2IGFH

Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
221
structure length
221
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFTFSRCAMSWVRQTPEKRLEWVAGISSGGSYTFYPDTVKGRFIISRNNARNTLSLQMSSLRSEDTAIYYCTRYSSDPFYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 A.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA B13I2 FAB (LIGHT CHAIN)
total genus 41
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1991-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfH01
1DUYA 3FMGH 4OGAD 1M71B 5F9WB 5CIPB 1GGIL 2AQ1A 5HHPB 1HHKB 1OF2A 3QO1A 5E6YA 2XTJD 5BVPH 3IDGA 2X70A 4PLNC 5IM7B 2IQ9L 1X44A 4PJ9C 3V6ZA 4C4KO 3VRLE 4L9LC 4Y16C 4I2XE 4LPYA 3LVEA 1IAOA 3HR6A 1R24A 4P3DB 3RY5A 1RK0B 3CZJA 2VDRH 5FA4B 2D9CA 2Z8SA 3MROB 4XNUH 1YEKH 3RWFB 3C5ZC 2W1NA 3PWPA 3TBWA 2Z4QA 4GRLD 5CKAA 2FR4A 1SYSA 1A22B 1C7SA 4JY5H 3BIKB 1YEKL 3QFJD 1UJ3C 4JG0L 5CSZB 5HGAA 3ULUF 1ZHNB 4Q9RL 3D39D 3GM8A 4Y19A 3F58L 3QIWC 3BKYL 1X5GA 4ZOCA 1QP1A 1YEGH 1UWXK 3GMOA 2DKSA 4LMQI 5IR1B 2P42B 2R9HD 4NN7B 2CIKA 2VAAA 3IU3A 3VGAB 2CRIA 4QRSA 1VADB 4LKCB 5FHBH 2UUDH 3ALXA 4GS7B 3SJVE 1F58H 2ORBH 3VMOA 1JHKL 5HHNA 3RX5A 1MCQA 1OAXH 4OZFG 2P7TB 1DQMH 5FGBC 5EOCL 3C6LC 3OJMB 1EFXA 3LV3B 3RKDC 5IFHH 1QYGH 2Q8BH 3THMH 3NIDE 4M62H 3RWHB 4LLYB 4GKSA 1MCBA 4I77L 5I73B 4X8JA 3RWGB 2DQDL 4MQXD 2APBA 4PRDB 7FABL 3P4LA 2AXJA 4QRTA 3O9WB 1P7QD 3DROA 1CWVA 2FHFA 1IC4L 4M5YL 1JWUB 5FCUH 3K80A 4HFUL 1ZMYA 3WO4C 3EJJX 3FO2B 3P9LB 4H20H 3ARBA 2FYYA 4RMWA 1GAFL 1KLGB 1XGPA 4Q0XL 4KTEH 4NIKB 2P8MB 1MJ7H 1A14H 1IGMH 3X12B 5EU4A 3DETC 1ADQA 3WDIA 4PJIA 4UTBH 1WZMA 5DF0A 5SWSA 4Z7OE 2R29L 5IV2B 1CLCA 4MD0A 3VGAC 2NXZB 2CGRH 1ZLSH 4EQ3A 1LD9B 4F37F 4PREB 1HIMH 1U3YA 1RUMH 3MRBB 1L0YA 2MKWA 5DDHB 3U36A 5IV2A 2YC1B 1FLRL 4M1CC 4AG4H 4JKWA 5GRJH 3WHXA 5TQ0L 2CDGB 3T08A 4OBSA 1GHFH 3FCTA 3TPUA 2DL2A 1AXIB 1U58B 1UENA 2Z31D 4E5XB 4XRCB 4FXGB 3F58H 2VR9A 4NRYA 1YEGL 2VQTA 3UTSD 1J1PL 1JRHI 4O5LH 2X4QB 5E70A 1XFPA 4KHXL 1F4YH 4OF6A 5K59F 1HDMB 1N6VA 3EGSA 3ULUD 4MD4B 1AD0A 4R96B 4EI6B 1KEGL 3AY4C 4RRPA 4X80H 3UTTD 5DVOA 3BP4B 4J4PD 3DURA 3CSPA 1FL5A 1C5CL 1MJUL 4RX4D 5T5NF 3S5LA 4N1EA 4UILL 3WFBH 3KGRA 5E99L 2XTJB 1ZLSL 2QSTA 3HE7A 2R0ZH 2OK0L 5C9JB 1HE7A 4K71B 1NFIA 5KVDH 1QNZL 3TWCL 5FOBB 1YEEL 1U8QA 2VN4A 2GK0A 1FV1B 5DK0A 3HI6L 4KUCF 2GCYB 4X7DC 1MCOH 4DUWA 4NJ9H 4XBEL 1IKNC 4HIEB 3OKLA 3WIHA 4QXTB 1U8MB 1ZT4B 3WNOA 4P4RB 5F3HB 1JF5A 3EJYD 1RMFH 1G9EA 4JB9L 4LRNL 1TETL 4JHWL 4P4KA 4PLJD 1A64A 1TJGH 2B2XH 3CGTA 4KDWA 3BW9B 2VDLH 1JPFB 3KHOA 4OFPA 4NWTL 4RFOL 1EERB 3VXQA 3U2SA 4UIKH 5HJ3A 1Q0YH 3SKNA 4QOKD 4XMPH 4YIQB 4JFHE 2I26N 3WV0A 3O2VH 3X11A 1A6PA 1NAMA 3QDGB 4XNXH 4YPGA 3QEUA 2PYED 4Y88A 5E1AA 2DB8A 3R8BB 4KKAC 4WHDA 1P4LA 4HC1A 1DQML 4YIQA 2EDHA 2BX5A 3RL1B 3WNKA 3NZ8B 3GSNB 1MF2H 5J11C 1KJ3L 5CJ5A 3IDMA 1JZ7A 3V6ZB 3QRFM 3INUL 2G75B 3LKOB 3F5WB 1I9IH 4UUJB 5IM7A 3B2UD 3DXAB 3MA9H 5LGHL 2NMSA 2HLFC 1TENA 4I3RL 2NY6D 1CDYA 1MCKA 3VWJB 2ZUVA 1HHGB 2D2OA 3BYTA 2IC2A 1JVKA 3WFHB 4FQJL 1WZKA 2IANA 3ZT7A 1T20B 1YEJL 3VRLF 1LNUB 4MAUL 3NIGF 1MJJB 4YBLB 4JY5L 4GBXC 2GJ6A 3O0RH 1UKQA 2Z91B 2DQGL 2ICEA 5I8OH 1LO4L 5C09D 1NANI 4K7PH 1YNKL 4V1DE 2Q7YA 3EYUL 5D1ZB 1Q1JH 2F53B 3WDJA 1RFDH 1XGPB 3U7YH 5DQJB 4L9LB 2BCKA 2UZXB 2IALB 2X4SB 4Y16B 2Q8AH 2G5BB 4PJGB 1RZ8B 2ADFL 3SCMC 2VDNL 5DGQA 4F7CA 1PG7L 1RIUL 4F7PB 3OXRB 3NH7L 4RAUA 1T66D 2X4OA 4I0PD 1GGIH 3DX7A 3MGOB 4LNRA 2WUCH 5D5ME 1T2QL 4NDMA 4F2MA 4KJPC 3T2PA 2J12B 4PIRF 1GL4B 3CCHB 1KGCD 3MRBA 1MFAL 5E2VH 3B43A 4X4MA 1LO0H 1MFEH 4JFQA 3QUYD 3O6FA 1NFIB 3RKDD 4HKXB 1QSFA 4AEIL 4D9RE 4L3EE 1B3JA 3WLWD 3FQRB 3O2WL 4JPVL 3UO1L 4X6EB 2ZUUA 5HYSG 2F9BT 4L8DA 1RIHL 5LQBL 3NIDF 1A7QL 3QIUD 3KXFE 4J12A 4RAUB 4H26A 5C09B 4M1GH 1VPOH 4RNRA 3MRGA 1JWUA 4RGNC 5L7XH 4HMEA 4LHUG 3IAQA 4R8WH 5F9DC 3DV6B 2IAMB 3L7EB 1BEYH 1KPUB 2MHAB 4F57L 5D93C 5C86A 2XY1A 4S10A 1OTTD 5K9OB 1SMOA 2AJYL 2A9NL 3IDYB 4WI3A 4EKXA 4F9PA 5I74C 4MDJA 3MODL 2VUYA 1MFEL 5E8DH 2BNUA 1IQWL 2VIRA 1LO2L 1N7ML 2FX9H 2KZWA 4OLWH 1KTRL 1T7XA 5TE7L 5DRNB 4DW2H 1RAMA 4QTIL 5CEYA 1AE6H 3RGVB 4HIXH 2QTEA 1AJ7H 4XP5H 3KLAB 5EORL 2GT9A 2FD6H 2QEJA 1I8MA 1CXFA 2DWEB 1MAJA 4L4TD 3MR9A 4G6JL 4P48A 1QVOB 4LLQA 4UDUB 1N5YH 4TUKH 2MQ0A 5ALCL 2BFVH 3WO3B 2CUHA 4BH7A 1OY3B 1MJ8L 4OCWL 3IDJB 5GGRB 1G9MC 1CDCA 3HC0A 3SGJA 4K7PL 5JXEA 4MWFA 1ULVA 3O6FD 2R0LL 4XWOC 1I9RH 1U3HC 3HI1B 3WXWH 4M7JH 5EU5A 3RPIA 3CMOL 2OBGA 4FQJH 3F65A 4JPKL 4P2RB 2UWEF 1ORQB 2YOCA 4KJYA 1ZVSB 3L3HB 3BKJH 1CFNA 4U1GB 5DJ8B 5K59E 4MSWA 3FOLA 5K33A 1SY6H 4Y4FB 5TDOA 5E2VL 1N5AA 4FMFA 1XF5A 1U92B 3HC4H 4J3UA 3H42H 1RZJC 4OTXL 4WDIA 4OQTH 3I2CH 2AJZA 3GK8H 3I6KB 3PV6B 1JBJA 2QQQA 3B2VH 2M1KA 4LLUA 3P11L 3MGAA 2A0LC 5EUKB 1XGUB 2DLGA 4Z9KB 3G08A 3RWCA 2WUCL 1ERNA 4Z5RB 2ZSVB 1WICA 4ODXB 1A0QH 4R3SA 1QNZH 3RVUC 4FXLA 1IL1B 4Z7WA 4ZUVB 4QHLB 2E27H 5K9KB 4PJFA 5LGJB 1KJMB 3TT1H 2P8LA 2B2XL 3G08B 4AM0B 2R69L 5B39G 8FABA 2ZUTA 4DKFH 2ARJB 3E3QE 1MY5A 3HNTH 5HI3D 4BJLA 2VJXA 1WWBX 4ZTOH 4PJAF 3M8OH 2WWMC 1J0JA 4GRWH 2Q3AA 4EJ1C 1QHOA 4G6KL 2PCPA 4KRPC 1T2QH 4JO2L 2JJVA 3SPVB 2Z8VC 1GH7A 1E0OB 3MRLA 1QLEL 1ZE3C 3C5JB 4UB0H 3U7WH 3BH9A 5I6XB 5D1ZC 4AYFA 2YHGA 1VACB 4HXBH 4ETYA 1EZVX 1KIUA 4UUJA 1JGVL 1J86A 1SQ2N 2FGWL 3JSSA 4ENEC 3CFJB 3MRDA 4J3XA 2EDTA 4U3CA 2CPCA 4KRNA 2NY6C 2C4XA 3EYQC 3QNZB 3HZKA 1BIIA 1G9ML 2BY2A 3NZHL 1S7VA 2FEDC 4QGYA 4RISH 4WHYG 4S1SL 3JVGA 3A67L 1DBAH 4P49A 4KZEH 2H1PL 4H1LB 1MI5A 5I8KH 1WK0A 1ZSDA 2Y4SA 4G9FB 2GIYA 3AU1A 1XGTB 4I5BA 2CR6A 1WWWX 4LEOA 1I1YA 4L4TE 3D25A 4N8VA 4MXVF 3HLAB 2BHUA 2EO9A 1QR1B 5A43C 5J89A 4R4BA 5D1XD 4MCZB 2AJSH 2BOBA 4X0KA 3QHFH 5LAXA 1C08A 2BNUB 3UX9B 3K4DA 3ZYIA 1AD0B 2EZ0C 2A6DA 2AEPL 2YK1L 1LE5B 5DC9B 1RI8A 4WU5B 4WTZA 3GSQB 4MA7L 3ULSA 1HOCA 1E4KC 2CMRH 1X9QA 1PD6A 4AIXA 4PY7A 3SKOA 4W68A 3QIBD 5I19H 3MLWL 1MPAL 1RPQA 1PKQE 5D7SL 2V2WA 4XX1E 2I27N 2NY2B 2OZ4H 5GRJL 4Z7UE 1P1ZA 1CCZA 4NZJA 4P9HL 5C0IB 3P4OA 5E8NA 3CFBA 1EO5A 3JUZA 1SBSH 3JZ7A 3VXME 2H26A 5IBUG 2WANA 3PV6A 3BQUD 1FFOB 3GMNA 4HJ0C 2HT3C 4WFGE 2RAMA 4KKBD 1LP9B 1E28B 1SBSL 3LKNB 1J1PH 1U2CA 1UXSA 2YPLE 3V6OE 1N59B 3MLZH 2LTQB 3D39B 3VFNA 4U6TA 4RGND 4W6WB 3KLHD 3VI4E 3LD8B 2DQFA 5SWSD 3DVNB 2XZAL 1AGCB 43C9A 4ZPVB 3JWDH 1NCUA 2CUMA 3EHBD 4HS3A 1FYHB 3UTTA 4K3DL 3FQUB 3MTRA 4PG9B 43C9B 5IG7A 5EZJA 3BSZH 3IKKA 4PJFE 2R1XA 1ONQA 2HWZL 3HFML 4N9GA 1ITBB 2RFXB 5HSFA 3TCLB 3MUJA 1RJZB 4PRIA 3I6KA 4OZHE 2A73A 5AAMA 4F9LA 1RUPH 3O6MH 4LSDA 1CDUA 1XH3B 4MNQE 3DVNA 1IEHA 4Q0XH 5T3ZD 1D5BA 2IQ9H 4QRRD 1D6EA 3MZTA 1CFQA 3FB6A 5B39A 1CGWA 1LE9B 2EYRB 4YHNA 4FQLH 4BQ9A 1BIIB 4JO3L 4XPBH 2Z0BA 5C0BD 5IVZA 1T1XB 1C5BH 1SM3L 2Y07L 3P4NB 4YO0A 3G5XB 5ANMB 1IQDB 1EUTA 1MAKA 1H3TA 4Z7UB 3T1WA 3MPCA 4TVPD 1IC4H 4M5YH 5DTFB 4BQCA 3QPXL 2CIKB 4XCCH 1CF8L 5ELIA 4PRAB 3GIZH 3D25B 3KPPA 3MRLB 1J12A 3I6GA 3TZVD 5C3LD 1OTSD 4M3KB 3WIFA 1BBJA 4OD2B 1NBZB 5D1QC 2D0FA 4KMLB 1G7IB 3TH2T 1G9MH 4Y4KA 3MROA 5I1KL 3PUCA 1QA9A 1S9XA 4PRHD 5TFSL 1UH2A 5KVGL 4LAQL 4HC1L 4NKDA 2FJGB 3V7AG 1IC5L 5CCKL 3IGAB 3QQ9D 5J1AB 2CO6B 5KANI 2HTLD 2YS4A 4FZ8L 3DJ9A 1R3JA 1T3FA 3IFPA 3MV01 1H3UA 4KXZH 1I1FA 2IADA 2R2HA 3D3VD 3BQUB 1DE4A 1LO3L 4NQEA 4GW4A 1AXTL 2OZ4L 3W9DA 4WEBH 1MCJA 3BDYH 2B1HH 3AB0B 3TYFB 4OZHA 4JPKH 2D0GA 3T0EA 5BJTA 1LO5A 1S7XB 4JANA 4GKZA 4LMQE 4Z76A 3GMPA 2PCPB 1FG2A 3T2OA 3GSOA 3QEUB 1A7OL 3QB7C 3TBVA 5ISZD 5K93A 2EXWC 1KLUB 4UTAH 4G8FB 3QQNA 1YYLH 3MLTB 3RWDB 3S8WA 3H9HA 4YK4B 2X44D 3IETB 1MH5A 3CMGA 3GHEL 4F15C 3K81A 5DEGA 2X4PA 2V2WB 3KPOA 1INQA 2FD6L 1T2XA 2CRMA 3PE9A 4OGZA 1JNHB 1IAMA 4EDXA 1V3MA 4NC2B 1T4KB 4G9FD 1CDGA 2HT4D 5F1IB 2XA3A 4G42A 5FO9A 4WI9A 2BY0A 3L1OH 2BOCB 3D9AL 4WNQB 1K3ZA 5DSCA 1JPSL 2LE9A 1BVKB 1H3PL 1DVFC 1LK2B 4LLQB 2DD8L 1WJ3A 3RVVC 3BXNB 4Z7NF 1BZ7A 3QA3A 4YHLH 1KJ2L 3B9DA 3PJSB 2FWOA 3AS3A 4F7EA 1I4FB 1NAKH 1N4XH 5C0CB 3BOVA 3Q48A 4W4OA 2FO4B 3RL2B 1JI1A 3D3VA 3EFFB 4I48B 3KPSD 4AMKL 4HUXB 3UJTL 3O45A 4WI8A 3EBAA 1INDH 3EUUA 5A1AA 3N9GH 3K7UA 3MNWA 1NLDH 4R2GD 3MV11 4MD5A 4N0UB 3QIWB 3V4PH 1F6FB 3BPOB 2A6JB 5GRVK 5ILTL 1WCBA 1GOHA 1E4WL 4NC1C 1JGVH 2FGWH 2D7TH 2OQJA 3S88L 1CIUA 5CSGA 2IMNA 3CFCL 5AD0A 1KB5B 1FFNB 1KCSH 5GGQL 5F7MC 3FTGB 3UC0L 3TA3A 2XWBB 4Y89A 4GS7C 1XF2B 3OKOA 4HXAH 3V5DB 1BQHG 5AG9A 3U0TB 3UZVB 1I1AB 5FIEA 4BH8B 4DZBA 3LS4H 1GC1L 1AQDA 1MSPA 2HT3D 1JHTA 4FFVD 1P4LB 4R96A 5KW9H 5HHVL 4LVEA 2AK4B 4B50A 3RDTC 3RHWK 4LLAA 4J8RB 1MCPH 4LSVL 1ACZA 3HE7B 2NY2C 2B4CC 5I8OL 1IJ9A 1A7RL 4HJJH 4TULH 1AI1H 4F7MB 4M6OL 1NC4B 2P24B 1MI5E 1FO0B 3UYOD 5FO7B 2NZIA 4JEGB 5FYJH 3HE7C 1Y6MR 3C6LB 5FF6A 1KULA 1EGJL 4JFFB 1GPOH 5JORA 3TIDA 1JN6A 3VFTB 5C0JA 4OLYH 1FYTD 3IDXL 1Z9MA 1W72A 2DM7A 4EN3C 1NDMA 2J7LA 2FIRT 4PJFF 1Q94B 2AXHA 5CZVH 4HWEL 5J1AA 2J8HA 3CC5A 3BE1H 4PJXB 2X40A 3SDAC 5C0FA 3I75A 3N1QC 3DBXB 3LKRB 3RWFA 2XPGB 1YJDL 4O02L 1H0DA 4F9LC 4HGWA 4N0CD 1PYWA 3VA6A 5I18L 1CD8A 4UNVA 2VERN 1KT2A 3BO8A 3VXMA 3Q6FA 4XNMB 4HS6A 5DUPL 3E3QC 1WT5A 3VXNA 5HVFB 4OKVA 3VXSE 4G9DB 5DI8A 4PP2B 1OAUL 5I71C 3STZB 1CL7L 1CIDA 2YD1A 3IF1B 5I1GL 5ICYB 3MUHL 4FNLH 5LAXB 3RWIB 1I9RL 4HK0A 2VXUH 3JV5A 5IQ9B 5DT1H 3I84A 4M8QB 4JVUA 2G5BA 4LCWD 3BZFB 2IANB 4PRHE 3DI3B 4FTVE 1U2HA 3QUXB 2M8XA 1KTKE 1KELL 2EEAA 3QNXA 3B6SB 3MO1B 2WBWB 5F7FA 1AGFB 3UBXG 2ZUYA 4OKDA 3KG5A 4YWGL 5BV7B 4PUBH 4Z0BH 2Z35A 2W9EL 3GJEA 5T3ZL 2R2CA 2MQCA 2Q76B 2KPNA 2V5YA 3T0EB 1DZBA 4HT1H 1JV5B 1FZMA 4GG8B 4UNUA 1KB9J 2A6KA 4TNWF 1BX2A 4XNXL 3ROOB 3QUYB 5FCSH 3V0WH 5MEQB 1JWMB 1C8PA 2XICA 3GSRB 4KDTA 2Y36L 4M7LL 3PQYD 3GSWB 1RULH 3DLQR 3DUHA 3SDXB 3T0XA 4Q58C 3QDJA 1KJ3H 3D0LB 4U0RB 1KIQB 2OJZH 3RPKA 3NABH 4DGYH 1QPXA 4RAVA 3MLUH 4MMXC 4XI5D 4U1GC 3ZL4L 1I3GH 3G5ZB 5EH1A 1BBDL 2EH8H 3MOAH 5TFSH 5K9QG 4Q74A 3C87A 4A6YH 3L95B 1BECA 3EOBB 4R97B 5C0CE 2A9MH 1VFOA 5KBNC 4KK8D 4XP4H 1TLKA 5BZDB 1QO3B 5KSVB 3U9PH 5EOQL 4K8RL 3VGEA 4YGVA 3QUZD 4DJMA 5BQ7B 2F19L 1EO7A 3M17A 1F4HA 2FZ3B 3HA0A 5DSCB 3ELAT 4WV1A 1GOFA 5HI5C 5SV3A 1F3DJ 2EKSA 4NQDD 5MENB 2NY0C 5E4EC 1PZ5B 1YNKH 1LMKA 3M17B 4DN4L 4N1HB 3VWJD 3OKNB 4PV8B 3FOMA 2IFGA 4WW1A 2D7OA 4FQ2L 1XCTA 5GJSH 4MJIE 4MQSB 4JFEE 4JQVA 2DYPB 5JHDE 1VERA 4NQUA 5CUSL 5E2JA 1NMAL 1FCGA 3O45B 4M03A 1JYVA 2KH2B 1SYSB 3LRHA 4M7KH 4XC3L 4XP1L 3F6IA 3GUTA 3HUJF 3EDKA 1IZKA 4R2GC 2JJUA 3JTSA 4WFHD 4OZGB 1GYAA 1U8IB 5ETUA 5DQ9A 3A6BH 3DO7A 2EO1A 3HPJB 1ND0A 1OARL 4YHZL 3U30B 5GRWA 5E7FA 3P77B 1Z6JT 5E2WL 1MHHA 4DGVL 1CE1H 3HUJB 2UUDK 2ITCB 4DKEH 3RVXD 3FFCE 1U8LA 5D1QD 1X5HA 4LAQH 4JM4L 3OKLB 3LAFA 4BM7A 2IG2H 2VE6A 4PJEE 1K85A 4LVNB 3MJ9H 2I9LA 1DBMH 5EUOF 3VRIB 4YHOL 3QUMB 2NYYD 4HWBH 2ED9A 4I3SL 4M43L 1ZHBA 3BUYA 3QEHA 3IGAA 1ZEAH 3QWRD 1CTOA 2XOTA 5GGTA 1BWMA 4KVNL 1NEZB 3IS1X 1RZKL 5HJ3B 4XMKL 5FYLE 1I1AC 1CFSA 3QPXH 5FCUL 4OZIE 3WUWA 3OJDB 1A7OH 4EEEA 3MRRA 1IGYA 3T2NL 1X5XA 5IFAH 1OP5H 4XXCC 3IAGC 1S7XA 2AKRB 3C08L 3PWJA 4MJ6B 5EZJB 4OZFB 4BSVB 4TTDC 1RK1A 5ESQA 4ALAH 4JZNB 5IB3A 1HKLL 1DBKL 1UKTA 2EC9T 5EG6C 5C0BA 1EFXD 1OAYH 3UBXA 2AJ3A 5HTSA 1IL1A 5FFLA 1V7NL 2AJUL 3ULVH 5I0DA 4CU7A 3PWPE 3SQOL 4PJIE 3BHBB 1PYWB 2FHCA 4OFYD 3T8XB 2NY4C 2NY3C 3ZHKA 3RIAK 3EO0A 3MJ8B 1QFWI 1DQQB 3N1GC 5GGTL 4Y2DC 3DARA 1RJCA 1IFHL 4XWGL 5C0GA 5IW6A 1O0VA 1MRCL 3U9PL 1JUFB 2H1PH 3A6CH 5BMFH 1NKOA 4KC3B 1Z3GL 3K2UH 3IDNA 2MNUA 4JFYA 4JVWA 4JDVB 1YMMB 3I3EA 1RZIB 3HCVA 4JFOA 3JWDL 4KJWC 1VGEH 3GBLA 2E3VA 5HY9A 4E5XA 1FL6B 2EIZB 3CSBA 2PO6B 4EBQH 3X3FL 4G6ML 2DLFL 4HK0B 3O8XD 5DHYA 3WXVL 4PPTA 1CXEA 1JGDA 4JO3H 5ICYA 5J06A 1HHIA 2A38A 3ILPB 4ZAKA 1Q0XH 3S4SG 2BVOB 2V7HA 3BSZL 4A6YB 4APQB 2OR8A 1G7QB 3HG1A 4IOFC 1X5FA 4EN3B 3WN5A 4KROB 4M7LH 3P30L 5ICZB 3U9UB 1FSKC 1H3GA 4PJCE 1KC5L 4LSRL 4Q7DA 5IB5B 4RDQF 5J4MA 3DSNA 1T6VN 3MRJA 4JHAH 3LCYA 1GZPB 4QHKI 2HFFA 3MZGB 4PY7B 5J56B 4NNYB 2H8PA 1YMMD 4PGDB 3OL2A 3HNTL 5I75B 2AW2A 5FO9B 4DZBB 3NVQA 4FFVC 1F4XH 3MV8A 1CLZL 1NDGA 4F80A 2WBJA 4QRUA 3F7YB 5B8CA 4JO1H 5E00A 2A1WH 2VDOL 4IJ3B 4HUVA 3FO1B 2JELL 2ZCLL 2KDGA 3LN4B 3VFUA 3AROA 4M43H 4XAKD 4YNYA 3N1PC 5I1JL 4C58B 2ESVD 4EI5C 1ZEAL 4XVUD 2YSSA 4ZFGH 3VXOA 3BIAX 1MHEB 3MNVB 1MLBB 1M7DB 1NCAH 4G8FA 2ADJB 1RUKL 1F90H 1K4CB 1A6WH 1BQHB 1FGNH 3G9VA 4ELMA 4YAQB 2HFGL 4PJ5D 4DK6A 5EU3A 2BNRA 5FYLL 5TE4L 4P5MA 5BCAA 3ABZA 3PHSA 3G6JF 3JWOC 5SX5K 1XF5B 1QBLL 3X11B 5BXFB 7FABH 2Z93B 2O5YL 3H0TB 3SKMA 3MUY1 5JZ7C 1J0IA 3KNBB 2VWEE 5DC4B 5EZOH 2D31A 3DTXA 3O3DA 2HMID 2VC2L 4V2BA 2NW3A 4HGMA 1P7KB 4GRMB 1IAII 3WE6B 4UQ2A 1FFNA 5H94A 3BUYB 2DDQH 2XFXA 2EKSB 4JJHA 4QY8B 2I60L 2L7JA 3C6SA 1G6RL 5JTWA 2O26U 3DXAA 1FNAA 2J8UE 9CGTA 1TQCB 4BH8A 3ARFB 2G9HB 4I13B 1R3IH 4X9FA 4P23C 4AEFA 4WFFD 4Z77A 2UZYB 3V4UL 3HZYA 2YUZA 4HUXA 3WIHL 3HS0A 1DUZB 5DD1L 3MRKB 3O4LA 5B4MC 1ND0B 5GPRA 3NTCL 1BLNA 1GPOL 1SEQL 3IRZA 4MS8D 5T3XD 5H37H 3VFMA 1NGQL 3LN5A 4HCRH 3MLRH 3KYNA 3MRKA 3O4LB 3BZDA 1IM9B 5GGVY 5DTFA 3HUJE 4EIGB 5I16A 2CKBH 3S37H 3L7FA 1YN6A 1RJLB 1EHLH 5IW1A 1A3LH 2H45A 5FHAL 1LO5B 2VRAA 5C0RL 4JFED 4DGIH 5DK2A 1S7UB 1TVDA 1UH4A 2Y1VA 3MRNA 4YDJB 2EC9U 4FQCH 4IDJH 3PWLA 5DJDA 4NQEB 5JQHC 3ARDB 5BVJB 4IRJD 5HGDB 4M9OA 1UZ8B 3QHZH 3H9YA 2QADC 5I66B 3TESA 2CSPA 1VPOL 1JK8A 2OSLA 2AGJH 1YEDB 2FGZA 3D69B 2NY1D 1LWRA 4J3TA 2W65A 3NPZB 4QHKJ 2GFBB 5MEND 1NCDL 2NW2B 1X4YA 5JIIA 1TQBC 3CSYB 5DJAB 1KEML 2BC4B 1ZLVH 4LCIH 2NY5C 3WXWL 4K7FB 2QADB 1HQ4B 3CMOH 1INEH 2IFFL 1AQKH 5JQ6H 2GSIB 4GXUM 1G6RA 2BNQB 5CJXC 4WWKD 4OZIF 4FQXA 2B1AH 2E6QA 3UBXB 4PYGA 2B5IB 3U82B 2VLKB 3GI8L 1JZ2A 3CVHA 4PGBA 2R0KL 2B1AL 4UNTA 3IFPB 2HKFL 1N6QL 4XI5C 1IGTA 4UU9B 1IT9H 3N85H 1RHHB 1G7JA 5I15L 3RVWD 1RZ8A 4JO4L 1OM3H 1NMBH 4U6XA 4ISVB 3BN9C 2Y7QA 2YC1A 4PRDA 4XCFL 4ODWA 1AR2A 3SDAA 4Q9QH 1UM5L 4OLUL 1YNTA 2WAHA 1WCQA 4CNIA 1LO4H 1EHAA 4HKXA 3LSOB 2ZWLT 1M7IB 1T7YA 4R7DB 5KTEL 1UWXH 2EDFA 1AFVL 1DQLH 2CUIA 4NOBA 4LDEB 3SJVA 4U3HA 4P2YA 3DGGB 3MYZA 4YR6A 3G5YB 4P46A 4IOIA 4YDLC 4E0RB 1UWEL 5J3HC 1ZA6B 3OKKA 1U91B 2MCPH 2X5PA 1VEMA 3FO9A 1N6QH 3MXVL 3FQUA 4PG9A 4X6CF 5IG7B 5F3BA 2XWJA 2JJSC 4IOIB 3BVNA 2AXFA 1S9YA 4Y5VA 4ZUUB 5I8CB 2O5XL 4JR9L 1JYNA 4OLVL 1W0WA 5MENE 2NQCA 1P7QA 1J10A 5D96B 1YN7A 3GKWL 3TPUB 1UEMA 1KN4H 2MCG1 5BO1L 3MACH 5DWUH 5E03A 5DFVC 1EO8L 4M48L 1FFOA 1A9BA 2QSCH 5IMKA 1CFTA 1JNLH 4G8GD 3FT4B 4P2QD 1IGFH 4OI8A 4EVNB 3HAEB 5L0QB 4Y4HA 4P9ML 3L3DA 2NY5L 4DZ8A 5C71A 4GRLA 1T0MA 4NYLA 4HS3B 1F13A 1A47A 3MOBL 3NIFE 5DJ2A 1ZVYA 4D3CH 2X7LB 3D48R 2H6PB 1C12B 2JIXB 3L9RB 4XVTL 5KN5A 5CHNA 2MQ3A 1QR4A 4MA8L 4NKIL 1ZK9A 5TE4H 5EB9A 3MV9E 5F9OL 5EIIB 1FYTB 3ZMRA 1Z0NA 5T1LD 3O3UN 3S88H 4HBQA 3SGKA 3BKCH 3C5ZA 5E9DE 4Y19D 1EFQA 3RWDA 3C6LD 3W82A 2ZCKH 3ORJA 5F6IC 1I8LC 3MA9L 4PTUA 3QUZA 5B3JF 4MNQB 3E8UH 3T0BA 1MCWW 1TJIL 3VXRE 5IBLC 2C5DC 4PYHA 4MXWH 4ZQKA 2E8YA 4BKLB 5IMLB 3GGWB 3F6LA 4HPYH 1BFVH 4FN0A 2QBWA 3RTQA 4YPGB 3JV6A 3V8CA 1AJ7L 2GK2A 5JLZB 2C1PB 2XA8L 3FHAA 5HYJE 4PRPD 4RGOH 1JYXA 1PLGH 4ONGH 1HEZA 1SHMA 3GMOB 4YX2H 2UV3A 5AWNL 1DQDL 3EJZD 4OF0A 3GMMA 3QJFB 1ADQL 5C0DA 1R3KB 1A3RH 2B20A 1LEIA 1JI2A 1R5IA 2X1WL 4K3DH 5GGVH 3DETD 4HUNB 1ZAGA 4UTBL 1OVZA 3VD5A 3U0PB 2OXGA 4R4BB 2EDWA 3EGSB 4IJ3C 3L3IB 2PW2B 4YE4H 4MNGE 5L8JB 1GGTA 5IKCB 1CLOL 3L3JA 3EOTL 4M6ML 4D0DA 1GC1H 3P9MA 1RY7B 4IOFD 3B8SA 4LPXA 4PJ8D 3EYFA 1NCCL 1WVZA 4DN3H 1S7RA 1BQUA 4JG1H 2EDDA 1S5IH 5GIRB 4H20L 1YMME 3O41A 5C9JA 1RU9H 2ZNWA 3CFKA 3ULUL 4O2CB 1CGUA 2F54E 1UB6B 1R3IL 4LRNH 2A6IB 3GIVB 2MKLC 1GVIA 4JZOB 1LK3H 1PX3A 3O3EB 4LCCC 4OM0L 3MJ8A 3BJLA 4NQCB 4Z6AT 2VL5A 2X4NB 4RGMB 2YUVA 4HBCL 1EJ6A 2E9JA 5EFIB 3IJHA 1C5BL 3HE6B 1NUFA 2YPLA 5AYUH 1I7ZB 1OCWL 5D1QA 4U1SA 1JUFA 5GGSY 2X4QA 5INDA 4QXGH 1E4XH 4K94H 1FAKT 3VXTB 1IAIH 1S9VB 4NZRL 1NUDA 3W2DL 3B8YA 4C59B 5JHDA 2HWZH 2DLIA 2VO5A 4RAHA 4EUPH 2IH1A 1NFDF 3WJLC 1MQKL 1A6UH 4J6RL 4CRPA 1O5DT 5E2UH 2AABL 4KKCC 4LBEA 3WCYA 4ELMB 3LQZA 1F58L 2CRZA 2B0SL 1YNLL 1N0XL 1ODAA 5IFAL 5DD5H 2YXMA 1LDPH 5IIEB 3CDGB 2M2DA 4IDLA 3T3PE 3VE0A 1FV1A 4OUUB 2QSQA 3ARDC 4MXQD 5DQDH 3FFCA 3FCTB 3SDCC 1T0NA 2Y9RT 4U1IB 1NJ9B 5DQDL 2NCMA 2MWCA 2YD9A 3FOLB 4OM1L 4H8WC 3M1BB 2NX5B 3DBXA 4NP4L 3BPCB 5HDBF 4FABH 1HYSD 4UDTB 5CD3A 1H0DB 4OIIL 4LP4A 3TZVA 3GI9H 4KTYA 1FIGH 1YY9C 5CEXB 2WP3T 4S2SA 1RZFH 5GZOC 1NCWL 1PY9A 4NNPL 4NKMB 3GM0A 2DAVA 1NCTA 5FOJA 2JK5A 1UVQB 5D7SH 2BSTA 3PABA 2VC2H 2XKNA 5EN2B 3S96B 3FMGL 3FJTA 2AVGA 2VXQH 2NTFB 4GAYA 1AGEB 1K4DB 4NWTH 4WUUB 3U0PA 1WZLA 4M6AA 5CCKH 5DFVD 3ZSTA 1EUUA 1VEOA 2DMCA 1MAML 2XZZA 3I9GH 4LRIA 1EXUB 4X7TA 4CVWA 4PRPE 3U1SH 2XY2A 4I2XB 5C07D 1R24B 4XBEH 1NEZA 4JFQB 4UINH 5F7WC 1UJTA 1SEBB 2X70B 5C0BB 5I9QB 1JRHL 4MNQD 3HB3C 4OCLC 1QFWM 5JDSB 3PGCB 3TJHC 2EDYA 2GSGA 2ATPA 2GEEA 4Y19B 5FK9A 1QFHA 5JOFA 5IVXF 3KVQA 2ZSWA 2I9TA 3TBSA 1MWAB 2PO6C 2IPKB 1FYTE 3WUWB 4OF5A 2P44B 3I85A 4HG4K 1BF2A 2NX5E 3UXFA 4HUWA 4NGHH 3D0LA 3P4MB 4ETQB 2WBJD 4M62L 2FJFA 4XPGH 1MCFA 3QEQD 4M00A 5D2NB 5HHOD 2AEWA 3PNWA 4WTXA 3K2MC 2GTZB 1U8KA 1F42A 2P8PB 4NFBA 4RZCB 5DHVH 4YHYC 2P5WD 2ADIA 5IHZA 1IVLA 1N0LA 3T4AB 4LCUA 2BFVL 4JZOA 1JNHA 4WFGD 2E27L 3BWUC 3H7BA 1CGYA 1FLRH 4LLWB 2R1YB 3HFMH 2C3HA 3OBAA 5JW5B 2OYPA 3GRWH 2OI9C 3K0WA 4XPAH 3X13B 1T6WA 3AS0A 5JOEA 4YDKH 1NCBL 3SKOB 2FB4L 3GSNH 3F62A 2NZ9D 5D71L 1OW0C 1N8ZB 4JQVC 5JW4R 1HXYA 1TVBA 2GITA 3EJZC 1WFUA 5TQ2H 1C08B 1X6LA 2B0SH 2IPUG 3HMXA 1K2DA 1KB5H 3SBWC 5I17A 3QIBB 2UVEA 3NMEA 4E41B 3WIFB 2OL3B 1YPZE 5FM4A 4DVBB 4UAOC 5CGMA 3NCYP 4UT6L 4OGAC 3C9NA 3JTSB 4ELKA 3BPNC 2BRRL 4XVSL 3OB8A 4DWHA 2QJDA 2OL3A 3RZCC 4JKPH 5T3ZE 2VAJA 4P9HH 2YBRB 1YQVL 5JPNB 3G6DH 2WNGA 4GXVL 3ZE2F 1YECH 2NY3B 1JPGB 2NY4B 3MV7B 3QXDA 3EZJB 3OAZH 3OPZL 1JTPA 5D5MB 3MV8B 3ROLA 2UWEE 2WINA 1BQLL 1KJ2A 4M5ZH 2H32H 1ZLWK 3KR3H 4P3WA 4NBXB 4K9EL 5FYKU 1DDHA 1EEYA 4AENB 4UT9H 4PJDF 3MRHA 4JRXE 5FECA 3TFKC 1RU9L 1XZ0B 2HJKB 4U1JA 3AXLA 3UYPA 3QDHA 3V0VA 2ZUSA 1I7RB 1P4IL 1A8JH 4IIQB 5GS2D 3OSKA 5IB2A 5ICZA 4MNHB 1H8NA 5FYJL 2VLJD 2Z92A 5JXAH 1YUHB 4DVRL 2I07B 1XGQB 3F12A 5C08A 2VLKD 4NO0A 1JPFA 3B2VL 1XR8B 3BP5B 2BK8A 1T04B 1E4JA 4OFDA 1TDQA 4U7MA 5JW3L 5KN5B 2R8SH 1HHJA 5D72L 3H42L 1RHHA 4FXKB 1M6OA 1AGEA 3T0WA 1YC7A 2RBLA 3R0NA 3GHBL 4MD4A 4KZDH 5EO0B 5D6DA 3FAXA 5SWZA 1E6OH 1JTOA 1B2WL 1VESA 2BVQB 2UYLB 5L7XL 4GAGH 4RDQG 1I7UB 5D93B 5LXGL 3PWNA 2VNCA 4L4TA 1KXTB 2IAMC 3LMJH 2DQUL 3QNYA 2D7PA 3KYOA 4JFDD 4JCLA 4QHNA 5A16B 5J6HA 3ULVE 4NO5B 5EBLA 4LVNC 4GMTH 4HDIB 2V7NB 1KV3A 6FABL 1JGLH 1HILB 2COQA 2NX5A 5IMKB 5E6IC 3KPNA 3DOSA 4UDTA 5FUZL 2V5MA 3SJVB 2KQMA 1GGCH 1KBGL 2W38A 3SO3B 4DVRH 4B7IA 4HDIA 5FV2A 2H9GA 3FB6B 3MYJB 2YKLH 1QSFE 1QRND 4RMSA 3KPLA 2JB6B 4PB0H 4YZFF 1G9NH 4X6CA 1DVFB 4KI1A 4F9PC 5J0BA 3ZKXB 5AUMB 4KK9D 5AYQA 1BQSA 1I7UA 1EGJA 5HHXH 1Z0MA 1AGDB 4ZXBD 4RMQA 4XTRC 5A3IC 3MRIA 1H15A 4QRPD 1T1WA 1ZANH 2CLVB 3O4OC 1U41A 3KAAA 4DW2L 3G6DL 2BOBB 5DD3L 1MLCA 3H9SD 4W4OC 3L6FA 3RWGA 4BUHA 1TCRB 2VDLL 2OXHA 1QLRB 4P46D 4ZNCD 1FCCA 3BFOA 1G6RB 3O0RL 4NSKB 1F4WL 2JB6A 3ARZA 1DN0A 3OQ3B 4NN5B 4XCFH 5IB1B 4IDJL 3IVKB 1UG9A 2CLZA 1R3HB 3IS0X 1OL0A 5I1LA 2O61B 3O6FB 5FYJU 1SY6L 1J0ZA 5FAAA 5HHNB 3V6BR 4C57C 3QZWA 3HB3D 4YHYB 3ZDXF 1QACA 2V17H 3LKRA 2EC8A 1T83C 3CFEB 1NCNA 1A7QH 5D7IA 3IT8D 1BJ1H 4KDVA 3IJSA 1AKJA 1JNLL 5DRZA 4X5XA 1LEKA 3B5TA 5KVDL 1FO0A 5HVWA 2EZ0D 4MQTB 1S7WB 1CG9A 3BWAB 2IALA 1LEGB 3DUSB 2IQAA 3NFPA 1S7QB 5HHME 1B4RA 3AFLA 3ZO0A 3TO4A 3VXPB 3M45A 1KEGH 4LU5H 2IAMA 3L7EA 2Q7YB 1FNGB 4UQ3A 3ULSB 1KCUH 1YECL 1RZGB 2XQYG 3PNWB 3PQYE 5CD5D 1OSZB 5BOZG 2PR4H 4M6OH 1BVLA 5C0CA 3QH3B 4NC0B 2Q6WA 2FBOJ 3IKCB 4EXKA 2WUBH 5M95B 2PTUA 1JF1B 5C2BL 4P2RE 3QQ4B 1FH5L 1KIRA 4O2FB 2YA2A 5A2FA 1JPSH 4D0BA 2XKSA 1H3PH 1CVSC 1BZ7B 3QA3B 1SJXA 5FECB 1UM5H 4OLUH 5FDWA 2ZCHH 1B0GA 5IJVB 2E7MA 5LXGH 3RVTC 3RTQC 4PRPA 4XBPB 1UQSB 3FZUC 3WL9A 1A6ZA 2VITA 2GAZA 3LIZL 3PDOA 3E6FA 2VL4A 1RZ7L 1MJ7L 2VDKH 4NRZB 4OSUH 4APQD 4G7YH 1AGBB 2VZSA 5LGHH 3SHSA 1K8IB 3KJ4C 4EVNA 1I4FA 1OHQA 2AS5M 1KACB 4X80L 2Y6SC 5FEBA 4CADB 3PGFL 5GJTH 4H1LH 4P4KB 1J0KA 1XR9A 3KJ4B 4QHMA 4WFEE 4P23B 2L7UA 2CLVA 1FNSL 2AJUH 1OF2B 4FFZL 5B38G 4XMPL 3QXAA 4K2UL 4ZMAT 5GHWL 3O2VL 5EZIL 3WMSA 4TUJB 4YHLL 4N0YL 1GHFL 1GSMA 2DLTA 3DYOA 2XWJB 1CBVH 4UBDD 4JFZL 1D5ZA 5TF0A 5KSBF 2FZ3A 1U95B 4Z7VB 3MYJA 2XQYK 5MEQA 1UB5A 1TETH 1RUPL 3QZWB 3QUMH 4NQSA 2C4FU 2NY6B 2ILLA 4P2RA 1HHHB 4JJ5B 4P9HC 5IVOA 2DJSA 1XCQB 2YN3A 4X5WB 1CXIA 2AAVA 4YLQT 3RWEB 3S37X 1IGIL 2R23B 2BSSA 3T77B 1HK6A 1NGZB 3JBG7 3MRMA 3GO1H 4V1DA 3G6JB 4O00A 4QYOA 4KJPD 1CICD 5CJOL 3B9AA 2XZCL 15C8L 4IMLA 5DJ8A 3ARBB 3ZYZA 3EDDA 3U48A 4ZSOB 3OX8A 3BEVA 4QOKB 2VUOA 4EOWL 1NH6A 2DWEA 2LABA 3NPSB 5HYQA 4JM2A 3IFLL 3NCBB 1JFQH 2H6PA 3BP7B 1A1OB 1UCBL 5C2UB 3WEXA 5EU6E 4Y0GA 4F7MA 32C2A 4ZUTB 2QV2A 3UYRH 4F3FB 4TSAL 4GKSB 4LOUC 3T77A 2EE6A 3SY0A 4L8BB 4TSAH 3D18B 3OKEB 4PGJA 1HKLH 3B5GA 4PRAA 1MEXL 2Y25A 1OTUD 1SYVA 1OTTC 4HUUA 3S6CA 5DEFB 4GQPH 3G6AB 3TT3H 1WBZA 1XT5A 1MVFA 3L1OL 2O5ZL 4YPJA 1T5WB 1I85A 3FO2A 3P9LA 5EOCH 1NBZA 1G7PB 3TNMA 4EI5B 1MWAA 2EDEA 3OKKB 4LSTH 2F54D 2HFGH 4J3VA 3QHTC 4JGMA 3UTQB 4M93C 3OGOE 2DJ4A 2DTMH 1FE8H 2LFGA 5CEZH 3HMWH 3KPRE 1UZ6E 1QQDA 4R0LA 4N0YH 3AS1A 2MFNA 2EDBA 4WEUD 2Z8WC 3STLB 4PRNA 3G9AB 1QVOA 3ARGD 2Y5EA 2ZJSL 5JPMB 2GJ6B 1YDPB 1OP3H 1X3DA 3VGGA 3A67H 1PEZA 4KZEL 1Y6KR 3CD4A 3S3JA 2GKIA 4F2MB 2Z31C 2LAAA 2NW2A 4X99A 2HVJA 4KTDL 4YBHA 1IILE 4WVRA 3D0VA 4XBGA 4YFEA 5L2JB 1DSFH 1U3HD 3VXSD 4U2YA 2H26B 4G9FA 1I8KA 1UB6A 1EAJA 1EBAA 2BVPB 5IMOB 1IC7L 1W0YT 2VSDA 3BGAA 1OCWH 1A4KB 4QRSB 2FIKA 4H88L 4CW1A 4NO2A 3DIFB 2DQJL 1MPAH 1P4BH 1KLGA 1OAYL 5DXWA 3QIWA 4JN2B 4YH6A 2Y5TB 4C83A 3LB6C 3EOBA 1EMTL 1G7HB 1FJ1A 1INQB 1FFPA 5IVNA 1FRGH 3REVA 4WI4A 5CD5C 2DF3A 1KIRB 1XF1A 4JRXB 5FHBL 2JTDA 2ADGA 1WEJH 5DVLA 3LRSB 4PRBB 1Z5LA 3O9WD 2UY6A 3RY6C 3A6CL 3QR2A 4QXWA 2XZCH 3RDTD 3ZKNC 4PLJC 2X4UA 3W0WE 3NFSL 3PXJA 1UACL 3FOMB 4OUUA 3Q5TA 4Z8FL 2LU4A 5CMAA 5I1EH 3MLVL 5HHMB 1XCTB 1II4E 3VFVA 3VMNA 2ARJA 4WUKL 1CN4A 4LSUL 5DVMA 3QUXD 5I1AA 1FORL 3EYSL 4JFXA 1LGVA 1DQTA 2IAND 3QI9B 3UTPE 5FDYA 2K7QA 4K23L 5LCVL 5GS1C 1U3ZA 4KVCL 3W9EA 3BPLB 4F7TB 4I2XA 4JFZH 3BI9X 1DLHB 5JHLH 4L8CA 2Y6SD 3ALWA 5ADOL 4HH9A 1Q9LB 1K6QL 4OSUL 3FQNA 4QHMB 2XQBL 3D39E 1R5IB 2HLAB 3B2UC 4X9BA 5TH2B 5I1CH 1X5YA 1TZHA 3TA3D 3IF1A 4NZTL 3ZTJG 1GCFA 2HT2C 4ZO9A 4QO1A 2MTPA 1F02I 4NRYB 3EO9L 1XGYH 3QFJB 2ZCHL 2R15A 5JW4Q 1CT8B 2HFEB 3OGCB 1WWCA 3MC0A 1T0MB 1ZGLP 1D5ZB 4Z7VE 3WE6A 5ALCH 5JA9A 4YDIH 1KT2B 3UP1A 2P46B 1B0RB 5DLMH 5DUML 2DIJA 5C6TH 1F8TL 1SYVB 4PLKD 5KSUB 1U8KB 1D9KA 4PJBF 2HJFB 1Y0LB 2R1WB 3TPKA 5DRWA 3H9SB 4PFEA 4XVJH 5F96H 5C0EB 1ED3A 5BZWB 1AO7A 5LWYL 5C0RH 2EH8L 1CE1L 4UAOB 3MOQA 4QRPB 4JAMA 5CIPH 3SDXA 5E9DB 1HXMB 2FATL 4Q6IA 4G9FE 15C8H 1XEDA 1QA9B 1S9XB 4TSCH 2ED7A 4GXUN 4LRIC 3RGHA 1ZHLA 5F7LB 1IGTB 4UU9A 1HH6B 1QRNB 1CK0H 1FL6A 2EIZA 1FPTH 5JMOC 2XRAH 3Q3GB 3ILQD 4AY0A 3BRFA 2B4CH 3SO5A 3QCUH 3SJVD 1FZKB 1I1FB 2IADB 2Q3ZA 2R2HB 5DRXB 4C4KT 2CK2A 5E6IB 3OKEA 2EECA 1B2WH 2BMKA 1I8KB 3D39A 4WWKA 5IHBA 1EHXA 2R69H 5F8QC 3WHXB 4G8IB 1DL7L 4BFBD 1OTUC 2EDQA 4ODVH 1TIUA 3I6LE 2X4RB 3MBXL 5HYIA 5CILL 3DO3A 3PL6D 1AE6L 1OAUH 5C0IA 3HC3H 3BHBA 1TJHL 5ID1B 2F5BH 1OPGH 4X98A 1QQDB 4QWWC 2VAAB 2IEPA 4AK1A 3KPSB 5DZOA 4Y5XB 1N3NA 4NKMA 1TCRA 3UTTE 1JZ8A 3P0GB 5C0CD 1S7UA 1T5XA 3MBED 3ARQA 3ILPA 4ZAKB 4OZIA 1PSKL 2VR5A 5ADPH 3MGTA 3HKFA 3EYVA 4M1DL 3TNNA 5IGXH 1A6AB 4HX1A 4XBGB 1JF6A 4CMMA 4D9QE 1JGLL 3PV7A 3V7AE 5DD0H 1Q9WB 4K07A 3DX6B 1JCKA 3UTSA 1KYOJ 5D7KD 1NCBH 5IB2B 2VLRB 4XB7A 3LQAC 5L2KE 5JQ6L 4X4XB 5HXMA 5JOPD 2D4FA 1F4WH 3KWWA 1TJHH 3DX6A 1HCVA 2O5XH 4ODBD 1FBIH 3PHOB 4X83A 3RQ3A 4LNRB 4OD3H 1IGCH 3QDJD 5CIPA 1CLYH 3LH2H 2J5LC 4O51A 4QTHA 3TO2A 5DMKA 4FXKA 2A77H 4D0CB 3LQZB 3FQXA 4HAGA 2VLRD 2H2SC 1U91A 4P59H 1G7MB 3ZHDA 2DJUA 4E41D 1VADA 4LKCA 1DANT 2UYLA 1RVFH 3VCLA 2BXYA 4XCYA 4WHCA 1UA6L 1UWGL 2ZOKA 3QDGE 5KZCD 5E9DA 4YEFA 1OGAE 1M6OB 3BW9A 3IDGB 2CLRA 2CIIB 1N59A 2VZUA 3KYAA 4FP8H 1E4XI 2DQIL 4KQ4L 2P5ED 3SDAB 1WWAX 4Q6IC 1CDIA 3NFNB 4N0UE 3F12B 5MERA 4PJ5E 4MAYB 4M93B 1OP5K 4XP6L 5I18H 3MQIA 3DRTA 1BIHA 1P7HL 3GMLA 2D7TL 1HHGA 5CBEA 1OAZL 5DD1H 5JDJA 4Y4HB 3X13A 2ZSWB 2VR4A 3VH8B 3VFGL 3OXSB 2DN7A 3MLVH 4PJIF 4NKDB 1TZIA 1BWWA 4HKBA 2Z91A 4D9LL 3NAAL 3O6KL 5I16B 3SPVA 4E42B 2ITCA 5IBTH 3FQNB 1XCQA 4NM4L 1TZHB 2KKQA 3I02A 5I1CL 5D9SA 5D2LF 2B1HL 3OV6A 3UROR 1BVZA 3H2WA 1P5VA 2IGFH 3ARTA 3AS2A 4KMQA 3OWEA 4U6HB 2PUQT 1OD9A 5LJYH 3O2DL 3QFJE 4R9HA 4TVPE 3FB8A 4XX1G 1LQSR 4GQ9H 4BUGA 2YMXL 4QRRB 5ISZA 3QWQB 3W9DB 2EKJA 2I24N 4L5FL 5JIHA 4DAGL 4OZHB 3ROLB 4XNYL 1G7LA 4R97C 1KIPA 5DJ2B 4EUPB 3PIQB 1TNNA 2IQAB 3GNML 3NFPB 3W0WA 4CUCA 1N5AB 2VZTA 4PJ9D 4ZFZA 3N06B 4NJAH 4GG6A 3KXFA 1VENA 5T1KB 2F74B 4OGYH 3AY4A 2L4OA 1PQZA 3CSGA 4U0RC 4J4PC 5EU7C 3SE9H 3FKUS 3MLTA 4GSDH 3V52H 3CNKA 2EXYD 4QT5B 5TGBB 4Y4HC 3WFEH 1J1XH 3EOAA 4EIZC 4WW2A 1JN6B 1IKNA 5BW7A 1BFOA 1YA5A 4M8QA 4ZYKB 4Z76B 4NKOA 4C83B 1BD2B 3PWVA 5E8PB 3LHPH 5IB5A 1FN4A 5GGSB 3SQOH 1NGXA 5LVEA 4AMKH 1CQKA 3TYGH 1UXWB 4HJ0D 3BDYL 1NCAL 1IC5H 3GO1L 4KKBC 4I4WB 4HQQL 3VG0L 2FX8L 3BD4A 2EDOA 4XPTH 3DV6A 4OGXL 3V2AR 5E4EB 2AJSL 4PGEB 2WW8A 1BGXL 3RAJL 4P3CL 1FORH 2NY2D 3EYSH 1UM6L 4J3SA 2O5YH 4L8DB 4POYA 3BEWB 4PREA 3NCJH 5CMAB 2BXZA 4AT6B 1I3UA 3QCTH 4HUUB 1L7IH 4NCC2 4POZC 1ZKAA 1XGRB 3QUXC 2WP3O 2B7DT 5GGRA 4CVXA 3WO4B 4XPHL 5C6WH 1RV6X 1BQHA 4MJIB 2Q86B 3GBNL 1QRNE 5ADOH 4S11A 5JZ7D 4QWWD 2Y06H 3BIBX 1JHTB 2J8UF 3U4AA 1MFDH 4MGXA 1X4XA 1EDQA 4BFEA 3DX7B 3I9GL 3MGOA 3WKMH 3VFWB 3BZEA 1NAML 4S1DD 5C0ND 2V2TB 3OKOB 4BELD 2XKNB 3BKMH 1F00I 2AV7B 3BP6B 3QG7L 4R0LC 4AIZB 3P77A 1ZGLB 3IU3B 3OZ9L 1A3RL 2PYEA 4NP4H 1KOAA 1T7VA 1A7PL 2PNDA 2RGSA 1QFPA 5CJXA 4FQQB 4ODUA 1QKZH 5JXED 1OAZH 2W0PA 1VFAB 4U1MB 4V1DB 3LY6A 1I7RA 4PP1D 3WKNA 3W5MA 5C7XL 3VFNB 1IKFL 2NR6C 5F1SA 2HAZA 2QLVB 4HKJA 1MCCA 1OP3K 3SDCA 4HHAB 4D9LH 4GQ9L 1AXSA 1XR8A 1P9MC 4AH2A 4PJAE 5I66A 1U93B 1G7LB 1FVDB 4HEPG 3IFNL 2BNRE 4I0CC 1YEDA 3D69A 4M1CD 2AV7A 2AP2A 3TT3L 1A1OA 4GKNB 2XG4A 1T1WB 4O58L 2FSEB 1RVFL 5F7NC 1WBYB 2APXA 4FFWC 4NCC1 3RU8L 1RJLA 1U9KA 1CGVA 2FCBA 4LGRB 3TYGL 4OZGA 1FNSH 5M7QA 1KLUA 4QXGL 3LQAH 3RNQB 3ARGB 3ULUC 1NGZA 3MRMB 3QUYC 3RA7L 5E1AB 1BD2A 4LHQB 2JCCE 4EOWH 3WFDH 4O9HH 4HW6A 3V8OA 1MHCA 2CDEA 4J6RH 1EEZB 3IXAA 1HWGB 2BCKB 2X4SA 4XCNA 1NKRA 3VXQB 4OZ4B 5I1HL 2HRPL 3GSXA 5GGUB 3T65A 4GW4B 3HR5A 4I9WE 4MX7B 3GSRA 2OR7A 1OSPL 4NN6B 5TF1H 1JYWA 1J18A 5E8EB 1S7VB 3FB5B 4FFYL 5HGBA 3ZTJH 4BSWB 4I3GA 4PBWD 1JHKH 4MXVE 4PY8I 1VGKA 3WHE1 1TITA 4HKBB 4QF1B 3PGCA 4PJ9B 2VXTL 4KPHH 4LSPL 2X9XA 4AZ8A 5MP6L 1Q9LA 3RVWC 3QCTL 5HGHB 4HV8A 1LP9E 3QDJE 3GSXB 5GGUA 3T65B 4KVNH 4QRPA 5I30L 1LVEA 1QBML 4U1NA 3IKCA 4LHUB 3BGMA 4FQXD 4DEPB 3MBEC 4Z7UF 4NM4H 4ORGA 2DKMA 3GSWA 5ACLA 2CD0A 3QPQD 4R4FL 4HJJL 4XC3H 3R06B 5T1LA 1MCHA 4NQCA 3NABL 1FDLL 5GS0C 2OL3L 3LHPL 4PP2A 4P2QB 4L4JA 4IRSD 3N1MC 1L7TH 5JDSA 2OP4H 4DUXA 4G8GB 4GG6B 1YC8A 2GCYA 4YX2L 4AM0A 4WI6A 4M9PA 1UKSA 5B8CC 2AXGA 4X7FC 4DGVH 4KHTH 4YK4C 3PP3K 3TBSB 1CZ8L 4OLXL 3F7YA 3V0WL 4WO4A 4ZUSA 1U8IA 3TC9A 1FZMB 3Q1SL 2VABB 1KB9K 2GJZB 4Y4HD 3C09C 3REVB 5I1IL 3HPLA 3BP4A 5F7EH 1FO0H 1BJ8A 5E7BA 2VIRB 2X1PA 2GTWB 1K4CA 5DD5L 5T3ZH 1TXKA 4UI2A 3PHQA 4O2EA 4MDIB 3HMXL 2JJTA 4XCYB 3EDFA 1CE6A 4ZTOL 3WNMA 2B39A 1KTDB 2RB8A 3MXVH 3WN5B 4M6NH 1OLZA 2YD4A 1U3JA 4WTZG 4XAWH 4OLEA 3CLEL 2ZKHL 3OX8B 4Z95L 2F19H 4J1UB 4TSCL 3UTOA 1IC1A 1TPXC 5FKAA 3PDOB 3CXHJ 3CLEH 3PABB 1G9NL 2H8PB 4JZJC 3IDNB 1W0VA 3ZDZE 1CLYL 1DBJL 3A0OA 3LH2L 1N26A 1U0QA 5AWNH 3GZKA 1XIWC 4GSDL 3AAZA 1FO0L 1MFCL 4KRPD 3UZEA 2H9GB 5B3JE 4CN6A 4LFHG 3WLWC 3C60C 1NGYA 4G7VH 4W6XB 4HFWB 2VOTA 5ACZB 1BMGA 2GT9B 1PZUB 3S98A 1NUGA 3LKPB 1I8MB 5ENWA 1BFVL 5D1ZD 3TIDB 4X9HA 2FLBT 3IAPA 2CKBL 1CD1B 5D7JB 1MFBL 1PG7W 3EYVB 4HT1L 3VD7A 1MFNA 1S78C 3P0VL 1WFTA 3EYQD 3HC0B 1IGJA 4YEEA 2FL5A 2C7UB 3ECBB 4NWUL 3FONA 2LQRA 4JY4B 4NUJA 1D5MA 3Q5OA 1L9NA 5F1OB 1TZGL 4GOSA 4L4VB 3OKMB 1LP9A 1KFAH 5CP7B 3K8MA 2P7TA 4YDIL 3TP4A 3X14A 1T1XA 1UXSB 4X7TB 1IEAA 2VDNH 4CJ1A 4KJWD 1VHPA 2DS4A 1ZWIB 2DWDA 3KPNB 4LCCA 2Z92B 4G7VL 5F70A 1ZT7A 1K4DA 2C4FT 4K3HA 4YXHH 3KYMA 1KN2L 5DMIH 1IAKA 5EBMA 3V4VL 3FTGA 5KOMC 1KCUL 1LO2H 2SEBB 2XZQL 4PTTA 5L0QC 3SKJH 5E6IA 5DMGD 4WU5A 1K6QH 5FB8A 2EDLA 5KS9F 3DX9B 5I71B 5DA0B 4F7CB 4NN5C 1KJVB 4PJ8A 5E8OA 3CFJA 2DM4A 1PDKA 1HXMA 3VD9A 1GGUA 3CH8A 2OK0H 1FGVL 1IE5A 3HNVL 1KJ2H 1JZ6A 3HLAA 3BQUC 5C0AD 5C1MB 3KPQA 5JO5A 1DBJH 4Q9BA 5KS9A 5H2BA 1NC2D 4DEPC 1U8OA 1E6OL 3FFCB 5CGYC 3NGBB 4OUOA 4ODWB 2AV1A 2F8XC 3BUTA 4NQVB 2V9TA 2VH5L 2Y23A 4RWHA 12E8L 5BJTB 1DQJB 2Z4QB 3ZTNL 3ZLQC 3QJFA 5C0DB 4YDLB 2A0LD 3FQTA 4POZD 3BX7C 1JHLH 3JTTB 5L88H 5KAQF 2ZUXA 3C8DA 1P1ZB 3T3PF 5HDOA 4ZFGL 1L9MA 2VDPL 3HMXH 1IM9A 3EKCA 3K3QA 1C16A 4BFIB 3V9FA 1W8OA 2I5YH 3LRGA 3JTTA 3KPQB 3QHZL 5MEOA 4LLWA 4MDIA 3OR6A 5ABDE 3EO9H 1QBLH 1YQ2A 3L95A 3SEPA 1JGUH 3L3HA 2OTUB 2GI7A 2ESVB 1YEIL 3X3GL 5ITFB 3GRWA 5HI5D 3AC0A 4IMKC 1NBYB 5IB1A 2NY0D 3BGFB 3ESUF 3F7VA 2OTUA 1F3DH 1OGAA 4FQPA 4UINL 4IOSD 5IF0B 2MCPL 4I5BB 4U3XA 4P3DA 3G04A 4G9DA 4KRLB 2VZOA 5IB4B 1N4XL 3JUYA 3H8NA 4IRSC 5F72S 5TF1L 4HZLA 2OP4L 3AXLB 2NXZD 4AQOA 1D5IH 4YHPB 5BMFL 3QI9A 1F4XL 4Q9CA 1ZLWH 1MJUH 4KHTL 2J8UA 3MXWL 3DTXB 5KVGH 4MS8C 4J2XA 4RFNB 4KFZC 4KK5C 3U46B 1XF4A 3MMEB 5FO8A 5ERWA 1LO0L 1M1SA 4MMZC 4ZS6D 5FUCC 3AVEA 1NBYA 1NSNL 1OTSC 2F58L 2AK1L 3QI9D 4LVHC 4XH2B 3RU8H 3MRQB 5B38B 1UM4H 4OD2A 3C2SA 4JDTL 1P7QB 4Y5YC 5IQ7L 3MV8D 3CU7A 3O8XB 5DJXA 4C55A 2D3VA 5CEZD 3RP1A 5TPWH 3MLYL 1I3VA 1XMWA 1TVHB 4OCRL 2HYMA 1HI6B 3FO0L 5E00B 5F88B 3QUYA 4N8CH 1ETZA 4PJAB 4N5ED 4MA1B 5IVXE 4H26B 1VGEL 4Y8AA 1T89A 4O51B 5SX4I 3OHXB 2F8VA 1T21A 1MQ8A 4ODHL 3CXHK 4G6AD 1MEXH 1H3VA 2VDQH 2P43B 3V5HA 4TN9A 1A6WL 3R8QA 3LEYL 3GB7A 1LDPL 3TEUA 2F54A 5E94B 1UH3A 5EO9A 5I1JH 4N0RA 5GISL 3CU1A 4DFIA 1J5OH 4HKZA 2G60L 5T1DH 3BRGC 4GG6E 2PW1B 4JLRA 5FYLH 1A02N 4IIQC 4MVBD 3VI3F 3VXSB 4JVPA 4GAJL 4JHBA 3EZ8A 3DRQB 1VEPA 3FT2A 1W72B 2I60H 5EU4B 2VXQL 2QKIB 4XPFH 5HDLA 4DKDC 4DQOH 3KPSA 3UJJH 4NBZB 1N2RA 3VRIA 3ZYOA 2FL5B 3MFGB 2ICWJ 4HS6B 4GLRH 1CG9B 3BWAA 3P9WB 2QKIA 5HHOB 2X4OB 4AEHL 4YDKL 4ZUWA 4QEGA 1JGUL 1M05B 1EV2E 4AEHH 5HHOA 4LLVB 4I1NB 3LZFL 2GSGB 3P2TA 2QQNL 4BA8A 1KSRA 1MRFH 5ETUB 1A14L 1IGML 5AYUL 2XTJC 3U0WL 2F74A 3ZHLA 4DOHB 1D6VL 1V7NH 4HD9A 3CIQA 4X6FA 5GHWH 4XPHH 2WK2A 1T20A 4OB5H 4EUPA 3WS3B 3ZE2E 2XG5A 2BZDA 2FYYB 2GFBA 5D7IF 4K94C 4IRJA 3ULUH 1A21A 1ZTXH 3QO0A 5HPMB 4YHKH 3OXRA 1HH6A 1QRNA 3WKML 5AEAA 3IFLH 5HGDA 1WISA 1UXWA 2FECL 3T3ME 43CAB 1JNJA 3K74B 2Q8BL 3THML 3NACL 3PP4L 5EO0A 2J6EA 4ODHH 1CE6B 5GQBA 3SE4C 2DQCL 2Q86A 3UDWA 3JWOH 4F33B 5EOCJ 4DCQA 4X7SL 2HTKD 1S8DA 4L5FH 5DJYB 1BHGA 1MI5B 2VL5B 2X4NA 1F45A 2JLLA 4LDOB 1Q0XL 3GMQA 4JKKA 3DMMD 5CAYB 4N8CL 4WW2B 5F9JA 3TN0D 5TQ0H 4OCXH 4WO4D 5FYKH 5EULV 4LARL 4YNYB 3T0AA 1ACYH 1IAOB 1YPZA 3QYCA 2HTLC 4XCEA 1DBBL 3ROOA 1GIGL 2ZG3A 3MFFA 1U8HB 3C9NB 3FQWA 4LIQH 1T4KA 3NZHH 3QQ4A 1WAAE 4ZODA 5FYJD 2PW2A 4MQXC 3RL1A 4YHOH 2LU7A 1PKQA 1ZHNA 4D0DB 3DI2B 5IEKB 1NANH 5JPNA 1B0GB 3QFDB 2GW5A 2CLRB 4G5ZL 3FHQA 3MBEA 4HZLB 2P1YA 2MSPA 4U6HA 3D2UA 4P23D 2Y36H 1FL3A 4LLMB 2KQNA 5FUOH 1K8IA 3OAYH 2ARWA 3GMLB 3FO1A 1JGDB 3MRCA 5JOPE 4WW1B 2HG5B 3P4NA 5TDPB 1OOAA 3KLDA 4JFDA 2J3SA 3LMJL 4X6BB 4ZS6C 3HC4L 1FVCB 4PUBL 3TH3T 4ZOEA 2P8LB 4WDIB 3DMMA 4ZQKB 5FA3B 5ICXA 4YJZL 3OG4B 5DRZB 2F5BL 2IBZX 1CGSH 1UJ3B 1LILA 4JDTH 4K9EC 1T03L 5GZND 1V7ML 1SVZA 3LS5L 1K3IA 4M4PA 2HP4A 4PR5A 1IGFL 4UMGA 4HKJB 3D87B 1AFVH 3E6HB 4IRJC 2FJFB 4PJ8B 5E8OB 1GJIA 5EC1B 1RZGA 2G5RA 3BH8B 1NBVL 4XP9H 5BRZB 4HGKC 4LLDB 3STZA 4C56A 1ES0B 1WAAA 1MCSA 1XF3A 4NC1E 1SEBA 5D1XA 4HV8B 5E8EA 1T2JA 4KZDL 3UTZB 3SDDB 3ARRA 4PS4L 4JRYA 3WD5L 2EH7L 3ZZ1A 4U2ZA 3D85D 2AEIT 2D03H 1FZJA 3D2UD 1EH9A 4WWKC 1CZ8H 1WBZB 4XNZC 1DQJA 3WDHA 5CZXC 1ZWIA 2DWDB 4PRPB 2IH3B 4P2OC 4ZXBA 2QL1A 3UPRA 1BM3H 4WFED 2BHZA 4GMTL 1K9TA 4KH2A 4NNXA 4TRPH 1OW0A 1UEYA 1GRWA 2IF7A 2DQHL 5DUBA 1KCSL 2DLEA 3GHBH 5GGQH 1X4ZA 3UC0H 4MSWB 5LBSH 4XCNB 2AJ3B 4KK8C 2P8MA 1IEBB 4F3FA 43CAA 1MUJB 3CDGA 4PJCF 2WQRA 3VI3E 1NGXB 5ESQB 2R2BB 1S9KC 3TO4D 1A1NB 3CPLB 5JUEL 4M6NL 3HE7D 4HSQA 3VFWA 4N9OB 1N7MH 2FX9L 4OLWL 2EIEA 3HTLX 3EIFA 4PS4H 3PWPD 4PJCB 1UWEH 2IH1B 1O7SA 4LSVH 5DZNA 5EO1B 4OKVB 1HYSC 4LLYA 3IDJA 4KGJA 4H8WL 3LSOA 1R3LA 2VZVA 3C60A 4X6FB 1YY9D 2YKLL 2EDNA 3KXFB 1BM3L 1ZT7B 1OPGL 1R3LB 2NY7H 1IBGL 3SDDD 3CVHH 1VFUA 1FZOA 1E28A 3BESR 4NZDA 3RUGB 1PGRB 1JMZA 3BZFA 2R56H 1CFNB 1U8NB 1RZKC 4NDMB 4GAFB 1WBXA 3BDBA 5ADPL 5JPMA 3ZSSA 1JWSA 2NTFA 4GAYB 4HMCA 4MDJB 5FA3A 2XT1B 3CFKB 2V17L 5BVJA 1RFDL 1WTLA 2R4RL 1I8IA 5KSBE 3FL7A 2ENYA 1E27A 3JV0A 3PGDA 5JIKA 2KL6A 1KPUA 2MHAA 4LASL 4I0KA 1QFWL 3S37L 5F1IA 5E2TL 5D7LE 2GTWA 3UJTH 1H3WM 2WV3A 5C2BH 2YPLB 3GUTB 3RJQB 1M7XA 1FDLH 5I8EB 4E41E 3NFSH 3T3MF 4F58L 1KB5L 1I85C 4M8VA 5ENWB 4XXDA 5BS0E 3GMNB 4AT6A 3QCVL 5I2IA 4JFHD 3SGEH 3UTPD 1G6VK 1UB5B 5T3XH 3P4OB 1CFBA 2CKBA 4JREB 3ARWA 4LGPB 3QDMB 3B9KB 3F7PC 1UGNA 2BNRD 3RWJA 1W0VB 4UV7L 2JIXA 3L9RA 2APFA 4PB9H 3G5VA 4LKXA 1XF4B 3MMEA 4Z7NE 5I1AB 1BJ1J 4G8EB 4U6XB 2DI9A 1MFAH 1BQLH 2AI0H 5AZ2L 2MPAH 4M5ZL 1RJYA 2OTWB 1MCOL 1KELH 4Q97A 1NEZG 3QIUC 1MHHB 4M1DH 2P5EA 4ZFFB 2PYFA 4D8PA 2YWYA 4Z7WF 3OJ2C 3KYNB 1JIBA 5DQJA 5FA4A 4GRMA 1FL3B 3O8XA 2NY3D 2NY4D 3MV7D 4TQEH 4LLDA 5CSBA 5HYFA 3FT4A 5HVHC 4JO1L 4TNVF 2C3VB 2CXGA 5TH2A 2BSRA 2R0ZL 4Y4KB 2X41A 1U36A 1I9EA 3D3VB 1KENH 2QR0B 3C8KA 1DDHB 1EEYB 4AENA 3WUZA 4ODTH 1ZA3B 3BAEL 1BZ9B 2OTWA 3PDDA 2JJWA 3I6GB 1N8ZA 3HI6H 2R4SL 2ICWA 3U46A 4BSWA 4DKAA 1FE8L 5ESVB 1KC5H 4LSRH 3S34L 3JV4B 1B90A 4M02A 1DE4B 3R0MA 3DMMB 4KI5F 4ZTPL 4GW5A 4BZ1H 1FQ9C 3UBXI 3SE3A 4JHWH 1EAPB 5IMOA 3JV4A 1B88A 1WITA 1AKJB 2O93L 1EXUA 4FTVA 3RZCD 5BV7L 2AV1B 3L3IA 5A2LH 5TDNA 1NLDL 4XHJC 2CGRL 2PF6A 5IQ9A 4NQED 5C8JA 3QAZC 2YBRA 2OR9H 3MRPB 5SWQA 4E42A 4PJHE 1FNGA 4UQ3B 4XPGL 5HHQB 3VWKB 1N6UA 3STLA 3SGJC 4WEBL 1FNLA 3VXUB 1UM4L 1N2RB 3QJHA 5DR5L 1AC0A 3QQ3B 1R3JB 1T3FB 4X98B 3AREA 2WIMA 4LCWE 2WBJB 1U3HA 2HTKC 5I8EA 4FQHB 1FRGL 2FJGA 1F4YL 2BOCA 4QF1A 3CVHB 3K4ZA 3MXWH 1HXYB 3U36B 3AUVA 4XVUC 1FVEA 5CEZE 2NYYC 2X1XR 1QPPA 3LB6D 4OT1H 1NCCH 2DDQL 2J2ZA 5D2NA 1KF9B 5HYEA 4PTUB 1LDSA 1UADC 5DUBB 4LQFH 3ULVC 5IBUB 3VXSA 3OB0H 4OT1L 2BC4A 1NQBA 3VFSB 2JF1A 1BAFH 4EN3A 3TVMA 2H32B 1NL0H 4MJ5B 3RBSA 2ENSA 2VKWA 3TCLA 2XPGA 3N0PB 4I9WD 1HIML 3UAJC 4EI6A 4HWUA 5C07B 3HHRB 5SWSB 3VWKD 1P4BL 2D9QB 2EYTB 5F44A 2V2TA 4TTDD 3QG6B 3RDTA 4JM2F 1MHEA 1MLBA 5EZIH 1IAIL 5EBWA 1SBBA 3BT2H 5FV1L 1YY8A 1JGEB 1IGJB 4KROC 4I18A 1RZFL 1NMCC 3QG6A 5KSBB 1NCWH 2HRPH 1NFKA 5KAQG 3RWHA 3CUPA 3T2NH 4U1SB 4X0KB 1OAXL 1V8HA 1MCDA 1U8NA 1C5DB 5DVKA 1IC7H 3LDBB 2QHRL 2DMBA 5GISH 4NO0B 4QOKE 1MFDL 1SJEB 1M7IA 4X7CC 5TQ2L 1C5CH 3K46A 4N5UA 1A9EA 3QNYB 4A2LA 2J8UB 3V0VB 5CS7A 2R29H 3TA3C 4P57A 2BSTB 1YY8B 4Z7VF 2NX5D 2W60B 4U1HA 5CEZL 3MCLL 4R26H 1QLRA 4YBQD 3WSQH 2GY7B 5KSAC 2BSSB 3VGHA 2AXFB 4CAGA 4JG0H 1MELA 3BT2L 2XNAA 3T0DA 1R0AH 5GGTH 4ODTL 4BSVA 2OCFD 1CXLA 1RIVL 4MZ3A 3V5DA 3MNZB 4BSJA 3LKNA 1X7QA 5BV7H 4LP5A 3VU2A 3WFEL 4QNPE 4KV5F 4RCAA 4ZSOA 4HWBA 5AD0B 2FR4B 5MI0B 3LEVH 1TTFA 1KCKA 2BVTA 4ZPVA 4PLKC 1JHLL 2R2EB 4C56B 4BZ1L 3DRQA 3FT2B 4JFEA 4JRYD 3AAZB 3KPMA 4HWZA 4IRSA 3ME0A 4PJHA 1UYWH 3VXRA 2BNRB 1D9KB 3BD5A 2PO6D 4TTGA 3ZE0E 3B9KD 4RA3A 3WFHA 3BDXA 1RJYB 2X1QA 3U6RB 1KENL 4LNVA 4L8CB 5T1DL 2Y72A 3GK8L 1A4JB 25C8L 1ETZB 3C6LA 4XMLH 3HE6D 3GBMH 1UCBH 1F5WA 1P53A 2PXYB 3LEXA 4RFEA 4TSBH 2NY0B 4CADA 1TJIH 3KLHC 5JR1L 3NZ8A 4WIQA 3PDGA 3RTQB 2BVUA 3QRGH 4LQFL 5IGXL 4DQOL 5JMRA 5IESL 1AO7D 3G6JA 4QYOB 1N0XH 5SWZD 2FLRT 4MNGB 5I8KL 1RZ7H 5D9SB 1EA9C 1Y18B 3KPRB 3PQYA 3V95A 2DYPA 5EZLA 2QR0A 1EFXB 1BBJB 4L4VE 4YBLC 4Y8DC 5CFHA 3EOAB 1AQDB 5F7YC 3SGKC 5D96C 2AJXL 4MNGA 4CJ0A 4P5TB 3JVGC 4IHOB 4G6FD 1OWWA 1QTYT 2RIKA 2X09A 4XRCA 1X6NA 1T83A 4WW2C 1MQKH 4NT6A 1OWRM 4OZGE 5GS1A 4L29B 2APTA 4TUKL 3GMPB 2XYCA 3BAEH 4KGLA 1I1CA 2QSCL 4R4NC 2A6KB 1NC2B 4L3EA 4WUUE 5DK2B 1R5WA 4Y4FD 4MQ7B 4MD5B 4N0UA 3S34H 3WS6C 5C08D 4KI5E 3UYRL 3RIFK 3CX5K 3GMRA 1VACA 2KZ1B 1QFWH 4YHZH 3X17A 1GGCL 1KBGH 3TO4B 1BREA 1N5YL 3T0EE 1KCLA 3B6SA 4OV5A 1KJMA 1FPTL 1EEZA 4ZFOL 5MEPB 1MREH 3GSVA 2HA1A 3SBWA 5JOFB 4LVOB 4HIXL 5F9OH 2DOCA 2XZAH 4L8SC 4PRNB 2YZ1A 4QRTB 5ECJE 4X4YB 3QWRA 4I3SH 1CFVH 1A6ZB 4GG8A 3QEGL 4GW1A 1QSEB 2F5AL 5IB3B 2FIKB 3OAYK 3LPFA 1ZV5A 4QXUL 3VXNB 3QUML 2JIXD 5F96L 3PG2A 2YR3A 3RGVD 2BRQA 5SX5H 4BH7B 4ELME 1NMCB 1SJHB 4JFDE 2FX7L 2DL9A 3VW3L 2PR4L 4K7PX 1VDGA 4NZUH 4X4ZA 5F89A 3T4YB 5ISZE 1G7QA 4MJ5A 1FL5B 1T03H 4HKZB 1F3JA 1V3LA 3CZFB 2VDMH 2Z31A 5J6GA 1LD9A 4U4BA 4CU8A 5BRZD 3SDCB 4KUZH 3ZT5A 3RVUD 4PGEA 2IAMD 4Z95H 3QUZB 4HAFA 4JN2A 4NRXB 1EVTC 3KS0J 4HMDA 4MLIA 3PWNB 1TMCB 1T1ZA 4MWFB 3AMLA 2EXWD 2Q8AL 2DQHH 4PJCA 3D3VE 4TNWK 5F93C 1MLCB 3TT1L 4DK3A 3CFDA 2WWMD 4XCEB 4UDUA 4M1GL 3RWEA 1OGAD 5F71A 4OLXH 4YHIB 2BP3A 5I1GH 5EU6A 1DL7H 1W72H 1VFMA 2M26A 3MV8E 1FZOB 3U6RA 1PSKH 4MHHG 4O4YL 3G6AA 4MCYB 1WF5A 3DIFA 3V6FB 2O61A 1J7VR 2CDFA 5FGSA 3FN3A 4AEIH 3M1BA 3TJEL 3HRPA 2A83B 4X8XA 2ITDA 3W0WB 2CDFB 4Y19E 2VXSH 3DYPA 3KPPB 3VDBA 1VCAA 4ESKA 5T3XE 4NQDA 4PJEB 3VFTA 1NMBL 1DCLA 5KSAD 3W0WD 5I1EL 5IWLC 2YD2A 4P46C 4G6JH 4XAWL 4XHJD 4JREC 2IPUK 4PD4J 2N1KA 1R6VA 4ACPA 3GRWL 1KFAL 2QHLA 4PG2C 4QCIB 4B7LA 5F7DA 1VSCA 1SEQH 4J4PA 4XP9L 4HCRL 4OV5B 2VISA 4PGCA 2DQFB 5E8DL 1ZT1B 2YPVL 4XGZA 3DXAE 4I0PA 1YEFH 4KV5E 2Q87A 5DJ6A 4R7NA 3VMPA 2YRLA 3HZYB 5KSUA 4HK3N 2IH3A 3D1MC 2HKHH 3QXTA 2EH7H 4NZTH 3RIAF 1A7BA 32C2B 2BNQD 3VFMB 2RFXA 2DIAA 3TN0B 2YD5A 3VFPA 4UZGA 5GIRA 1G0DA 4Z7OF 1ZSDB 3WIIH 5F1KC 3LEXB 4RFEB 2C1PA 1JPST 4JPVH 2PYFB 4D8PB 3GMRB 2P4AB 5ACMA 5DRWB 2NY1B 1MRDH 2R1YA 1EEQA 2CK0L 4PJ9A 2NNAB 3LKQB 4URTB 5SWSE 3BH9B 2EICA 5EIQA 3FT3A 1Z9SA 1HSAB 5B22A 5C6TL 4U33A 3ARDD 3MNWB 1KEMH 2JJTC 4MXQC 4R8WL 2P8PA 4ONFH 2VQ1B 3RIFF 5C8JB 3EW3B 4R4FH 5EZLB 2N56A 3JWNC 3DVGA 1IRAY 4DCQB 1HZHL 1XR9B 4OI7A 4R90H 3RVTD 5JHDB 2FB4H 1HNGA 2GQHA 2NXYD 4BZ2H 5KG9B 2HVKA 2OSLB 5IROA 2J1KA 4JFFD 4PJDE 3NN8B 2L0DA 1P2CB 5IF0A 1XIWB 1F3RB 4XZUB 5DEZA 3HI5H 1WIUA 1PW3A 1IM9D 4KMTH 2UWEB 5E1HB 3W11C 2VXTH 4JANB 4DGIL 4ONHB 4JKMA 3EOYG 2P49B 1K5NB 5DVNA 1H5BA 5F3HA 3O3EA 3M07A 5TDPA 4H88H 5F9WC 5HI4D 1AXSB 4N0CC 1D7FA 3FQWB 1QKZL 5F7EL 3BYYA 4MAYC 4L3CA 5FM8A 5SX4H 4PJBA 2E7HA 3H7LA 3SDXF 2X4TB 4QHUB 4N90D 1KG0A 3L3OA 4LPCA 4GKNA 1HSBB 3W39B 2X4PB 3NN8A 2AGJL 3U2SB 1WCBB 3E0GA 4XZUA 1O7VA 1RIVH 4YBQC 4K23H 2V5RA 5E5UB 3WFDL 4DVBA 5IVXB 3HZVB 4X6DA 4BK5A 1H5BC 4XXDB 3H0TA 4KHXH 1FFQA 5EOTA 2ESVA 1BX2B 2RR3A 3MNZA 1KCRH 5IVXA 4Q6YA 4X7EC 1HYRC 1M7DA 1J8HB 3TH4T 1JTTA 4P5TD 3QIWD 1UQSA 1I8LA 3TJHD 5JXAL 2C1OA 3BD3A 4NO3A 3MA7A 3TZVC 1T0PB 4DZ8B 4FXGA 3C6SB 4PJ5B 1NBQA 1SVCP 3QIUA 3VFUB 1X5JA 4LCYB 2VSCA 4KPHL 1KPRA 2E7BA 4R6UA 5DMKB 4H0IA 2JB5H 2IG2L 3L3GA 3E2HB 3ZYJA 25C8H 1NC4A 2ERJB 2J6EH 4XMLL 4OB5L 4OGXH 3LN9A 4LCIL 1IAIM 1A3QA 2DQTL 1G84A 4NQCE 4S0TD 1IKFH 3OR7B 5H35B 4MD0B 4D9QD 3MCG1 4P3CH 2YEZA 3HE6C 1Q8MA 1YN7B 3B5HA 2EEBA 2ZNXA 3ARUA 3ARYA 2DI8A 2FEEL 5CJQH 5GS2H 3S7GA 4X6CE 1GAFH 4ZAKC 2OMNA 4RFOH 2ZCLH 1RUAH 4UTAL 1LK3L 3UTQA 1DBKH 4OD1L 3PP4H 4UIMB 1F4AA 3FB7B 4LOUD 2FO1A 5CP7A 5I1KH 1MCLA 5H37G 4Z5RA 1F6LL 3OKDB 3WXVH 4QGTA 3DX9A 2D7QA 4AH2B 2E7LA 2NZ9C 1Q9OB 4KAQL 4DOHE 3VJ6B 2BVEA 4M61B 3VFOA 5IWLA 3KPLB 3BO8B 1IAKB 3VXMB 4XXCA 5FYKD 5BZWA 1FIEA 1TPXB 3GBML 4IBLT 3WLBA 5D5MF 5D7IB 3GHEH 4ZFOB 4CVZB 1HNFA 2NLJB 3IJHB 5TDNB 1ZXQA 4X5LA 3NPSC 1S9WA 1NL0L 4Y4FC 2BVYA 3NIFF 2E9BA 5K9JL 1SM3H 4YDVB 4G6MH 4NKQB 3LQMA 4IS6A 4W4NA 3RVVD 3LQAL 3MRIB 3FFDB 4TQEL 2RHEA 1BD2D 3UMTA 2VLKA 4M61A 4NO0D 3VFOB 5K9OA 1QG3A 1CL7I 1RK1B 5GRVL 5GJSL 3WNLA 5DC0A 4Y5VC 5IW1B 4OIIH 4ZDHA 2A77L 4CDHA 1PFCA 4W6YB 5EA0H 4K2UH 5IFJB 4GRWE 1IGYB 2CMRL 2OZ4A 5T1KD 4Z7QF 3RVXC 1J1XL 3DUUB 1TQCC 5I74B 4FQIL 3BJ91 3P73B 1WFNA 3SE9L 3V52L 1A1MB 3O3BB 1FC1A 1S5IL 1RZKH 3L3KA 4S1SH 3LV3A 35C8H 1DEEA 5I17B 2I25N 3O6LL 1D5XB 4HIJA 5KVMC 1WT5C 2XWTA 2Y06L 3T1FA 2G75A 2PXYC 2WINB 1FAIL 5ALBL 4K8RH 3DECA 3WEXB 3MLZL 5CJ8A 2VQUA 5C0AB 5ID0B 5FYJE 3MJGX 4OQTL 2XXCB 2VWEC 4M7ZC 4OAWA 2J6EL 3EJYC 1J87A 1QZ1A 3MRFB 2WQ8A 1CL7H 4XHQA 3J7HA 3O41B 5A2IH 3HPJA 3DGCR 1DQDH 3MLUL 1E4KA 4R90L 1CVRA 5JW4M 4L3ED 1FFRA 5JNYB 5ITFA 1NGWB 1DTUA 4HPOL 5CILH 3OMZA 3H6JA 5IBTL 3SCMB 4KKAD 3VXUD 5I75C 2IBGA 2DQTH 5CLWA 4ALAL 3C60D 2J4WL 1H5BB 2ZZUT 4QTHB 2HG5A 3VXOB 2X89A 4WJ5A 2OX5A 5E2WH 4ONOA 3L3OB 5A3ID 4Y2DD 1TNMA 4MAYD 4KMTL 5I0ZA 2DYPD 5K9KA 5LGJA 1FVCA 2DIBA 4WJ5B 1J88A 2P5EB 3SDAD 4ZFFA 5L9DL 3QSKB 4P59L 2A6JA 2EDRA 4H25B 1AKJD 4LL9A 5GS0H 5IMMB