2IGFH

Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
221
structure length
221
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFTFSRCAMSWVRQTPEKRLEWVAGISSGGSYTFYPDTVKGRFIISRNNARNTLSLQMSSLRSEDTAIYYCTRYSSDPFYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 A.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA B13I2 FAB (LIGHT CHAIN)
total genus 41
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1991-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfH01
3BKCL 2P49B 3ELAT 1DQJA 1TJHH 4NC2B 2NTFB 1KSRA 5A2JH 1XGYH 4P3CH 3NZ8B 3O0RH 4GS7B 2YWYA 4OQTL 1J88A 2KQMA 3CUPA 4GW1A 3NFSH 3VFMA 2AK4E 4HJ0D 5SWQA 5BO1H 2B39A 3VXMA 3DX7A 5ID1A 2VXVH 4F2MB 5L88L 1FNEB 2X9XA 3G5XA 4PRBA 5TDPB 3NN8A 1WFTA 5L6YL 3X17A 1URLA 1RZ8B 3CC5B 5DJ6B 3MC0A 2FYYB 2X44D 5L6YH 2RAMA 4FQQB 1QHOA 3S5LA 3H9YA 4PJ9D 4HS6B 1Q0YL 5EOQH 4XI5C 3VFGL 3HNTL 4G7VL 5CIPH 1MCOL 4DVRH 3MTRA 1SEQH 4GG6E 3VFGH 3MNVB 1BOYA 4AIOA 1R3LA 2XTLA 2C1PB 3C8KB 1NGZA 3PGFH 1S7TA 5CCKH 1S8DB 1NCAL 3L5IA 3QO0B 4NFCA 4TUOA 4RBPH 3KYAA 3F12B 3GSNB 4HUMB 5DEZA 1GJIA 3BZDA 5JW3L 4IRSA 4P3DB 4Y4FC 1DQLH 2XTJB 1KG0B 1T6WA 5HHXH 3WFEH 1ZSDB 4JFOB 4N9GB 1AO7A 2HTKD 5DUBB 5HHMD 1GOFA 5F1KC 4JDTL 4MQXC 3RL2A 4PG2C 3CFBA 3CVHH 5J9PA 2NR6D 1I1AA 3RA7H 2Z31B 3QCTH 1AFVH 2IQAB 1JRHI 2HYMA 3MRJA 4U6HA 1NCTA 3PQYE 2Q3AA 3KLDA 3QFJB 4XMKH 1WWWX 2R29L 3Q48A 5C0EA 3O41A 2EICA 2HJKA 5HHQA 1DFBL 2X4SB 4PGDA 2I07B 5T5NF 3MRFB 1NGYB 5TE7L 4U2ZA 3IF1B 5GZOC 4RMRA 3DUUA 2QQKL 2RGSA 1AGBA 3TWCH 4D9LL 2DLIA 4LHUG 3CSYB 2AP2A 1LEKB 5CEXB 4LCUA 3GI8L 4J1UB 1A3LH 2UVEA 4YFLF 5I15L 1NEUA 3MQIA 1G9MH 4YGVA 2YD4A 4GRLC 2AJXL 2BCKA 1RK0B 4ZUTB 4HKJA 4MNGB 3ME0A 2BVYA 3EO9L 3GJFA 4DN4L 3DV4A 3MREA 4P23D 1J8HE 5E2WL 1ZHLB 2QR0A 1A7QL 4FABL 1MEXH 3NPSB 4MZ3A 4Z7VB 4IRJB 1XIWC 3UTPD 1UJ3A 3BMWA 1JTOA 4X5XA 1KJVA 4XC1H 2P43B 3DV6B 1YYMH 4HJJL 1N0LA 4X9HA 2O26U 1C1EH 1UA6L 3UJJH 1JZ3A 4PP2B 8CGTA 2VQ1A 4HK0A 1YPZE 3STLB 1CGYA 4ZFOA 4H1LA 4AENA 3SE8L 1VENA 3P77A 1JHKH 2LFGA 5E8EA 4H88H 4YHML 1MCHA 2X4RA 3LHPL 4QHMB 4NJAH 4JHZA 4X9BA 5GS0L 3V5HA 5B4MC 1Z2KA 2BC4B 3MRMA 4W6YB 4KJWC 1CFBA 2DLFL 3P4MA 3T4YA 4N8VB 3MLXH 2YUWA 4Q6YA 1FYTA 4IRJC 2VYRE 1G6VK 4BFGA 3JTTB 4GG8A 2FBJL 1Q1JH 1A1NA 3C09C 1BIIA 2R15A 5J6HA 4UI2A 1BQHG 1M7DB 4ODXB 1A6ZB 1UXWB 4XWOC 1SJEB 2CK0H 3EOTL 3OKDB 1NFDE 3RY6C 3TV3H 3GKWH 2CK0L 5F9OL 4JAMB 2UYLA 3M1BB 1YPZB 4P46D 4EVNB 4IMKA 2OR9L 3GNMH 4NN7C 1WICA 2FL5A 1KXQE 2ZCLH 2OK0L 1JGUH 1EGJL 4Z7WA 3LQMA 5EU7E 1IE5A 3ALPA 1MHHB 1MJ8L 2XY1A 5EUOA 5FO7B 4YHPA 4LIQL 2FZ3B 4LAQH 3MLZH 3TVMB 5D93C 1F4YL 3TCLA 1B4RA 1RIHL 1Q9KA 4P0DA 2XN9D 2X1WL 1PLGL 5JXAH 5CEZL 4YDKH 5LQBH 1I1RA 4KHXH 5F7FA 2OP4L 2W60A 2WBKA 5CGMA 4YFDB 3G5VA 1Q9WB 1GIGL 1U95B 3PWLA 5E00B 1ZTXL 4DKEH 1EEYB 3D85B 1FJ1A 3DVGA 4U1NB 3VXUB 5F3BB 1AE6H 4YJZL 5D1ZA 1IEHA 2NY6B 2DIAA 2VLJA 3E6HB 1DL7L 4PJDE 2D7NA 3F58H 3GKZA 3DETD 4YBLC 4X4XB 4X6CB 1FN4B 3BQUA 1ZHKB 4MXWH 4PJ5D 5BO1L 2H6PA 3QRGL 5T3XE 3VXSA 5JZ7C 5I1KL 5J06A 3VW3H 3MV9E 3O2VH 1FRGH 1H9VA 4PP1D 2Z91B 1JGDA 1J7VR 1I9EA 4J3TA 3WSQL 1JWSB 4N0CC 1MELA 4LASL 2E9IA 1DUYA 5AD0B 2PYEE 1SMAA 3FO2B 1ZEAL 3TJHC 4G42B 2DDQL 4BSVA 3HE6B 3TP4A 3EAKA 2VAAB 3CFJA 2J6EL 1ZEAH 3VG0H 3VFTB 3RIAK 5DJ2B 3RVUC 4DKFL 3L9RA 3DI2B 3V6BR 1WAAA 2LAAA 4P9HH 4EXKA 3E1F1 2IG2L 4IIQB 4HIXH 5DTFB 3BHBB 4JRYD 3SOBL 4CGTA 3HZMA 3NAAH 2QSVA 3TZVA 1YUHA 2WQ8A 4P46C 3TN0C 5IW1A 5HHXL 1AQDA 3RJQB 4TRPH 1OAZL 2P5EA 4TULH 2OR7A 4JM4L 4QRRE 3GMOB 2UZXB 1A64A 3BPNC 3HS0B 1AP2B 4HH9A 1GGBH 2FLRT 4E42A 1YEDB 4OV5A 3QPQD 1SBBA 1ZLWH 1AKJD 3NACH 1PEWA 1RHHB 5KOMC 4Y4FA 3QIUD 5C8JA 3BP7A 2DWDA 1I7RB 3A6CL 5DQ9B 4ALAL 2CDGA 5HDBE 1QLFA 2FHCA 4G7YH 2WBJB 2WINA 4NC0B 2R0WL 4LARL 3T3ME 5ID0A 5FGBA 3T77B 2W07A 1T66D 5IMLA 2VZUA 2ADJA 1J1PH 1V3KA 1HHJA 3MLTA 4LSQL 5F6IB 1IARB 3BW9B 3MJ7A 1UKSA 4WV1B 3TH3T 4C59B 3LSOA 3P0GB 2AGJL 4R4FL 1SYVA 4HXBH 2OZ4H 3KPMB 1DLFH 1N64H 3T0EC 5L2JB 4MAUH 3VRJA 1Y18B 2CIIB 5D5MB 4Q2ZB 1KF9B 1XGTA 5MEPA 2IAMA 2NX5E 2PW1B 3C6SA 3VA2C 4JZOA 1FBIH 1U8IA 4D0BA 3MV01 3WIFA 2X7LB 4BQ9A 5CZKA 4WO4B 1S7RB 1UACH 5D72H 4A6YA 3M07A 5HGHB 3ULVF 1RHFA 3LRGA 3GI9L 4XVUD 5KAQG 1E4XL 4N0CD 3ILPA 4AEEA 3WUWG 4LFHD 4BFBD 1HILB 2EDKA 2Q8AH 4F33A 3OPZH 4HKXB 2BVEA 5EZLB 4TSBH 1Q0XL 1JNJA 3OKKA 4PJAE 3O6KL 2APBA 4M6ML 5ENWA 5KVFL 3O81A 4XRCB 2PW2A 4HF5L 5I1DA 4PJFB 4HUUB 4WW2A 3ZDXE 4M6MH 3O2DA 1AQKH 4YHIB 5EBMA 5JDJA 3BD3A 3O45A 2UVFA 3BZEB 2NXZC 1WCBA 4QRPE 2NYYD 4U1KB 3GB7A 1R5VB 3BQUC 1ZK9A 1NC4D 4I18A 1W0WA 3G6JA 3BDBA 4JRXD 1FL3A 3VFNB 4HHAB 2R2HB 4OIBA 2YKLL 4G6KL 5DLMH 3FB7A 3L1OH 1EAPB 2GTZB 1B2WL 5CHNA 2W59A 5CJ5A 1IGTA 5C6PB 4K8RC 3NCCB 3WL9B 3QRFM 4JG1H 3V7AE 3KPTA 7FABL 5BS0A 5D7IE 3BYYA 1OD7A 5F44A 4Z0XB 1OWRM 1KJ2H 3QCTL 1O5DT 5F9OH 3GSVA 2QSTA 5CSBA 3NCBB 5MERB 3V52H 3T0XA 1JGVL 4R7NA 4M1GL 5D7KE 4HKZA 5I8CB 4LRIA 4RMTA 3WFHA 2VQTA 1OAQH 3PP3K 1FIGL 4GT7A 4M9PA 4YC2C 3SGJA 5DMKB 2CSPA 4LVNB 1C08A 1FAIL 3L3OB 4PGZA 3IJHA 3PWPD 1J8HA 5BMFH 1UWEH 5TE7H 5CKGA 1C16B 3S97C 5E1HB 3SN6N 4D3CH 3QDGD 3OJDA 1N2RB 5HGDA 2QQKH 3IU3B 4IDLA 4MD4A 2D03H 3LH2H 5IJVB 3QO1B 3GGWA 5I16A 3BDYH 3OZ9L 3RUGE 4J2XA 4OZHE 3SDDC 5HGAB 1YEHH 4FMKA 3TBWB 3LN5A 4NQDB 1RFDL 1YEEL 2JJUA 5DI8B 1FVCA 5BVPL 2AJZB 5CINH 1DQDL 1XF3A 5L9DL 1HQRA 2ZUXA 1QLRB 3G5YA 2EEAA 4GKOA 1IL1A 2FJFB 2OYPA 5CEYA 2ZSVA 3ARBD 3U6RB 1KLGB 3MA9L 3BD5A 3IDGB 1AJ7H 2VZVA 3SCMB 1KPRB 1BVLA 5K9KB 5FECB 4PTTB 1BJMA 4NQCE 4F7PA 5A2FA 4PY8J 1QLEH 4IOIB 1WF5A 2G9HA 4RDQG 3DIFA 3WFBH 1D7FA 3VXOB 5GRVK 3SPVA 2P7TB 1J1OL 5C0CA 4GW5A 2DM4A 1IJ9A 3C60C 3W9EB 1I8MA 4KVNH 3WEXB 3NABH 4LSUH 2MCPH 3T4AA 1IBGL 2H2SC 5F70A 1G9EA 5D4QA 3RUGA 4CRPA 1DE4B 1EO8L 1T5XA 3RBSA 3TYGH 4JRXE 3P0YH 3REWB 4QYOB 5I71C 5E9DA 4X80H 1DJSA 5CP7B 1J0KA 4EJ1C 2UWEA 1QVOB 5C92A 4M93B 1SJHB 4KRPB 3ZL4L 5DA0B 4YX2H 4C83B 4GS7C 4KK9D 1WGOA 3LD8C 5GJSH 3VA6A 4JFDD 4Y5VA 2Q8BL 1L6XA 2JE8A 2VC2L 2CLZA 2CUMA 2YPVH 3MA7B 3VMNA 4JJ5A 2X6MA 4PJEF 1IM9D 2VLME 5GGQL 1GYAA 2J4WH 1WEJH 5HYJD 1CDHA 4PJGA 2XKUA 4PS4L 4UILL 4G8GB 5DRNB 4HIEB 4GRWE 1NMAL 5ESVB 4NO0D 3WE6B 3DVIA 2KZ1B 1OD9A 5FV1L 4W4OA 1QFPA 3UROR 3UO1L 4NRYA 2P8LB 5C9JB 3KPOA 3R0NA 4LARH 3IS1X 4D0DB 4OLYL 4Y88A 1K3ZA 4YDKL 2X09A 3O9WC 5JW5B 3QEQA 3WLBA 2GFBB 3EYUH 1NDMB 1V7MH 2XFXA 3RY4A 3MUGB 3GRWL 1UB6B 4GRMA 2EC9U 3BSZH 3UBXG 4WEMB 4U1MB 3QG7H 3W11D 5EO9A 3D0VA 4FQ1L 4AEHH 1KPVB 4PRHB 2AW2A 1H3GA 3T0VA 2CR6A 4I3RL 4P9MH 1NBZB 5BXFB 3QZWG 2OL3L 2XTJD 3MRNA 2P24B 1OAXH 5GJTL 5D7SL 2DBLH 3KLAA 4Z0BL 3WDIA 5JHDB 5L88H 2AEIT 5EN2A 1WIOA 1I9IH 4YHKL 2OSLA 3BOVA 1D9KC 5E1AB 1LD9A 5D2LF 1CBVL 3K7UA 2XWJA 4UOW0 35C8L 2GAZB 5HSFA 3SDAA 35C8H 2OI9B 3D69A 1QR1B 5HHPB 5CSZB 1UZ6F 2AQ3A 4P5KA 5FM8A 1U8NA 4R6UA 5GRUH 4HF5H 1IAOB 3T2QA 4U0RB 4WW2C 4CMMA 5TPWH 4HT1L 5I1JH 4Y19B 3PHSA 4G80B 5DJCB 1KIRB 4PJIF 1KB5L 2JJVA 4TVPE 1CFTB 3H7BB 4U33A 5LGHH 2ZCKL 3EFFB 2F53B 3QUMH 1D5IL 1XFPA 5FK9B 4M7LT 1CLZL 2QSCL 4Z78B 1SMOA 2HJLA 2YXFA 1QA9B 4MJ5A 2YRZA 3U46A 5DFVC 4YPJA 1N6VA 5DJ8B 1FORL 5EU6A 1W72L 2HTLC 4JDTH 4TVPD 1S9VB 2OR8A 3DTXB 1YQ2A 2OI9C 3K81A 1YYLL 4QT5B 1KT2B 5CJXC 3RWFA 4JPVL 4DWHA 1ZVSA 1RIUL 1HDMA 1B0GB 4ZUVB 2FB4H 3UJTH 3FB5B 1MSPA 5E8PB 3BPLB 1BQLL 2VZ1A 2A38A 5CLWA 5DS8B 1LEGB 2PUQT 4KTDH 3OXSB 4QTIL 3BP5B 4KXZI 2JKXA 5FYLL 2V5SA 4HUWB 3VH8B 3ETBF 3OR6B 4ODUA 2V7HA 3BO8A 4MXVE 3C5SB 3JWNC 3RVWD 4DKAA 4A6YH 1Z5LA 1Q9OB 2NW2B 2VLRA 5ALBL 4HXAL 4LEOB 3SDXE 3V4UH 3QEUB 2E7LC 4KK5D 4XBGB 1H5BB 3HTLX 1RZ7L 3S34H 2BNUB 4MJIE 3BKJL 4U7MA 4TPRH 5D7KD 43C9B 4XPAL 3BPCB 3VFRA 2UZYB 3QDMD 3WN5B 3NA4A 2GY5A 2VDOL 3I75A 4M7ZB 5E5UB 1CXEA 5BVJB 1A7QH 1JF1B 2B2XH 4UAOC 2HG5A 2ICEA 3L95A 2GJ6E 5JQ6H 1IC4H 4TNVK 2ESVE 4ZS6D 1G7QB 1JZ2A 3MRBA 5TQ0H 1DEEA 4XCCL 4Z7VF 5JW4R 4HZLA 1HYSC 1FPTL 5CMAB 4OI9A 3MJ6A 2EE6A 1MLCA 3S4SB 1FYHB 1OSPL 2DQEL 4NQXB 3HPJA 3STZA 3HB3D 1AQKL 1OTSC 1UYWL 4ZD3L 1PG7X 4YXHH 3UX9B 4AIXA 1S78C 1BBJB 4EBQH 2VR5A 2NY4D 1JE6A 1HHIA 3C5JA 1XCTA 5FGRA 4MA7L 4LOUC 2IAND 1RJLA 5I1HL 1GL4B 2JIXD 5GS2D 5D2NA 3PNWA 1GPOH 3QQ3A 3B6SA 3P0YL 2VDRL 3GSRB 3QUMA 1YECH 4JM2F 4HZAA 3MRPA 5C0IA 3FTGA 3L3IA 4LPTA 2Q7YA 4HLZH 3R06B 2VDPH 1S9KC 5F1NB 1NCBH 1NAMH 4ONFH 1EEUA 3U0WL 5CBAB 2V2TA 2BMKB 4O58H 1GH7A 1T1YB 1UADC 1KFAL 4OZHA 1ZANH 4JY6B 4ZYKB 5M7QA 1ITBB 1NLDL 2Q7NA 3ARBB 4NKIL 5SWZD 5CD5D 1QSEA 5DRXB 4WU7B 3V6FB 2J88L 5E6ID 1MY7A 3LVEA 5F7KC 1CDJA 3EYFB 4NZRL 2HVKA 3L5JA 1AXSB 2HJKB 2XZQL 5HHQB 2XZAL 1PFCA 5BMFL 2K1MA 1CXFA 1UWEL 4F3FB 1GGIH 2R1WB 4NZRH 4J4PD 2C3XA 2C7UA 5FOJA 3E3QC 3G9VA 3S36X 3HMXH 3FRPG 4XP5H 5FA4A 3WS6A 3FQXA 5GGVY 5LAXA 5JR1L 3QWOB 1A3RH 3I84A 5CEXA 5HPMA 4EUPB 3QXAB 1KUMA 2JIXB 1A3RL 4QTHA 1S7QB 3WIIL 1AE6L 2UZIL 3UBXI 5LKNA 4C56A 1P4LB 2VXTL 3U7YL 2BVQA 3DX9A 1FO0B 3IFOB 1V05A 4X6BA 3VXMB 4EI6B 5ID1B 1QFWH 4F2MA 4B41A 5T3ZL 4PTUB 3RWHA 4P2RD 4LNRB 4IRJA 3GSOA 1CD0A 4KH2A 4X6FA 2ZSWB 5GS0D 1I9IL 4YHKH 1LO0H 4ZFZA 1NFDA 1BD2E 1LO4L 2ICWJ 5EOCJ 4P5TD 3DO7B 2X89D 4U0RC 3VGGA 4CKVX 3C5ZD 4U6YA 1IGFH 4G5ZL 4E0RB 2ENYA 4WFGD 1J10A 4J3XA 4ZTOH 2IC2A 4J12A 2GUOA 2VN4A 4M8QB 4RZCB 4OFKA 2ZUQB 4ODSH 3VMOA 1A6TA 4RIRA 3C2SA 2WLYA 4QOKA 4N0RA 4P9HL 1OF2A 5KG9B 2NY5L 1JV5A 2FJGB 3O4LB 4XVSH 5H94A 5T5FL 2EXWC 3TYGL 3FQWB 4HUVB 1AIFA 2L0DA 2BOCB 4P2QA 2HN7A 4GG8B 3NCJH 1N3NA 1AXTL 4KKAC 4DCQA 1JHTA 4QEGA 1A7RH 2GSGB 3CLEH 1I1YB 3U0TA 4YX2L 3ZL4H 1HI6B 1PYWB 5JIHA 5DUBA 4C56E 4MD5B 1IM3A 4XNQA 1UXWA 2PYEB 2YN5A 3HAEA 4KK6C 4LSDA 1SJEA 1X5JA 4NRZB 4QRPD 3O4OC 5EC1B 2BNQD 4HCRH 2YS4A 5E08H 2IQAA 4JAMA 1TCRA 4F9PC 2VXQL 3MGTA 1WITA 3MRCB 1VKXB 3SKMA 1U93A 2FDBP 3F6LA 4PJ9C 1I7UA 5DC9B 1LE9A 1XH3B 1WFOA 2VXSH 2Z9TA 5F7EH 2APFA 2F5AL 3DROA 3LQAH 3MLVH 2DQJL 4PJEB 4HD9A 3EDJA 4FG6C 1CFVL 3MROB 1M71A 2OTWA 2I07A 3H3KA 1NGYA 1JI1A 2ICWI 4NDMB 4ELMB 2EH8H 3EKCA 5FA3A 5IBUB 2B1HL 3OAYH 3CSYA 4GAYB 3RGHA 1MRFH 4NQSB 4JRYE 2YUVA 3ESUF 4ZAKA 3RDTD 4DEPC 4N1HB 5D7IF 3MRDB 1YMMA 3LKQB 5EU4B 1K8DB 3IDUA 4BZ2H 3QIWD 3VXPA 3DMMD 4OLWH 1X5FA 1A2YA 1TJHL 4MNGA 1EEQA 1NMBH 4L4TA 1OB1A 1VPOH 1JI2A 1RJYA 4PJCF 3MUZ1 4JCLA 3EFDH 4U1IB 2QR0B 3DPBA 2W92A 3F7YA 8FABA 3P73A 4NGHH 3DI3B 5DJYB 3THML 4X6CA 5GGRB 1FNEA 5FKAA 1N5YL 2W0PA 1TENA 1HXMA 5C6TH 2NY1C 4NNXB 4AENB 4HFWA 3QQ4A 4DGYL 1I7ZB 2VL4A 4OZIB 1CVRA 1KIQB 3BAEL 3OKLA 2JCCE 4FG6D 5IQ9B 3S3SA 3Q1SH 4DW2L 5AD0A 2D7OA 2PO6C 2IEPA 1YNLL 3MRMB 1YQVL 4BSWA 3DO3A 2BNRD 4R0LB 2GJ6D 3HE7D 4MWFA 2RQ8A 3K1KC 3VFTA 2FH6A 4LLDA 4YUEL 5HDQL 4WV1C 4PY7A 1NAKL 4PJHB 1UXSA 1MPAH 5TE6L 4KK6D 1MJUH 3OHXB 4IRSB 5I1HH 4FQHB 1YY8B 1BECA 3EOAA 4N0FA 3MOBH 4IM8A 2JB5H 1U42A 4PJDB 2NMSA 3D48R 4PG9A 1XGRA 4JGJA 3BJLA 4KDWA 4M7JH 4DTGL 2JJWA 4WI5A 4PJXB 5C0DA 4O2CB 4X4MA 4J3WA 4Y4KA 5IR1B 3MO1B 4MJIA 5AZEL 3RA7L 1CIDA 3N9GL 3VJ6A 3W0WE 2EDDA 3FT3B 3HZVA 3N1PC 2EDTA 3BGMA 5C0EB 5JMRA 1JGEA 1D5ZB 5F71A 3LZFH 3CMGA 2V17H 4KMTH 1VEMA 2GK0B 1RZFL 4OCXH 4H26A 2ARJB 3MRRB 1LO3L 2XZAH 3FQRA 2PO6D 4DGVH 5H35B 4XNUH 1YDPA 1WWAX 1IQDB 3UBXB 3P2TA 4APQD 1OGAD 4B53A 1OWWA 2R4RH 3CK0L 3TT3H 1DQJB 2MOVA 4CN1A 5I1IL 3UC0L 1O0VA 4OLUL 4JO2L 4LSSH 5B8CB 3TT3L 2IWGA 1OGTA 4PLJC 3CUPB 1XGTB 1KJMA 3HCVA 2HMID 5IHLB 2LU7A 1Z9MA 4KV5F 3LV3B 2AEQL 1FN4A 1N4XH 1E27A 4K2UH 1JJUA 1DP0A 5J11C 1MJ7H 1WK0A 3K0WA 3K4AA 1MCFA 1S9WB 4LKCA 1U8HA 5FUOL 1HILA 1MJ7L 3HNSL 3Q6FA 4TQEL 2BY3A 5DVNA 1JWSA 1T21A 1CICB 1K4CA 5TE4L 3STLA 3RVVC 1AC6A 4JHWH 5LWYH 4HGKC 3EYSL 4QXUL 1JP5A 3D0LA 5ENWB 1K4DA 5E8EB 1JL8A 1S7TB 4YXHL 2C3WA 4YHMH 1ZXQA 1BM3L 4C57C 3KYKH 2X41A 3UCRA 3LKRB 4KUZH 3RUGF 1GOGA 3FB6A 4IIQA 3I6GB 2A83B 2XA3A 1KG0A 3RBGA 5D9SB 5L7XL 5SWSA 3TZVB 5I74B 5IP4A 3FQTA 3SDDB 1YNTB 1LMKA 3K3QA 2P5EB 4EEEA 1XCQB 4LPCA 5IB4A 5EB9A 2NY6D 5CZVL 1OPGL 3GO1H 4PJEE 4I77H 2IALB 4UDTA 3ZE1F 2DL9A 4GXVL 4NT6A 4MXVF 4ACPA 1B6UA 1JHLH 4GJTB 4KWUA 3SKJL 4NBYB 3RGVB 1EAJA 1H3PH 4GXVH 3B83A 1MFEL 4L3EA 3GSVB 4DAGH 4NKIH 2R1XB 4R7NB 4ETQB 1EEZB 3IXTB 4LCYB 4MJ6B 4N0UB 4PJXE 4PGDB 2YSSB 3IDJA 5ETUA 2BDNL 3EO0A 1QO3A 3KPSE 2EDLA 5BV7L 3TO2B 5K9OA 1C08B 5B38B 4GQ9H 4X7TB 1KGCD 5D6DC 3DUUB 1WTGT 4OZGE 5D71H 4FOMA 3J8F7 3KG5A 4HUXB 3GJFK 4OM0H 3RX7A 1HCVA 1R24A 2D2OA 4PJ9A 3HC0B 3KGRA 2Y1VA 4HWNA 4JQIH 3VGHA 3LRSA 4XVJH 1FGNL 4TTDC 3WNKA 1NDGB 3SQOH 2NXYB 1IGJB 2AABL 3LS4H 4YZFE 1CGUA 4NKQB 5JA9A 2UZIH 5MEPB 2EEDA 4RX4A 3DVGB 1P84J 3BZ4A 4PB9L 1BAFH 2P5ED 4HUKB 5B38G 3DVNA 1S7RA 3KJ4C 4M1DL 3TO4A 5HGHA 1B0WA 1IT9L 3EFDL 3SY0A 1CLYL 3HMWH 4XB8A 3AB0B 3WJJC 2BRRL 3PGDA 3GJFH 4CDHA 3K8MA 5C0AA 1INQB 4OLZL 3SO5A 4PP2A 3KYOB 2XYCA 3QRGH 1PEZA 5EZLA 3VXSB 1T1XB 2A0LD 2X4UA 5DFTA 3FFCB 1BEYL 2DLEA 3RP1A 4JE4B 2XN9B 1BVLB 4HJGA 1KIPB 1ND0A 4PTTA 1FV1A 1R3IH 5I76B 2RJMA 4GRLB 1BQHA 4X7SH 2E7HA 4Z7UB 3BWUC 1SYSA 5D1XB 3BH8B 3QUXA 4PJIA 3HE6A 3P4MB 3E0GA 2ZG2A 4X7SL 3RX5A 2WBJD 3OF6D 4MDJA 3AS1A 5DD1L 1FL3B 1T80A 2J6EA 2FNBA 3GM8A 3T4AB 25C8H 2R2HA 4X5WA 3CDGB 3MZTA 3VDBA 1A6VL 2YPLD 4LVHB 3F5WA 3MRQB 2DYPB 3CCHA 4RFOH 4NKDA 2NPLX 1H5BC 5JIPA 1MJUL 2FSEB 4UV7H 2AV7A 4RNRB 2HT2D 3EYQD 3JXAA 5T3XL 3VFSA 1U8JB 5EOTA 3BRFA 2F9BT 3MV7D 3A6BL 5FV2A 4QHUB 4KZEH 4PIRF 2N4IA 5DEFA 5JDSB 2ZP0T 1IEBB 5ICXB 5L8JB 3HLAA 1B0RA 4Z7WB 2AXGB 1T7XA 2P44B 1RHHA 5AZEH 5EOCL 3QJFA 3LQAL 5DD0L 3IJSB 4HIEA 4P59H 3QCUH 3KPNB 3QAZB 2BOBA 1TIUA 2G5RA 4WHCA 2DBJA 4BZYA 4NKMB 5F89B 1FC2D 1QBLL 3T3MF 5IJVA 4N0UE 1HHHA 1UC6A 3MFGB 1WBZA 4GXUM 5FDWB 1U95A 3VI4E 5F9JB 1IC7H 1R6VA 4PRDA 4M03A 3ZKQD 4GRMB 4YXKH 2VDKL 1X7QA 3QHFH 4JHAL 2Q3ZA 4LSTL 5EO9B 1PKOA 3RL1B 4TTDD 1VFBB 5MENE 1E6OL 4LGSB 4P46B 5DJ0A 1WQVT 5GSVA 2IFGA 3ZLQC 4LGPB 1YNKL 3QPXL 1U8IB 4D0BB 5EZOH 5E2WH 2VAJA 3OGOE 3TVMC 4WO4A 4LCIL 3O8XC 3FHQA 3HAEH 3QQ9C 3GMLB 1WFUA 3LKSA 5JHDA 5CJOL 1MI5A 4ODHL 5T1MA 4XCCH 5EULV 1KYOJ 1IQWL 3GMRB 1KPRA 4PD4J 1JGDB 1BZ7B 2XA8L 5ALCL 2RFXB 2GAZA 3KXFD 5DK0A 5FCUH 1YEIL 4G7VH 4OM1H 4LU5H 3LMJH 2AERT 2EYSB 3VXOA 4GW4A 1YEIH 1R3HA 4OM1L 4LPUA 5I1DB 4P5KB 5CZXD 4LL9A 4YE4L 2XN9E 2Q86A 5I66B 4ZOCA 5J4MA 1DE4A 1QFWI 1T5WA 3VE0B 1TQCB 3VFNA 4LHQB 2RCSH 1AGCA 2UWEB 5IT2H 4FP8L 3WKMH 2HJLB 1QA9A 4MJ5B 5C6WH 2FR4B 3ARDC 3UTOA 4MGXA 3U46B 1QOKA 4OIIH 3OG4B 4Y2DB 1VESA 3QUYD 2OQJB 5JOPE 4HBCL 4XCFL 3GMOA 5J1AA 1NAML 4LLMA 4ONFL 2A74B 3IFPA 2X4PA 4NO3A 4G6AD 4WY7L 4M7JL 3RNQB 2CRZA 1K2DA 3H42H 5DJDB 5F1IB 5DGQA 3I50L 3MLSH 1J9CT 2ZUTA 1IKNC 1JWMA 5DJZB 4WY7H 4JJ5B 1G7PA 5D70H 2QADC 1ZVSB 3QT2A 4E5XA 1I7RA 5DQ9A 3ZKNC 3S9DB 3WHE0 4NYLB 4L9LB 1NAMA 4WGVB 4X7FC 3QIBA 1C5BL 4N0YL 5E70A 1OAQL 3OXSA 1FIGH 3RFZC 3JBG7 4GMTL 5E2VH 3PL6B 4LAQL 5C07B 1W8NA 3E2HC 2BDNH 5EO1B 5BV7H 1K3IA 4K94H 2NX5A 5BJTB 2CUIA 1N7ML 2DQHH 2M26A 1NGWA 3GDBA 3B3IA 1F2XK 1XMWA 3GGWB 3VRJB 1A1OB 4K94C 3D0VB 3NA9L 3SDAC 2ZUQC 2XKNA 4UINL 4Y19D 2CO7B 3TO4C 1LK2A 4JQIL 1G6RA 1FGNH 1A6PA 5E8NB 2NZ9D 4UINH 4HFUL 4Y0GA 5TF1L 4ORGB 2MPAH 3TN0A 3BIKA 3PWPE 4HQQH 4RRPG 1YN6B 2EKJA 4QHLB 3RI5K 3QUYB 1A7BA 3KLAB 2IBZY 4Q0XL 5ADPL 4L1HA 4K2UL 5TF0A 3TZVD 2ZOKB 3HFML 4AL8H 2G60L 2J8UB 4HKXA 6FABH 2F54E 3JV0A 4QLRA 5CJBA 3T2NH 1BF2A 3D18A 4PRIA 5BZDB 2DD8L 1RUMH 4XH2A 4PY8I 2MNUA 3QUZB 1X5HA 4H88L 2JJSA 5JPNA 1IGFL 2Q6WA 2YBRB 5ADOH 1LP9B 4Z7UF 5C0CB 2EIBA 2R4SL 3SHSA 1KIRA 4M6OH 5AZ2H 4DOHE 1W0WB 2VDMH 3EFFA 3G6JB 3RPIB 4L8SB 4K7PY 4XVSL 5T5FH 5BOPA 3C6LC 4U6XA 1Q1JL 3K8LA 3P11H 2MQ3A 3Q5YA 4XPHH 3SGKA 3T0EE 5EU5A 2H9GA 5JPMB 4GAJL 4JPKL 1MCRA 2FEDC 1N5AB 1TETH 4ZSOB 4S0SD 5ESAA 2EIZA 1S7WA 3DBXA 4XXDA 4TRPL 4P49A 3ULUC 2GIYA 1YY9C 3O6MH 5SX4I 1OTUC 2WMPA 5I8OH 1RZGB 1XF1A 2NY0B 1U3JA 5GISH 5DZNA 3P9LB 3OV6A 4W6XB 1EGJH 4RAVB 4L3CA 3FCTA 5GQBA 4PBVC 4HPOH 4DGIL 4HWZB 3MMEA 4YQXH 4IOFD 1LVEA 2ZG1A 3WN5C 4AT6A 1C12A 2YRLA 3MBEB 5JOFA 5C9JA 5IBTL 2EH8L 4F3FA 5D71L 5IW6A 1PSKH 1P1ZA 4F7CA 4PGCB 3RNKB 4XPGL 3GEWB 1MUJA 1HN1A 2Q20A 4IDJH 3G6AA 5FA4B 3IXAB 2CRMA 1NBYA 1M6OB 2PF6A 1A4KA 5F8QC 4MAUL 1LO5A 4U1LA 2VDNL 1RJZA 2DQDL 3I75B 4OLXL 2B1AH 1OAYH 3KPPA 1BBDL 1JYWA 5DK3A 5FYJD 1HQRB 2YD8A 5EA0H 3VD5A 1P4LA 2NCMA 3UTZB 3WXWH 5HYJB 3L95B 5EA0L 3C08H 1G7QA 2KH2B 4MDIA 1KACB 5GHWL 3VXQA 4M62L 5D5MF 5E95B 4N1EA 3O3BB 3NZHH 4QF1A 1RZJC 4YWGL 1LEIA 5A16B 5BS0D 3PP3H 3D69B 4XNMA 1U2CA 1QSFD 4PBXA 1SBSH 3QDGE 4E41B 2R69H 1G9NL 1CYGA 2Q76B 3WBDA 2OS7A 4BKLB 4UT7H 4GKZB 3MUY1 3PUCA 1NC2B 1WSST 3DMMB 4Z7NE 1KB5H 4UU9A 1CFTA 1I1AC 1NCAH 3H7BA 3QXUA 4CAGA 2NXYD 3AGVA 5HHNA 4Z78A 1YY9D 5IKCA 1UFUA 3BE1H 4PBWD 4L5FH 2HN7B 4DOHB 4AY0A 3OXRB 3S88L 4C83A 3VXMD 1I1CA 3PDOA 1DCLA 3WFEL 5F7DA 1CXKA 2D0GA 2GW5A 3SCMD 3DGGB 2Z4QA 3NBNA 1HHGB 3QEGH 2CD0A 4X6DB 4R26L 5EO0A 2E7BA 5DMIL 1YYLH 1RD6A 3B9KA 3DUSB 3HN3A 1PVHA 1FYTE 5D70L 4MD0B 3U36A 3UAJC 5HYFA 3FB5A 1AFVL 3P9MA 4OD1L 1WWBX 2MHAB 5C0FA 5ICYB 2I25N 4NHCH 1D6EA 1UM4L 4P4RA 1KPUB 4NRYB 4P2OC 3U2SA 2E9BA 2CKNA 3KYNA 3NOIA 3CVIH 3QEQB 2EO1A 5TDOA 4LLAA 2AGJH 2XFXB 1QBLH 3QH3B 4R4FH 5CD3B 4QRSB 5C09E 3T0BA 5FA3B 5C0BD 4JRXB 3QWOA 3QIBC 1AC0A 5HTSA 1S9XB 1RZ7H 2JIXA 2BNUA 1EERB 2CKBB 1FGVH 3HR6A 3MRDA 1S7QA 4JEGB 5T1KA 5HYSA 3PP4L 4QRPB 3FQUA 5FYLD 3BKML 4L4TB 5HYIA 1B9ZA 5I19L 1S7VB 3IDNB 4O00A 4OZ4A 2LU4A 1QZ1A 2C4XA 4FMFA 5E1AA 2IANA 2XI9A 3D39B 5FHBL 5GGTH 2DI7A 3MRBB 4XCEB 3F7VB 4I13B 5HYJE 5KZCD 1ED3B 5D7IB 1Q38A 4OF0A 1IKNA 3MBXL 4CVZA 3V8CA 1F3JA 4PJ8A 2PO6B 2Y5EA 2OTUB 15C8L 3OKEB 4J4PA 5FF6B 3ARGC 4G80A 5DJCA 3WIHA 3MLUH 4U4BA 4PRHD 4BSWB 5HY9A 2EDRA 1F42A 4JFEE 1BVKA 4Y4KC 4R2GD 1T7ZA 3FMGH 2AEPL 2WP3O 4OGZA 3M17A 2NY0C 4X80L 3Q6GH 3FT4A 1QEWA 1YPZF 5DURD 2VDQL 4XNZC 5IVNA 3QPQC 4K9EL 3GSXA 4U31A 3RY6A 1ERNA 2PYEA 4PJDA 3BIBX 3QDJD 4MS8D 4ZUWA 4OZFB 1JN6A 4TOYH 5EIIA 1JHLL 1MJJA 2IBZX 2K9UA 2VC2H 1HDMB 2YPVL 5D1ZD 3PDGA 3C87A 1DVFC 4O58L 4OD2A 1V3MA 5DF0A 5IR1A 4MJIB 2NLJA 1YJDC 5DS8A 4JY6A 4ZYKA 1IEAA 2X4NB 2R2EA 1DLHB 5EDXA 5TGBB 1J12A 5LGJB 1EMTL 1A9EB 3NIGE 1NKRA 2CXGA 3ZYJA 5D6CB 4LCWA 1NSNH 3EDDA 4K23L 3OR7B 1G0YR 2AXFB 3SGEH 4A2MA 3Q0HA 3V6ZB 5T3ZD 4QCIA 3U7WH 3NIFF 4NZUL 4U2YA 4YDJA 3VRIB 3Q5TA 4PPTA 1CWVA 4F37K 3A6OA 4XP6H 2GEEA 2ARJA 5IB2A 5FHAH 4HMCA 3BDYL 3O11A 3OZ9H 4LLWA 4XCYA 4XP5L 1YMMB 4AQ1B 3NCMA 5ITBL 4G9FE 4LCCC 3IDMB 3ALWA 1KTLB 3MJ9A 5D6DA 1HWGB 3AU1B 3GFUA 3L7FA 4Q9CA 1MREH 2IGFL 2ZPKH 1RUAL 5EUOF 2Y7QB 1OAYL 3H0TA 4NO0B 2ERJC 1L6ZA 1LQSR 1P7QD 5B3JE 1A9BB 1CDBA 3F58L 1DEEB 4C55A 3DLQR 1VFOA 1LGVA 2PTTA 4ODTH 3DYMA 4LNRA 5IF0A 2P1YA 1VFAB 4FQIL 3HI6L 4KAQH 4NQXA 1FZJB 4AMKL 2XXMB 4CMHC 1BFOB 5GRYA 3S5LB 1FNGB 4NHUA 4OCNC 3QNXB 1KGCE 1XGPB 3RKDD 4RA0C 3CZFB 3CFDA 3KPSD 1SEQL 4ZQKB 5JOPD 5AZ2L 3SDYH 3ZE2F 2VTFA 4P2RE 4G43B 4GRWB 4WWKC 4MNHB 5LXGH 2FCBA 2X05A 3GIVA 4TUJB 3RDTA 3OHXA 1YY8A 1U3HA 4K7PL 2VIRB 3VDAA 2EDHA 3EOAB 3LDBB 4RGMC 3T8XB 5MEQB 1NUGA 5D9SA 4CVXA 1IC5H 1MY5A 5DA4A 3KJ6L 3L5HA 4XHJC 5H2BB 1MIEL 2AI0L 4PG9B 2GKIA 4XZUA 3R0MA 4L4VE 3X12A 5IB3A 2HKFH 2ATPA 2VXUH 4XNQB 4L29B 4HAFA 4NQEE 1K6QH 5C0DB 3RWGA 4QWWC 4IJ3C 4NT6B 5K9QI 3T2PA 3H9SB 3VJ6B 4G9FA 3MV8B 3ARBA 2DKMA 3QJHA 1DBKH 1I9JL 2EZ0C 1WAAF 3CX5K 5C09B 3V0WL 4FFZH 3V6FA 2BX5A 1XH3A 4RGNE 4OJFH 3QEHB 1GZPB 4JR9H 4PJEA 4TNWK 2GK0A 3RZCA 2HWZL 5KW9H 1U58B 1S7SA 5JTWA 3CFIC 1QO3B 4KDTA 2PR4H 3S37H 1QFUL 3DOSA 5KW9L 3INUL 1AR1C 3VGAC 2PR4L 3S37L 3HC4H 5I1CH 1JRHH 4WFED 1R24B 5LJYH 1UM6H 3FT2A 3HC0A 1N6QH 3CH8A 3PV7A 3TIEB 4XPAH 3EJYC 5E99L 2FRGP 1M7IB 4HS8L 3EHBC 4Y2OA 5E6YA 4RWHA 1OLLA 2AJXH 3O0RL 1TVHA 5IVXE 1D5MA 3K8KA 4ORZC 4U1IA 4M4PA 2Z8VC 3FOLB 4M1CD 2JCCA 4ZS6C 2B2XL 1GCFA 1UACL 4X6FB 5GHWH 2E5EA 3ARTA 5D72L 5DJYA 4OLVL 1BQSA 5GGRA 5CBEB 1YYML 5BW7A 1A0QH 3V6OC 1FFRA 5HJ3B 4JY4A 4GSDH 1VFUA 4Y5XB 3S96A 1FG9C 2VQ1B 4RISL 1P2CA 3HNTH 3RTQC 4E0RA 1T3FA 2O5XH 3QSKB 3TNNA 2AJVL 2C3VA 1G9NH 1QNZH 4GRLA 4KDVA 3SGEI 3VXRD 3QWQB 5HVHC 3QNZB 1IAMA 3S98A 4QOKB 12E8L 1NBVL 3NPZB 3CJJA 1CLZH 2PTVA 4M4RA 2FEEI 3L3JA 2QADB 1T20B 1AIFB 4MA7H 3QI9A 3U4BH 3BFOA 3WKNA 4APQA 4XP1H 4PREA 3BEWA 5H37H 1F97A 2X1OA 1OGAB 5IW3A 3SKNA 2E7LA 4WFGE 3L5XH 4XP9H 3TA3C 4GOSA 1JTTA 2UY6A 5J6HB 4HBCH 4XCFH 1E4KA 4YIQB 5DMYA 4I2XB 2GYSA 4NRZA 5D2LA 3I02A 4RBPK 1XGRB 4H5SB 1FVEB 5J8OA 2R1YB 2BSRA 4ODVL 4UQ2B 1EPFA 2F15A 4LSPL 1TCRB 4OQ1A 2NY2B 2BSED 4L3EB 1MIML 3UTTE 4Y4KB 1WBXB 5ICXA 4OT1L 5DHXB 4OCYL 3KXFB 1SM3L 1EHLL 1ULVA 3QUXC 4Y19E 2ZCLL 5C0NC 1VGKA 4LLYA 1M71B 2OTWB 3BKYH 5K59F 4EDWH 3WHXA 4FTVE 1NSNL 3PIQB 2F74A 2N7AA 5DUML 4M7KH 3TVMA 5E9DD 1UZ8B 4Q6IC 4Z7WF 4NQSA 3QXTA 4UDUB 5IEHB 1BF8A 5KZCB 5FHAL 1AKJB 4HK3J 3W0WD 2W60B 4K3JH 3LKQA 3C6LB 1JZ8A 4XGZA 3VFUB 4R7DB 2UWEF 1A6WH 4OLUH 5B8CA 4F57H 1FJ1B 5HHME 3OAUL 4X4YB 3RY5A 5BRZE 8FABB 3U48A 4ZXBB 2GTWB 1NANI 4WHDA 2YA1A 5E6IB 1AY1L 5EORL 4XB7A 4DUXA 3LV3A 4OD3H 3GMLA 4F9PA 4HIIB 1IM9B 2MSPA 1NUDA 2GSIB 3BX7C 3RTQA 1CL7H 1F3DH 4PJHE 4YK4B 2DN7A 4J3OC 5KS9E 3D39E 3V4VL 1RUML 3HUJA 1Y6MR 3MPCA 1X4YA 1MH5B 4KQ3H 1BZ7A 4U3CA 5KN5B 4FQIH 4KAQL 4ZOAA 1X6NA 4KQ3L 1BQHB 2VO5A 1F8TH 3MCKA 2E27L 4Z7UA 5ADOL 5EH1A 2YXMA 1FFOA 2P5WD 2Z35A 3FONA 4ONGH 4FQXB 3MLXL 1RU9H 3O3UN 2NY3B 4PY7B 1XF5B 1I8LA 5F97E 4OF8A 3EJZD 3W0WB 4DK6A 1S5HB 2A83A 1WIPA 1VACB 3DHJA 3ULSB 5SWSB 1FFPB 2AJYL 1HH9A 5FM5O 3ZTNH 3CXHJ 4UNTA 5I18H 2FR4A 2E7MA 2W9EH 5FO9A 2XY2A 3TT1H 5GGVL 1AQDB 4NM8L 1GC1L 5J1AB 3P4LA 4NQDE 1KFAH 3RNQA 3OX8B 1GC1H 3T0WA 4EIZC 3W9DB 3RZCC 1B0RB 3FAWA 4QNPE 3DGCR 3QP3A 4PJ5B 2DKSA 1DVFB 2XRAL 2ENSA 4DAGL 1GC1C 1DBKL 4LAJH 5HHVH 2J2ZA 2PN5A 5GIRB 2XZQH 5FB8B 4ALAH 4MB4A 3IT8D 4PG2A 3LN4B 3CFKB 5MP6L 4JFFE 2FIKA 4ZNCD 1N59A 5B38A 1V7ML 5CEZH 2CRIA 4X7TA 5FGCE 2O5ZL 32C2B 1WBZB 3GBLA 2C9AA 4LHUB 5F9JA 3ZO0A 2O5ZH 3BW9A 3MJ7B 4WV1A 4JQVA 2WIMA 1ZV5A 4XBPA 4LNVA 1X7QB 4F80A 1CK0L 5AUMA 3UTSB 4XVJL 1V7NL 2CLRA 3V8OA 2W0FB 3CX5J 3T0ED 3ORJA 3AY4A 2XZCH 5E8NA 3S35X 5E99H 4Q2ZA 4ORGA 4D0CB 3BIKB 1OAXL 4MX7B 1BAFL 2EDXA 4HDIB 3VGAB 1IVLA 2RBLA 3BXNA 1CLYH 1QRNA 3PGDB 3AC0A 3OMZA 1MFBL 1NCWH 4YNYA 1PDKA 4OLZH 5FGSA 2VISA 1UH4A 5I1KH 1MFBH 2A6DA 3RVTC 3KYOA 4PLKC 2K3TA 3G6JF 4QXWA 3KYMB 1K4DB 1LK3L 1A6UL 1U8PB 3IFLL 3FOMA 3QZWB 2KUTA 1J8HD 1IKFL 4QRUB 2YBRA 3SDYL 1SYSB 3LY6A 4OFPA 5EBMB 4PJHF 5I66A 3BZEA 4PRIE 3MV9A 1E28A 2C5DC 1T5WB 3K2MC 4NM4H 3VE0A 1A1MA 2HT4D 1HHKB 2ESVA 4I18B 4OFVA 4G6FD 5D7LB 3V6OA 4P57A 1NEZB 4JRWA 1JPFA 1GRWA 3IKCA 3QEQD 4O02L 2EYTB 4TN9A 1KCVL 2FSEA 4LVNC 4RNRA 3O6LL 3SE3C 5J3HC 5L8LB 2HJFB 5F9DC 4L3AA 2CJUH 4K7FB 5INCB 5BS0B 2WIIB 3EOBA 4OUOA 4RX4D 1IEBA 5FCSH 5EU3B 2EDOA 5IMMA 3F7RA 1U8OB 2PNDA 1OW0A 4HIHB 4L9LA 2WANA 2BNRB 2DQJH 1JPSL 3V52L 4OJFL 1SM3H 3BP6A 4JR9L 2I9TA 1IGYA 1CT8B 1XZ0A 3AAZB 4GKSB 4X4ZA 1Z9SA 1J05A 3GMNB 4PJFE 4HUXA 3HNVL 4JFFD 4KK8D 5JOFB 4DGVL 3CDCA 2DYPD 4N90D 43CAB 4HXBL 4PGCA 2XKNB 4PLOB 4PRDB 4M48L 4WI3A 5MEOB 4XT1C 2VDKH 4JHAH 2ICCA 1E6JL 4XPFL 1VB9A 3ET9F 2ZUUA 1AGEB 1PD6A 3D3VB 3HRZB 1NKOA 4YK4C 4P46A 5DJ0B 2ZNWA 3QUYA 1IFHL 4ELKA 3OAZH 1TDQA 3W82A 1KCUL 3QPXH 3O6FD 2AS5M 1FVCB 1OTTC 1DBAL 1MEXL 4L1DA 5E03A 2VE6A 1FVDB 5IOPA 1C7TA 1F11A 3QNYB 4OTXL 1QR4A 1WZMA 3LQZA 3VGBA 3G6DL 4K07A 1R5WA 2ITDA 2V2WB 1RUKL 2XN9A 4M5YH 3ILQD 2XA8H 5A16A 3MA9H 4RWYH 3FO1B 4PJBA 1RUKH 5IIEB 5KVFH 1I9RL 1MOEA 1OP3K 2D7MA 2DQEH 4GW4B 1QNZL 4QY8A 1NGXB 1INEL 4I48A 3BISA 3PL6D 4P5MB 5GS0H 1UYWH 2KPNA 2W38A 3AREA 5T1LA 3B5HA 4NN6B 2YZ8A 3CDGA 3HZYB 5FYKH 1DQTA 1V8HA 5TE6H 1EUTA 2MCPL 4NUJA 5I73C 2QHRH 3RUGB 1FFQA 1NQBA 1T5XB 1W0YT 4KHTL 1C8PA 3JVGC 2JB5L 2EIZB 3S4SG 1B2WH 2YD5A 1G7HA 3QDAA 4IRJD 2I27N 3TFKC 4FS0A 4L8CA 2IH1A 5JQHC 1P6FA 4Y2DA 1WIUA 4DTGH 1CN4A 2OQJA 5C3TA 5F8RC 1RZGA 3TT1L 4ODVH 4NO3B 4Z95H 1XF4B 3ZTJG 1XF2B 1TCMA 3J7HA 2Q8BH 1M1SA 5IEKA 1H3PL 2BVOA 3ULVC 5C0BE 1DN0B 5JXEC 4F7EB 1JGUL 2VJXA 1X44A 2YUZA 4QXGH 4Z7NF 3FN0H 1EFXD 3P9MB 4JFHD 3BWAB 4NC1C 4P2RA 4G8GA 3BJ91 4NZTL 4G8EA 2BK8A 4L4VD 3U7WL 1A7PH 1L7TH 2CO6B 5DUMH 4ZFFA 2E3VA 4S11A 5IW6B 4WHYH 1A5FH 5DT1H 1L9MA 1U3ZA 2IPUG 3VXRE 3GJEA 3BEVA 2DL2A 3RVUD 1NGWB 1FYTD 2DM7A 5IMKB 1TFHA 1LO5B 2HRPH 3W5MA 2Y6SD 4ZS7L 3SQOL 4QRRA 4TYUA 2BNQA 3MYJA 1IAKA 2QHLA 3TA3B 1V7NH 5HYQB 3GSUA 5D1ZC 3K2UL 5HHOD 3U7YH 2MKWA 4M61B 2H8PB 2DQTL 4QHLA 3RIFF 5CJQH 3MRNB 3ARSA 4OF7A 5I73B 1IT9H 3I9GL 4MDIB 3IDNA 1BD2B 3R8BB 2KDGA 1P7KB 2NNAA 1WCQA 4WJ5B 3WJLA 3HHRB 3T65A 4ZUUA 3O3DB 5DRZA 3I2CH 4L9LC 4JQXA 3H9SD 5F88B 4JN1H 3VD7A 4BZ1L 1DUZB 2V9TA 3CZJA 1X4ZA 5D96B 1R3IL 5JPNB 1QSFE 3KYKL 4Q6IB 1X5GA 3N1QC 4FTVD 2Q86B 3VG0L 5GRUL 4GBXC 3NABL 3DMMA 3D2UB 1IAOA 3X3GH 2M8XA 1IBGH 4FFVC 3TH2T 4P4KC 2DLHA 1F6AA 3W81A 4XVTH 4WHTA 4X8XA 3X3GL 3JV6A 4H20H 4KPHL 1AGCB 4PGJA 1C7SA 2X70A 3SJVA 3QUML 3HKFA 4H20L 2JJTA 2FX8L 2A6KA 5DMGD 2H9GB 1I4FB 1G7LA 4X0KB 4A2LA 2G5BB 4ZSOA 1GXEA 2W9EL 3TLRA 2MMXA 1IGMH 4YR6B 4ZAKD 5E0QA 3S5LG 4L4TE 5DD6B 4GFTB 4O51A 1OAKL 1U6AH 3GO1L 4B7LA 3GSXB 5DJDA 5EO0B 4UV4L 1W72H 4NQED 2FECI 4P5TA 1UCBH 1RI8A 5GGQH 2J4WL 3VXSD 4I0PA 5M94B 1LNUB 5ICYA 3X13A 2BVPA 1H0DB 5F7WC 3O6FB 3VFPA 4TUKL 2R2EB 1KPUA 3EBAA 3QUZC 4I5BA 3QUKB 4QRTA 3ULVL 2IPUK 4UB0H 3VFOA 5JHDD 2DLTA 2DJSA 4FQJL 3U9PH 4ZUSA 5BRZB 3WFCH 2NX5B 3OR6A 1KJ3L 1FLRL 3QH3A 5HVHB 5FYKU 1F4WH 5I2IB 5EBWB 1KJ3H 4P2OD 5DD5L 4Y16D 4XBEL 1KYOK 4O2EA 4N8VG 1MUJB 2YPLB 1N6QL 3BSZL 3V4UL 2F54D 3BPOB 1IC7L 2NY7H 3IXAA 4I3GA 2FO1A 1RIVL 5L2KD 3L5WB 5T1KB 5HYSB 1OSZA 4UIMA 5JIKA 3LS5L 3KDMA 1A4KB 1JK8A 1BJ1J 2WZPD 4M93C 4U1LB 3REVB 3IETB 3AY4C 5K9JL 3AU1A 4S1RH 1QSFA 4N8CH 4OKDA 1BFVL 4LPWA 3V2AR 3TBYA 3MV7B 3DX6A 4I0CC 2VDOH 3NZ8A 2EDYA 5D7SH 4GW1B 2PYFA 4ISVB 4NO0A 1WC7B 3VWJB 1E4XH 2HVJB 3UTZA 5BVJA 2P5WE 1S7XB 2BRQA 2IANB 4YDIH 3VXTB 3JSSA 4XCNA 2HG5B 1YA5A 3B9EA 2CXKA 1ADQA 4NKOB 1EA9C 3TIDB 3CC5A 4NQVB 5HYSG 4H1LG 4XH2B 4GSDL 2FYYA 2VABB 4W6WB 5C3LD 2IBBA 3BGFC 2Y9RT 4EI5D 1D3CA 1OP3H 3WS3A 1L7IH 4ZG1A 5E2TH 4XNMB 3LPWA 5IM7B 1LP9A 1YQVH 4GUPA 3GSQA 1YMHA 2ZCHH 3UZQA 4DW2H 4BKLA 1CF8L 2VLKA 5AYUL 3QIBD 2ED9A 2X4QA 3B9AA 2FGZA 2YD6A 2B4CC 4NM4L 3WNNA 1D5IH 1FZOA 1HHIB 1AD0B 4B7IA 3C2AL 1CVSC 4X6CF 3ARGD 4BH7B 3RAJL 1QFOA 2ICWB 3KHOA 4UV7L 2VIRA 3ARRA 3EJZC 1I3VA 5L0QB 2VDRH 4RGND 1VHPA 5HD8D 3F62A 4C54A 5H2BA 4JFOA 2H2PC 3AREC 1VADB 2EIDA 3TO4D 3KLHD 3X12B 5IB3B 4MNQD 3TPUA 1UM5L 3QEGL 5F1NA 3LPFA 4LVOB 4X7DC 2NR6C 1QQDA 4Q74A 1D9KB 3S3JA 2GITB 4OD2B 4TVSa 5HI5C 5E8DL 1KJ2B 3RVVD 5CBAA 1IILE 2EXYD 5J9PB 5C08B 3O4LD 2Z31A 1QG3A 3LB6C 2ED7A 1DLHA 4S1DD 5DO2D 2V5TA 2VITB 3PWVA 4NP4L 1KIUA 4FQPA 4JKLA 5I1GH 3VXRB 5F1OB 3EYOB 4N5ED 2IH3A 4XTRD 4K3HA 4POYA 3SE4C 2I60H 4MCYA 5CGYC 1LP9E 5I0ZA 5KBNC 4GMTH 1HEZB 5GRVL 3HC3L 4YHOL 4ZXBC 5IVXF 1JNLH 3KPQB 4K71B 2OJZL 4PRID 4HXAH 5CS7A 1DANU 1L4IA 1A5FL 1F58H 5TDOB 5DT1L 3E6FA 2XACC 3CK0H 3PWNA 1WZLA 3QAZC 1RZIA 3LEVH 3CSPA 3NA9H 1FNAA 4LF3A 5LAXB 1IAII 3ARZA 3EYVA 1VSCA 1QACA 3O2WH 4HFUH 1B6DA 3U7AA 1R3JB 1U8LB 1U3YA 4P99A 4ZUTA 1CLOH 4CN4A 3H0TB 3G08A 1E0OB 5HYJA 5L9DH 1LO2H 3K80A 2R8SH 5JW4N 4HGWA 4YPGB 2ICES 3EDEA 1FO0A 2QSQA 2X1PA 4IHOB 2HFTA 5IF0B 2R2CA 4J8RA 1KTRL 3HMXA 3OG6B 5L0QC 2A73A 4I0PC 2I9LA 4S1DC 5CBEA 4Y8AA 1JWUB 1BFOA 2HT3D 1R0AL 3NTCH 1I9RH 3AUVA 3QNXA 2VQUA 3DO7A 4E41A 1F4HA 4JHWL 2CKBL 4LRIC 4OCRH 1INDL 3ARDA 3MACH 4PRNB 3N1GC 4RQQB 1Q8MA 1K9TA 2M1KA 2OTUA 2X4RB 1INDH 2YN3A 5E7BA 3BIAX 1CTNA 2R56L 3GSNA 4J6RH 3HI5L 1ES0B 4JZNA 3T4YB 1YEKL 1FYTB 2VDLL 4I3SH 4ZTPL 4X9FA 2X4TA 1T20A 2DWEA 4J7RA 4ERSL 5JNYA 4JM2C 2XKSA 4PREB 2QJDA 1E4KC 3OSKA 1A1NB 4N9GA 1ZGLM 5L7XH 2EECA 2X1XR 3K46A 4PV9B 2D9QB 3MJ9H 2MJWA 3IAQA 1JHTB 5K59E 2PETA 2VDPL 5I6XB 1A14H 4LLQB 3RL2B 1MAML 3H42L 2YD3A 3QG6B 3DJ9A 5KSBA 3MODL 4POUB 4PJFF 1MFEH 3V6OE 2R2BA 2WUBL 3GKWL 3VRLE 4KROD 4Z7OE 1QTYT 3MCLH 3N85L 4G8FA 5BQ7A 1LDPL 4C4KT 4XX1G 1WBXA 3QWRA 2MHAA 5C0FB 1LDPH 2JJTC 3KXFA 3MJGX 1FC1A 3S3PA 2VL5B 5F9WC 2D0HA 1NCCH 3FZUD 1A9EA 1RMFH 4PV8A 1VGKB 1HSBB 1XIWB 3MNWB 5MP6H 3IAPA 3MROA 3V6ZA 3HA0A 5C0CD 3TCLB 2W9DL 5D8JL 3ZKMD 4KRLB 4QRSA 4JO4H 3D87B 5E8OA 1FH5L 1WISA 2LU3A 1F4XH 2Y23A 2OP4H 3DVFA 3SKUD 3MLPA 4YHLH 2AABH 1D5XA 3LS4L 5BOZG 2DTSA 3QG7L 4Q97A 2B5IB 4U3XA 1Q9LA 3JWDL 1M7IA 1RIVH 1HXYA 3WO4C 3L3GA 3V0VA 4QKXB 5EZIL 4WFHE 3B8SA 4OLXH 4OLWL 4D9QE 1MREL 4WUKL 3WYRA 1ZHLA 2VXTH 4XMPL 2QKIA 3AS0A 3H9HB 3KR3H 5GJTH 4Q0XH 2JCCB 1UJ3B 1FCCA 4JG0H 2YC1B 1ZT1B 5E6IA 5DR5H 4X4XA 4K55A 3MLWH 4HULB 4JG0L 1F5WA 5I1LA 4Q9BA 5TFSL 3U9UA 1IM9A 1TVBA 1A3QA 1ETZB 3F7VA 4PJCA 1ZA3A 3S96B 1CU4H 3HR5A 4IRZH 2ADGA 2EDNA 1MH5A 1JNHB 3QQ4B 4J3VA 4OZIA 5KSUA 4N5EC 3E8UH 5CWSB 3QNZA 2R69L 1EHAA 4HS3B 5GGTA 3V5HB 2HFGL 3CH1B 5BV7B 5IG7A 1I1FA 2DDQH 3C6LD 4ODSL 3MGOA 5E94A 4JFPB 3DNKA 5KS9A 3IGAA 1OY3B 5EBGA 5DJ2A 5HI4D 4R8WH 4KKLC 4R0LA 5C0BB 3BEWB 1ORSB 3RDTB 1WZ1H 4RAHA 2IG2H 1UH3A 3BP4A 4YUEH 1OGAA 3VWKD 3OKOB 5HVWA 25C8L 3FT4B 3HZMB 1WZ1L 5JW4M 4FHBD 3CLEL 2FGWL 4KI1A 4F8TA 1FFPA 2QL1A 5FGBC 4U49A 2SEBA 1JN6B 3UPRA 2FIRT 3VGDA 3QA3B 2R1YA 4LSRL 3ZKND 3KJ4B 3QDMB 1OTTD 1VGEH 2X89A 5A1AA 2E9WA 2XTJE 1UCBL 5T1KD 4UT9H 4KZEL 3TA3D 1BPVA 2EXYC 3RWDB 4OV5B 1MI5E 5C71A 4CJ0A 4X6DF 4OGAC 2LQRA 5BV7C 5KSAD 4LLYB 2YMXH 4JFXA 1RUPL 4NP4H 4WI9A 3HZVB 5MHSD 2F74B 4OGYH 3W2DL 4WI2A 1MHPH 4PP1C 1ADQH 3L7EA 4YHNA 2R0LH 3HC3H 4LLWB 4R97B 4OF6A 5DSCA 3ROLB 2N56A 4HWEL 3RVWC 2QLVB 1RK1B 1JTPA 4LGRB 5KTEH 1LE5A 2CLRB 2J12B 3QDME 3RKPA 5KTEL 5DQDH 3OQ3B 3NFSL 1FBIL 4YBQD 3X14B 3WIFB 4G9DA 1MFNA 1D5MB 3T1FB 5LBSL 1HINL 2DB8A 1IC4L 3G5XB 3BXNB 1SJXA 3GBNH 2UUDH 2VERN 2H45A 1QRNB 2BNQE 1VFAA 1U8MB 2XT1B 1UA6H 3GBNL 1FZJA 2J5LB 4QXTA 4MSWA 1MCNA 4R90H 3WLWD 1IQWH 4JY4B 3FB8A 4D9RE 4X6DE 4XAWH 3RIFK 3MCKB 4ZOEA 2VKXA 1JHKL 3KYMA 3Q1SL 5IROC 2W0LA 4JFFB 3WFDH 4KRPC 4QXUH 2VAAA 4XPBL 3FOMB 2APTA 2R0ZL 3D0LB 1S8DA 3JTSB 4WW2B 4U1JA 2H26A 3L3DA 2LTQC 1WCBB 5DVMA 3SJVE 4WEBH 3LKRA 3NFNA 1IGCH 4DZ8B 3W0WA 3L3JB 2W9LA 3LRHA 2F58L 4UTAL 1MCWM 4WEBL 1S5HA 4FP8H 3BE1L 5MEQA 4J3SA 4APQB 1YEKH 4KHTH 4XP1L 3ULSA 5D7LA 2A9NH 4MMXC 3ESVF 4P57B 1YUHB 3L1OL 4R9HA 5IK3A 1IGTB 1FE8L 3OGCA 4H1LH 5BZWB 5JO5B 4HH9B 4OI7A 5IB4B 3K74B 5LG1A 5CZVH 1Y6KR 3TN0D 5E8DH 4K9EC 5INCA 2WIIA 3GBMH 4YAQA 1DVFA 1II4E 3SKJH 4WTZG 4Q58C 4QXGL 2F54A 4ZDHB 1KENH 5MERA 5JUEL 3ZKSD 4JANB 1I8IB 5IB1A 3IJYA 5CGYD 1Q72H 1EMTH 2X4SA 3RZCB 1Z9OA 5HBBA 1R5IB 3DX8B 5MI0C 1C5BH 4MJ6A 4OAWA 1LHZA 1X6LA 4K94L 1KN4H 4Z8FL 2VUYA 4Y1AD 1HHJB 3MLTB 1LO3H 3NFPB 2JCCF 2Z0BA 1REIA 3TO2A 5K9OB 3S35L 5HVGB 4XNUL 5IWLC 4WW1B 2VLJE 1N2RA 2BERA 3U1SH 4KHXL 1MHCA 3WS6C 1Y0LA 3JUZA 5ESQB 2H32B 2E9JA 1AKJA 1F4XL 3U30C 4BFEA 3LEVL 5F7LB 2R4RL 3OKYA 5HDLA 1H3XA 4RMQA 5E4IA 4JFDB 3S36L 4FQCL 3SKOB 5HD8C 3C6SB 4NQDA 1A6WL 1NGPL 4EI5A 1NL0L 1RFDH 1YEEH 1TVHB 2ZUWA 1NFKA 2X7LA 1MWAB 4FQCH 3GJFB 2GCYB 1DL7H 4FABH 5BVPH 3BZ4B 2VKWA 4Z7VA 2R39A 4OGAD 2ZNXA 4JM2A 1KJVB 5DD3L 2GTWA 1H8NA 1QLRA 5SWZB 4JFZH 3C8HA 3UTSE 5IOPB 5DD3H 4X83A 1GGYA 5DR5L 1MFAH 4BH8B 4QGTA 1GZQB 3R8QA 4L8DA 3OKKB 1XT5A 3U6RA 1R5WB 3RIAF 1AJ7L 1U91B 4AM0B 4BUHA 5TE4H 4BZ1H 1KLUA 3OJMB 3PABA 2D4FA 3VXNA 5FECA 3DRTB 1S9YB 5DMJB 4G5ZH 3UPAA 5JLZA 3O45B 1UB5A 3ZKXB 4I2XE 5I76A 1AHWB 4JZJA 3E8UL 3OB8A 4DZBA 3TBTA 3MGAA 1CFSA 4I48B 3RZWA 1FZKB 3QUXB 1Q94B 4ZPTA 5J89A 4NFBA 4NUGH 3JTTA 2VDLH 4I3SL 1RU9L 2FBJH 1XEDA 1NEZA 4JPKH 3VMPA 1X5YA 4P48A 3NCYP 3OTTA 5CHNB 4XPHL 4GG6F 4PJGF 3H7LA 3GHBL 2AK4B 4IJ3B 1SJHA 2VLKE 1P4IL 4PJ7F 1MAMH 4C56D 3IB4A 5CKAA 1U8JA 5EOTB 2BSRB 1P4IH 3CDYA 4BFIA 4KKNA 3EDFA 4G3YH 1JCKA 2Y4SA 4QHUA 4X8JA 4L8BB 1VGEL 4Y89A 2VLLA 2NY3C 3MA7A 1MCDA 1QBML 3UTQB 3DRQB 3UTTA 2OBGA 1T1ZA 2NY3D 5DRNA 4QNPF 2GJ6A 3HE7A 5DWUL 2YK1L 1F4YH 3AAZA 3QDJE 3QUZD 4GKSA 4NZUH 1Q9KB 4OFIA 5B4MD 2EO9A 4WUUA 2CH8A 3ILQC 2P4AB 1UZ8A 3LN4A 4JPWL 5KSVA 3CFKA 4LBEA 4M6NL 1QFHA 4Y5YA 3NIDF 1MCPL 3RWIA 2QQQA 4IDJL 32C2A 1ADQL 1QRND 3G5VB 1S3KL 4LP4A 1MCPH 4CJ1A 4ZAKC 1CFQA 2CDEB 2F5BL 2ITCB 4ZO6A 5SX5H 1HQ4B 2F53E 3NGBB 4XBPB 3SQBA 1QPXA 2VWEE 4AH2A 2NY4B 3L3HB 3N50A 4JFHE 3D3VA 3UYRH 3C60B 1RURL 2B5IC 2VLJB 5FYJL 3BKCH 4E41D 1VFBA 5F6HJ 1FO0L 2FLBT 4XMPH 1ONQB 4S2SB 2H8PA 2I24N 3QNYA 3FQNB 1ZHKA 4HIIA 4ZSOE 5D5ME 2FJFA 3LQZB 3RTQB 3PWJB 1KLGA 5FM4A 5EC2A 3SCMA 1P9MA 2A9MH 1Q0YH 3AMKA 3O3DA 2XWBB 5JHLL 2RR3A 3GMRA 4GMSL 5AG9A 1OP5K 3WUZA 2G9HB 1PQZA 5ALCH 1NEZG 1L7IL 5TDNA 2I5YL 2X5PA 2DM2A 3MRGA 2R0KL 4QY8B 2G2RA 4BSVB 4LRNL 3IRPX 1G7JA 3Q2CA 4PJAF 3RU8H 1R3HB 3N1FC 4H0HB 1IKFH 1CGSH 2EIEA 1TPXC 3ROOA 2AAVA 1MCQA 2H1PL 1EV2E 4HIXL 4R3SB 1QKZH 2DQUL 1A6VH 2F53A 2DTMH 5DC4B 3QWRD 5A40E 2UUDK 1VACA 2C4FT 4M9OA 5GZNC 2VLRE 2YKLH 3B9DA 4GBXA 3BRGC 4JO1H 1G7MB 1ZE3C 4XNXL 1DQLL 5T3XH 1NLBH 1I4FA 1AR2A 1AD9A 2J7LA 4DN3H 4EQ3A 4CDGC 4JZJC 4Y5VB 1EVUA 4R4NC 4IS6A 1L0YA 4LLUA 4KXZH 1YEDA 4U6VL 3RWCB 4LLMB 3W9DA 3HI1A 4K7FA 2BVOB 1N8ZB 4PR5A 4M1CC 1T0MB 2DWDB 5DMIH 3N0PB 3JZ7A 1U8OA 4FQ2H 4XPTL 4ZNEA 5E56A 3I85A 4P2RB 4J23A 5EZJA 2WBJA 2WINB 2QADD 1PX3A 2YD9A 4EDWL 1P53A 4M5ZL 4URTB 2ADJB 1RZFH 2QV2A 1W72B 1J05B 3GMNA 3PL6A 3TWCL 3C5SA 3P30L 2GFBA 2HAZA 1T6VN 1IAIH 4PD4K 2VLRB 1UM6L 4EI5C 2HT4C 4KZDL 2W1NA 4U1MA 1CGXA 1ZHNA 4Z9KB 3VI3E 1MLBA 4LSTH 4MS8C 1HOCB 1E6OH 5EG6C 4QOKE 4D0CA 1CDIA 1A4JA 1G9ML 4JDZA 3REVA 4DN4H 5E4EC 1UWGH 4MLSA 4Y1AE 3QB7C 3GI9H 3DYOA 4XC1L 2AEQH 3TNMA 3V5DA 3VD4A 2FWOB 4YNYB 1EHXA 5EORH 2ICEB 4G8GE 2VISB 4JFZL 4MJID 4WDIB 4G6JL 4EDXB 1OT1A 1IAIM 1GGCH 4JPIA 2G60H 4NKOA 6FABL 5CLTA 5GGTL 5FCUL 2PW2B 5LWYL 4IMLA 2KZWA 3S4SA 3SE8H 3GMMB 4QRUA 3VFVA 4CMMB 1J1OH 2F19L 4WTWA 1J5OH 1E28B 1TZIB 4EBQL 5D2NC 4GKNA 4PJCE 1X5XA 1HHKA 3GSNL 3JV6B 3BVNB 2X70B 2CGRH 4PGEB 4V1DA 1FZOB 3IKCB 4KK9C 5MEND 4BH7A 3TBSB 2QBWA 4YR6A 4WFFE 1YECL 4HX1A 3DTXA 3SGDI 3FTGB 2EKSB 1VADA 1NCBL 5C2BL 2WUBH 3TPUB 1F02I 2X10A 4NN6C 3RJDA 1BD2D 1ZT4A 3DETC 4HKZB 1KJ2A 1LNUA 1DN0A 1MJ8H 1FL5A 4Y5YC 3O6FA 5J11B 2ORBH 1DANT 4NPYB 4N0YH 4G8IA 1NC4B 4HUWA 2FEEL 2AK1H 4NN5B 3SO3B 4NZTH 4ZO9A 2AK1L 4WFHD 2HVKB 4Y16C 1Q9OA 3F8UB 5GS1A 2Z8WC 3RHWK 2Q1EA 1FG2B 2IBGA 4UAOB 1CFNA 2AQ1A 2V6HA 2C7UB 1QHPA 2BSTB 4PJDF 1MFCL 5HI3C 3FFDA 4HH8A 3C5ZB 3BUYA 4KJYA 1PLGH 4OUUB 5JXAL 4AK1A 5HGAA 4V1DE 5MEOA 1OL0A 1BMGA 3D25B 4L3ED 3WXVH 3KDMB 1MRDH 1B90A 2BY0A 5JORA 5HPMB 3QXAA 1GIGH 4D94A 3ZDZF 4B5EA 1EJOH 1MWAH 4QRRB 5I1AB 2MPAL 4NQCD 4QTHB 3TPKA 3B9KC 4LLVA 5HYQA 1RJZB 1CDGA 4NN5C 5TQ2L 1RUQL 3KPSB 2IQ9L 2B1AL 2O5YL 4C56B 2LVCA 1GAFH 2VE6B 4FTVA 1FO0H 1NBQA 2HVJA 2BVQB 2VNCA 4MXWL 4V2CB 5IHBA 4AEIL 4RDQF 5HYEA 4PTUA 3RWHB 3DYPA 5LCVH 1P7KA 1NCWL 3ZE2E 3V4VH 1NCDH 3QIUB 3GSOB 2PXYD 1CLCA 4ODTL 1V5JA 1MCKA 4PLKD 1MLCB 1A22B 2ZSWA 4H8WC 4M62H 4EUPH 1RZ8A 3O3BA 1X9QA 2XXCB 3M8OL 4FZEL 4UZGA 2D4DA 2BFVH 1A6UH 1PKQB 4AMKH 3RHWF 2DM3A 4AZ8A 4OKVA 4CW1B 3RVTD 4YO0B 3AREB 5T1LB 3D5OF 1NUFA 4RZCA 4NQUA 4UT7L 2ZUYA 1ES0A 4JZNB 3PNWB 3LD8B 5ERWB 1IC5L 5FEBA 2AV1B 2NTSP 5IKCB 4KMQA 5ILTH 5IHUH 5JOEA 1LDSA 1T0NA 2HKFL 5I30L 4JQVC 4CUCA 2G5BA 3NAAL 5GJSL 1KTDA 3TC9A 4LPVA 3KJ6H 4O4YH 4H0GA 4LKXB 3PDOB 1M05B 5I8OL 4J3UA 2ERJB 5IB5B 3QG6A 3WNPA 4KKCC 3FAXA 5C0AD 1K6QL 4X6DA 4ZO8A 1SVZA 1RIUH 5EU7C 5A3ID 3NIGF 2NW3A 1FL6A 5L2KA 3VXRA 2F8OA 5D1QB 3WE6A 3D2UD 2FATL 2WW8A 4MD0A 4X99B 3U36B 1TJGL 1UG9A 3O2DL 4P59L 5A3IC 1ODAA 3EYFA 2AKRB 1P5VA 2FECL 4QRTB 3QFJA 4M7LH 1CFVH 3QBTB 3ARYA 3MNWA 3QDJB 1YJDH 4HW6A 3U2SB 1V3JA 1BLNA 2VZOA 3ARFD 3S6CA 2WV3A 4NDMA 3EYUL 3HNVH 5SWSE 3BEVB 2DQIL 4ELMA 5J0BA 1K8IA 3DHMA 4OZFG 2BXZA 2VLMD 1WUNT 4GAYA 5E7FA 3MRKA 2DQIH 3JV5A 4FQ1H 2CRYA 3QHFL 1JRHL 2O93L 3P9WB 4U1HA 1OAUH 5KANI 4BM7A 3GSUB 1OCWH 4I3RH 5DJAB 2P47B 3EHBD 3LIZH 4YGVB 1WWCA 5E5MB 3ULVD 5DVOA 1YNKH 3N06B 2BCKB 3O8XD 1CD8A 1RK0A 4OQTH 5C0JA 2FEDD 3MV7A 2IFFL 3IFOA 1UWGL 1W2KT 2YEZB 1WJ3A 3W39B 4ISVA 4MYWB 4WJ5A 1LD9B 1IC1A 4OTXH 2EH7L 3IAGC 4X5XB 1YN7B 5KSAB 3G04A 3U9UB 3TIDA 2PXYC 2Y07H 2NX5D 4MAYA 1DUZA 2MCG1 1A0QL 3IFLH 3AS2A 4JO3L 1I7ZA 4HK0B 3O4OB 3BN9D 3GMPB 4Z7VE 1X3DA 4DEPB 2R0KH 5KVGL 5E4EB 5DXWA 1KIQA 3OKLB 3T0DA 1EJ6A 5FFLA 1UT9A 4GUPB 2KKQA 4FFYL 3WHE1 1H8OA 3UYPA 4NJAL 3MYZA 4WHTB 4OIAA 1TZGL 4M3JA 5KS9B 1U2HA 2F58H 4UTAH 3GRWA 2NY4C 5FYKL 1MQKH 1PY4A 2YHGA 3ZHLA 4PJHA 4Y4HB 1MPAL 2KL6A 2ICWA 2HKHL 4FQHA 1NLBL 4MD5A 2X9YA 4MHHG 4ZPVA 2A6IA 1S9VA 1Z6JT 1M7DA 2VDQH 2CMRL 2UY7A 3RWEA 2CMRH 2R2BB 7FABH 3D85D 2FB4L 1YEFH 4GH7B 5E8PA 1LE9B 3CXHK 4ETYA 3R1GH 3ZDZE 1U8QB 4OT1H 2HH0L 4I5BB 3SDXB 2D7PA 3L3KA 3MOAH 4YFLI 4LDLB 3VFOB 3WD5H 4K3EH 2HH0H 5SV4A 3DWTA 4ZUSB 5BRZA 4PRPE 1BREA 5DJXB 3MV7E 3O9WD 3LZFL 3OR7A 1JPGB 5J7CC 1E4JA 1HZHL 2DJ4A 4LCCB 1FIEA 1RY7B 4JHBA 4K3JL 4F8QA 4D3CL 5LQBL 1C5DA 3IU4H 5L8KB 3HUJE 3BPCA 4KK8C 3BD4A 2P5WA 4WNQA 1Q9LB 4BQ8A 5DSCB 5E24E 1RZIB 4RFEB 2VMFA 5ITBH 4LFHG 4UTBH 3IETA 3IDMA 4X9IA 3EYVB 5KSBE 1LE5B 5HGGS 1OB1B 4HQQL 4UTBL 3S7GA 4QHNA 1R3JA 4NJ9L 3ARDD 1CDCA 1WLHA 2HLAB 4U1GC 3ULUE 2V5RA 5B3JF 3E6HA 1JUFB 2WWKO 2CLVA 5DDHA 4XAKE 4NCC2 3PGCB 4IRSC 1BOGB 4JFEA 3SE9H 1MFAL 5I1EH 5D7JA 1HIML 4U6TA 1JYXA 4G9FD 2IMMA 5LCVL 5TDPA 1AH1A 4RA3A 1FSKC 2GK2A 4NWUL 1QLEL 1WVZA 1VCAA 4P2OB 4DUWA 3VW3L 1NH6A 1K4CB 4MB3A 5IQ9A 1SEBA 1OQOA 3GSQB 2D3VA 2BFVL 1YMHB 1BBJA 2FO4A 2J3SA 1I1FB 5IV2A 4JFFA 4ONGL 3FKUS 3STBA 3MNVA 4WEUD 3JTSA 4UOJA 3D3VE 2C1PA 2H32H 5FO8B 2DLFH 5ISZA 5GGUA 1XGUA 1I1AD 2M2DA 4P4KA 4PJGE 3FB6B 4XVTL 1J1XH 4MNHA 1CQYA 4ZTPH 4K8RL 4TUJA 4NSKB 4UOW1 3Q6GL 4W81A 4XWOD 3W5NA 2F8VA 1RZKL 1RSFA 3F7PC 2Q7YB 3ZT6A 2ZWLT 2GJJA 3Q5OA 5FKPA 5A43C 5IVXA 4FXGB 3U0WH 4PJXA 3OGCB 1D9KA 1BWWA 2LE9A 3RWDA 3WJLC 5C08A 3MLRL 5D7LE 2CK2A 1AP2A 3D6GA 2VITA 3PWVB 3FT3A 2YPKA 3WUWA 3MLRH 4YAQB 1VEOA 5DRXA 2LAGB 4JFXB 1LWRA 2Y36L 3MCG1 3A67H 1T7WA 5IMOA 1I8IA 2Y06L 3A67L 2YSSA 1L0XA 3DURA 2R1WA 1XIWA 3EO0B 1CDYA 2XPGA 3CU7A 3MUHL 5IBTH 3WLWC 4M7LL 1QD0A 3VI4F 3V4PH 1FLRH 3CFCH 4PB0L 1IQDA 1S3KH 5E8OB 4WW1A 1FFNA 4PJ9B 3GIZL 3MFFA 4XBEH 1E4WL 3LN9A 1MHCB 4PJ7B 3IVKB 1Y0LB 5ESQA 1BFSA 1RK1A 3WXVL 1D5XB 4UT6H 3FRPA 3E2HB 2APVA 3GIZH 3PV6A 3VWKA 3WIIH 4NCDA 3FT2B 4J1UA 3OBAA 2VDNH 1IGJA 1MCIA 4OGXL 3MXVH 3DSNA 3HCVB 5CUSH 4JFQB 3SDXF 5CJQL 4Z77A 4IBLT 5GS2H 3T1FA 2A77L 3VFMB 4RMVA 3ZHDA 2E6JA 3IS0X 3EO1A 3DV4B 4K8RD 2XWTB 3AFLA 4YDIL 3NN8B 5C0AB 1U8MA 4ZFZB 1KEMH 4S1SL 4QXTB 2OL3B 5I74C 5ACMA 4FQQA 5I6XC 4GMSH 4HS6A 1DSFH 3FFCA 1Q0XH 1MCOH 2JELH 1KIPA 4DVRL 4ZTOL 4L4VA 3SGJC 4NO2B 4AJ0A 3HAEG 4XRCA 2FD6H 4FXLA 5CWSA 1PKQE 2HFEA 2YA0A 3MXWL 4PJFA 1P9MC 2J6EH 4HS3A 3QO0A 5CZXC 5IG7B 3MUJA 2DI8A 4FFYH 1CXHA 5KG9A 2YD7A 5E94B 5JNYB 4MAYC 4HBQA 1HKLL 1X4XA 4P3DA 3VWJD 4JDVA 3FQTB 3SDDA 2Z93B 2DYPA 3CCHB 3DXAE 5ILTL 4M02A 2VWEC 1JPST 4PV9A 1BIIB 3QYCA 1TJIL 2GTZA 3HAEB 2YZ1A 4QHKJ 3QDGB 5EC1A 1DQMH 4HCRL 4TSAL 3VXUE 5AAMA 4YIQA 4PRHE 5D2LB 4Z5RB 3T0EA 2CJUL 3GMQA 5JIIA 5ICZB 4I9WE 4LSPH 2W65B 2E6QA 5CD5C 3UMTA 3HLAB 5IB1B 1EIBA 3DROB 4WCYL 1P4BH 3SDCA 5JXED 4XMKL 4OCYH 5D1XD 2OLDA 4WCYH 3DX8A 5I8CA 2Z92B 1JF6A 4A6YL 2COQA 1ZHBB 2QQLH 3INUH 2D7TH 4NKMA 3ZDYF 3L7EB 2R0LL 1T2JA 3RWIB 1I7TB 3OJDB 4M48H 4P3WA 3BQUD 4WTZA 3N1MC 5ALBH 3P3YA 4MVBD 3B9KD 4GO6B 5IEHA 3SJVD 3ARGB 3UP1A 4PGBA 2L7JA 2ID5A 4MCZB 1A2YB 3C6LA 4S1RL 1RVFL 4TPRL 1MHEA 3LIZL 1UCTA 2GCYA 1FLTX 3DVNB 5C0CE 3BKMH 1BIHA 3TO4B 3MREB 4JM2B 2IPTL 2Z8SA 4S2SA 4X4YA 5JA8B 4V2BA 4YBQC 1DQDH 3MV8D 5I1LB 4Y4HD 1N5YH 4ODBD 1ACYL 4L8DB 1DTUA 3BQUB 1ZA3B 3BESR 4W68A 3SO3C 2J1KA 4JRYA 3V95A 1U91A 5SV3A 3IFNL 1ACZA 1OSPH 4TSBL 2N1KA 4ZFOB 2OX5A 3VXNB 2RFXA 3P77B 4JO3H 1B3JA 1FPTH 5JLZB 1GGTA 4JB9L 3CVHB 3CH1A 4PJIB 3DIFB 3WFDL 2EDFA 5KJRL 4JFPA 4PYGA 5GSRB 2P7TA 1CD1A 1FFOB 4RRPA 3RPKA 3L3DB 3ZZ1A 3W9EA 3GSNH 3ROOB 3PXJA 5C0BA 1T04A 3BP4B 4FQXA 4DZ8A 1PGRB 5CP3H 1N0XH 5DLML 3NCYS 1A7NL 1G0XA 2RCSL 3DSFL 4Q7DA 2AK4A 5CIPB 1A6ZA 1EUUA 2SEBB 4PLJD 5CP7A 1RZKH 1F00I 4RMSA 3O3AA 3EOTH 2AJUL 5C2BH 2GY7B 4JM2D 5IUSA 4LLUB 1JMXA 4KGJA 2ZUSA 1KCRL 2AJ3B 3OX8A 2DLGA 3MCLL 2MFNA 4PR5B 4X4ME 2J8UE 3QQ9D 2F54B 1EHLH 2J88H 1T03L 3EGSB 4HKBB 2GJ6B 3HE7B 3KPNA 4ZXBD 1D5ZA 4UILH 3CSBA 1L7TL 3B5GA 4KKLD 5F7NC 4LK4A 1ZVHA 3H3PL 4YHNB 5C07A 3T77A 3NFPA 1HHHB 1W72A 3KPOB 5CSGA 4JO4L 5IMLB 4QGYA 3UBXA 4MA1B 2XV6B 4HMDA 2D31A 2BJMH 1CDUA 3QULA 5DURB 1HQ4A 4YHLL 4LHUA 1EO7A 4S1QH 3RL1A 5JR1H 1BQUA 3K2UH 4NQEA 3UTSA 5MHSE 2UV3A 3ARED 5T1LD 4NNYA 3OAZK 2DQFA 1KOAA 1NL0H 2DF3A 4JY5L 4GAGH 3X14A 4M00A 1OT2A 4KKCD 3LKNB 2DRUA 4GXUN 1N4XL 3FQNA 3LKSB 5F96L 3TNMB 3QQNA 2APWA 3HMWL 3FL7A 5CJ8A 1RULL 4HV8A 1NCDL 3RZCD 1W0VA 2J8UA 3B2UC 1BGXH 5EN2B 1XR8A 1CICA 2WBWB 2DQGL 4WTXA 2OSLB 5DK0B 4X98A 3FB8B 4EN3D 2QTEA 2A6DB 3EYSH 2EYSA 4ELME 1KLUB 1JPTL 3MLYL 2IMNA 1HH6B 5INDB 1BM3H 1OLZA 4U1JB 4JQXC 3UDWC 3VGEA 4XMLL 2R56H 4XNZB 3HI5H 3C8DA 1EFXA 4DKFH 4NBXB 5EPMA 5B39B 5FOBA 4LDOB 1ZA6A 2XOTA 1TZHA 4WO4C 2WBJC 3H9SE 4LDEB 3UTTD 4OF3A 2QSCH 2ESVB 4NOBA 2HTKC 4GAJH 5DFVD 3CLFH 2FX8H 5BRZD 3IDYC 4O4YL 2EE3A 2E6PA 3DBXB 2IALA 4UDTB 5GGVH 4GLRI 5GS1C 3PJSA 4NN7B 3KVQA