  5CK9 A;  3QUI A;  4QVC A;  3CCE A;  1M2V A;  3HKS A;  5FWC A;  5FWB A;  4HVV A;  4A4F A;  2M9U A;  1QVG P;  3PE0 A;  2L3Q A;  3LWI A;  5KYY A;  1PSE A;  1RLQ C;  3CCE T;  1BIA A;  1UE9 A;  4PJJ A;  2LP5 A;  2A28 A;  1GFC A;  1WFW A;  2RHZ A;  4F04 B;  4BE1 A;  1I5O B;  4M78 C;  2EYX A;  2RHY A;  3E1S A;  1MNE A;  1B34 B;  4HVW A;  3UT1 A;  2AZS A;  4F7U B;  1SSH A;  2H8H A;  1OX8 A;  4BE0 A;  1WLP B;  2P0Q A;  3EG0 A;  3HFN A;  2RF0 A;  3M0R A;  5GMK l;  2KRO A;  1WJS A;  4F7U F;  2P0P A;  3RDV A;  2OAU A;  4M78 D;  4PJO A;  3VS5 A;  4JJN K;  2IPO B;  2XID A;  1KQS P;  2CT3 A;  3KUF A;  1PCX A;  4VUB A;  1LCK A;  4RTY A;  2JN0 A;  2D8J A;  1M8M A;  4IUP A;  1RAA B;  3M57 A;  1ABQ A;  5CIU A;  4LD6 A;  1TWB A;  1LNX A;  2BE7 D;  2BKD N;  3RES A;  3JB9 H;  3THK A;  1Q81 R;  3CCQ Q;  2HMA A;  2K3Y A;  5CQX A;  3G1J A;  4ORZ A;  3RKY A;  2GTO A;  2DL4 A;  4DBR A;  2RNA A;  1W2B S;  4QVD A;  3S3O A;  3JCM Q;  2HKQ B;  3HSB A;  4M77 B;  2CS7 A;  1WDX A;  3M0P A;  3X20 B;  4C8Q C;  1PRL C;  2CP3 A;  4BDY A;  3M58 A;  1M1K C;  2CH4 A;  1YI2 T;  2DE0 X;  2E3I A;  2PQW A;  3VUB A;  2VKN A;  1Q7Y R;  1G5V A;  5KE2 A;  3EGU A;  4C8Q D;  2MMP A;  4GLM A;  3V7R A;  4MZM A;  2AZV A;  2DBK A;  4A54 A;  3H8Z A;  1UGR B;  3A8L B;  4E6R A;  1V76 A;  1BI0 A;  5FU6 B;  1QCN A;  3RNJ A;  2EYW A;  4KUI A;  4PFO A;  4AG1 C;  4B6M A;  4E2F B;  1VQ6 Q;  4KH0 B;  1SG5 A;  2HDA A;  2E1H A;  3OYJ A;  4IUV A;  4C5I A;  3EGX A;  2EQU A;  4PK4 A;  3G71 A;  3TQ7 P;  2MPX C;  1VQ7 T;  4DBQ A;  4HVU A;  4NOY A;  5GAN d;  4FL6 A;  4OGC A;  4KT0 E;  4UC4 A;  5LJ5 e;  2L3P A;  4J9C A;  2E64 A;  5HCK A;  3G71 T;  2HSP A;  2RMO A;  2KAF A;  3G7Z A;  1FX7 A;  1UUE A;  2KT8 A;  2DLP A;  2K2M A;  1NYF A;  4Y92 A;  2CZ7 B;  2BZY A;  2V8K A;  2RK1 A;  3VS6 A;  1H64 1;  1YFN A;  3FJ5 A;  1RAH B;  3UWN A;  1ABO A;  2HD0 A;  2GF7 A;  2LTO A;  2PZ1 A;  4M77 G;  2CP6 A;  2L0A A;  2RJC A;  3X25 B;  1K73 U;  2CP7 A;  2E12 A;  4M78 E;  2W0Z A;  2FRY A;  2NWM A;  3S6W A;  1GCQ C;  1VQP A;  3EG9 A;  2EYQ A;  1T0H A;  2YRV A;  4XAX B;  3FC3 A;  4M78 A;  1K9M U;  4ZGJ B;  3AHU A;  2M1H A;  1VQP T;  3E9F A;  4FT4 A;  2BE9 B;  2NUP A;  3Q1J A;  1QQJ A;  1X69 A;  3F70 A;  2DD5 A;  3OA6 A;  1CKB A;  2D1X A;  1U06 A;  3M56 A;  4FYW B;  4X9D A;  2WSC E;  2RHX A;  5GAO n;  1YCY A;  4PJM A;  3MEA A;  1X2Q A;  3OYM A;  4FYY B;  4ME7 A;  4QQ6 A;  2QI2 A;  5CKH A;  3ULR B;  3A8O B;  2SRC A;  1XTD A;  4IIM A;  1BI3 A;  4OGE A;  1W70 A;  1GCP A;  3RMS A;  4RG2 A;  2DL5 A;  2AKL A;  1Q86 R;  2XD0 A;  5GAN 2;  3GBQ A;  2LJ1 A;  4C8Q A;  2Z0W A;  4CC3 A;  2KBT A;  3CCM Q;  1MMA A;  1TUC A;  2DIG A;  3JCM V;  5L23 A;  2XHC A;  1AOJ A;  1XOV A;  2XDP A;  3QG1 A;  3CME Q;  3EG3 A;  1XQH A;  4BI3 A;  5I21 A;  2JZ2 A;  2MIO A;  3M4Y A;  5IXF A;  4C0F A;  2CDT A;  3C94 A;  1W2B A;  4DA4 A;  2HNI A;  2F5K A;  1X2K A;  1CKA A;  4BDZ A;  3UPU A;  3J81 E;  2ZPH B;  4ZNX A;  4HKE A;  1TOV A;  1K73 R;  1KHI A;  4XQ3 A;  1UHC A;  1E6G A;  4C0D B;  2HSE B;  1JXO A;  4HCZ A;  2LVM A;  3X28 B;  5GAM h;  2C0I A;  2EQK A;  5A2Q E;  5I2M A;  1NLO C;  1XJW B;  4J5Y A;  1K9M R;  2DM1 A;  1OUL A;  3A98 A;  2JS2 A;  4JJC A;  2VVK A;  3CCQ A;  5GMK e;  3M54 A;  2KRN A;  3EH2 A;  1KK7 A;  2F1L A;  1ARK A;  1M27 C;  5J3B A;  4Z89 A;  5LJ5 d;  1IHV A;  3CCQ T;  2FVU A;  1WHK A;  2DX1 A;  3PGG A;  1NEG A;  1C1A A;  2O4X B;  1X43 A;  3QDR B;  3VUZ A;  2COZ A;  2O2O A;  2F2X A;  1QVP A;  2P0K A;  1KSW A;  3PMI A;  4JS4 A;  3JAM E;  1GCQ A;  2VUB A;  1ZHI A;  4MDW A;  1PSF A;  1K8A U;  1RAG B;  3H0I A;  4A53 A;  2DPP B;  5KH6 A;  3JB9 I;  1W2B P;  3LX7 A;  1SRM A;  1QMC A;  4K11 A;  2Y4X A;  2KT1 A;  3RMQ A;  3MCA B;  3JSC A;  2QQB A;  2Y4Y A;  2QQR A;  1S72 T;  3OMC A;  3KXT A;  1VQ6 A;  4GY5 A;  2GBQ A;  5FU6 C;  2WAC A;  3E19 A;  2DZC A;  2ESW A;  1E6H A;  2YSQ A;  1IGQ A;  2LMJ A;  4E7H A;  5D6W A;  2DKG A;  1KQS S;  3RUX A;  3ZEH A;  1VQ6 T;  4LDY A;  4MDX A;  3NTH A;  3ME9 A;  2FHD A;  3VV0 A;  4A63 B;  3EHQ A;  1UEB A;  3CBM A;  3OBW A;  4EMK B;  2K57 A;  1QP2 A;  4CI0 C;  5DM7 R;  2D0N A;  3JCM P;  2LQK A;  2YUO A;  1B07 A;  1I81 A;  2COW A;  3VYH B;  3VS3 A;  1YIJ Q;  3NGP A;  3M9Q A;  1MV3 A;  1MMD A;  1RI0 A;  3QWY A;  4AFZ C;  4NL3 A;  2QTV A;  1TTH B;  5CKF A;  4ZTF A;  1U8R A;  3RIR A;  8ATC B;  5CKD A;  2DO3 A;  2LT4 A;  1AWW A;  1K8A C;  4XU3 A;  1IHW A;  4J83 A;  1VQ8 Q;  2DYI A;  4F7U E;  5GAN 3;  1QCF A;  1VQM Q;  5A0G A;  1MHN A;  3CCL T;  1KHC A;  4RKU E;  1ZX6 A;  4FW2 A;  1B34 A;  2RQR A;  4F7U A;  3HHT B;  1WXU A;  3P8B B;  4LN2 A;  5AT1 B;  3CCR Q;  4N4H A;  2QK0 A;  5GAM g;  3HRS A;  4Z02 A;  2X3X D;  2KY9 A;  5FLX E;  3OS1 A;  3JCM h;  3CC4 T;  2FZG B;  1BYM A;  3RR6 A;  5EC7 A;  2E6Z A;  1UFF A;  4M77 E;  2ROT A;  2DJQ A;  2CYZ B;  3CCS Q;  3CCM A;  3LGF A;  1KQ2 A;  3BDL A;  3SDZ A;  1QW1 A;  3H6Z A;  2PNI A;  2PVD B;  5KYU B;  5KCH A;  2ZPB B;  3I55 T;  2DXC A;  2DTI A;  3SHW A;  4JJB A;  4LUE A;  5CVI A;  4HCK A;  2MAM A;  4WF2 A;  2LNH B;  5GAN j;  2EWN A;  1MGQ A;  3FEO A;  1PG5 B;  1ZUU A;  2QXF A;  1M1F A;  1WNL A;  1UTI A;  4ZN3 A;  3OYN A;  3L2Z A;  4PKC C;  4M7D G;  4C0D C;  2F69 A;  2LC4 A;  4PNO A;  1BCO A;  1YBY A;  1SEM A;  2CKK A;  2CT4 A;  4LUD A;  1AVZ C;  2DL3 A;  2ZCF B;  1PKS A;  2K3B A;  2EJ9 A;  2KGT A;  2K5F A;  4KH1 B;  2COY A;  5DY9 A;  5KYW A;  2E5K A;  1Q81 U;  3D7S B;  2XI9 A;  1M30 A;  3NPF A;  2FPD A;  1KQ1 A;  1YWO A;  3EFO B;  3E9G A;  2JT4 A;  1TG0 A;  1QCO A;  2AKK A;  2RI3 A;  3QYG B;  2RI5 A;  1HYO A;  1M2O A;  1W6X A;  2EGE A;  3MP1 A;  4XTY A;  1WHL A;  1RAC B;  2EQM A;  4QT7 A;  1KG1 A;  2DVE A;  2KMT A;  2CZ0 B;  2D8H A;  3HTR A;  5CCA A;  4X9C A;  2X4X A;  2LQW A;  1X75 C;  1Q7Y U;  3OSV A;  1OV3 A;  4XU1 A;  3CQT A;  1WXT A;  4RTU A;  1NZ9 A;  1I07 A;  3HFO A;  2O88 A;  1G3Y A;  2FYK A;  2LNV A;  1TUG B;  4AFS C;  3BE3 A;  4QVZ A;  2I0N A;  3EHR A;  3QJ6 A;  4ELZ C;  2QDL A;  1Q95 G;  4LXC A;  4PFZ A;  2G3R A;  2EYZ A;  3JCM g;  3HP9 A;  4C5E A;  3OSS C;  2IG0 A;  4EMK C;  1KC8 U;  1Q81 C;  2EKO A;  2DXU A;  2ED1 A;  2CGH A;  4FU6 A;  2DER A;  1NYG A;  3ZBD A;  5HK0 A;  3UA6 A;  2WSF E;  4O6J A;  1ZUK A;  1YIJ A;  4M7A G;  2DIQ A;  3OYA A;  4J7F A;  4J6Y A;  3PVL A;  2GNC A;  5GAM d;  4RTV A;  2A37 A;  2VGN A;  1D0X A;  1AT1 B;  2FZK B;  1OX9 A;  4DEY A;  2M16 A;  1BK2 A;  2CUD A;  1VQ8 A;  4J6W A;  2BZ8 A;  4LDV A;  2RJE A;  3VS1 A;  4NS5 A;  3VJP A;  2DK3 A;  1Q7Y C;  1Y0M A;  1B7T A;  1WX6 A;  1VQM A;  2RN8 A;  2J05 A;  2X9H A;  3BY7 A;  4XU0 A;  4A4H A;  1VQ8 T;  1OQK A;  2RA2 A;  2F2V A;  2JOY A;  3PNW C;  4JRI A;  3X26 B;  3NTI A;  2DA9 A;  1FMV A;  3SWN B;  2D9T A;  5FRN A;  4V2S A;  3QKJ A;  4AT1 B;  3CCR A;  1TU0 B;  2KE9 A;  4M77 F;  1WHJ A;  5I11 A;  5LJ5 j;  5AYF A;  4R55 A;  4IUR A;  2EIF A;  3L42 A;  4OB0 B;  1D1C A;  2E4H A;  1JU5 C;  1TUD A;  2K6D A;  3CCR T;  3NTK A;  1IGU A;  1WXB A;  1AZE A;  1O75 A;  2D0Q B;  3OYG A;  2DD4 A;  4JJD A;  3WVD B;  3EH1 A;  1EZZ B;  4CC7 A;  5C0M A;  3MEV A;  3CCS A;  1RAD B;  2X3W D;  3A8H B;  3CMA Q;  1G8X A;  2F2W A;  1Q86 U;  3MHX A;  1QLY A;  2JS0 A;  4DEX A;  2QTX A;  2R5M A;  1I0C A;  1EIF A;  1FYN A;  1NM7 A;  3UA7 A;  1WA7 A;  1V29 B;  4N4I A;  3QBY A;  5IN1 A;  3GPL A;  3M0U A;  5FRO A;  1WYX A;  3JB9 J;  3M59 A;  1VYT A;  1KC8 R;  4HT9 A;  3MET A;  2EJF A;  1JO8 A;  2K5L A;  1PC0 A;  3JCM c;  3CC7 Q;  5IXB A;  1VQN Q;  1BKB A;  1G3S A;  2CUB A;  3H9N A;  4M75 G;  1X01 A;  4RTZ A;  1ZA2 B;  4GBQ A;  2C06 A;  3CD6 Q;  4IIO A;  4N4G A;  2YLC A;  2HL5 C;  1SPK A;  1BU1 A;  4A4K A;  1KIK A;  4BB7 A;  3OQ5 A;  1HSQ A;  2LCS A;  3OYI A;  3OYF A;  2CRE A;  4R0K A;  3A5Z B;  2GCX A;  3UDC A;  1NPP A;  4E47 A;  1I4K 1;  2KEA A;  3CXC S;  4J6X A;  1LPL A;  1YJN Q;  1VIE A;  4JZ3 A;  1BI1 A;  3JB9 G;  2HL3 A;  4EMK A;  2JM8 A;  2CP5 A;  4XK8 E;  1DJ7 B;  3V8J A;  2GQI A;  3JCM X;  1HJD A;  5GAM f;  4ZGD B;  3M4G A;  1Q86 C;  1U1T A;  2FZC B;  1W4S A;  2RQT A;  1E7O A;  3REB B;  2EKH A;  3CPF A;  2OTL Q;  1WHG A;  4OMM A;  4X34 A;  1WHH A;  1VQK Q;  2V8J A;  4QW2 A;  1ZA1 B;  2R5A A;  2MOX A;  1BCM A;  4L59 A;  1M5Q 1;  3LH0 A;  2PTK A;  1YN8 A;  2BUD A;  5DLQ E;  3JCM d;  4C92 G;  5IT9 E;  1CSK A;  2HBW A;  1UJY A;  1QWE A;  3O5Z A;  1NLP C;  3A8M B;  3GLX A;  2M0O A;  2YRC A;  2KYM A;  3R6N A;  3DB4 A;  2HBP A;  4JRK A;  3WXM B;  2W10 A;  3RBB B;  3QWX X;  1K73 C;  5GMK j;  3VYG A;  4PJO B;  1MMN A;  1NJI U;  1M3A A;  1OPL A;  1YHQ Q;  2DL8 A;  1WHM A;  2HQH A;  2XIC A;  1JRI A;  2EVR A;  1UGV A;  1K9M C;  4PJO F;  1PD0 A;  4D6W A;  5D6X A;  3V7C A;  3WVE B;  3J7A F;  3SFM A;  2R58 A;  2X4Y A;  4RTX A;  2Y90 A;  2MWO A;  2FEI A;  2JM9 A;  4AG2 C;  5KYN A;  3ZL7 C;  2KNB B;  1M90 U;  2YUP A;  3DLM A;  3G4S Q;  5FW9 A;  2O01 E;  3HRT A;  4J9F A;  2K7A A;  1I1J A;  2ABL A;  1K9A A;  1UG1 A;  4BD3 A;  1OYX A;  3L1A A;  2A3L A;  3MKD A;  2AT1 B;  2IIM A;  2BZX A;  1K0X A;  2EJG A;  4JRP A;  2FG0 A;  2A7Y A;  1BB9 A;  1PRM C;  3EFR A;  2O9V A;  2JTM A;  3GF5 A;  1NG2 A;  2MWP A;  5LJ3 j;  1SKU B;  2RQW A;  4JLI A;  1J3T A;  2H3J A;  2KRM A;  1N8R R;  3OW2 P;  2ZAE A;  4JUV A;  5GAO p;  2VYT A;  4M77 C;  4LDW A;  1X27 A;  2NUZ A;  3MJX A;  2FB7 A;  4CC2 A;  1JJ2 S;  4CRI A;  1YJ9 Q;  4FW1 A;  2DTH A;  1GBQ A;  4GLK A;  1G3T A;  2KI7 A;  3A8G B;  1MV0 B;  1Y96 A;  2KK4 A;  4Q5W A;  3OYB A;  2HQE A;  2VAS A;  2DXB A;  4FYV B;  4PJO G;  4M77 D;  1X6O A;  2L89 A;  4E7Z A;  2VC8 A;  5CKB A;  1ZSZ B;  1WPY A;  1V1C A;  1BI2 A;  2NUT B;  2ZZD A;  5KE3 A;  3CMA A;  1NJI R;  4F16 A;  2JVV A;  2MF2 A;  3A1P A;  4ZN1 A;  4KUD K;  3LH5 A;  1D09 B;  1Y7X A;  3LYI A;  2RQV A;  3EFO A;  3QO3 A;  4HCC A;  3CMA T;  2SEM A;  3CXC A;  2E10 A;  1O9S A;  2DTO A;  2JW4 A;  2VXF A;  2DEU A;  1FXX A;  1VOM A;  1GXI E;  4OVA A;  4DBF A;  2KSS A;  1D1A A;  3JCM f;  2DNU A;  3EG1 A;  2YDL A;  5GAN h;  1VQ9 Q;  1VQ5 Q;  1Z9Q A;  2EAY A;  3CC7 A;  1M90 R;  3DLL A;  1VQN A;  4MMK A;  4OMN A;  3G6E Q;  3OYY A;  4XU2 A;  3MO8 A;  4EMG A;  2PU9 B;  1AWJ A;  3SB2 A;  3CD6 A;  2LDM A;  3RER A;  4C0G A;  1VQN T;  3OYL A;  1U5S A;  1M3B A;  3OS5 A;  4IUU A;  3URG A;  2RH2 A;  4F17 A;  3CD6 T;  4OB3 B;  2EFI A;  3P8H A;  4E7L A;  1PD1 A;  2DF6 A;  2AIR B;  4J9I A;  4PFP A;  4XTV A;  1JB0 E;  1AHJ B;  2JXB A;  2LRQ A;  5GAN 7;  3PMT A;  1YJN A;  4Y28 E;  4CC4 B;  3R6O A;  1OEB A;  4M7D B;  1I5L A;  1NEB A;  1KD1 U;  4RTT A;  1N5Z A;  4YTL A;  1YJN T;  3CCU Q;  4OB1 B;  2H3E B;  3QZ9 B;  4M7D F;  3LLR A;  2QEX Q;  1WQW A;  4BUG A;  4C8Q B;  5GAN 4;  2OTL A;  2K4Y A;  2PVG B;  2WSE E;  2XU8 A;  3IQL A;  4ELY C;  1YI2 Q;  1VQK A;  3PVQ A;  2DYB A;  1WGS A;  3CXC P;  1G2B A;  1UGS B;  1HXD A;  2P4T A;  4OF1 A;  1VQO Q;  4LD9 K;  4LDU A;  4E7K A;  2OTL T;  1PWT A;  2EGC A;  4M75 E;  3BW1 A;  5I2S A;  1YJW Q;  5ECA A;  1QP3 A;  1RAI B;  2QQ9 A;  1WJQ A;  1KJW A;  3TSZ A;  4HA8 A;  3OY9 A;  5KYX B;  4IUT A;  1T3L A;  3I35 A;  2V26 A;  3OYK A;  5GAM e;  1YCS B;  4HXJ A;  2ATC B;  3GNF B;  1XNI A;  4C0Z A;  4M78 G;  4M77 A;  3TVT A;  3CME A;  2GFA A;  3M55 A;  4DOV A;  2XMF A;  5GAN 6;  3TU4 K;  3OYH A;  1YHQ A;  3CCM T;  1R0C B;  1ZBJ A;  1ACM B;  1OI1 A;  1SSF A;  3OBY A;  3CME T;  1EX4 A;  3FIF A;  2E65 A;  3QSU A;  2LJ3 A;  1YHQ T;  1VQ7 Q;  2CZ1 B;  5CKE A;  4MZT A;  1U3O A;  1OZ3 A;  4PLI A;  3V8L A;  4DBH A;  2LCL A;  1JJ2 A;  2JNG A;  4JLG A;  4HCB A;  1VUB A;  2YT6 A;  4PJO D;  1K76 A;  2RJF A;  3QXE B;  2L8D A;  2OJ2 A;  3HPW A;  4XTW A;  3G4S A;  3GP8 A;  1D1B A;  5IHK A;  1AEY A;  3EGD B;  2HQX A;  3DB3 A;  1R0B G;  4N0A C;  1Q82 R;  4ATO A;  4C92 E;  4FIB A;  3FJP A;  4C8Q G;  2L5Q A;  2LCC A;  3L2R A;  1KD1 R;  3FDR A;  2YUN A;  2J6K A;  1NE8 A;  2CP2 A;  4M7A B;  7AT1 B;  2MK5 A;  5D7U A;  4D8K A;  5GAN g;  3L2V A;  3CC2 Q;  3VS4 A;  2J6O A;  2ENM A;  4OML A;  4FCY A;  2HAX A;  5LJ5 h;  4BAC A;  4M7A F;  1YIT Q;  3JCM J;  1YJ9 A;  3VKI A;  1T3S A;  1H3Z A;  1MMG A;  2LQN A;  3INZ A;  3VU3 C;  4Z8A A;  4J7I A;  3I5S A;  2VWF A;  1YJ9 T;  2EPD A;  4O5V A;  5GAN 5;  5IAY A;  1N6A A;  2X4W A;  1ZLM A;  4C5G A;  2VB6 A;  1D3B B;  5KCO A;  2ZPI B;  1G83 A;  2EYY A;  1UEC A;  2X4J A;  3FB9 A;  1JJ2 P;  1ZSZ C;  5HKC A;  4B9W A;  2HZY A;  1GL5 A;  1JXM A;  2HCK A;  2GGR A;  2QA4 Q;  5GAO r;  2E70 A;  4II1 A;  4D8D A;  2DRK A;  4J9D A;  1IRE B;  1M1K U;  2LZ6 B;  5J26 A;  2KXC A;  1SRL A;  1Y57 A;  1VIF A;  3HL8 A;  3O8V A;  4AMC A;  2DAQ A;  1VQ9 A;  1VQ5 A;  2P4R A;  3G6E A;  4AFQ C;  2MCN A;  1KFZ A;  3CCJ Q;  1YNZ A;  3N5B B;  3P8D A;  2KRS A;  1VQ9 T;  1VQ5 T;  2DJZ A;  4OMO A;  4JZ4 A;  2NYS A;  4EPC A;  2YLB A;  3QPH A;  2E6N A;  3OW2 S;  4OB2 B;  1RAE B;  3UF4 A;  3M53 A;  2KQW A;  3G6E T;  3MP8 A;  2C0O A;  4PJO E;  2VV5 A;  2DIL A;  1YIJ T;  1I8F A;  3JCM e;  1H3H A;  3C95 A;  1M8V A;  4M75 B;  4QQG A;  1F1B B;  4XTU A;  1VYV A;  5GAO q;  2C0T A;  2HKN A;  1VQL Q;  5I22 A;  2G6F X;  4M75 F;  5EG2 A;  2A0F B;  3I56 Q;  2XKO C;  1VQM T;  3CCU A;  4OMF B;  4M7D C;  2K5I A;  1TSF A;  1B3Q A;  2HEQ A;  3SD4 A;  2CZ6 B;  4XTX A;  2QEX A;  2OTJ Q;  2M0Y A;  4LNP A;  1YI2 A;  3CCU T;  4RG8 A;  2X51 A;  2RD1 A;  2KVQ G;  4N0A A;  3TSW A;  3NHN A;  3OYE A;  1VQO A;  4EIK A;  1N9S A;  2QEX T;  4M7D D;  2XDD A;  2YWW A;  5HY6 A;  4EMH A;  2CH4 W;  1YJW A;  5FU7 B;  2RK2 A;  2DRM A;  2LT1 A;  3JB9 F;  1GBR A;  2MI6 A;  5LL6 S;  1VQO T;  1KC8 C;  5LJ3 f;  4KGZ B;  2GQV A;  2B8A A;  1YJW T;  2QQS A;  3BDU A;  3GOX A;  1IO6 A;  4JS5 A;  3NFC A;  5GMK h;  1S72 Q;  1K1Z A;  4B9X A;  3L2W A;  1M1K R;  2JJ9 A;  1IRX A;  3CCS T;  3CPW S;  2O4X A;  1M3C A;  5LJ5 g;  4WTO B;  3H0H A;  4ANJ A;  4XTZ A;  1EFN A;  4C92 B;  4F7U G;  1P92 A;  1RL2 A;  1NPR A;  1VQ7 A;  4ZGE B;  5L8R E;  3TRE A;  2ZPG B;  4C92 F;  1OU9 A;  3PT9 A;  4EDU A;  1BIB A;  3S3M A;  3MPU B;  1ZSZ A;  4FSX A;  5KYW B;  5CR2 A;  1N9R A;  1ZQ1 A;  2DBM A;  2OI3 A;  2NUT A;  2YHT A;  3QHS A;  2KYB A;  2ZPE B;  3PTA A;  2CSI A;  3PFS A;  2JMA A;  2V1R A;  4TVR A;  3QII A;  3L2U A;  1OPK A;  3SEM A;  1LVK A;  4WCI A;  2EBP A;  1IZ6 A;  3VRY A;  3C4S A;  5LJ3 h;  3GNG A;  3M0S A;  2VGM A;  2L3R A;  3CC2 A;  3PIO A;  4M7A C;  1N27 A;  1UJ0 A;  2E41 A;  3CCL Q;  2BTT A;  1IB8 A;  5A0D A;  1C0M A;  1M2V B;  2QGG A;  5CQY A;  3OS2 A;  1YIT A;  3DKM A;  1N8R U;  5GAN 8;  2RHU A;  2OX7 A;  1T0J A;  3CC2 T;  1MND A;  2DMO A;  1JQQ A;  3V8K A;  1TH7 A;  5KYY B;  4BY6 B;  1YIT T;  1QKX A;  4J9B A;  4E7S A;  5GAO m;  4M7A D;  5IHI A;  2LQ8 A;  1TXQ A;  3VS7 A;  8AT1 B;  1WQ7 A;  1Z9Z A;  2E5Q A;  1D0Y A;  2RQU A;  1ZBX A;  3CC4 Q;  2AHJ B;  1D0Z A;  3OW2 A;  4M7D E;  3C12 A;  2ECZ A;  1M4Z A;  3T9N A;  5GJW B;  4DQ2 A;  1M9S A;  2J7I A;  3VS0 A;  2DFU A;  2MYS A;  4RUG A;  4OMP A;  4M7D A;  4R56 A;  2QA4 A;  2RM4 A;  4A4E A;  4C8Q E;  1UGP B;  1M1G A;  2QA4 T;  3V7S A;  2J6F A;  4PL6 A;  2FO0 A;  1U1S A;  5IH2 A;  4AFU C;  4LDX A;  1Y71 A;  2A36 A;  3I55 Q;  4PJL A;  4KBM B;  5DLO A;  4F14 A;  4RTW A;  3CCJ A;  3NMZ C;  4FM4 B;  2RHI A;  3KBG A;  3MEW A;  2PUK B;  2LX9 A;  1YWP A;  5D6Y A;  3M0T A;  3CCV Q;  1QVF S;  5KYX A;  2FPE A;  3I5R A;  2L3S A;  1N8R C;  4A4G A;  1AZG B;  2DET A;  3CCJ T;  1JBM A;  2FL7 A;  1A0N B;  3TEE A;  2JUF A;  2M51 A;  1R8O B;  1NBE B;  1Y07 A;  2LJ0 A;  5KYU A;  1X6B A;  3OYC A;  4E7I A;  1VQL A;  1QWF A;  4M75 C;  4RMO A;  1HD3 A;  5GAN f;  3MP6 A;  2GFU A;  2YRD A;  2NLU A;  2QAS A;  2F5T X;  4L6V 5;  3I56 A;  1WZO A;  2VXE A;  3CPW A;  1FMK A;  4QQD A;  2FPF A;  3LW5 E;  5HK3 A;  1VQL T;  4RCB A;  3OMG A;  3CBO A;  1QKW A;  3RKX A;  2R57 A;  3VRZ A;  3SWN C;  4MML A;  4OMQ A;  2OTJ A;  3I56 T;  1RAB B;  2O9S A;  1JEG A;  2QAZ A;  1VQ4 Q;  2XG8 D;  4M75 D;  1NJI C;  3JRZ A;  4DOW A;  2J06 A;  3JCM W;  1VA7 A;  3OS0 A;  2OTJ T;  3EGX B;  3EGD A;  1RUW A;  5IHN A;  2X35 A;  4PLL A;  1W1F A;  3H0F A;  1QVG S;  2RPN A;  1OU8 A;  2GTJ A;  9ATC B;  4M7A E;  1RLP C;  1WJR A;  1WIE A;  5FU7 C;  5J39 A;  1H8K A;  3I9Q A;  1FMW A;  5LJ3 g;  1H92 A;  4M7A A;  1PM3 A;  1M90 C;  2YUQ A;  2OAW A;  1S72 A;  4P5N A;  3AT1 B;  1FWZ A;  3JB9 D;  4ZTJ A;  1ZSG A;  5CO7 A;  2V8I A;  5GAO l;  2K3X A;  3MEU A;  3CCE Q;  1AWO A;  4RCC A;  3J80 E;  3ER0 A;  3QJY A;  2YXY A;  4C92 C;  2ZPF B;  3EG9 B;  1C6V X;  4JPB W;  1K0S A;  4E7J A;  5LJ3 e;  4M78 B;  4BE2 A;  1SHG A;  4FSS A;  2I2L A;  1PNJ A;  1D3B A;  2NUP B;  2ROL A;  2RJD A;  2EQI A;  3CPW P;  3CC7 T;  4M78 F;  5GJV B;  1VYU A;  2AK5 A;  2E3H A;  2QG9 B;  2PVO B;  4C92 D;  3CBP A;  3VS2 A;  2K9G A;  1UHF A;  3BFM A;  4JDS A;  1G3W A;  3TCJ A;  2O31 A;  1TS9 A;  3L2Q A;  5A0L A;  5GAM j;  3FLG A;  4J9G A;  5FRM A;  2RO0 A;  4KGX B;  4X1V A;  4OP0 A;  1Q82 U;  1K4U S;  3RKW A;  1SF9 A;  3CCL A;  2K79 A;  1AD5 A;  3EFS A;  1S1N A;  3M5A A;  2EW3 A;  3REA B;  1OZ2 A;  2EGA A;  2IVW A;  3LGL A;  1MUZ A;  3PIP A;  3KFV A;  3M0Q A;  4KRT A;  1LJO A;  4LE9 A;  1UB4 A;  2DEQ A;  4C8Q F;  4ESR A;  4JRQ A;  4BY6 C;  1VQK T;  2KDS A;  1PHT A;  5CAI A;  4MZP A;  1K8A R;  3CC4 A;  2B86 A;  3E2U A;  2M02 A;  1YP5 A;  4M75 A;  1QVF A;  4KUL A;  2DVJ A;  4L5G A;  1LOJ A;  3LWH A;  3X24 B;  5M9O A;  3H41 A;  5LJ5 f;  2CP0 A;  2BIV A;  3SWN A;  4J9H A;  1GFD A;  3CEY A;  2KXD A;  2LX7 A;  2JMC A;  3EG2 A;  4NL2 A;  4PJO C;  2QQA A;  2DXT A;  1ZUY A;  4QKU A;  4IUQ A;  4FYX B;  5GMK m;  2CSQ A;  1RI9 A;  3I55 A;  2L2P A;  1Q82 C;  2ZGW A;  3OYD A;  3G71 Q;  2EQJ A;  1PKT A;  1KD1 C;  2FRW A;  2QDY B;  3EAE A;  1SHF A;  4PJN A;  4Y91 A;  2DZ9 A;  4FT2 A;  3CCV A;  1BBZ A;  1UDL A;  2ED0 A;  3CCV T;  2P84 A;  3G4S T;  1QVG A;  4M4Z A;  2A08 A;  1IXD A;  2QYZ A;  3UAT A;  1Y96 B;  3JCM b;  4J9E A;  4C92 A;  3QZ5 B;  1HK9 A;  2D6F A;  3U23 A;  2DL7 A;  2XK0 A;  5C6S A;  2JTF A;  2RI2 A;  2V1Q A;  3QDF A;  1VQP Q;  1QVF P;  1WI7 A;  5LJ3 d;  3FRN A;  2JTE A;  5GMK i;  3HRU A;  3C0C A;  1UGQ B;  2RB6 A;  1VQ4 A;  4KGV B;  1AWX A;  3S3N A;  6AT1 B;  3QYH B;  4Z88 A;  2K2V A;  4BI8 B;  1KQS A;  3GIB A;  1X6G A;  1VQ4 T;  3OB9 A;  4J8O A;  5GAN e;  1R77 A;  2QGF B;  1GRI A;  2XDB A;  3JV3 A;  2PUO B;  3ASK A;  4IKF A;  1OOT A;  4HT8 A;  4BI4 A; 
#chains in the Genus database with same CATH homology
 3ZFJ A;  4C5H A;  3PT9 A;  4EDU A;  5CK9 A;  2EJG A;  1BIB A;  3QUI A;  4JRP A;  4N4H A;  4QVC A;  3S3M A;  3CCE A;  2A7Y A;  3HKS A;  5GAM g;  3HRS A;  4FSX A;  4Z02 A;  5CR2 A;  1N9R A;  1ZQ1 A;  3EFR A;  2JTM A;  4A4F A;  2KY9 A;  2YHT A;  2M9U A;  3GF5 A;  3QHS A;  5FLX E;  2ZPE B;  3LWI A;  2MWP A;  3OS1 A;  3JCM h;  4JLI A;  5LJ3 j;  3PTA A;  1PSE A;  3PFS A;  2H3J A;  3CC4 T;  3CCE T;  4TVR A;  1BIA A;  4JUV A;  3QII A;  3L2U A;  5GAO p;  2VYT A;  4M77 C;  4LDW A;  1BYM A;  2RHZ A;  2FB7 A;  1JJ2 S;  4CRI A;  2E6Z A;  4BE1 A;  2DTH A;  4M78 C;  4GLK A;  1G3T A;  4M77 E;  2RHY A;  1IZ6 A;  3A8G B;  2CYZ B;  3E1S A;  1B34 B;  3C4S A;  3UT1 A;  1Y96 A;  4F7U B;  5LJ3 h;  3GNG A;  3CCM A;  2KK4 A;  4Q5W A;  3LGF A;  1KQ2 A;  3BDL A;  3OYB A;  2VGM A;  3SDZ A;  1QW1 A;  2HQE A;  2L3R A;  3H6Z A;  4BE0 A;  2DXB A;  1VQP T;  2P0Q A;  4PJO G;  4M77 D;  3HFN A;  1X6O A;  2L89 A;  3PIO A;  3CC2 A;  2PVD B;  4M7A C;  1N27 A;  5GMK l;  2E41 A;  1WJS A;  4F7U F;  5A0D A;  2P0P A;  5KCH A;  2OAU A;  2VC8 A;  2ZPB B;  4M78 D;  5CQY A;  3OS2 A;  3DKM A;  5CKB A;  4JJN K;  1YIT A;  1N8R U;  5GAN 8;  2XID A;  1WPY A;  2RHU A;  3I55 T;  1BI2 A;  2DTI A;  2DXC A;  2ZZD A;  3CC2 T;  3KUF A;  5KE3 A;  5CVI A;  3V8K A;  3CMA A;  1TH7 A;  4VUB A;  4BY6 B;  2JN0 A;  2JVV A;  2MAM A;  1YIT T;  2MF2 A;  4ZN1 A;  4WF2 A;  4IUP A;  4KUD K;  3M57 A;  5GAO m;  1Y7X A;  4M7A D;  5GAN j;  5CIU A;  4LD6 A;  2LQ8 A;  3LYI A;  3QO3 A;  1LNX A;  2BKD N;  1MGQ A;  2EWN A;  4HCC A;  1WQ7 A;  3RES A;  3JB9 H;  3CMA T;  2E5Q A;  3FEO A;  1ZBX A;  2QXF A;  1M1F A;  1WNL A;  2E10 A;  3CXC A;  2K3Y A;  5CQX A;  1O9S A;  4ZN3 A;  2AHJ B;  3OYN A;  3OW2 A;  2DTO A;  2VXF A;  3L2Z A;  4M7D E;  3C12 A;  3RKY A;  1FXX A;  1M4Z A;  4PKC C;  4M7D G;  4OVA A;  4C0D C;  3T9N A;  1W2B S;  1GXI E;  4QVD A;  2KSS A;  3S3O A;  3JCM f;  3JCM Q;  2F69 A;  2LC4 A;  4PNO A;  3HSB A;  4M77 B;  2CS7 A;  4DQ2 A;  1M9S A;  3X20 B;  4C8Q C;  5GAN h;  4M7D A;  1YBY A;  4BDY A;  2CKK A;  3M58 A;  1M1K C;  2EAY A;  4R56 A;  3CC7 A;  3DLL A;  2QA4 A;  1VQN A;  2ZCF B;  2RM4 A;  1YI2 T;  4MMK A;  4A4E A;  4C8Q E;  3OYY A;  4XU2 A;  1UGP B;  3MO8 A;  4EMG A;  2PU9 B;  2PQW A;  2EJ9 A;  3SB2 A;  3CD6 A;  2LDM A;  3VUB A;  2K5F A;  3RER A;  1M1G A;  4C0G A;  1G5V A;  2QA4 T;  3V7S A;  5KE2 A;  1VQN T;  5DY9 A;  3OYL A;  4PL6 A;  4C8Q D;  1U1S A;  1Q81 U;  3OS5 A;  2MMP A;  4IUU A;  3URG A;  2RH2 A;  2XI9 A;  4LDX A;  1Y71 A;  3V7R A;  1KQ1 A;  3CD6 T;  4OB3 B;  2EFI A;  4MZM A;  3P8H A;  3E9G A;  4E7L A;  4A54 A;  2RI3 A;  4KBM B;  3H8Z A;  5DLO A;  3QYG B;  2RI5 A;  4XTV A;  1JB0 E;  3CCJ A;  1AHJ B;  2RHI A;  4FM4 B;  1UGR B;  2LRQ A;  3A8L B;  3KBG A;  3MEW A;  3MP1 A;  5GAN 7;  2PUK B;  1BI0 A;  2LX9 A;  3PMT A;  4XTY A;  5FU6 B;  1YJN A;  4Y28 E;  2EQM A;  1KG1 A;  5D6Y A;  3R6O A;  4KUI A;  2DVE A;  2KMT A;  1QVF S;  2CZ0 B;  1N8R C;  4M7D B;  4A4G A;  5CCA A;  3CCJ T;  2E1H A;  4X9C A;  1JBM A;  2FL7 A;  1I5L A;  2X4X A;  1KD1 U;  3OYJ A;  1X75 C;  4YTL A;  3TEE A;  1Q7Y U;  2JUF A;  3OSV A;  4IUV A;  4C5I A;  1YJN T;  4OB1 B;  2EQU A;  3G71 A;  1R8O B;  3QZ9 B;  4XU1 A;  4M7D F;  1VQ7 T;  1Y07 A;  3LLR A;  4NOY A;  5GAN d;  4FL6 A;  4OGC A;  1WQW A;  4KT0 E;  4UC4 A;  4BUG A;  4C8Q B;  5LJ5 e;  5GAN 4;  3OYC A;  2OTL A;  1NZ9 A;  4E7I A;  2K4Y A;  2PVG B;  2WSE E;  2XU8 A;  4ELY C;  1VQL A;  1VQK A;  2E64 A;  3G71 T;  4M75 C;  4RMO A;  1WGS A;  2KAF A;  5GAN f;  3G7Z A;  3MP6 A;  1FX7 A;  3HFO A;  2GFU A;  1UGS B;  1HXD A;  2NLU A;  2P4T A;  2F5T X;  1G3Y A;  4L6V 5;  4OF1 A;  2VXE A;  4LDU A;  3I56 A;  3CPW A;  2FYK A;  4E7K A;  2OTL T;  2LNV A;  4QQD A;  4M75 E;  2CZ7 B;  5HK3 A;  3LW5 E;  2V8K A;  2RK1 A;  3BW1 A;  1VQL T;  4RCB A;  1H64 1;  3OMG A;  3CBO A;  5I2S A;  3RKX A;  2R57 A;  3UWN A;  1QP3 A;  2QQ9 A;  1WJQ A;  4QVZ A;  3QJ6 A;  3SWN C;  4MML A;  2HD0 A;  2OTJ A;  3I56 T;  2GF7 A;  2LTO A;  4HA8 A;  4ELZ C;  3OY9 A;  4M77 G;  2XG8 D;  2RJC A;  4IUT A;  3JRZ A;  4M75 D;  3X25 B;  4DOW A;  3OYK A;  5GAM e;  1K73 U;  1NJI C;  3JCM W;  2E12 A;  4M78 E;  3GNF B;  1XNI A;  2G3R A;  4C0Z A;  4M78 G;  3S6W A;  4M77 A;  3JCM g;  3OS0 A;  1VQP A;  3HP9 A;  4C5E A;  3CME A;  2GFA A;  3OSS C;  3M55 A;  2IG0 A;  2OTJ T;  2EYQ A;  2YRV A;  4EMK C;  4DOV A;  2X35 A;  4PLL A;  1KC8 U;  4XAX B;  1Q81 C;  3FC3 A;  4M78 A;  2EKO A;  5GAN 6;  2DXU A;  3TU4 K;  1K9M U;  3OYH A;  1YHQ A;  2CGH A;  3CCM T;  4FU6 A;  4ZGJ B;  1QVG S;  1OI1 A;  3ZBD A;  5HK0 A;  1SSF A;  3AHU A;  4M7A E;  2M1H A;  2WSF E;  3E9F A;  3OBY A;  4FT4 A;  1WJR A;  3Q1J A;  4O6J A;  3CME T;  1YIJ A;  4M7A G;  2DIQ A;  3OYA A;  3FIF A;  4J7F A;  5FU7 C;  5J39 A;  2E65 A;  4J6Y A;  3F70 A;  2DD5 A;  3OA6 A;  3QSU A;  1YHQ T;  5GAM d;  5LJ3 g;  2CZ1 B;  4M7A A;  5CKE A;  1M90 C;  2VGN A;  4MZT A;  1OZ3 A;  3M56 A;  4PLI A;  1S72 A;  4P5N A;  3V8L A;  4X9D A;  1FWZ A;  3JB9 D;  4ZTJ A;  2LCL A;  2WSC E;  1JJ2 A;  2M16 A;  2JNG A;  2V8I A;  4JLG A;  2RHX A;  5CO7 A;  5GAO l;  5GAO n;  2K3X A;  4J6W A;  1VQ8 A;  4HCB A;  1YCY A;  1VUB A;  3MEU A;  4LDV A;  2RJE A;  4PJO D;  4NS5 A;  3MEA A;  3VJP A;  2DK3 A;  1Q7Y C;  3OYM A;  2RJF A;  4ME7 A;  4RCC A;  3QXE B;  2L8D A;  4QQ6 A;  3J80 E;  3ER0 A;  3QJY A;  1VQM A;  2QI2 A;  3HPW A;  4XTW A;  3G4S A;  3GP8 A;  5CKH A;  3BY7 A;  4XU0 A;  4A4H A;  1VQ8 T;  4C92 C;  3A8O B;  2RA2 A;  2HQX A;  2ZPF B;  2JOY A;  3DB3 A;  3PNW C;  1XTD A;  4JRI A;  3X26 B;  3NTI A;  4N0A C;  4E7J A;  5LJ3 e;  4M78 B;  3SWN B;  2D9T A;  1BI3 A;  4OGE A;  5FRN A;  4V2S A;  3QKJ A;  3RMS A;  4BE2 A;  4RG2 A;  4ATO A;  4C92 E;  3CCR A;  5LJ5 j;  4M77 F;  4FIB A;  3FJP A;  5AYF A;  2L5Q A;  4C8Q G;  4IUR A;  2EIF A;  2I2L A;  4R55 A;  3L42 A;  2LCC A;  1D3B A;  3L2R A;  2XD0 A;  2RJD A;  3FDR A;  4OB0 B;  5GAN 2;  3CC7 T;  4M78 F;  4C8Q A;  2PVO B;  4C92 D;  1NE8 A;  3CCR T;  3CBP A;  4M7A B;  2DIG A;  3NTK A;  3JCM V;  3BFM A;  2XHC A;  4JDS A;  1XOV A;  1G3W A;  1O75 A;  2D0Q B;  2XDP A;  3QG1 A;  3TCJ A;  2DD4 A;  1XQH A;  5GAN g;  3OYG A;  4BI3 A;  3L2V A;  4PJO A;  2HAX A;  5LJ5 h;  5I21 A;  2JZ2 A;  4BAC A;  4M7A F;  3L2Q A;  3JCM J;  3M4Y A;  1YJ9 A;  5A0L A;  3VKI A;  4C0F A;  5GAM j;  3WVD B;  3C94 A;  1W2B A;  5C0M A;  1H3Z A;  3FLG A;  3MEV A;  4DA4 A;  5FRM A;  2RO0 A;  2HNI A;  2F5K A;  3CCS A;  3INZ A;  3A8H B;  4OP0 A;  3VU3 C;  1Q82 U;  4BDZ A;  4J7I A;  3UPU A;  1Q86 U;  3MHX A;  3RKW A;  1YJ9 T;  4O5V A;  3J81 E;  2QTX A;  2ZPH B;  2R5M A;  5IAY A;  5GAN 5;  4LD9 K;  1N6A A;  1EIF A;  2X4W A;  4HKE A;  4C5G A;  3CCL A;  1KHI A;  4XQ3 A;  3EFS A;  3M5A A;  4C0D B;  1D3B B;  4HCZ A;  1OZ2 A;  5KCO A;  2LVM A;  2ZPI B;  3X28 B;  1V29 B;  2IVW A;  5GAM h;  4N4I A;  2EQK A;  3LGL A;  3QBY A;  5A2Q E;  5I2M A;  5IN1 A;  3GPL A;  5FRO A;  3PIP A;  2X4J A;  3FB9 A;  3JB9 J;  3M59 A;  4J5Y A;  5HKC A;  4HT9 A;  3MET A;  4B9W A;  2EJF A;  2K5L A;  1LJO A;  1UB4 A;  3JCM c;  2DEQ A;  4C8Q F;  4JRQ A;  1BKB A;  1G3S A;  5GAO r;  4BY6 C;  1VQK T;  2KDS A;  4M75 G;  2E70 A;  1X01 A;  4II1 A;  5CAI A;  3CCQ A;  4MZP A;  5GMK e;  3CC4 A;  3M54 A;  2C06 A;  4N4G A;  1IRE B;  2YLC A;  4M75 A;  1QVF A;  4KUL A;  4A4K A;  1M1K U;  4L5G A;  5J3B A;  5LJ5 d;  1LOJ A;  5J26 A;  3CCQ T;  2FVU A;  4BB7 A;  3OQ5 A;  1VIF A;  3HL8 A;  3O8V A;  3LWH A;  3X24 B;  2DAQ A;  3PGG A;  3OYI A;  3OYF A;  1VQ5 A;  1VQ9 A;  5M9O A;  5LJ5 f;  2O4X B;  3A5Z B;  2GCX A;  3UDC A;  3QDR B;  2BIV A;  3SWN A;  1NPP A;  3VUZ A;  4E47 A;  3G6E A;  1I4K 1;  3CEY A;  3N5B B;  3P8D A;  3CXC S;  1VQ9 T;  1QVP A;  1VQ5 T;  2DJZ A;  2P0K A;  4J6X A;  2QQA A;  4NL2 A;  4PJO C;  2DXT A;  3PMI A;  1VIE A;  2YLB A;  3QPH A;  2E6N A;  4EPC A;  4JS4 A;  3OW2 S;  3JAM E;  1BI1 A;  2VUB A;  3JB9 G;  1ZHI A;  4IUQ A;  4MDW A;  1PSF A;  4OB2 B;  3G6E T;  3M53 A;  2KQW A;  1K8A U;  3MP8 A;  5GMK m;  4EMK A;  4PJO E;  2VV5 A;  3I55 A;  4A53 A;  4XK8 E;  2DPP B;  1DJ7 B;  3V8J A;  5KH6 A;  3JB9 I;  3LX7 A;  3JCM X;  1YIJ T;  1Q82 C;  2ZGW A;  1I8F A;  3JCM e;  3OYD A;  3C95 A;  5GAM f;  4ZGD B;  3M4G A;  1Q86 C;  1U1T A;  2Y4X A;  2EQJ A;  1W4S A;  1M8V A;  3RMQ A;  1KD1 C;  3MCA B;  3JSC A;  2QQB A;  2QDY B;  3EAE A;  4M75 B;  4QQG A;  4XTU A;  4Y91 A;  5GAO q;  3CPF A;  2DZ9 A;  2Y4Y A;  4FT2 A;  2QQR A;  4X34 A;  1S72 T;  3OMC A;  3CCV A;  3KXT A;  2V8J A;  1VQ6 A;  4GY5 A;  4QW2 A;  2R5A A;  4M75 F;  2WAC A;  3E19 A;  5FU6 C;  5EG2 A;  2DZC A;  4L59 A;  1M5Q 1;  3LH0 A;  2XKO C;  5D6W A;  2DKG A;  4E7H A;  1VQM T;  3CCU A;  4OMF B;  3RUX A;  1KQS S;  4M7D C;  3CCV T;  3G4S T;  2K5I A;  3ZEH A;  1QVG A;  4LDY A;  1VQ6 T;  4MDX A;  2BUD A;  5DLQ E;  3JCM d;  4C92 G;  5IT9 E;  3SD4 A;  3NTH A;  2CZ6 B;  3ME9 A;  4XTX A;  2QEX A;  2FHD A;  1Y96 B;  3VV0 A;  3JCM b;  4C92 A;  1YI2 A;  3CCU T;  1UEB A;  3A8M B;  3GLX A;  3QZ5 B;  2M0O A;  3CBM A;  3OBW A;  4RG8 A;  1HK9 A;  4EMK B;  2K57 A;  2RD1 A;  3DB4 A;  2KVQ G;  2HBP A;  4JRK A;  4N0A A;  2D6F A;  3WXM B;  5C6S A;  2XK0 A;  1QP2 A;  4CI0 C;  5DM7 R;  3OYE A;  2JTF A;  2RI2 A;  1VQO A;  1N9S A;  2QEX T;  4M7D D;  1K73 C;  2XDD A;  5HY6 A;  5GMK j;  3VYG A;  5LJ3 d;  4EMH A;  4PJO B;  1NJI U;  3JCM P;  1YJW A;  3FRN A;  5FU7 B;  2LQK A;  2RK2 A;  5GMK i;  2LT1 A;  3HRU A;  3JB9 F;  2XIC A;  1I81 A;  1JRI A;  2MI6 A;  5LL6 S;  1UGQ B;  2RB6 A;  3VYH B;  1VQO T;  1KC8 C;  1VQ4 A;  5LJ3 f;  2GQV A;  3M9Q A;  1K9M C;  4PJO F;  4D6W A;  5D6X A;  2B8A A;  3V7C A;  1YJW T;  1RI0 A;  3S3N A;  2QQS A;  3BDU A;  3WVE B;  3J7A F;  3QYH B;  2K2V A;  4NL3 A;  4BI8 B;  3SFM A;  1KQS A;  2R58 A;  2X4Y A;  5CKF A;  4ZTF A;  3GOX A;  1U8R A;  4JS5 A;  2Y90 A;  2MWO A;  3NFC A;  3RIR A;  5GMK h;  4B9X A;  5CKD A;  2DO3 A;  2LT4 A;  3L2W A;  1VQ4 T;  3GIB A;  3CCS T;  3OB9 A;  3CPW S;  2O4X A;  4J8O A;  1K8A C;  4XU3 A;  5GAN e;  4J83 A;  5LJ5 g;  4XTZ A;  4F7U E;  5GAN 3;  4C92 B;  4F7U G;  1M90 U;  2XDB A;  1P92 A;  2PUO B;  3ASK A;  3DLM A;  1MHN A;  5A0G A;  1RL2 A;  2O01 E;  3CCL T;  3HRT A;  1KHC A;  4RKU E;  4IKF A;  1B34 A;  1NPR A;  1VQ7 A;  4BD3 A;  4F7U A;  3HHT B;  1OYX A;  4ZGE B;  5L8R E;  3L1A A;  2A3L A;  3TRE A;  2ZPG B;  4HT8 A;  4C92 F;  3P8B B;  4BI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...