2IG0A

Structure of 53bp1/methylated histone peptide complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Methylation State-Specific Recognition of Histone H4-K20 by 53BP1 and Crb2 in DNA Repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Tumor suppressor p53-binding protein 1
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ig0A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ig0A01
3I56A 2R5AA 2F5KA 2MWPA 3CMAT 3S3MA 3P8DA 2X4YA 4ZTFA 3PNWC 3LX7A 4A4FA 4LD6A 2RHUA 1QVFA 1XNIA 1NJIU 3LGLA 4PLIA 3QBYA 3MP6A 1YJ9T 3CCJT 4C5GA 3NTKA 2R5MA 1YITT 3NTIA 2IG0A 1K8AC 3LH0A 5IT9E 2HQEA 3OYMA 3QJ6A 3CCMA 3P8BB 3LGFA 2R58A 2QEXA 2E70A 1VQMA 1N27A 3OY9A 1XTDA 1YJWT 1OYXA 3MEUA 1IZ6A 1SSFA 1Q82U 3A5ZB 3CCEA 3OW2A 3H8ZA 1YJNA 5KCHA 3CEYA 2RHZA 3SD4A 2LCCA 2LRQA 3CPWS 4BE2A 4E7LA 5KH6A 4ZN3A 1KQSS 1G5VA 3CCLA 4II1A 3G6ET 1Q82C 3QKJA 5FROA 5C6SA 2E5QA 3J81E 1YHQA 3CCLT 1NZ9A 2OTLT 3MP8A 3P8HA 2GFAA 5IAYA 2D9TA 3GOXA 3ASKA 3PIOA 1Q7YU 2EIFA 3L2QA 3OW2S 4N4GA 1VQ9T 2JZ2A 4IUPA 4CRIA 3DB4A 2RO0A 2E6ZA 4A4EA 3CPWA 1VQMT 1Q86C 3OS0A 3OYDA 1VQ5T 4YTLA 1YBYA 1S72A 2EQMA 2JTFA 1M90C 1KC8U 2XHCA 1YIJT 1VQNA 2BIVA 4HCZA 1OI1A 1X6OA 4BDZA 2NLUA 4UC4A 4C5EA 4IUVA 3FC3A 1VQLT 3CCJA 3DLMA 1YJ9A 2XK0A 2RI5A 1OZ2A 1Q81U 3FDRA 4Z02A 5J3BA 2DIGA 1YIJA 3MO8A 2OTJT 2B8AA 3S6WA 2M0OA 3DB3A 3OS2A 3EAEA 1YHQT 2FHDA 1Q81C 2KDSA 3CC4A 4QQGA 1WJQA 3LLRA 3CMAA 2LDMA 3KUFA 4A4HA 2LTOA 2EQKA 3OYAA 1K73U 3M9QA 4IUQA 1BKBA 1YJNT 4ZN1A 2M16A 2EKOA 3Q1JA 2QEXT 3ME9A 3OQ5A 3CC7T 5KCOA 3CMEA 4Q5WA 2LQ8A 5FLXE 1VQ6T 3CCET 3OYLA 1K9MU 3FLGA 1WJSA 3PFSA 3CPFA 5M9OA 2CKKA 2E6NA 3G71A 1KD1C 2O4XA 3TREA 1RI0A 4QQ6A 5IN1A 3OYBA 2RJCA 2DIQA 1WJRA 4BE1A 3DLLA 1W2BS 4E7HA 4RG2A 2R57A 3E9GA 3CCUA 3MP1A 4QQDA 2M1HA 5D6YA 2MWOA 2QA4A 4C5IA 4E7JA 4FU6A 3C4SA 3G4SA 1M90U 3CCRT 3CCVA 5FRMA 1OZ3A 2OTJA 4IURA 1KD1U 2X4XA 3I55T 3CD6T 2QA4T 3NTHA 1MHNA 3OYEA 2YRVA 3CCUT 3I55A 2LVMA 5A2QE 2JOYA 2DAQA 2JUFA 1VQPA 1W2BA 2RHYA 3OYCA 3HKSA 4GY5A 3CCVT 1KHIA 1VQNT 3L2UA 1YI2A 1K8AU 4IUUA 2PQWA 5J39A 2K3XA 1VQ9A 1VQ8A 1K73C 3CCQA 1VQ7A 2L3RA 4QW2A 4IKFA 1WGSA 1VQ5A 3CC7A 2O4XB 1VQKA 3G71T 3MEVA 5J26A 1QVFS 2EQJA 1K9MC 4EDUA 3UWNA 3PMTA 4IUTA 3CCST 3OYJA 5C0MA 1VQ6A 3OMGA 5KE3A 3CMET 1M1KC 3PIPA 1EIFA 3CCSA 2HQXA 2L89A 4OVAA 1QVGA 2QQRA 3OYFA 3G6EA 2RHXA 3J80E 3E9FA 3F70A 2GFUA 1JJ2S 3OYGA 4N4IA 2XDPA 2RJFA 2KVQG 4BDYA 3OMCA 1VQOT 2RHIA 5DLQE 3OB9A 1VQ8T 2JNGA 3CC4T 1Q7YC 2EQUA 1VQ4A 4N4HA 3S3NA 5D6WA 2LCLA 2DO3A 3L2VA 4E7IA 1S72T 1QVGS 4C5HA 1KHCA 2RI3A 3UT1A 3OYYA 1VQPT 3MEWA 3JAME 1VQLA 1VQ4T 4FL6A 2X35A 3CXCS 3CD6A 1VQOA 4PLLA 5DM7R 1YI2T 4ZTJA 1Q86U 2RI2A 5KE2A 3LYIA 2MI6A 3META 3OS1A 3OYKA 2RJDA 3OYIA 2JVVA 4PL6A 4BACA 3J7AF 4L59A 2X4WA 5CIUA 3I56T 3KBGA 1RL2A 3O8VA 4BD3A 2OTLA 3BDLA 1JJ2A 3G4ST 4A4GA 3L42A 3FEOA 2BKDN 4B9XA 2GF7A 3L2WA 1YJWA 4TVRA 2EFIA 3PMIA 3ZEHA 1NPRA 5FRNA 2WACA 1N8RC 1M1GA 1H3ZA 5HY6A 2P0KA 1NPPA 3OYNA 3OYHA 1YITA 2G3RA 4NS5A 3CC2A 2K3YA 1VQKT 2BUDA 2RJEA 1UEBA 3CC2T 3CCMT 1N8RU 3OA6A 4BE0A 4QVZA 2QQSA 1M1KU 5D6XA 3CCQT 1VQ7T 4X34A 3CXCA 3L2RA 3H6ZA 1KC8C 3QIIA 1NJIC 2VYTA 1KQSA 4E7KA 3S3OA 3ER0A 4B9WA 3CCRA 3MEAA 5LL6S 2L8DA
chains in the Genus database with same CATH superfamily
2K7AA 3I56A 3FIFA 2EYXA 4WCIA 3V7CA 2EJ9A 2R5AA 4KH1B 3RBBB 3VS4A 4XQ3A 3CMAT 3P8DA 4PFPA 4PJJA 4JJDA 2MF2A 1WA7A 1BU1A 3OSVA 1TU0B 2CZ0B 3PT9A 3CC7Q 2IIMA 4OP0A 2VC8A 3NTKA 1U1TA 2M0YA 5GAN7 2ZPBB 3NTIA 2A7YA 2I0NA 4PKCC 1VQ6Q 3EHRA 3M0QA 2DYIA 2YUQA 3HP9A 3JB9H 2DJQA 1M4ZA 1ABQA 2KROA 1JO8A 4HT9A 2RQUA 3LGFA 2E5KA 5CVIA 2E3IA 2E70A 3HFNA 1N27A 4M75C 2YSQA 1YJWT 1TS9A 1IZ6A 1EX4A 3A5ZB 3CCEA 1YFNA 2CGHA 1U06A 2DEQA 3X20B 3CPWS 2PUOB 4JDSA 3OSSC 5KH6A 4II1A 3I56Q 1SHFA 1FX7A 2GBQA 2DYBA 1Q82C 3G4SQ 2E5QA 1QVPA 3J81E 4M75G 1G3YA 2K2VA 3MP8A 3P8HA 1NE8A 1K73R 1SF9A 5IAYA 4ZGDB 1H641 1NJIR 3CCJQ 3PIOA 4HXJA 2K4YA 2LC4A 4LDVA 3MKDA 2ED1A 3DB4A 2EAYA 4M7DD 4A4EA 1VQMT 4X9CA 1PM3A 1ABOA 1VOMA 1OX8A 3OYDA 1AZGB 1VQ5T 4YTLA 1S72A 2V1QA 1M90C 2FPFA 2BIVA 1TUDA 2ESWA 2GTJA 1X6OA 1ZX6A 2HEQA 2LMJA 1K0XA 4PJOC 4OMMA 1VQLT 3DLMA 1Y71A 1M27C 4F7UG 3FDRA 4Z02A 2JS2A 3MO8A 2PNIA 1BI3A 1PC0A 3GLXA 5GAMd 1UGPB 2B8AA 2QQBA 3DB3A 3EAEA 1YHQT 1H3HA 1AVZC 1Q81C 1M30A 2XD0A 3CMAA 2LDMA 1YCSB 2JTMA 3TSWA 2LTOA 1C1AA 2MPXC 1GBQA 2QAZA 3EGXA 1YJNT 2DXUA 4XU2A 2YHTA 1MNDA 1QMCA 1PSEA 1QWFA 2EKOA 4AFSC 4PJMA 1RI9A 2EYZA 1YN8A 2DTHA 5KYNA 1G3SA 4C8QE 4JJCA 1WX6A 3JCMd 3EFOA 1W4SA 5KCOA 1YITQ 4Q5WA 4M7AE 5FLXE 1VQ6T 2XU8A 1M2VA 3CCET 4M7DE 3M56A 1XQHA 4FYXB 5CCAA 2COZA 3FLGA 4ELZC 1S1NA 2C06A 2XDDA 1ZBJA 3TU4K 3G71A 3JCMX 3TREA 3L2ZA 2RMOA 2JM9A 2CZ7B 3EGUA 2RA2A 3I35A 1C6VX 2VXEA 4XU0A 3TCJA 2DD5A 3N5BB 1G83A 1B34B 1X2KA 1WJRA 2Z0WA 5HKCA 3I55Q 1W2BS 1O75A 4JRKA 4C8QA 1I0CA 1R0CB 3CCUA 2LNVA 3NGPA 2QA4A 4MDWA 4X1VA 1R77A 5HK3A 2KMTA 4FU6A 2IVWA 1ZSGA 2VV5A 3A8GB 2KK4A 3CCVA 1OZ3A 4OMQA 2X4XA 4C92G 2J06A 1MHNA 4XTVA 4HVWA 1BI1A 3CCUT 2OI3A 2LVMA 1NM7A 6AT1B 4D8DA 5A2QE 4E7SA 2PVDB 5IHIA 1VIEA 4LDXA 4A4KA 3CCRQ 1YI2A 4LD9K 2DD4A 3EH1A 5CKFA 4C92D 4A53A 5DLOA 5J39A 3BW1A 2FZCB 2M51A 1JXOA 3DKMA 3BY7A 2EGAA 4FSXA 3QSUA 1F1BB 1VQ8Q 3G1JA 4QW2A 3WVEB 1UGSB 2QTXA 1VQ5A 2VVKA 2K5IA 1VQKA 2JS0A 4LDUA 5J26A 2EQJA 4HVUA 4MMKA 1JEGA 3PGGA 3OYJA 2ZGWA 1QP2A 2E12A 5LJ3j 3PIPA 1EIFA 4ME7A 4M7DG 2L89A 2QYZA 1D1BA 3J80E 3F70A 3EG2A 1MMGA 4DA4A 1QQJA 3CC2Q 1PHTA 2MK5A 3RR6A 2KVQG 4F7UB 2KSSA 2XICA 4FCYA 2I2LA 2JNGA 1PD1A 2NWMA 3S3NA 1K76A 1VYUA 2L0AA 4F04B 2GQIA 4FYYB 1I07A 3REBB 2K9GA 4E7ZA 4M7DF 1IXDA 2KRNA 4C5HA 1QVGS 1FWZA 2QGFB 1KJWA 2RI3A 4BI8B 3OYYA 3H9NA 3MEWA 5GAMg 3QYHB 2K6DA 1MV0B 3QWYA 1CKBA 2F69A 4A63B 4NOYA 1B3QA 3NMZC 1GCPA 4Y91A 3CD6A 4RCCA 2WSCE 4HCCA 2EYWA 3JCMJ 4ZTJA 2KXCA 2W0ZA 4KBMB 2NUPB 4J9DA 3INZA 3VU3C 3OYKA 1RAIB 1WHKA 4XU3A 4PL6A 3UATA 3M55A 3FB9A 3J7AF 4FIBA 4L59A 2DTOA 4KH0B 2LNHB 1NBEB 3I56T 3KBGA 2K5FA 1YJNQ 2JM8A 1I8FA 4AG2C 3G4ST 4LDYA 2EYYA 4OMFB 4DBQA 3QHSA 5IXFA 1M3CA 1G2BA 3LWIA 4B9XA 4JZ3A 2CDTA 2GF7A 1YJWA 8ATCB 1HD3A 3GP8A 3PMIA 1VQ4Q 5FRNA 2JN0A 4X9DA 4M75D 4L6V5 1N8RC 3JCMc 1RAHB 1NPPA 4LXCA 2YUNA 3KXTA 2PZ1A 3CC2A 3ZL7C 4PJOA 4M7AG 5IXBA 1PCXA 3PVQA 4N0AA 4JRPA 3JB9J 2GNCA 3CCMT 1Q82R 3REAB 2CREA 3OA6A 1WYXA 2QQAA 4KGXB 3EGDB 1M5Q1 2PVGB 1NEGA 2CZ1B 1YJ9Q 1VQ7T 4X34A 3L2RA 1KC8C 2J6KA 3QIIA 2DETA 3JCMQ 1WXBA 4ANJA 5GAMj 1BB9A 3I9QA 1NYGA 4O6JA 1KQSA 4EMKB 3RNJA 4M75B 4M7AC 3S3OA 1U8RA 2YLBA 4Z89A 4PNOA 1E7OA 3CCRA 3H0IA 1BYMA 2YRDA 3R6NA 1WXUA 1IO6A 2F5KA 3E19A 3CCUQ 2MWPA 5LJ5e 2QGGA 5GAOm 2X4YA 4ZTFA 1G3TA 3LX7A 3M4YA 4JUVA 3VYGA 2KAFA 4LD6A 2HAXA 3RKWA 1WIEA 4JRQA 3CBPA 3SWNA 1QCOA 3SWNB 2KT8A 1OQKA 1W70A 3OBYA 3CCJT 3AT1B 2VWFA 2CP2A 4C5GA 4LUDA 1D09B 2R5MA 4AFUC 3RKXA 1WXTA 1LVKA 3QJ6A 3CCMA 1GL5A 2D0QB 3CPWP 4ESRA 2R58A 2V8IA 2QEXA 3OY9A 4A54A 3VS7A 4QKUA 2CZ6B 4RG8A 3MEUA 5EG2A 1Q82U 2A28A 4J9GA 1X75C 1ZHIA 1UG1A 1I5LA 3H8ZA 3NPFA 1LCKA 2RHZA 2KYMA 3SD4A 2LCCA 3LWHA 1UE9A 5GJWB 4BE2A 2MOXA 1GCQA 4ZN3A 3CCLA 3G6ET 3QKJA 1YHQQ 2CH4W 5HK0A 3CCLT 1X01A 1MNEA 4V2SA 3GNFB 4XTYA 2DPPB 5GMKe 4DEXA 2D9TA 2RQRA 2QDLA 1WHLA 1T3SA 2HDAA 2RNAA 2EIFA 4M7AD 1VQ9T 1RLPC 4DBFA 4IUPA 5CO7A 5GAOl 3D7SB 2X3XD 4PJLA 1OX9A 5GAOq 2QQ9A 3EHQA 3JCMV 1Q86C 5GAN5 1S72Q 1YBYA 1WHJA 1LJOA 3V8KA 1KC8U 1YIJT 4ZNXA 1OI1A 3VKIA 3JCMb 1MUZA 4FYWB 1UGVA 4UC4A 5LJ5d 1ZSZB 1KFZA 2P4RA 2KT1A 5GAN8 1X69A 2YUPA 2DL5A 3UF4A 4RTVA 4DBRA 2BZ8A 1Q81U 5J3BA 3JCMe 2OTJT 2CSIA 1ZSZC 3MCAB 2HMAA 2MCNA 3S6WA 3OS2A 1SEMA 4M78A 2FHDA 4RTWA 3U23A 1BCOA 1X6GA 4QT7A 3HRSA 1WJQA 2NYSA 5KYUB 3LLRA 2BZXA 4B6MA 3EG1A 3EG9A 1MGQA 3KUFA 3RKYA 4J9IA 4A4HA 5L23A 1V29B 1ZSZA 1BKBA 2BE9B 4BY6B 1AWWA 1YNZA 2B86A 1GFDA 2E65A 3M54A 2FYKA 1UHCA 2DERA 2KXDA 4J8OA 2LQ8A 3CBOA 1Y7XA 5CKDA 2VB6A 1WQWA 2DM1A 2HKNA 3GBQA 1K9MU 1OU9A 1UDLA 1W2BP 2AZSA 2DZ9A 1KD1C 2O4XA 1G8XA 1RI0A 5GAN4 1VA7A 1IRXA 3HTRA 1KSWA 4PJNA 1D1CA 1TXQA 2RJCA 2HCKA 2XKOC 1RUWA 2DL8A 1LPLA 2PTKA 3DLLA 2ECZA 4LN2A 1Q95G 2F2VA 1WI7A 2LQWA 3MP1A 4PFOA 4DEYA 5D6YA 1GCQC 4C5IA 2KGTA 3G4SA 4PFZA 2QEXQ 3V7RA 4CC4B 3CCSQ 2OTJA 4IURA 1K1ZA 2D8HA 3GIBA 2ZPIB 1T0HA 4J9CA 3OYEA 1UGQB 2OAWA 3UDCA 3VS5A 4HVVA 1ZUKA 1TUCA 2RHYA 3OYCA 4GY5A 3A8LB 3CCVT 3H0FA 1PKSA 1M90R 3JB9F 4QVCA 3X24B 1K8AU 2KI7A 3C0CA 2VGMA 1WHGA 2EGEA 3T9NA 3EFSA 3TSZA 5GAN3 3GNGA 2DMOA 5DY9A 2CYZB 5LJ3e 2EJGA 2QG9B 3A98A 2L3RA 2OTJQ 1D1AA 4J7IA 1WGSA 2CH4A 4F7UE 4HT8A 4M75E 1VQKQ 1FMVA 2AKKA 1K9MC 1VQPQ 3M0TA 4M7DB 4C8QF 2ZZDA 4DOWA 2K5LA 4C8QB 5D7UA 1V76A 1HXDA 2DXBA 3VS3A 1T3LA 1QVFP 3OYFA 1TH7A 2RHXA 2O01E 2GFUA 1JJ2S 1Y57A 1FMKA 3ULRB 1NLPC 4BDYA 4HKEA 3OB9A 4C8QG 3PE0A 2FRYA 1VQ8T 2FPDA 3CC4T 1VQ4A 5CQXA 1VYTA 2JW4A 2F2WA 3R6OA 4EMKA 4PJOD 1YWPA 1SPKA 1KHCA 2RM4A 3X28B 2PU9B 2CP7A 2J6OA 3M0UA 3JSCA 5AT1B 4C92A 4CC2A 4FL6A 2KYBA 2YT6A 2M02A 3VS6A 1Z9ZA 4ZGEB 3QXEB 2X35A 3CXCS 1QKWA 3HRTA 1RACB 1YWOA 4C0DC 1Q86U 2JMAA 1BIAA 2CP3A 3META 4OMOA 2JT4A 4BUGA 1AEYA 1N5ZA 5L8RE 1HK9A 4J9FA 1BI2A 1RLQC 2X4WA 3CXCP 1K0SA 1RL2A 3O8VA 2HSPA 3G7ZA 1KG1A 4O5VA 5GAN6 3BDUA 2X9HA 2ROLA 3FEOA 4KGVB 4M7AB 3L2WA 4XK8E 2EFIA 3CCMQ 3OBWA 3I5RA 4M78C 3RIRA 3QZ5B 2WACA 5CQYA 1PG5B 2A08A 1TOVA 1QKXA 2DILA 3OYNA 4E47A 5CAIA 2G3RA 4M78B 1X27A 1PRMC 2H8HA 2HL5C 4PJOE 5I2SA 3VYHB 2FPEA 1A0NB 3NFCA 5LJ5f 3URGA 3CC2T 2K57A 1N8RU 3M0RA 1M1KU 3JB9I 1K8AR 3VUZA 3MPUB 2V26A 4J83A 2LQNA 1E6GA 1AWOA 1NJIC 1WHHA 4GLMA 4HCKA 1UGRB 2DE0X 3WXMB 2C0TA 2E3HA 4E7KA 2DEUA 1M1FA 5LL6S 2L8DA 4M7AF 1ZA1B 1Y96B 2ZAEA 4E6RA 4JLIA 1VQOQ 1KIKA 1OEBA 3FRNA 2QASA 5CKBA 1IGUA 3PNWC 1HYOA 2DL4A 2AIRB 2CP0A 4A4FA 1QVFA 1XNIA 2E64A 1DJ7B 1QWEA 1NJIU 4KUDK 5GANg 4J9BA 4EIKA 1G3WA 5KYWB 4PLIA 5GANd 2HD0A 2FZGB 2KQWA 4JS4A 1YITT 2YDLA 3CBMA 2LJ1A 1YP5A 1K8AC 3LH0A 5IT9E 5I2MA 2OX7A 4CC7A 2OJ2A 1KQSP 3CCVQ 1VQMA 2J05A 1OYXA 2FB7A 1VQ5Q 4R56A 1RAEB 3SFMA 1N8RR 4QVDA 3OW2A 1BIBA 2DL3A 1YJNA 1FMWA 1GRIA 3CEYA 3ZFJA 1RABB 4JPBW 4E7LA 1VQLQ 1QW1A 3CMEQ 1KQSS 4OB2B 1E6HA 4HCBA 5FROA 5C6SA 2EW3A 4PJOG 1YHQA 4OB0B 1RAFB 4FSSA 2OTLT 2XIDA 3G71Q 2EVRA 2GFAA 1YIJQ 3JCMf 3GOXA 4AFQC 3ASKA 2DBMA 1Q7YU 4KRTA 3L2QA 4N4GA 1TUGB 2JZ2A 3H41A 5LJ3d 2D8JA 2O31A 2E6ZA 5GAOn 4BY6C 3CPWA 2ED0A 2FL7A 4VUBA 3VRYA 5KYWA 1AD5A 1UB4A 1Q86R 2EQMA 2JTFA 5GMKh 2XHCA 1VQNA 2YWWA 1JXMA 2ROTA 5GJVB 4BDZA 2NLUA 2CT3A 5CR2A 4R55A 3C94A 4C5EA 4RUGA 2RI5A 1B34A 2Y4YA 1OZ2A 1ZUUA 1AOJA 4C92C 3FJPA 1KQ2A 4C92E 4XTZA 1CSKA 2KEAA 2L3SA 1M8MA 4PJOB 3V8LA 3BFMA 2KDSA 3CCLQ 2AT1B 3CC4A 2X4JA 1C0MA 5LJ5g 2YLCA 2EQKA 2JMCA 1QCFA 3OYAA 2DF6A 1K73U 3M9QA 3QJYA 4IUQA 1BCMA 2HBWA 1RAAB 2F5TX 5GANe 4ELYC 4ZN1A 2M16A 2ZPGB 1D3BA 4CC3A 4IIMA 4OF1A 1KQ1A 3EGXB 4XTXA 4EMHA 3ME9A 1QP3A 1ZLMA 2PUKB 5CK9A 3PFSA 1HSQA 3CPFA 4FW2A 3HHTB 5M9OA 2LP5A 1Y96A 1YJWQ 4QQ6A 1MMNA 4JZ4A 1D0YA 3SHWA 4JRIA 5IN1A 4DQ2A 2KE9A 2DX1A 1M3AA 2LX7A 2DIQA 1WLPB 5GAMh 4HA8A 2NUTA 3E9GA 2RPNA 2L3QA 4QQDA 3CC4Q 1WQ7A 1Q81R 3VS0A 2RK2A 2X51A 2ZCFB 4OMNA 2F1LA 4E7JA 2EJFA 3EG3A 5LJ3f 3HSBA 1SHGA 5FRMA 3SDZA 5I22A 3UPUA 4F7UF 3CD6T 2QA4T 3NTHA 2YRVA 4F7UA 4ZGJB 2ATCB 3JRZA 3I55A 2WSFE 1IGQA 1WDXA 2JUFA 1VQPA 1W2BA 3M0SA 3V8JA 4L5GA 1D3BB 2HKQB 1VQNT 3L2UA 4OMPA 1M9SA 1YI2Q 4IUUA 2V8JA 1N9RA 4OB3B 2YUOA 1KD1R 3A8OB 3TQ7P 4M78G 2Y90A 2K2MA 2DKGA 3RDVA 2DTIA 1PD0A 1UHFA 2HZYA 2ZPFB 2COYA 2RQVA 3CCQA 2KR3A 4J6YA 2F2XA 3JCMg 2GTOA 1R0BG 4RTTA 2D0NA 3RERA 1BI0A 2E41A 3MEVA 2LT4A 1QVFS 2DA9A 2CS7A 4EDUA 3UWNA 3CD6Q 1PRLC 1T0JA 5FWCA 3M4GA 4C0FA 3CCST 1U1SA 5LJ5h 3C12A 4RTXA 2FVUA 2DVJA 1VQ7Q 5KE3A 3CMET 2IPOB 8AT1B 2O88A 3CCSA 2HQXA 4GLKA 4OVAA 1QVGA 2E4HA 4D8KA 3E9FA 3G6EQ 1R8OB 3QWXX 2EYQA 4N4IA 4M77F 1SSHA 2FZKB 2D1XA 2XDPA 2QTVA 1TSFA 2RJFA 4Y28E 1O9SA 3JV3A 4NL3A 1ZQ1A 2CP5A 1QCNA 3OMCA 2RHIA 5DLQE 5IH2A 5A0LA 2DXCA 1VYVA 2LT1A 1Q7YC 2HSEB 3X25B 3V7SA 1JJ2P 2LCLA 5GAOr 2DNUA 3L2VA 1OU8A 1YCYA 4F14A 5IHNA 4E7IA 1S72T 2DRMA 5CKEA 3UT1A 4M7DC 2C0IA 5CKHA 3SB2A 3A8MB 3WVDB 1VQPT 2OTLQ 2EWNA 3JAME 1VQ4T 4RMOA 2K3BA 2MMPA 3CMAQ 2GCXA 2KRSA 1VQOA 4J6XA 3KFVA 4PLLA 2CUBA 5DM7R 3GF5A 3VS1A 3EG0A 3M5AA 3OS1A 3QDRB 2RJDA 2JTEA 2LQKA 2JVVA 4BACA 5KYXA 2XDBA 4WF2A 1I4K1 4BI4A 4RCBA 5CIUA 1SG5A 2YXYA 3EFOB 1AWXA 2CSQA 2XI9A 2KRMA 4ATOA 3BDLA 3RMQA 2COWA 3L42A 2A0FB 2BKDN 2LCSA 2DBKA 4C0GA 4BB7A 4TVRA 1OOTA 3EFRA 2RD1A 2QXFA 3ZEHA 3X26B 1U5SA 5GANj 1NPRA 1WHMA 4C92F 1H3ZA 4F17A 2P0KA 4KT0E 1YITA 3JCMh 4NS5A 4R0KA 2DXTA 2VUBA 4BI3A 3RESA 3VJPA 2BUDA 2AK5A 1GBRA 4AMCA 4BE0A 2A3LA 2KBTA 5FW9A 4M75F 5D6XA 3SEMA 3CXCA 2SRCA 2HL3A 3H6ZA 9ATCB 2GGRA 3VRZA 3A1PA 4MZTA 2DFUA 1UUEA 1I5OB 4XTWA 1GXIE 4AT1B 2RK1A 2QK0A 2O9VA 4XU1A 3ER0A 4B9WA 3MEAA 3A8HB 2H3JA 1NLOC 4EMKC 3S3MA 1GFCA 2L3PA 5I11A 3SWNC 5GAMe 4MDXA 1BK2A 2RHUA 1SRMA 1WNLA 4Y92A 3LGLA 2RH2A 3ZBDA 3UA6A 3QBYA 3MP6A 3OS5A 1YJ9T 2A36A 5I21A 3THKA 1RADB 2P4TA 5LJ5j 1ZA2B 2IG0A 1Z9QA 3AHUA 2O2OA 1WFWA 1MMDA 2HQEA 3RMSA 3VV0A 5KYUA 3OYMA 2EGCA 3P8BB 5FU7C 3TVTA 1XTDA 1IREB 1SSFA 2GQVA 2E1HA 1UJYA 4M77D 4M77B 1ACMB 1I1JA 2V8KA 5FU7B 5KCHA 1EZZB 2LRQA 1Y07A 2DLPA 2M9UA 3TEEA 4M77C 1G5VA 4C92B 1QLYA 3QG1A 1SKUB 1TTHB 1NEBA 4M7AA 1AT1B 5HCKA 1VQMQ 2VKNA 2KY9A 1NZ9A 1PSFA 2V1RA 3PTAA 1KC8R 1IHVA 2AHJB 5IHKA 4OGEA 1HJDA 1B07A 5FWBA 5LJ3g 3OW2S 4IIOA 4CRIA 2FO0A 2DRKA 7AT1B 2RO0A 4M77G 3OS0A 4E2FB 2L5QA 4JS5A 1JRIA 1BBZA 1JQQA 1P92A 4HCZA 4FW1A 2HBPA 1PKTA 3OW2P 1SRLA 4IUVA 3FC3A 3CCJA 5KYYB 1YJ9A 2XK0A 4J5YA 2RF0A 3LW5E 1MMAA 2DIGA 4LE9A 1YIJA 2QDYB 4RKUE 1JU5C 1FYNA 5KYXB 2M0OA 2EKHA 5A0GA 4M75A 2CT4A 3E1SA 4XAXB 4QQGA 2CP6A 4NL2A 2EPDA 5KYYA 1IB8A 2XG8D 1H92A 2CUDA 4M78D 3C95A 3HRUA 4JJBA 4LNPA 1CKAA 3Q1JA 3UA7A 2OAUA 2QEXT 1W1FA 3OQ5A 3CC7T 3CMEA 3M57A 2O9SA 2AZVA 4P5NA 1Y0MA 1TWBA 2BTTA 2VGNA 3OYLA 4M7DA 1ZUYA 4PK4A 4PJOF 1WJSA 1VQNQ 1D0ZA 2CKKA 2E6NA 1N6AA 1X43A 4FT4A 4OMLA 4RTZA 3OYBA 2Y4XA 2P0PA 1AWJA 3MJXA 4BE1A 5FU6B 3HFOA 3PVLA 4E7HA 2C0OA 2MIOA 2R57A 4KULA 4RG2A 3O5ZA 4J7FA 1IHWA 1UECA 3QYGB 2M1HA 1X6BA 2MWOA 5AYFA 2QI2A 4M77A 3JB9D 5FU6C 3C4SA 3M58A 1M90U 1LOJA 1TG0A 3CCRT 2FEIA 2NUPA 4GBQA 1FXXA 1M8VA 2AKLA 1OPLA 2DJZA 3GPLA 1KD1U 1EFNA 4FM4B 5GAOp 2RQTA 4KGZB 5ECAA 3I55T 1OULA 1VQ9Q 5LJ3h 4WTOB 2ENMA 2RQWA 2SEMA 2JOYA 1X2QA 4C0ZA 2DAQA 4M78E 2WSEE 3HKSA 3EH2A 3NHNA 1KHIA 1UJ0A 1VUBA 2VASA 4CI0C 1K9MR 2X3WD 1WZOA 1Q7YR 2J6FA 2PQWA 4KUIA 1LNXA 2QA4Q 4LDWA 2K3XA 2EQIA 1VQ9A 1VQ8A 1K73C 1VQ7A 2VXFA 2DL7A 1J3TA 2K79A 3CQTA 4J9HA 4IKFA 1I81A 2G6FX 3CC7A 1XOVA 4OGCA 3BE3A 1UTIA 2O4XB 2ZPHB 1XJWB 5GMKl 3FJ5A 2ZPEB 4RTUA 4C8QC 3VUBA 3G71T 2JJ9A 5GMKm 3PMTA 4IUTA 2A37A 5C0MA 3E2UA 1VQ6A 1KK7A 1AZEA 4C8QD 3CCQQ 3OMGA 4M4ZA 1M1KC 2BZYA 4EPCA 2NUTB 4OB1B 3QPHA 2QQRA 3G6EA 1MV3A 3OYGA 3MHXA 1JB0E 2LX9A 2DVEA 3I5SA 3HL8A 4FYVB 3EG9B 4XTUA 4J9EA 4K11A 1VQOT 1AHJB 1WPYA 2BE7D 2EQUA 4N4HA 1OPKA 5D6WA 2FRWA 1JBMA 3M0PA 2DO3A 2JXBA 5GMKi 4Z88A 2P84A 5GANh 1N9SA 1H8KA 1PWTA 1M2OA 1VQLA 2H3EB 2E10A 2MAMA 3JCMW 3JB9G 1W6XA 4MZMA 2HNIA 3M59A 4M78F 1YI2T 1QVGP 2RI2A 2YRCA 5KE2A 2NUZA 2W10A 3LYIA 3QZ9B 3VS2A 2MI6A 2D6FA 2LZ6B 2XMFA 3OYIA 4AFZC 2MYSA 5GAMf 5GMKj 2HQHA 4LUEA 5EC7A 4F16A 3JCMP 1UFFA 2ABLA 4C0DB 1U3OA 1OV3A 1VIFA 1NYFA 4J6WA 4D6WA 1B7TA 2J7IA 2LJ0A 2LJ3A 2PVOB 4BD3A 2OTLA 1JJ2A 2RB6A 1ARKA 1K4US 3H0HA 4A4GA 1PNJA 2P0QA 3IQLA 2RN8A 4JLGA 4DOVA 4AG1C 1NG2A 5GANf 1M1KR 4MZPA 3QUIA 3QDFA 2DZCA 1RAGB 1M1GA 5HY6A 1M2VB 4ORZA 4JJNK 3OYHA 3CCEQ 5GAN2 2K3YA 4FT2A 1VQKT 1K9AA 4RTYA 2RJEA 1UEBA 4EMGA 4DBHA 3L1AA 2DK3A 5A0DA 3LH5A 4QVZA 2QQSA 4M77E 2L2PA 3CCQT 4N0AC 3RUXA 1V1CA 4Z8AA 2KNBB 1M3BA 2VYTA 3HPWA 3EGDA 1D0XA 4MMLA 1ZBXA 2EBPA 3QO3A 2FG0A 3M53A
chains in the Genus database with same CATH topology
1Y96B 1BYMA 3I56A 3A8HB 3FIFA 2H3JA 4JLIA 3V7CA 2EJ9A 2F5KA 2R5AA 3FRNA 3E19A 4EMKC 1VQPA 2MWPA 4XQ3A 1KD1C 5LJ5e 3CMAT 4PNOA 3S3MA 3P8DA 5CKBA 5GAOm 2X4YA 4ZTFA 1G3TA 3PNWC 3SWNC 3LX7A 5GAMe 4MDXA 3M4YA 2MF2A 4JUVA 3VYGA 2KAFA 3OSVA 4LD6A 4A4FA 2RHUA 2HAXA 1QVFA 2CZ0B 1XNIA 2E64A 3RKWA 3PT9A 1DJ7B 1WNLA 4JRQA 3CBPA 3SWNA 1NJIU 4KUDK 5GANg 3SWNB 1G3WA 3LGLA 4M7AF 2RH2A 4PLIA 3ZBDA 3QBYA 5GANd 3OBYA 3MP6A 4OP0A 3OS5A 2HD0A 2VC8A 1YJ9T 3CCJT 2KQWA 4C5GA 5I21A 4JS4A 2P4TA 3NTKA 1U1TA 2R5MA 5LJ5j 2ZPBB 5GAN7 1YITT 3CBMA 5DLOA 3NTIA 2A7YA 4PKCC 2IG0A 3AHUA 1K8AC 3HP9A 3RKXA 2HQEA 3LH0A 3RMSA 5IT9E 3VV0A 3JB9H 3OYMA 1M4ZA 3QJ6A 5I2MA 3CCMA 2D0QB 3P8BB 3LGFA 4HT9A 2R58A 5CVIA 2V8IA 2E70A 3HFNA 1N27A 4M75C 5FU7C 4A54A 3OY9A 2QEXA 1VQMA 1XTDA 1YJWT 2CZ6B 4RG8A 1OYXA 2FB7A 3MEUA 1IREB 5EG2A 1IZ6A 1SSFA 2GQVA 2E1HA 4M77B 4M77D 4R56A 3SFMA 1Q82U 4QVDA 3A5ZB 3CCEA 3OW2A 1X75C 1ZHIA 1BIBA 2V8KA 1I5LA 3H8ZA 1YJNA 2CGHA 5FU7B 5KCHA 3CEYA 2RHZA 3SD4A 2DEQA 2LCCA 3LWHA 2LRQA 3X20B 1Y07A 2M9UA 3ZFJA 3CPWS 4BE2A 2PUOB 4JDSA 3OSSC 3TEEA 5KH6A 4E7LA 4M77C 1QW1A 4ZN3A 1KQSS 1G5VA 4C92B 3CCLA 3QG1A 4II1A 4OB2B 1FX7A 4M7AA 3G6ET 3QKJA 1Q82C 4HCBA 5FROA 5C6SA 4PJOG 2E5QA 1QVPA 3J81E 1YHQA 4M75G 1G3YA 4OB0B 5HK0A 3CCLT 2KY9A 1NZ9A 1X01A 1PSFA 4V2SA 3GNFB 2XIDA 2OTLT 4XTYA 2DPPB 2K2VA 3MP8A 3P8HA 5GMKe 2GFAA 1NE8A 3PTAA 3JCMf 2D9TA 4ZGDB 5IAYA 3GOXA 1H641 2AHJB 3ASKA 4OGEA 3PIOA 1Q7YU 2K4YA 2EIFA 2LC4A 4LDVA 5LJ3g 4M7AD 3L2QA 4N4GA 3OW2S 1VQ9T 2JZ2A 4IUPA 4CRIA 5LJ3d 5CO7A 5GAOl 3DB4A 2EAYA 2RO0A 4M7DD 4M77G 2E6ZA 4A4EA 5GAOn 4BY6C 5GAOq 3CPWA 1VQMT 2QQ9A 3JCMV 2FL7A 3OS0A 4X9CA 1Q86C 3OYDA 2L5QA 5GAN5 4JS5A 4VUBA 1VQ5T 4YTLA 1YBYA 1UB4A 1S72A 1LJOA 2EQMA 2JTFA 1JRIA 3V8KA 1M90C 5GMKh 2XHCA 1P92A 1YIJT 1KC8U 2BIVA 4HCZA 1VQNA 1OI1A 1X6OA 2HBPA 3VKIA 4BDZA 3JCMb 2NLUA 5CR2A 4R55A 4UC4A 5LJ5d 3C94A 4C5EA 5GAN8 4PJOC 4IUVA 3FC3A 1VQLT 3CCJA 3DLMA 1Y71A 1YJ9A 2XK0A 4J5YA 2RI5A 1B34A 2Y4YA 1OZ2A 4F7UG 1Q81U 3FDRA 4Z02A 5J3BA 3LW5E 4C92C 3FJPA 2DIGA 3MO8A 1YIJA 4C92E 1KQ2A 4XTZA 1BI3A 3JCMe 2QDYB 3GLXA 2OTJT 4RKUE 3MCAB 5GAMd 1UGPB 2B8AA 3S6WA 4PJOB 2QQBA 2M0OA 3DB3A 3V8LA 3OS2A 5A0GA 3BFMA 4M78A 3EAEA 2FHDA 1YHQT 4M75A 1Q81C 2KDSA 3E1SA 4XAXB 3CC4A 3HRSA 1WJQA 4QQGA 3LLRA 2X4JA 2XD0A 3CMAA 2LDMA 4NL2A 5LJ5g 2YLCA 2JTMA 1MGQA 3KUFA 2XG8D 3RKYA 4A4HA 2LTOA 2EQKA 3OYAA 1V29B 1K73U 3M9QA 3QJYA 4IUQA 1BKBA 2F5TX 5GANe 1YJNT 2DXUA 4BY6B 4M78D 4XU2A 4ELYC 2YHTA 3C95A 3HRUA 4ZN1A 1PSEA 2M16A 2EKOA 2ZPGB 3Q1JA 2E65A 1D3BA 2DTHA 3M54A 2FYKA 1G3SA 4C8QE 2OAUA 4OF1A 1KQ1A 2QEXT 3JCMd 4XTXA 4EMHA 3ME9A 3OQ5A 3CC7T 1W4SA 5KCOA 4J8OA 3CMEA 3M57A 1QP3A 4Q5WA 2LQ8A 3CBOA 4P5NA 5FLXE 4M7AE 1Y7XA 1W2BA 1VQ6T 2XU8A 5CKDA 1WQWA 3CCET 2VGNA 3M56A 3OYLA 1XQHA 2PUKB 5CCAA 4M7DA 1K9MU 4PJOF 4M7DE 3FLGA 4ELZC 1WJSA 5CK9A 2DZ9A 3PFSA 2C06A 3CPFA 5M9OA 3HHTB 2XDDA 2CKKA 2E6NA 3G71A 3TU4K 1N6AA 1Y96A 2O4XA 3TREA 1RI0A 3JCMX 3L2ZA 4QQ6A 5GAN4 2CZ7B 1KG1A 2RA2A 4FT4A 4JRIA 5IN1A 4DQ2A 3OYBA 2RJCA 2VXEA 2XKOC 2DIQA 4XU0A 2DD5A 3TCJA 3N5BB 2Y4XA 2P0PA 1B34B 5GAMh 4HA8A 1WJRA 4BE1A 5FU6B 5HKCA 3HFOA 3DLLA 4E7HA 1W2BS 4KULA 1O75A 2R57A 4JRKA 4RG2A 3E9GA 4J7FA 4C8QA 3CCUA 3MP1A 4QQDA 2LNVA 3QYGB 1WQ7A 2M1HA 2MWOA 5D6YA 4MDWA 5AYFA 2QA4A 2RK2A 2QI2A 4M77A 2ZCFB 4C5IA 5HK3A 2KMTA 4E7JA 3JB9D 4FU6A 5FU6C 2EJFA 2IVWA 3C4SA 3M58A 3G4SA 5LJ3f 2VV5A 1M90U 1LOJA 3A8GB 3CCRT 3HSBA 2KK4A 3CCVA 5FRMA 1FXXA 1M8VA 3SDZA 1OZ3A 3V7RA 2OTJA 2DJZA 4IURA 3GPLA 3UPUA 1KD1U 4FM4B 2X4XA 4F7UF 5GAOp 4C92G 3I55T 3GIBA 3CD6T 2QA4T 2ZPIB 3NTHA 1MHNA 3OYEA 4XTVA 1UGQB 1BI1A 2YRVA 5LJ3h 4F7UA 3CCUT 3UDCA 4ZGJB 2LVMA 3JRZA 3I55A 2WSFE 5A2QE 2JOYA 4C0ZA 2DAQA 4M78E 2JUFA 2RHYA 3OYCA 2PVDB 2WSEE 3HKSA 4GY5A 1VIEA 3A8LB 4L5GA 3V8JA 3CCVT 1D3BB 4LDXA 3JB9F 4A4KA 1KHIA 3L2UA 1VQNT 1YI2A 4QVCA 1M9SA 1VUBA 2DD4A 3X24B 4IUUA 1K8AU 4CI0C 4LD9K 2V8JA 1N9RA 2VGMA 5CKFA 4OB3B 4C92D 4A53A 2PQWA 3A8OB 3EFSA 4M78G 2Y90A 3GNGA 1LNXA 2DKGA 4KUIA 3T9NA 5J39A 3BW1A 5GAN3 4LDWA 3DKMA 2DTIA 2K3XA 3BY7A 4FSXA 5DY9A 3QSUA 2CYZB 2ZPFB 5LJ3e 1VQ9A 1VQ8A 2EJGA 3CCQA 1K73C 1VQ7A 2VXFA 2L3RA 4QW2A 3WVEB 4J6YA 4IKFA 1UGSB 3JCMg 2QTXA 4J7IA 1WGSA 1VQ5A 1I81A 3CC7A 1XOVA 4OGCA 2K5IA 2O4XB 1VQKA 3RERA 2ZPHB 4F7UE 5GMKl 1BI0A 4M75E 2E41A 2ZPEB 2LT4A 3MEVA 4LDUA 5J26A 3VUBA 4C8QC 3G71T 2EQJA 1QVFS 2CS7A 4MMKA 4EDUA 1K9MC 3UWNA 5GMKm 4M7DB 3PMTA 3M4GA 4IUTA 4C8QF 2ZZDA 4C0FA 3CCST 4DOWA 3PGGA 3OYJA 2ZGWA 5C0MA 1U1SA 5LJ5h 3C12A 1VQ6A 2FVUA 2K5LA 1QP2A 4C8QD 4C8QB 3OMGA 5KE3A 3CMET 2E12A 5LJ3j 1HXDA 1M1KC 3PIPA 4EPCA 1EIFA 4ME7A 2DXBA 3CCSA 4M7DG 2HQXA 2L89A 4OB1B 4GLKA 3QPHA 4OVAA 1QVGA 2QQRA 3OYFA 1TH7A 3G6EA 2RHXA 3E9FA 3J80E 2O01E 3F70A 2GFUA 1JJ2S 1R8OB 3OYGA 3MHXA 1JB0E 2EYQA 4DA4A 2LX9A 4M77F 4N4IA 2DVEA 2XDPA 2RJFA 3HL8A 2KVQG 4Y28E 4F7UB 2KSSA 1O9SA 4NL3A 1ZQ1A 4BDYA 4HKEA 3OMCA 4XTUA 1VQOT 2RHIA 1AHJB 5DLQE 3OB9A 4C8QG 1WPYA 2XICA 1VQ8T 2I2LA 2JNGA 5A0LA 3CC4T 2DXCA 2LT1A 1Q7YC 2EQUA 4N4HA 3S3NA 3X25B 5D6WA 1VQ4A 3V7SA 2LCLA 5CQXA 1JBMA 5GAOr 2DO3A 3L2VA 1YCYA 4M7DF 3R6OA 4EMKA 5GMKi 4E7IA 4PJOD 5GANh 1N9SA 4C5HA 1S72T 1FWZA 1KHCA 2RM4A 3X28B 1QVGS 2RI3A 2PU9B 5CKEA 3UT1A 4BI8B 4M7DC 4C92A 3JSCA 3OYYA 5CKHA 3SB2A 3A8MB 3WVDB 1VQPT 2EWNA 3MEWA 5GAMg 3JAME 3QYHB 1VQLA 2F69A 1VQ4T 4RMOA 4FL6A 4NOYA 3CCRA 2E10A 2MAMA 3JCMW 3JB9G 4ZGEB 2MMPA 3QXEB 2GCXA 2X35A 4MZMA 3CXCS 4Y91A 3HRTA 3CD6A 4RCCA 2WSCE 1VQOA 2HNIA 4J6XA 4HCCA 4PLLA 5DM7R 3M59A 4M78F 1YI2T 3GF5A 3JCMJ 4C0DC 4ZTJA 2RI2A 1Q86U 5KE2A 4KBMB 3LYIA 3INZA 3QZ9B 2MI6A 1BIAA 3M5AA 3META 3OS1A 3QDRB 2D6FA 3VU3C 3OYKA 2RJDA 3OYIA 4XU3A 2LQKA 4BUGA 2JVVA 4PL6A 5GAMf 5GMKj 4BACA 5L8RE 4WF2A 2XDBA 3M55A 3FB9A 3JCMP 1I4K1 1HK9A 4FIBA 4L59A 1BI2A 2DTOA 4BI4A 3J7AF 4RCBA 2X4WA 4C0DB 5CIUA 1VIFA 3I56T 4J6WA 3KBGA 1RL2A 2K5FA 4D6WA 3O8VA 2XI9A 2PVOB 3G7ZA 4BD3A 2OTLA 4O5VA 4ATOA 1I8FA 3BDUA 3BDLA 5GAN6 2RB6A 3RMQA 3G4ST 4LDYA 1JJ2A 4A4GA 4OMFB 3L42A 3QHSA 3FEOA 2BKDN 3LWIA 4B9XA 4M7AB 2GF7A 3L2WA 2P0QA 4XK8E 1YJWA 4C0GA 4BB7A 4TVRA 2EFIA 4JLGA 3GP8A 3EFRA 2RD1A 4DOVA 3PMIA 2QXFA 3OBWA 4M78C 3RIRA 3X26B 3ZEHA 5GANf 5GANj 4HT8A 1NPRA 3QZ5B 5FRNA 2WACA 2JN0A 4MZPA 4X9DA 4M75D 5CQYA 3QUIA 4L6V5 2DZCA 4C92F 1N8RC 1M1GA 1H3ZA 5HY6A 3JCMc 2P0KA 1NPPA 4KT0E 3OYNA 4JJNK 4E47A 3OYHA 5CAIA 1YITA 2G3RA 3JCMh 4NS5A 3KXTA 2DXTA 4M78B 2VUBA 3CC2A 4BI3A 5GAN2 2K3YA 4FT2A 5I2SA 4PJOA 4M7AG 3RESA 3VYHB 1VQKT 4PJOE 3VJPA 2BUDA 2RJEA 3NFCA 4N0AA 5LJ5f 1UEBA 3URGA 4EMGA 4JRPA 2K57A 3L1AA 3JB9J 3CC2T 2DK3A 3CCMT 5A0DA 1N8RU 3OA6A 4BE0A 2A3LA 4QVZA 2QQAA 2QQSA 1M1KU 1M5Q1 2PVGB 3JB9I 4M77E 2CZ1B 4M75F 5D6XA 3VUZA 3CCQT 1VQ7T 4X34A 3L2RA 3CXCA 4J83A 3H6ZA 4N0AC 1KC8C 3RUXA 3QIIA 1NJIC 4MZTA 2VYTA 3HPWA 4XTWA 3JCMQ 4MMLA 5GAMj 1ZBXA 1UGRB 3QO3A 4O6JA 1GXIE 3WXMB 1KQSA 4EMKB 2RK1A 4M75B 4M7AC 4E7KA 3S3OA 1U8RA 2YLBA 4XU1A 3ER0A 4B9WA 1M1FA 3M53A 3MEAA 5LL6S 2L8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 A;  2R5A A;  2F5K A;  2MWP A;  3CMA T;  3S3M A;  3P8D A;  2X4Y A;  4ZTF A;  3PNW C;  3LX7 A;  4A4F A;  4LD6 A;  2RHU A;  1QVF A;  1XNI A;  1NJI U;  3LGL A;  4PLI A;  3QBY A;  3MP6 A;  1YJ9 T;  3CCJ T;  4C5G A;  3NTK A;  2R5M A;  1YIT T;  3NTI A;  2IG0 A;  1K8A C;  3LH0 A;  5IT9 E;  2HQE A;  3OYM A;  3QJ6 A;  3CCM A;  3P8B B;  3LGF A;  2R58 A;  2QEX A;  2E70 A;  1VQM A;  1N27 A;  3OY9 A;  1XTD A;  1YJW T;  1OYX A;  3MEU A;  1IZ6 A;  1SSF A;  1Q82 U;  3A5Z B;  3CCE A;  3OW2 A;  3H8Z A;  1YJN A;  5KCH A;  3CEY A;  2RHZ A;  3SD4 A;  2LCC A;  2LRQ A;  3CPW S;  4BE2 A;  4E7L A;  5KH6 A;  4ZN3 A;  1KQS S;  1G5V A;  3CCL A;  4II1 A;  3G6E T;  1Q82 C;  3QKJ A;  5FRO A;  5C6S A;  2E5Q A;  3J81 E;  1YHQ A;  3CCL T;  1NZ9 A;  2OTL T;  3MP8 A;  3P8H A;  2GFA A;  5IAY A;  2D9T A;  3GOX A;  3ASK A;  3PIO A;  1Q7Y U;  2EIF A;  3L2Q A;  3OW2 S;  4N4G A;  1VQ9 T;  2JZ2 A;  4IUP A;  4CRI A;  3DB4 A;  2RO0 A;  2E6Z A;  4A4E A;  3CPW A;  1VQM T;  1Q86 C;  3OS0 A;  3OYD A;  1VQ5 T;  4YTL A;  1YBY A;  1S72 A;  2EQM A;  2JTF A;  1M90 C;  1KC8 U;  2XHC A;  1YIJ T;  1VQN A;  2BIV A;  4HCZ A;  1OI1 A;  1X6O A;  4BDZ A;  2NLU A;  4UC4 A;  4C5E A;  4IUV A;  3FC3 A;  1VQL T;  3CCJ A;  3DLM A;  1YJ9 A;  2XK0 A;  2RI5 A;  1OZ2 A;  1Q81 U;  3FDR A;  4Z02 A;  5J3B A;  2DIG A;  1YIJ A;  3MO8 A;  2OTJ T;  2B8A A;  3S6W A;  2M0O A;  3DB3 A;  3OS2 A;  3EAE A;  1YHQ T;  2FHD A;  1Q81 C;  2KDS A;  3CC4 A;  4QQG A;  1WJQ A;  3LLR A;  3CMA A;  2LDM A;  3KUF A;  4A4H A;  2LTO A;  2EQK A;  3OYA A;  1K73 U;  3M9Q A;  4IUQ A;  1BKB A;  1YJN T;  4ZN1 A;  2M16 A;  2EKO A;  3Q1J A;  2QEX T;  3ME9 A;  3OQ5 A;  3CC7 T;  5KCO A;  3CME A;  4Q5W A;  2LQ8 A;  5FLX E;  1VQ6 T;  3CCE T;  3OYL A;  1K9M U;  3FLG A;  1WJS A;  3PFS A;  3CPF A;  5M9O A;  2CKK A;  2E6N A;  3G71 A;  1KD1 C;  2O4X A;  3TRE A;  1RI0 A;  4QQ6 A;  5IN1 A;  3OYB A;  2RJC A;  2DIQ A;  1WJR A;  4BE1 A;  3DLL A;  1W2B S;  4E7H A;  4RG2 A;  2R57 A;  3E9G A;  3CCU A;  3MP1 A;  4QQD A;  2M1H A;  5D6Y A;  2MWO A;  2QA4 A;  4C5I A;  4E7J A;  4FU6 A;  3C4S A;  3G4S A;  1M90 U;  3CCR T;  3CCV A;  5FRM A;  1OZ3 A;  2OTJ A;  4IUR A;  1KD1 U;  2X4X A;  3I55 T;  3CD6 T;  2QA4 T;  3NTH A;  1MHN A;  3OYE A;  2YRV A;  3CCU T;  3I55 A;  2LVM A;  5A2Q E;  2JOY A;  2DAQ A;  2JUF A;  1VQP A;  1W2B A;  2RHY A;  3OYC A;  3HKS A;  4GY5 A;  3CCV T;  1KHI A;  1VQN T;  3L2U A;  1YI2 A;  1K8A U;  4IUU A;  2PQW A;  5J39 A;  2K3X A;  1VQ9 A;  1VQ8 A;  1K73 C;  3CCQ A;  1VQ7 A;  2L3R A;  4QW2 A;  4IKF A;  1WGS A;  1VQ5 A;  3CC7 A;  2O4X B;  1VQK A;  3G71 T;  3MEV A;  5J26 A;  1QVF S;  2EQJ A;  1K9M C;  4EDU A;  3UWN A;  3PMT A;  4IUT A;  3CCS T;  3OYJ A;  5C0M A;  1VQ6 A;  3OMG A;  5KE3 A;  3CME T;  1M1K C;  3PIP A;  1EIF A;  3CCS A;  2HQX A;  2L89 A;  4OVA A;  1QVG A;  2QQR A;  3OYF A;  3G6E A;  2RHX A;  3J80 E;  3E9F A;  3F70 A;  2GFU A;  1JJ2 S;  3OYG A;  4N4I A;  2XDP A;  2RJF A;  2KVQ G;  4BDY A;  3OMC A;  1VQO T;  2RHI A;  5DLQ E;  3OB9 A;  1VQ8 T;  2JNG A;  3CC4 T;  1Q7Y C;  2EQU A;  1VQ4 A;  4N4H A;  3S3N A;  5D6W A;  2LCL A;  2DO3 A;  3L2V A;  4E7I A;  1S72 T;  1QVG S;  4C5H A;  1KHC A;  2RI3 A;  3UT1 A;  3OYY A;  1VQP T;  3MEW A;  3JAM E;  1VQL A;  1VQ4 T;  4FL6 A;  2X35 A;  3CXC S;  3CD6 A;  1VQO A;  4PLL A;  5DM7 R;  1YI2 T;  4ZTJ A;  1Q86 U;  2RI2 A;  5KE2 A;  3LYI A;  2MI6 A;  3MET A;  3OS1 A;  3OYK A;  2RJD A;  3OYI A;  2JVV A;  4PL6 A;  4BAC A;  3J7A F;  4L59 A;  2X4W A;  5CIU A;  3I56 T;  3KBG A;  1RL2 A;  3O8V A;  4BD3 A;  2OTL A;  3BDL A;  1JJ2 A;  3G4S T;  4A4G A;  3L42 A;  3FEO A;  2BKD N;  4B9X A;  2GF7 A;  3L2W A;  1YJW A;  4TVR A;  2EFI A;  3PMI A;  3ZEH A;  1NPR A;  5FRN A;  2WAC A;  1N8R C;  1M1G A;  1H3Z A;  5HY6 A;  2P0K A;  1NPP A;  3OYN A;  3OYH A;  1YIT A;  2G3R A;  4NS5 A;  3CC2 A;  2K3Y A;  1VQK T;  2BUD A;  2RJE A;  1UEB A;  3CC2 T;  3CCM T;  1N8R U;  3OA6 A;  4BE0 A;  4QVZ A;  2QQS A;  1M1K U;  5D6X A;  3CCQ T;  1VQ7 T;  4X34 A;  3CXC A;  3L2R A;  3H6Z A;  1KC8 C;  3QII A;  1NJI C;  2VYT A;  1KQS A;  4E7K A;  3S3O A;  3ER0 A;  4B9W A;  3CCR A;  3MEA A;  5LL6 S;  2L8D A; 
#chains in the Genus database with same CATH topology
 2K7A A;  3I56 A;  3FIF A;  2EYX A;  4WCI A;  3V7C A;  2EJ9 A;  2R5A A;  4KH1 B;  3RBB B;  3VS4 A;  4XQ3 A;  3CMA T;  3P8D A;  4PFP A;  4PJJ A;  4JJD A;  2MF2 A;  1WA7 A;  1BU1 A;  3OSV A;  1TU0 B;  2CZ0 B;  3PT9 A;  3CC7 Q;  2IIM A;  4OP0 A;  2VC8 A;  3NTK A;  1U1T A;  2M0Y A;  5GAN 7;  2ZPB B;  3NTI A;  2A7Y A;  2I0N A;  4PKC C;  1VQ6 Q;  3EHR A;  3M0Q A;  2DYI A;  2YUQ A;  3HP9 A;  3JB9 H;  2DJQ A;  1M4Z A;  1ABQ A;  2KRO A;  1JO8 A;  4HT9 A;  2RQU A;  3LGF A;  2E5K A;  5CVI A;  2E3I A;  2E70 A;  3HFN A;  1N27 A;  4M75 C;  2YSQ A;  1YJW T;  1TS9 A;  1IZ6 A;  1EX4 A;  3A5Z B;  3CCE A;  1YFN A;  2CGH A;  1U06 A;  2DEQ A;  3X20 B;  3CPW S;  2PUO B;  4JDS A;  3OSS C;  5KH6 A;  4II1 A;  3I56 Q;  1SHF A;  1FX7 A;  2GBQ A;  2DYB A;  1Q82 C;  3G4S Q;  2E5Q A;  1QVP A;  3J81 E;  4M75 G;  1G3Y A;  2K2V A;  3MP8 A;  3P8H A;  1NE8 A;  1K73 R;  1SF9 A;  5IAY A;  4ZGD B;  1H64 1;  1NJI R;  3CCJ Q;  3PIO A;  4HXJ A;  2K4Y A;  2LC4 A;  4LDV A;  3MKD A;  2ED1 A;  3DB4 A;  2EAY A;  4M7D D;  4A4E A;  1VQM T;  4X9C A;  1PM3 A;  1ABO A;  1VOM A;  1OX8 A;  3OYD A;  1AZG B;  1VQ5 T;  4YTL A;  1S72 A;  2V1Q A;  1M90 C;  2FPF A;  2BIV A;  1TUD A;  2ESW A;  2GTJ A;  1X6O A;  1ZX6 A;  2HEQ A;  2LMJ A;  1K0X A;  4PJO C;  4OMM A;  1VQL T;  3DLM A;  1Y71 A;  1M27 C;  4F7U G;  3FDR A;  4Z02 A;  2JS2 A;  3MO8 A;  2PNI A;  1BI3 A;  1PC0 A;  3GLX A;  5GAM d;  1UGP B;  2B8A A;  2QQB A;  3DB3 A;  3EAE A;  1YHQ T;  1H3H A;  1AVZ C;  1Q81 C;  1M30 A;  2XD0 A;  3CMA A;  2LDM A;  1YCS B;  2JTM A;  3TSW A;  2LTO A;  1C1A A;  2MPX C;  1GBQ A;  2QAZ A;  3EGX A;  1YJN T;  2DXU A;  4XU2 A;  2YHT A;  1MND A;  1QMC A;  1PSE A;  1QWF A;  2EKO A;  4AFS C;  4PJM A;  1RI9 A;  2EYZ A;  1YN8 A;  2DTH A;  5KYN A;  1G3S A;  4C8Q E;  4JJC A;  1WX6 A;  3JCM d;  3EFO A;  1W4S A;  5KCO A;  1YIT Q;  4Q5W A;  4M7A E;  5FLX E;  1VQ6 T;  2XU8 A;  1M2V A;  3CCE T;  4M7D E;  3M56 A;  1XQH A;  4FYX B;  5CCA A;  2COZ A;  3FLG A;  4ELZ C;  1S1N A;  2C06 A;  2XDD A;  1ZBJ A;  3TU4 K;  3G71 A;  3JCM X;  3TRE A;  3L2Z A;  2RMO A;  2JM9 A;  2CZ7 B;  3EGU A;  2RA2 A;  3I35 A;  1C6V X;  2VXE A;  4XU0 A;  3TCJ A;  2DD5 A;  3N5B B;  1G83 A;  1B34 B;  1X2K A;  1WJR A;  2Z0W A;  5HKC A;  3I55 Q;  1W2B S;  1O75 A;  4JRK A;  4C8Q A;  1I0C A;  1R0C B;  3CCU A;  2LNV A;  3NGP A;  2QA4 A;  4MDW A;  4X1V A;  1R77 A;  5HK3 A;  2KMT A;  4FU6 A;  2IVW A;  1ZSG A;  2VV5 A;  3A8G B;  2KK4 A;  3CCV A;  1OZ3 A;  4OMQ A;  2X4X A;  4C92 G;  2J06 A;  1MHN A;  4XTV A;  4HVW A;  1BI1 A;  3CCU T;  2OI3 A;  2LVM A;  1NM7 A;  6AT1 B;  4D8D A;  5A2Q E;  4E7S A;  2PVD B;  5IHI A;  1VIE A;  4LDX A;  4A4K A;  3CCR Q;  1YI2 A;  4LD9 K;  2DD4 A;  3EH1 A;  5CKF A;  4C92 D;  4A53 A;  5DLO A;  5J39 A;  3BW1 A;  2FZC B;  2M51 A;  1JXO A;  3DKM A;  3BY7 A;  2EGA A;  4FSX A;  3QSU A;  1F1B B;  1VQ8 Q;  3G1J A;  4QW2 A;  3WVE B;  1UGS B;  2QTX A;  1VQ5 A;  2VVK A;  2K5I A;  1VQK A;  2JS0 A;  4LDU A;  5J26 A;  2EQJ A;  4HVU A;  4MMK A;  1JEG A;  3PGG A;  3OYJ A;  2ZGW A;  1QP2 A;  2E12 A;  5LJ3 j;  3PIP A;  1EIF A;  4ME7 A;  4M7D G;  2L89 A;  2QYZ A;  1D1B A;  3J80 E;  3F70 A;  3EG2 A;  1MMG A;  4DA4 A;  1QQJ A;  3CC2 Q;  1PHT A;  2MK5 A;  3RR6 A;  2KVQ G;  4F7U B;  2KSS A;  2XIC A;  4FCY A;  2I2L A;  2JNG A;  1PD1 A;  2NWM A;  3S3N A;  1K76 A;  1VYU A;  2L0A A;  4F04 B;  2GQI A;  4FYY B;  1I07 A;  3REB B;  2K9G A;  4E7Z A;  4M7D F;  1IXD A;  2KRN A;  4C5H A;  1QVG S;  1FWZ A;  2QGF B;  1KJW A;  2RI3 A;  4BI8 B;  3OYY A;  3H9N A;  3MEW A;  5GAM g;  3QYH B;  2K6D A;  1MV0 B;  3QWY A;  1CKB A;  2F69 A;  4A63 B;  4NOY A;  1B3Q A;  3NMZ C;  1GCP A;  4Y91 A;  3CD6 A;  4RCC A;  2WSC E;  4HCC A;  2EYW A;  3JCM J;  4ZTJ A;  2KXC A;  2W0Z A;  4KBM B;  2NUP B;  4J9D A;  3INZ A;  3VU3 C;  3OYK A;  1RAI B;  1WHK A;  4XU3 A;  4PL6 A;  3UAT A;  3M55 A;  3FB9 A;  3J7A F;  4FIB A;  4L59 A;  2DTO A;  4KH0 B;  2LNH B;  1NBE B;  3I56 T;  3KBG A;  2K5F A;  1YJN Q;  2JM8 A;  1I8F A;  4AG2 C;  3G4S T;  4LDY A;  2EYY A;  4OMF B;  4DBQ A;  3QHS A;  5IXF A;  1M3C A;  1G2B A;  3LWI A;  4B9X A;  4JZ3 A;  2CDT A;  2GF7 A;  1YJW A;  8ATC B;  1HD3 A;  3GP8 A;  3PMI A;  1VQ4 Q;  5FRN A;  2JN0 A;  4X9D A;  4M75 D;  4L6V 5;  1N8R C;  3JCM c;  1RAH B;  1NPP A;  4LXC A;  2YUN A;  3KXT A;  2PZ1 A;  3CC2 A;  3ZL7 C;  4PJO A;  4M7A G;  5IXB A;  1PCX A;  3PVQ A;  4N0A A;  4JRP A;  3JB9 J;  2GNC A;  3CCM T;  1Q82 R;  3REA B;  2CRE A;  3OA6 A;  1WYX A;  2QQA A;  4KGX B;  3EGD B;  1M5Q 1;  2PVG B;  1NEG A;  2CZ1 B;  1YJ9 Q;  1VQ7 T;  4X34 A;  3L2R A;  1KC8 C;  2J6K A;  3QII A;  2DET A;  3JCM Q;  1WXB A;  4ANJ A;  5GAM j;  1BB9 A;  3I9Q A;  1NYG A;  4O6J A;  1KQS A;  4EMK B;  3RNJ A;  4M75 B;  4M7A C;  3S3O A;  1U8R A;  2YLB A;  4Z89 A;  4PNO A;  1E7O A;  3CCR A;  3H0I A;  1BYM A;  2YRD A;  3R6N A;  1WXU A;  1IO6 A;  2F5K A;  3E19 A;  3CCU Q;  2MWP A;  5LJ5 e;  2QGG A;  5GAO m;  2X4Y A;  4ZTF A;  1G3T A;  3LX7 A;  3M4Y A;  4JUV A;  3VYG A;  2KAF A;  4LD6 A;  2HAX A;  3RKW A;  1WIE A;  4JRQ A;  3CBP A;  3SWN A;  1QCO A;  3SWN B;  2KT8 A;  1OQK A;  1W70 A;  3OBY A;  3CCJ T;  3AT1 B;  2VWF A;  2CP2 A;  4C5G A;  4LUD A;  1D09 B;  2R5M A;  4AFU C;  3RKX A;  1WXT A;  1LVK A;  3QJ6 A;  3CCM A;  1GL5 A;  2D0Q B;  3CPW P;  4ESR A;  2R58 A;  2V8I A;  2QEX A;  3OY9 A;  4A54 A;  3VS7 A;  4QKU A;  2CZ6 B;  4RG8 A;  3MEU A;  5EG2 A;  1Q82 U;  2A28 A;  4J9G A;  1X75 C;  1ZHI A;  1UG1 A;  1I5L A;  3H8Z A;  3NPF A;  1LCK A;  2RHZ A;  2KYM A;  3SD4 A;  2LCC A;  3LWH A;  1UE9 A;  5GJW B;  4BE2 A;  2MOX A;  1GCQ A;  4ZN3 A;  3CCL A;  3G6E T;  3QKJ A;  1YHQ Q;  2CH4 W;  5HK0 A;  3CCL T;  1X01 A;  1MNE A;  4V2S A;  3GNF B;  4XTY A;  2DPP B;  5GMK e;  4DEX A;  2D9T A;  2RQR A;  2QDL A;  1WHL A;  1T3S A;  2HDA A;  2RNA A;  2EIF A;  4M7A D;  1VQ9 T;  1RLP C;  4DBF A;  4IUP A;  5CO7 A;  5GAO l;  3D7S B;  2X3X D;  4PJL A;  1OX9 A;  5GAO q;  2QQ9 A;  3EHQ A;  3JCM V;  1Q86 C;  5GAN 5;  1S72 Q;  1YBY A;  1WHJ A;  1LJO A;  3V8K A;  1KC8 U;  1YIJ T;  4ZNX A;  1OI1 A;  3VKI A;  3JCM b;  1MUZ A;  4FYW B;  1UGV A;  4UC4 A;  5LJ5 d;  1ZSZ B;  1KFZ A;  2P4R A;  2KT1 A;  5GAN 8;  1X69 A;  2YUP A;  2DL5 A;  3UF4 A;  4RTV A;  4DBR A;  2BZ8 A;  1Q81 U;  5J3B A;  3JCM e;  2OTJ T;  2CSI A;  1ZSZ C;  3MCA B;  2HMA A;  2MCN A;  3S6W A;  3OS2 A;  1SEM A;  4M78 A;  2FHD A;  4RTW A;  3U23 A;  1BCO A;  1X6G A;  4QT7 A;  3HRS A;  1WJQ A;  2NYS A;  5KYU B;  3LLR A;  2BZX A;  4B6M A;  3EG1 A;  3EG9 A;  1MGQ A;  3KUF A;  3RKY A;  4J9I A;  4A4H A;  5L23 A;  1V29 B;  1ZSZ A;  1BKB A;  2BE9 B;  4BY6 B;  1AWW A;  1YNZ A;  2B86 A;  1GFD A;  2E65 A;  3M54 A;  2FYK A;  1UHC A;  2DER A;  2KXD A;  4J8O A;  2LQ8 A;  3CBO A;  1Y7X A;  5CKD A;  2VB6 A;  1WQW A;  2DM1 A;  2HKN A;  3GBQ A;  1K9M U;  1OU9 A;  1UDL A;  1W2B P;  2AZS A;  2DZ9 A;  1KD1 C;  2O4X A;  1G8X A;  1RI0 A;  5GAN 4;  1VA7 A;  1IRX A;  3HTR A;  1KSW A;  4PJN A;  1D1C A;  1TXQ A;  2RJC A;  2HCK A;  2XKO C;  1RUW A;  2DL8 A;  1LPL A;  2PTK A;  3DLL A;  2ECZ A;  4LN2 A;  1Q95 G;  2F2V A;  1WI7 A;  2LQW A;  3MP1 A;  4PFO A;  4DEY A;  5D6Y A;  1GCQ C;  4C5I A;  2KGT A;  3G4S A;  4PFZ A;  2QEX Q;  3V7R A;  4CC4 B;  3CCS Q;  2OTJ A;  4IUR A;  1K1Z A;  2D8H A;  3GIB A;  2ZPI B;  1T0H A;  4J9C A;  3OYE A;  1UGQ B;  2OAW A;  3UDC A;  3VS5 A;  4HVV A;  1ZUK A;  1TUC A;  2RHY A;  3OYC A;  4GY5 A;  3A8L B;  3CCV T;  3H0F A;  1PKS A;  1M90 R;  3JB9 F;  4QVC A;  3X24 B;  1K8A U;  2KI7 A;  3C0C A;  2VGM A;  1WHG A;  2EGE A;  3T9N A;  3EFS A;  3TSZ A;  5GAN 3;  3GNG A;  2DMO A;  5DY9 A;  2CYZ B;  5LJ3 e;  2EJG A;  2QG9 B;  3A98 A;  2L3R A;  2OTJ Q;  1D1A A;  4J7I A;  1WGS A;  2CH4 A;  4F7U E;  4HT8 A;  4M75 E;  1VQK Q;  1FMV A;  2AKK A;  1K9M C;  1VQP Q;  3M0T A;  4M7D B;  4C8Q F;  2ZZD A;  4DOW A;  2K5L A;  4C8Q B;  5D7U A;  1V76 A;  1HXD A;  2DXB A;  3VS3 A;  1T3L A;  1QVF P;  3OYF A;  1TH7 A;  2RHX A;  2O01 E;  2GFU A;  1JJ2 S;  1Y57 A;  1FMK A;  3ULR B;  1NLP C;  4BDY A;  4HKE A;  3OB9 A;  4C8Q G;  3PE0 A;  2FRY A;  1VQ8 T;  2FPD A;  3CC4 T;  1VQ4 A;  5CQX A;  1VYT A;  2JW4 A;  2F2W A;  3R6O A;  4EMK A;  4PJO D;  1YWP A;  1SPK A;  1KHC A;  2RM4 A;  3X28 B;  2PU9 B;  2CP7 A;  2J6O A;  3M0U A;  3JSC A;  5AT1 B;  4C92 A;  4CC2 A;  4FL6 A;  2KYB A;  2YT6 A;  2M02 A;  3VS6 A;  1Z9Z A;  4ZGE B;  3QXE B;  2X35 A;  3CXC S;  1QKW A;  3HRT A;  1RAC B;  1YWO A;  4C0D C;  1Q86 U;  2JMA A;  1BIA A;  2CP3 A;  3MET A;  4OMO A;  2JT4 A;  4BUG A;  1AEY A;  1N5Z A;  5L8R E;  1HK9 A;  4J9F A;  1BI2 A;  1RLQ C;  2X4W A;  3CXC P;  1K0S A;  1RL2 A;  3O8V A;  2HSP A;  3G7Z A;  1KG1 A;  4O5V A;  5GAN 6;  3BDU A;  2X9H A;  2ROL A;  3FEO A;  4KGV B;  4M7A B;  3L2W A;  4XK8 E;  2EFI A;  3CCM Q;  3OBW A;  3I5R A;  4M78 C;  3RIR A;  3QZ5 B;  2WAC A;  5CQY A;  1PG5 B;  2A08 A;  1TOV A;  1QKX A;  2DIL A;  3OYN A;  4E47 A;  5CAI A;  2G3R A;  4M78 B;  1X27 A;  1PRM C;  2H8H A;  2HL5 C;  4PJO E;  5I2S A;  3VYH B;  2FPE A;  1A0N B;  3NFC A;  5LJ5 f;  3URG A;  3CC2 T;  2K57 A;  1N8R U;  3M0R A;  1M1K U;  3JB9 I;  1K8A R;  3VUZ A;  3MPU B;  2V26 A;  4J83 A;  2LQN A;  1E6G A;  1AWO A;  1NJI C;  1WHH A;  4GLM A;  4HCK A;  1UGR B;  2DE0 X;  3WXM B;  2C0T A;  2E3H A;  4E7K A;  2DEU A;  1M1F A;  5LL6 S;  2L8D A;  4M7A F;  1ZA1 B;  1Y96 B;  2ZAE A;  4E6R A;  4JLI A;  1VQO Q;  1KIK A;  1OEB A;  3FRN A;  2QAS A;  5CKB A;  1IGU A;  3PNW C;  1HYO A;  2DL4 A;  2AIR B;  2CP0 A;  4A4F A;  1QVF A;  1XNI A;  2E64 A;  1DJ7 B;  1QWE A;  1NJI U;  4KUD K;  5GAN g;  4J9B A;  4EIK A;  1G3W A;  5KYW B;  4PLI A;  5GAN d;  2HD0 A;  2FZG B;  2KQW A;  4JS4 A;  1YIT T;  2YDL A;  3CBM A;  2LJ1 A;  1YP5 A;  1K8A C;  3LH0 A;  5IT9 E;  5I2M A;  2OX7 A;  4CC7 A;  2OJ2 A;  1KQS P;  3CCV Q;  1VQM A;  2J05 A;  1OYX A;  2FB7 A;  1VQ5 Q;  4R56 A;  1RAE B;  3SFM A;  1N8R R;  4QVD A;  3OW2 A;  1BIB A;  2DL3 A;  1YJN A;  1FMW A;  1GRI A;  3CEY A;  3ZFJ A;  1RAB B;  4JPB W;  4E7L A;  1VQL Q;  1QW1 A;  3CME Q;  1KQS S;  4OB2 B;  1E6H A;  4HCB A;  5FRO A;  5C6S A;  2EW3 A;  4PJO G;  1YHQ A;  4OB0 B;  1RAF B;  4FSS A;  2OTL T;  2XID A;  3G71 Q;  2EVR A;  2GFA A;  1YIJ Q;  3JCM f;  3GOX A;  4AFQ C;  3ASK A;  2DBM A;  1Q7Y U;  4KRT A;  3L2Q A;  4N4G A;  1TUG B;  2JZ2 A;  3H41 A;  5LJ3 d;  2D8J A;  2O31 A;  2E6Z A;  5GAO n;  4BY6 C;  3CPW A;  2ED0 A;  2FL7 A;  4VUB A;  3VRY A;  5KYW A;  1AD5 A;  1UB4 A;  1Q86 R;  2EQM A;  2JTF A;  5GMK h;  2XHC A;  1VQN A;  2YWW A;  1JXM A;  2ROT A;  5GJV B;  4BDZ A;  2NLU A;  2CT3 A;  5CR2 A;  4R55 A;  3C94 A;  4C5E A;  4RUG A;  2RI5 A;  1B34 A;  2Y4Y A;  1OZ2 A;  1ZUU A;  1AOJ A;  4C92 C;  3FJP A;  1KQ2 A;  4C92 E;  4XTZ A;  1CSK A;  2KEA A;  2L3S A;  1M8M A;  4PJO B;  3V8L A;  3BFM A;  2KDS A;  3CCL Q;  2AT1 B;  3CC4 A;  2X4J A;  1C0M A;  5LJ5 g;  2YLC A;  2EQK A;  2JMC A;  1QCF A;  3OYA A;  2DF6 A;  1K73 U;  3M9Q A;  3QJY A;  4IUQ A;  1BCM A;  2HBW A;  1RAA B;  2F5T X;  5GAN e;  4ELY C;  4ZN1 A;  2M16 A;  2ZPG B;  1D3B A;  4CC3 A;  4IIM A;  4OF1 A;  1KQ1 A;  3EGX B;  4XTX A;  4EMH A;  3ME9 A;  1QP3 A;  1ZLM A;  2PUK B;  5CK9 A;  3PFS A;  1HSQ A;  3CPF A;  4FW2 A;  3HHT B;  5M9O A;  2LP5 A;  1Y96 A;  1YJW Q;  4QQ6 A;  1MMN A;  4JZ4 A;  1D0Y A;  3SHW A;  4JRI A;  5IN1 A;  4DQ2 A;  2KE9 A;  2DX1 A;  1M3A A;  2LX7 A;  2DIQ A;  1WLP B;  5GAM h;  4HA8 A;  2NUT A;  3E9G A;  2RPN A;  2L3Q A;  4QQD A;  3CC4 Q;  1WQ7 A;  1Q81 R;  3VS0 A;  2RK2 A;  2X51 A;  2ZCF B;  4OMN A;  2F1L A;  4E7J A;  2EJF A;  3EG3 A;  5LJ3 f;  3HSB A;  1SHG A;  5FRM A;  3SDZ A;  5I22 A;  3UPU A;  4F7U F;  3CD6 T;  2QA4 T;  3NTH A;  2YRV A;  4F7U A;  4ZGJ B;  2ATC B;  3JRZ A;  3I55 A;  2WSF E;  1IGQ A;  1WDX A;  2JUF A;  1VQP A;  1W2B A;  3M0S A;  3V8J A;  4L5G A;  1D3B B;  2HKQ B;  1VQN T;  3L2U A;  4OMP A;  1M9S A;  1YI2 Q;  4IUU A;  2V8J A;  1N9R A;  4OB3 B;  2YUO A;  1KD1 R;  3A8O B;  3TQ7 P;  4M78 G;  2Y90 A;  2K2M A;  2DKG A;  3RDV A;  2DTI A;  1PD0 A;  1UHF A;  2HZY A;  2ZPF B;  2COY A;  2RQV A;  3CCQ A;  2KR3 A;  4J6Y A;  2F2X A;  3JCM g;  2GTO A;  1R0B G;  4RTT A;  2D0N A;  3RER A;  1BI0 A;  2E41 A;  3MEV A;  2LT4 A;  1QVF S;  2DA9 A;  2CS7 A;  4EDU A;  3UWN A;  3CD6 Q;  1PRL C;  1T0J A;  5FWC A;  3M4G A;  4C0F A;  3CCS T;  1U1S A;  5LJ5 h;  3C12 A;  4RTX A;  2FVU A;  2DVJ A;  1VQ7 Q;  5KE3 A;  3CME T;  2IPO B;  8AT1 B;  2O88 A;  3CCS A;  2HQX A;  4GLK A;  4OVA A;  1QVG A;  2E4H A;  4D8K A;  3E9F A;  3G6E Q;  1R8O B;  3QWX X;  2EYQ A;  4N4I A;  4M77 F;  1SSH A;  2FZK B;  2D1X A;  2XDP A;  2QTV A;  1TSF A;  2RJF A;  4Y28 E;  1O9S A;  3JV3 A;  4NL3 A;  1ZQ1 A;  2CP5 A;  1QCN A;  3OMC A;  2RHI A;  5DLQ E;  5IH2 A;  5A0L A;  2DXC A;  1VYV A;  2LT1 A;  1Q7Y C;  2HSE B;  3X25 B;  3V7S A;  1JJ2 P;  2LCL A;  5GAO r;  2DNU A;  3L2V A;  1OU8 A;  1YCY A;  4F14 A;  5IHN A;  4E7I A;  1S72 T;  2DRM A;  5CKE A;  3UT1 A;  4M7D C;  2C0I A;  5CKH A;  3SB2 A;  3A8M B;  3WVD B;  1VQP T;  2OTL Q;  2EWN A;  3JAM E;  1VQ4 T;  4RMO A;  2K3B A;  2MMP A;  3CMA Q;  2GCX A;  2KRS A;  1VQO A;  4J6X A;  3KFV A;  4PLL A;  2CUB A;  5DM7 R;  3GF5 A;  3VS1 A;  3EG0 A;  3M5A A;  3OS1 A;  3QDR B;  2RJD A;  2JTE A;  2LQK A;  2JVV A;  4BAC A;  5KYX A;  2XDB A;  4WF2 A;  1I4K 1;  4BI4 A;  4RCB A;  5CIU A;  1SG5 A;  2YXY A;  3EFO B;  1AWX A;  2CSQ A;  2XI9 A;  2KRM A;  4ATO A;  3BDL A;  3RMQ A;  2COW A;  3L42 A;  2A0F B;  2BKD N;  2LCS A;  2DBK A;  4C0G A;  4BB7 A;  4TVR A;  1OOT A;  3EFR A;  2RD1 A;  2QXF A;  3ZEH A;  3X26 B;  1U5S A;  5GAN j;  1NPR A;  1WHM A;  4C92 F;  1H3Z A;  4F17 A;  2P0K A;  4KT0 E;  1YIT A;  3JCM h;  4NS5 A;  4R0K A;  2DXT A;  2VUB A;  4BI3 A;  3RES A;  3VJP A;  2BUD A;  2AK5 A;  1GBR A;  4AMC A;  4BE0 A;  2A3L A;  2KBT A;  5FW9 A;  4M75 F;  5D6X A;  3SEM A;  3CXC A;  2SRC A;  2HL3 A;  3H6Z A;  9ATC B;  2GGR A;  3VRZ A;  3A1P A;  4MZT A;  2DFU A;  1UUE A;  1I5O B;  4XTW A;  1GXI E;  4AT1 B;  2RK1 A;  2QK0 A;  2O9V A;  4XU1 A;  3ER0 A;  4B9W A;  3MEA A;  3A8H B;  2H3J A;  1NLO C;  4EMK C;  3S3M A;  1GFC A;  2L3P A;  5I11 A;  3SWN C;  5GAM e;  4MDX A;  1BK2 A;  2RHU A;  1SRM A;  1WNL A;  4Y92 A;  3LGL A;  2RH2 A;  3ZBD A;  3UA6 A;  3QBY A;  3MP6 A;  3OS5 A;  1YJ9 T;  2A36 A;  5I21 A;  3THK A;  1RAD B;  2P4T A;  5LJ5 j;  1ZA2 B;  2IG0 A;  1Z9Q A;  3AHU A;  2O2O A;  1WFW A;  1MMD A;  2HQE A;  3RMS A;  3VV0 A;  5KYU A;  3OYM A;  2EGC A;  3P8B B;  5FU7 C;  3TVT A;  1XTD A;  1IRE B;  1SSF A;  2GQV A;  2E1H A;  1UJY A;  4M77 D;  4M77 B;  1ACM B;  1I1J A;  2V8K A;  5FU7 B;  5KCH A;  1EZZ B;  2LRQ A;  1Y07 A;  2DLP A;  2M9U A;  3TEE A;  4M77 C;  1G5V A;  4C92 B;  1QLY A;  3QG1 A;  1SKU B;  1TTH B;  1NEB A;  4M7A A;  1AT1 B;  5HCK A;  1VQM Q;  2VKN A;  2KY9 A;  1NZ9 A;  1PSF A;  2V1R A;  3PTA A;  1KC8 R;  1IHV A;  2AHJ B;  5IHK A;  4OGE A;  1HJD A;  1B07 A;  5FWB A;  5LJ3 g;  3OW2 S;  4IIO A;  4CRI A;  2FO0 A;  2DRK A;  7AT1 B;  2RO0 A;  4M77 G;  3OS0 A;  4E2F B;  2L5Q A;  4JS5 A;  1JRI A;  1BBZ A;  1JQQ A;  1P92 A;  4HCZ A;  4FW1 A;  2HBP A;  1PKT A;  3OW2 P;  1SRL A;  4IUV A;  3FC3 A;  3CCJ A;  5KYY B;  1YJ9 A;  2XK0 A;  4J5Y A;  2RF0 A;  3LW5 E;  1MMA A;  2DIG A;  4LE9 A;  1YIJ A;  2QDY B;  4RKU E;  1JU5 C;  1FYN A;  5KYX B;  2M0O A;  2EKH A;  5A0G A;  4M75 A;  2CT4 A;  3E1S A;  4XAX B;  4QQG A;  2CP6 A;  4NL2 A;  2EPD A;  5KYY A;  1IB8 A;  2XG8 D;  1H92 A;  2CUD A;  4M78 D;  3C95 A;  3HRU A;  4JJB A;  4LNP A;  1CKA A;  3Q1J A;  3UA7 A;  2OAU A;  2QEX T;  1W1F A;  3OQ5 A;  3CC7 T;  3CME A;  3M57 A;  2O9S A;  2AZV A;  4P5N A;  1Y0M A;  1TWB A;  2BTT A;  2VGN A;  3OYL A;  4M7D A;  1ZUY A;  4PK4 A;  4PJO F;  1WJS A;  1VQN Q;  1D0Z A;  2CKK A;  2E6N A;  1N6A A;  1X43 A;  4FT4 A;  4OML A;  4RTZ A;  3OYB A;  2Y4X A;  2P0P A;  1AWJ A;  3MJX A;  4BE1 A;  5FU6 B;  3HFO A;  3PVL A;  4E7H A;  2C0O A;  2MIO A;  2R57 A;  4KUL A;  4RG2 A;  3O5Z A;  4J7F A;  1IHW A;  1UEC A;  3QYG B;  2M1H A;  1X6B A;  2MWO A;  5AYF A;  2QI2 A;  4M77 A;  3JB9 D;  5FU6 C;  3C4S A;  3M58 A;  1M90 U;  1LOJ A;  1TG0 A;  3CCR T;  2FEI A;  2NUP A;  4GBQ A;  1FXX A;  1M8V A;  2AKL A;  1OPL A;  2DJZ A;  3GPL A;  1KD1 U;  1EFN A;  4FM4 B;  5GAO p;  2RQT A;  4KGZ B;  5ECA A;  3I55 T;  1OUL A;  1VQ9 Q;  5LJ3 h;  4WTO B;  2ENM A;  2RQW A;  2SEM A;  2JOY A;  1X2Q A;  4C0Z A;  2DAQ A;  4M78 E;  2WSE E;  3HKS A;  3EH2 A;  3NHN A;  1KHI A;  1UJ0 A;  1VUB A;  2VAS A;  4CI0 C;  1K9M R;  2X3W D;  1WZO A;  1Q7Y R;  2J6F A;  2PQW A;  4KUI A;  1LNX A;  2QA4 Q;  4LDW A;  2K3X A;  2EQI A;  1VQ9 A;  1VQ8 A;  1K73 C;  1VQ7 A;  2VXF A;  2DL7 A;  1J3T A;  2K79 A;  3CQT A;  4J9H A;  4IKF A;  1I81 A;  2G6F X;  3CC7 A;  1XOV A;  4OGC A;  3BE3 A;  1UTI A;  2O4X B;  2ZPH B;  1XJW B;  5GMK l;  3FJ5 A;  2ZPE B;  4RTU A;  4C8Q C;  3VUB A;  3G71 T;  2JJ9 A;  5GMK m;  3PMT A;  4IUT A;  2A37 A;  5C0M A;  3E2U A;  1VQ6 A;  1KK7 A;  1AZE A;  4C8Q D;  3CCQ Q;  3OMG A;  4M4Z A;  1M1K C;  2BZY A;  4EPC A;  2NUT B;  4OB1 B;  3QPH A;  2QQR A;  3G6E A;  1MV3 A;  3OYG A;  3MHX A;  1JB0 E;  2LX9 A;  2DVE A;  3I5S A;  3HL8 A;  4FYV B;  3EG9 B;  4XTU A;  4J9E A;  4K11 A;  1VQO T;  1AHJ B;  1WPY A;  2BE7 D;  2EQU A;  4N4H A;  1OPK A;  5D6W A;  2FRW A;  1JBM A;  3M0P A;  2DO3 A;  2JXB A;  5GMK i;  4Z88 A;  2P84 A;  5GAN h;  1N9S A;  1H8K A;  1PWT A;  1M2O A;  1VQL A;  2H3E B;  2E10 A;  2MAM A;  3JCM W;  3JB9 G;  1W6X A;  4MZM A;  2HNI A;  3M59 A;  4M78 F;  1YI2 T;  1QVG P;  2RI2 A;  2YRC A;  5KE2 A;  2NUZ A;  2W10 A;  3LYI A;  3QZ9 B;  3VS2 A;  2MI6 A;  2D6F A;  2LZ6 B;  2XMF A;  3OYI A;  4AFZ C;  2MYS A;  5GAM f;  5GMK j;  2HQH A;  4LUE A;  5EC7 A;  4F16 A;  3JCM P;  1UFF A;  2ABL A;  4C0D B;  1U3O A;  1OV3 A;  1VIF A;  1NYF A;  4J6W A;  4D6W A;  1B7T A;  2J7I A;  2LJ0 A;  2LJ3 A;  2PVO B;  4BD3 A;  2OTL A;  1JJ2 A;  2RB6 A;  1ARK A;  1K4U S;  3H0H A;  4A4G A;  1PNJ A;  2P0Q A;  3IQL A;  2RN8 A;  4JLG A;  4DOV A;  4AG1 C;  1NG2 A;  5GAN f;  1M1K R;  4MZP A;  3QUI A;  3QDF A;  2DZC A;  1RAG B;  1M1G A;  5HY6 A;  1M2V B;  4ORZ A;  4JJN K;  3OYH A;  3CCE Q;  5GAN 2;  2K3Y A;  4FT2 A;  1VQK T;  1K9A A;  4RTY A;  2RJE A;  1UEB A;  4EMG A;  4DBH A;  3L1A A;  2DK3 A;  5A0D A;  3LH5 A;  4QVZ A;  2QQS A;  4M77 E;  2L2P A;  3CCQ T;  4N0A C;  3RUX A;  1V1C A;  4Z8A A;  2KNB B;  1M3B A;  2VYT A;  3HPW A;  3EGD A;  1D0X A;  4MML A;  1ZBX A;  2EBP A;  3QO3 A;  2FG0 A;  3M53 A; 
#chains in the Genus database with same CATH homology
 1Y96 B;  1BYM A;  3I56 A;  3A8H B;  3FIF A;  2H3J A;  4JLI A;  3V7C A;  2EJ9 A;  2F5K A;  2R5A A;  3FRN A;  3E19 A;  4EMK C;  1VQP A;  2MWP A;  4XQ3 A;  1KD1 C;  5LJ5 e;  3CMA T;  4PNO A;  3S3M A;  3P8D A;  5CKB A;  5GAO m;  2X4Y A;  4ZTF A;  1G3T A;  3PNW C;  3SWN C;  3LX7 A;  5GAM e;  4MDX A;  3M4Y A;  2MF2 A;  4JUV A;  3VYG A;  2KAF A;  3OSV A;  4LD6 A;  4A4F A;  2RHU A;  2HAX A;  1QVF A;  2CZ0 B;  1XNI A;  2E64 A;  3RKW A;  3PT9 A;  1DJ7 B;  1WNL A;  4JRQ A;  3CBP A;  3SWN A;  1NJI U;  4KUD K;  5GAN g;  3SWN B;  1G3W A;  3LGL A;  4M7A F;  2RH2 A;  4PLI A;  3ZBD A;  3QBY A;  5GAN d;  3OBY A;  3MP6 A;  4OP0 A;  3OS5 A;  2HD0 A;  2VC8 A;  1YJ9 T;  3CCJ T;  2KQW A;  4C5G A;  5I21 A;  4JS4 A;  2P4T A;  3NTK A;  1U1T A;  2R5M A;  5LJ5 j;  2ZPB B;  5GAN 7;  1YIT T;  3CBM A;  5DLO A;  3NTI A;  2A7Y A;  4PKC C;  2IG0 A;  3AHU A;  1K8A C;  3HP9 A;  3RKX A;  2HQE A;  3LH0 A;  3RMS A;  5IT9 E;  3VV0 A;  3JB9 H;  3OYM A;  1M4Z A;  3QJ6 A;  5I2M A;  3CCM A;  2D0Q B;  3P8B B;  3LGF A;  4HT9 A;  2R58 A;  5CVI A;  2V8I A;  2E70 A;  3HFN A;  1N27 A;  4M75 C;  5FU7 C;  4A54 A;  3OY9 A;  2QEX A;  1VQM A;  1XTD A;  1YJW T;  2CZ6 B;  4RG8 A;  1OYX A;  2FB7 A;  3MEU A;  1IRE B;  5EG2 A;  1IZ6 A;  1SSF A;  2GQV A;  2E1H A;  4M77 B;  4M77 D;  4R56 A;  3SFM A;  1Q82 U;  4QVD A;  3A5Z B;  3CCE A;  3OW2 A;  1X75 C;  1ZHI A;  1BIB A;  2V8K A;  1I5L A;  3H8Z A;  1YJN A;  2CGH A;  5FU7 B;  5KCH A;  3CEY A;  2RHZ A;  3SD4 A;  2DEQ A;  2LCC A;  3LWH A;  2LRQ A;  3X20 B;  1Y07 A;  2M9U A;  3ZFJ A;  3CPW S;  4BE2 A;  2PUO B;  4JDS A;  3OSS C;  3TEE A;  5KH6 A;  4E7L A;  4M77 C;  1QW1 A;  4ZN3 A;  1KQS S;  1G5V A;  4C92 B;  3CCL A;  3QG1 A;  4II1 A;  4OB2 B;  1FX7 A;  4M7A A;  3G6E T;  3QKJ A;  1Q82 C;  4HCB A;  5FRO A;  5C6S A;  4PJO G;  2E5Q A;  1QVP A;  3J81 E;  1YHQ A;  4M75 G;  1G3Y A;  4OB0 B;  5HK0 A;  3CCL T;  2KY9 A;  1NZ9 A;  1X01 A;  1PSF A;  4V2S A;  3GNF B;  2XID A;  2OTL T;  4XTY A;  2DPP B;  2K2V A;  3MP8 A;  3P8H A;  5GMK e;  2GFA A;  1NE8 A;  3PTA A;  3JCM f;  2D9T A;  4ZGD B;  5IAY A;  3GOX A;  1H64 1;  2AHJ B;  3ASK A;  4OGE A;  3PIO A;  1Q7Y U;  2K4Y A;  2EIF A;  2LC4 A;  4LDV A;  5LJ3 g;  4M7A D;  3L2Q A;  4N4G A;  3OW2 S;  1VQ9 T;  2JZ2 A;  4IUP A;  4CRI A;  5LJ3 d;  5CO7 A;  5GAO l;  3DB4 A;  2EAY A;  2RO0 A;  4M7D D;  4M77 G;  2E6Z A;  4A4E A;  5GAO n;  4BY6 C;  5GAO q;  3CPW A;  1VQM T;  2QQ9 A;  3JCM V;  2FL7 A;  3OS0 A;  4X9C A;  1Q86 C;  3OYD A;  2L5Q A;  5GAN 5;  4JS5 A;  4VUB A;  1VQ5 T;  4YTL A;  1YBY A;  1UB4 A;  1S72 A;  1LJO A;  2EQM A;  2JTF A;  1JRI A;  3V8K A;  1M90 C;  5GMK h;  2XHC A;  1P92 A;  1YIJ T;  1KC8 U;  2BIV A;  4HCZ A;  1VQN A;  1OI1 A;  1X6O A;  2HBP A;  3VKI A;  4BDZ A;  3JCM b;  2NLU A;  5CR2 A;  4R55 A;  4UC4 A;  5LJ5 d;  3C94 A;  4C5E A;  5GAN 8;  4PJO C;  4IUV A;  3FC3 A;  1VQL T;  3CCJ A;  3DLM A;  1Y71 A;  1YJ9 A;  2XK0 A;  4J5Y A;  2RI5 A;  1B34 A;  2Y4Y A;  1OZ2 A;  4F7U G;  1Q81 U;  3FDR A;  4Z02 A;  5J3B A;  3LW5 E;  4C92 C;  3FJP A;  2DIG A;  3MO8 A;  1YIJ A;  4C92 E;  1KQ2 A;  4XTZ A;  1BI3 A;  3JCM e;  2QDY B;  3GLX A;  2OTJ T;  4RKU E;  3MCA B;  5GAM d;  1UGP B;  2B8A A;  3S6W A;  4PJO B;  2QQB A;  2M0O A;  3DB3 A;  3V8L A;  3OS2 A;  5A0G A;  3BFM A;  4M78 A;  3EAE A;  2FHD A;  1YHQ T;  4M75 A;  1Q81 C;  2KDS A;  3E1S A;  4XAX B;  3CC4 A;  3HRS A;  1WJQ A;  4QQG A;  3LLR A;  2X4J A;  2XD0 A;  3CMA A;  2LDM A;  4NL2 A;  5LJ5 g;  2YLC A;  2JTM A;  1MGQ A;  3KUF A;  2XG8 D;  3RKY A;  4A4H A;  2LTO A;  2EQK A;  3OYA A;  1V29 B;  1K73 U;  3M9Q A;  3QJY A;  4IUQ A;  1BKB A;  2F5T X;  5GAN e;  1YJN T;  2DXU A;  4BY6 B;  4M78 D;  4XU2 A;  4ELY C;  2YHT A;  3C95 A;  3HRU A;  4ZN1 A;  1PSE A;  2M16 A;  2EKO A;  2ZPG B;  3Q1J A;  2E65 A;  1D3B A;  2DTH A;  3M54 A;  2FYK A;  1G3S A;  4C8Q E;  2OAU A;  4OF1 A;  1KQ1 A;  2QEX T;  3JCM d;  4XTX A;  4EMH A;  3ME9 A;  3OQ5 A;  3CC7 T;  1W4S A;  5KCO A;  4J8O A;  3CME A;  3M57 A;  1QP3 A;  4Q5W A;  2LQ8 A;  3CBO A;  4P5N A;  5FLX E;  4M7A E;  1Y7X A;  1W2B A;  1VQ6 T;  2XU8 A;  5CKD A;  1WQW A;  3CCE T;  2VGN A;  3M56 A;  3OYL A;  1XQH A;  2PUK B;  5CCA A;  4M7D A;  1K9M U;  4PJO F;  4M7D E;  3FLG A;  4ELZ C;  1WJS A;  5CK9 A;  2DZ9 A;  3PFS A;  2C06 A;  3CPF A;  5M9O A;  3HHT B;  2XDD A;  2CKK A;  2E6N A;  3G71 A;  3TU4 K;  1N6A A;  1Y96 A;  2O4X A;  3TRE A;  1RI0 A;  3JCM X;  3L2Z A;  4QQ6 A;  5GAN 4;  2CZ7 B;  1KG1 A;  2RA2 A;  4FT4 A;  4JRI A;  5IN1 A;  4DQ2 A;  3OYB A;  2RJC A;  2VXE A;  2XKO C;  2DIQ A;  4XU0 A;  2DD5 A;  3TCJ A;  3N5B B;  2Y4X A;  2P0P A;  1B34 B;  5GAM h;  4HA8 A;  1WJR A;  4BE1 A;  5FU6 B;  5HKC A;  3HFO A;  3DLL A;  4E7H A;  1W2B S;  4KUL A;  1O75 A;  2R57 A;  4JRK A;  4RG2 A;  3E9G A;  4J7F A;  4C8Q A;  3CCU A;  3MP1 A;  4QQD A;  2LNV A;  3QYG B;  1WQ7 A;  2M1H A;  2MWO A;  5D6Y A;  4MDW A;  5AYF A;  2QA4 A;  2RK2 A;  2QI2 A;  4M77 A;  2ZCF B;  4C5I A;  5HK3 A;  2KMT A;  4E7J A;  3JB9 D;  4FU6 A;  5FU6 C;  2EJF A;  2IVW A;  3C4S A;  3M58 A;  3G4S A;  5LJ3 f;  2VV5 A;  1M90 U;  1LOJ A;  3A8G B;  3CCR T;  3HSB A;  2KK4 A;  3CCV A;  5FRM A;  1FXX A;  1M8V A;  3SDZ A;  1OZ3 A;  3V7R A;  2OTJ A;  2DJZ A;  4IUR A;  3GPL A;  3UPU A;  1KD1 U;  4FM4 B;  2X4X A;  4F7U F;  5GAO p;  4C92 G;  3I55 T;  3GIB A;  3CD6 T;  2QA4 T;  2ZPI B;  3NTH A;  1MHN A;  3OYE A;  4XTV A;  1UGQ B;  1BI1 A;  2YRV A;  5LJ3 h;  4F7U A;  3CCU T;  3UDC A;  4ZGJ B;  2LVM A;  3JRZ A;  3I55 A;  2WSF E;  5A2Q E;  2JOY A;  4C0Z A;  2DAQ A;  4M78 E;  2JUF A;  2RHY A;  3OYC A;  2PVD B;  2WSE E;  3HKS A;  4GY5 A;  1VIE A;  3A8L B;  4L5G A;  3V8J A;  3CCV T;  1D3B B;  4LDX A;  3JB9 F;  4A4K A;  1KHI A;  3L2U A;  1VQN T;  1YI2 A;  4QVC A;  1M9S A;  1VUB A;  2DD4 A;  3X24 B;  4IUU A;  1K8A U;  4CI0 C;  4LD9 K;  2V8J A;  1N9R A;  2VGM A;  5CKF A;  4OB3 B;  4C92 D;  4A53 A;  2PQW A;  3A8O B;  3EFS A;  4M78 G;  2Y90 A;  3GNG A;  1LNX A;  2DKG A;  4KUI A;  3T9N A;  5J39 A;  3BW1 A;  5GAN 3;  4LDW A;  3DKM A;  2DTI A;  2K3X A;  3BY7 A;  4FSX A;  5DY9 A;  3QSU A;  2CYZ B;  2ZPF B;  5LJ3 e;  1VQ9 A;  1VQ8 A;  2EJG A;  3CCQ A;  1K73 C;  1VQ7 A;  2VXF A;  2L3R A;  4QW2 A;  3WVE B;  4J6Y A;  4IKF A;  1UGS B;  3JCM g;  2QTX A;  4J7I A;  1WGS A;  1VQ5 A;  1I81 A;  3CC7 A;  1XOV A;  4OGC A;  2K5I A;  2O4X B;  1VQK A;  3RER A;  2ZPH B;  4F7U E;  5GMK l;  1BI0 A;  4M75 E;  2E41 A;  2ZPE B;  2LT4 A;  3MEV A;  4LDU A;  5J26 A;  3VUB A;  4C8Q C;  3G71 T;  2EQJ A;  1QVF S;  2CS7 A;  4MMK A;  4EDU A;  1K9M C;  3UWN A;  5GMK m;  4M7D B;  3PMT A;  3M4G A;  4IUT A;  4C8Q F;  2ZZD A;  4C0F A;  3CCS T;  4DOW A;  3PGG A;  3OYJ A;  2ZGW A;  5C0M A;  1U1S A;  5LJ5 h;  3C12 A;  1VQ6 A;  2FVU A;  2K5L A;  1QP2 A;  4C8Q D;  4C8Q B;  3OMG A;  5KE3 A;  3CME T;  2E12 A;  5LJ3 j;  1HXD A;  1M1K C;  3PIP A;  4EPC A;  1EIF A;  4ME7 A;  2DXB A;  3CCS A;  4M7D G;  2HQX A;  2L89 A;  4OB1 B;  4GLK A;  3QPH A;  4OVA A;  1QVG A;  2QQR A;  3OYF A;  1TH7 A;  3G6E A;  2RHX A;  3E9F A;  3J80 E;  2O01 E;  3F70 A;  2GFU A;  1JJ2 S;  1R8O B;  3OYG A;  3MHX A;  1JB0 E;  2EYQ A;  4DA4 A;  2LX9 A;  4M77 F;  4N4I A;  2DVE A;  2XDP A;  2RJF A;  3HL8 A;  2KVQ G;  4Y28 E;  4F7U B;  2KSS A;  1O9S A;  4NL3 A;  1ZQ1 A;  4BDY A;  4HKE A;  3OMC A;  4XTU A;  1VQO T;  2RHI A;  1AHJ B;  5DLQ E;  3OB9 A;  4C8Q G;  1WPY A;  2XIC A;  1VQ8 T;  2I2L A;  2JNG A;  5A0L A;  3CC4 T;  2DXC A;  2LT1 A;  1Q7Y C;  2EQU A;  4N4H A;  3S3N A;  3X25 B;  5D6W A;  1VQ4 A;  3V7S A;  2LCL A;  5CQX A;  1JBM A;  5GAO r;  2DO3 A;  3L2V A;  1YCY A;  4M7D F;  3R6O A;  4EMK A;  5GMK i;  4E7I A;  4PJO D;  5GAN h;  1N9S A;  4C5H A;  1S72 T;  1FWZ A;  1KHC A;  2RM4 A;  3X28 B;  1QVG S;  2RI3 A;  2PU9 B;  5CKE A;  3UT1 A;  4BI8 B;  4M7D C;  4C92 A;  3JSC A;  3OYY A;  5CKH A;  3SB2 A;  3A8M B;  3WVD B;  1VQP T;  2EWN A;  3MEW A;  5GAM g;  3JAM E;  3QYH B;  1VQL A;  2F69 A;  1VQ4 T;  4RMO A;  4FL6 A;  4NOY A;  3CCR A;  2E10 A;  2MAM A;  3JCM W;  3JB9 G;  4ZGE B;  2MMP A;  3QXE B;  2GCX A;  2X35 A;  4MZM A;  3CXC S;  4Y91 A;  3HRT A;  3CD6 A;  4RCC A;  2WSC E;  1VQO A;  2HNI A;  4J6X A;  4HCC A;  4PLL A;  5DM7 R;  3M59 A;  4M78 F;  1YI2 T;  3GF5 A;  3JCM J;  4C0D C;  4ZTJ A;  2RI2 A;  1Q86 U;  5KE2 A;  4KBM B;  3LYI A;  3INZ A;  3QZ9 B;  2MI6 A;  1BIA A;  3M5A A;  3MET A;  3OS1 A;  3QDR B;  2D6F A;  3VU3 C;  3OYK A;  2RJD A;  3OYI A;  4XU3 A;  2LQK A;  4BUG A;  2JVV A;  4PL6 A;  5GAM f;  5GMK j;  4BAC A;  5L8R E;  4WF2 A;  2XDB A;  3M55 A;  3FB9 A;  3JCM P;  1I4K 1;  1HK9 A;  4FIB A;  4L59 A;  1BI2 A;  2DTO A;  4BI4 A;  3J7A F;  4RCB A;  2X4W A;  4C0D B;  5CIU A;  1VIF A;  3I56 T;  4J6W A;  3KBG A;  1RL2 A;  2K5F A;  4D6W A;  3O8V A;  2XI9 A;  2PVO B;  3G7Z A;  4BD3 A;  2OTL A;  4O5V A;  4ATO A;  1I8F A;  3BDU A;  3BDL A;  5GAN 6;  2RB6 A;  3RMQ A;  3G4S T;  4LDY A;  1JJ2 A;  4A4G A;  4OMF B;  3L42 A;  3QHS A;  3FEO A;  2BKD N;  3LWI A;  4B9X A;  4M7A B;  2GF7 A;  3L2W A;  2P0Q A;  4XK8 E;  1YJW A;  4C0G A;  4BB7 A;  4TVR A;  2EFI A;  4JLG A;  3GP8 A;  3EFR A;  2RD1 A;  4DOV A;  3PMI A;  2QXF A;  3OBW A;  4M78 C;  3RIR A;  3X26 B;  3ZEH A;  5GAN f;  5GAN j;  4HT8 A;  1NPR A;  3QZ5 B;  5FRN A;  2WAC A;  2JN0 A;  4MZP A;  4X9D A;  4M75 D;  5CQY A;  3QUI A;  4L6V 5;  2DZC A;  4C92 F;  1N8R C;  1M1G A;  1H3Z A;  5HY6 A;  3JCM c;  2P0K A;  1NPP A;  4KT0 E;  3OYN A;  4JJN K;  4E47 A;  3OYH A;  5CAI A;  1YIT A;  2G3R A;  3JCM h;  4NS5 A;  3KXT A;  2DXT A;  4M78 B;  2VUB A;  3CC2 A;  4BI3 A;  5GAN 2;  2K3Y A;  4FT2 A;  5I2S A;  4PJO A;  4M7A G;  3RES A;  3VYH B;  1VQK T;  4PJO E;  3VJP A;  2BUD A;  2RJE A;  3NFC A;  4N0A A;  5LJ5 f;  1UEB A;  3URG A;  4EMG A;  4JRP A;  2K57 A;  3L1A A;  3JB9 J;  3CC2 T;  2DK3 A;  3CCM T;  5A0D A;  1N8R U;  3OA6 A;  4BE0 A;  2A3L A;  4QVZ A;  2QQA A;  2QQS A;  1M1K U;  1M5Q 1;  2PVG B;  3JB9 I;  4M77 E;  2CZ1 B;  4M75 F;  5D6X A;  3VUZ A;  3CCQ T;  1VQ7 T;  4X34 A;  3L2R A;  3CXC A;  4J83 A;  3H6Z A;  4N0A C;  1KC8 C;  3RUX A;  3QII A;  1NJI C;  4MZT A;  2VYT A;  3HPW A;  4XTW A;  3JCM Q;  4MML A;  5GAM j;  1ZBX A;  1UGR B;  3QO3 A;  4O6J A;  1GXI E;  3WXM B;  1KQS A;  4EMK B;  2RK1 A;  4M75 B;  4M7A C;  4E7K A;  3S3O A;  1U8R A;  2YLB A;  4XU1 A;  3ER0 A;  4B9W A;  1M1F A;  3M53 A;  3MEA A;  5LL6 S;  2L8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...