2IGFH

Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
221
structure length
221
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFTFSRCAMSWVRQTPEKRLEWVAGISSGGSYTFYPDTVKGRFIISRNNARNTLSLQMSSLRSEDTAIYYCTRYSSDPFYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA B13I2 FAB (LIGHT CHAIN)
publication title Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 A.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 41
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1991-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfH01
4MD4A 4ZUUA 1MFCH 2R39A 2QSCL 1NFDF 4M8QB 1A0QL 5D6CB 3BO8B 2GW5A 4HFWB 3BRDA 4LF3B 3HC4H 2P5WD 2VAAA 2WBJD 1AKJB 2EE9A 3LDBB 5KVEH 1SEBA 4DKAA 3MRMB 2BRRH 2HVJA 3CDCA 4P46B 1QKZH 1BZ7A 1OF2B 2J8UE 5J11C 1NCNA 5D2LE 4X6CF 3WIFA 1IARB 1F6AA 1KB5H 2OI9B 4HKBA 5FYLE 2OSLB 5D7JD 5K9OB 4H1LB 3TEUA 4EIZC 3IB4A 5DRXA 4KVCH 3CFBA 1HKFA 5I74C 4DAGH 2RFXA 5EZLA 2NX5A 3FMGL 3MLUH 3QH3B 4NJ9H 3B6SB 3WSQL 2P1YA 3D85D 2HJKA 4KI1A 3GMPA 1UWXK 3UJJH 4OCRH 1RI8A 4TVSa 1WT5A 1IGML 2QKIB 4XPGH 2HT3C 2P46B 4BQBA 2HN7A 3QNXA 1H3UA 5CILH 4GMTL 5HSFA 3B2VH 3WHXB 1BLNA 1LO4H 2NW2B 3CFCL 4OCYH 4S1RH 2D9QB 3O2DA 2YC1A 3MLTA 3OKOB 6FABL 5AZEL 1RD6A 4OCNC 1CR9H 1QBLL 4NQDA 5J1SC 1A7OL 3S6CA 2GFBB 4HMCA 5HYIA 5GJSL 4K8RH 4XGZB 1A2YB 5IHZA 3WFDL 3JV6A 3O45A 2X7LB 4LNVA 2MHAB 3T4AB 5C09D 4PRBB 4A6YB 1NCCL 4DOHB 5D1QC 3QRGH 3ARPA 4QYOB 4XP9L 4U6HB 2AS5M 1H8SA 1RZKL 1A9EA 1Y0LA 3QIBC 2JELL 2BOCA 4NCC1 2E7CA 2RB8A 5IVXA 3JWDH 3SOBL 2P8PA 4HCRA 3FO9A 1FG9C 3SDCB 2DQFB 1BVZA 3D39D 3ES6B 2PO6B 1IKFH 4MA1C 4R96A 3RZWA 1JWMA 1EO7A 1D6EA 1ES0B 2MFNA 4K3DL 3HTLX 1EEYB 1FJ1A 2ZOLB 4CDHA 3ZT6A 1U8NB 4OLYL 1P2CA 3FHAA 3KVQA 2ZOKA 4G5ZL 4X6FA 4AL8L 1I1RA 3VXUD 5FA4B 4M1GL 1NAKH 1P7KB 4GW5B 3JV4A 5JHDD 3SDDA 5C1MB 1HHKB 4QXTA 4RIRA 4WFED 1QBBA 3NIDE 1T21B 1AQKL 4KUZH 1FL5A 4OLZH 3K0WA 1L7IH 4Z7UE 5C0GA 1SHMA 3T3PF 5EN2A 3P0GB 3QIUB 3UTSA 4AEHL 3SO5A 4QNPF 1IEAB 4HS8L 3UTPE 3GIZL 4DGYL 2AXFB 1CK0L 5IIEA 3P77B 3HI5L 2W92A 3WNLA 5EZIL 2Y36L 2AGJL 1S7VA 1H8OA 2OTUB 2LU4A 1DQTA 1PY4A 3LEXA 4HKJA 4XAKD 3SCMC 2EDQA 1J0KA 4ZAKD 3VMOA 1D9KA 2EYRA 1CDCA 1ZHBA 3QJFA 4PJGB 1YEKH 5D7SL 5DD0H 3HZKB 1W8NA 2KL6A 4DTGH 3BH8B 5FUZH 3IF1A 2MMXA 3KPRB 2OTPA 4H88L 5DRNB 1YEGL 5IBTL 4CU7A 5KVDL 3L3DB 3VXRD 3MO1B 5I17A 5TJWK 4NN7B 3V0VA 1G9MC 5GRYA 3ROOB 1J5OH 3MXWH 5BXFB 4KDWA 5CUSL 1U3YA 2E7BA 1AQDA 4WUUE 3LHPL 3LPFA 2IEPA 1GIGL 1B90A 2WUBL 4OKDA 1MJ7L 5I8CB 2P5WA 2JIXD 2VYRE 4M6OH 5KOVC 3MRNB 3LRSB 4BQ8A 3OPZH 1CFQB 3WNKA 1CXHA 3PWPB 3PHQA 3VJ6A 4KK8C 2AJ3B 5J1AA 3O3AA 4NKOB 1RJZB 1ONQB 3WL9A 3H3BC 2W9EH 4OF3A 4PGCA 3FQUB 2E6JA 1P9MA 2ITDB 2XZQL 5C08D 2NY6D 3DGGB 3I3DA 4LCYB 4E41D 3GMQB 2HFEB 3I6KB 1A1OB 5C0AB 4UOW1 4XH2B 3D85A 3SJVB 1K8DB 4HKZB 2HRLA 1R24B 2IAMC 4M6NH 4M43L 2YD9A 1DFBL 3QWRD 4NGHH 4WEBH 3MV7A 1XAUA 3BJ91 4MJ4A 4FA8A 4K7PX 1KEML 3MLSL 4W4OA 5E00B 5IB4B 3HZMB 5ILTH 5TE6L 4LSDA 4D8PB 5CSZA 2NY7H 2XWBB 3RWJA 4XPTL 4I3SH 1C08B 4LGRB 2EC8A 1KN4H 2X4PA 4PY7A 5D72L 2EYTA 4PBXA 4M02A 4L4TE 5CEYB 2CIKA 5I1GL 4P59L 1T4KA 1K4DB 5TDPB 4DJMA 5LQBL 4NYLA 5IMKA 1T3FB 1CG9B 4MD0B 3W9DA 2ID5A 4OUUB 4X99B 5C09A 3HZYB 2AV7B 1UG9A 1XF3A 4Y5XC 4N8VB 1OTTD 4U1JB 4RSVA 2BOBA 1YEFH 3DMMC 3RZCC 4O2EB 5JO5A 1PEZA 1HH9A 1YECH 3F12B 1G7JB 1QFOA 4QT5B 2YKLL 4HXBL 3LQZA 4PD4K 3BKJL 4PJHF 1QA9A 3HNSL 5F9DC 3Q6FA 1R3KA 3CX2A 3ROLB 2HYMA 3D39A 1EEUA 1NUGA 5DD1L 4PUBH 3JTSA 1TDQA 2DYPB 4LKXA 1XGPB 4LVHC 3QCTL 4PJEA 4DGIL 2VLRD 5L8JB 4KTEL 5F9JB 2H2SD 2E3VA 1EHNA 1ZXQA 4WV1C 4U1GC 3SDDC 1I4FB 5IV2B 4G3YL 4I3GA 3MGAA 5ESVB 2QADB 1I85A 3VXUA 3GI9L 3MXVL 5JHDA 3DRQB 3PNWA 3M17B 4JG1H 3FCTA 4PRAA 1NGZB 4YQXL 5KS9F 3DYPA 5TQ0L 3AUVA 4LSVH 3K7UA 4RWYL 2DL9A 4DKEH 5MP6L 1B4JH 4XXDB 5DJDB 5A3IC 3BYYA 2NCMA 3ARDD 1MQKH 5CINL 1DQQB 3I84A 3HE7D 2R0KH 5IOPA 4JR9L 1AP2A 2DJSA 3UX9B 4HW6A 1J8HD 1FG2A 5DXWA 1D9KC 3SY0A 5D70L 4PJ7A 5I19H 1KIRA 1TZHB 1X5HA 1G9EA 2XRAH 1XIWD 1Z5LA 2FEDD 4ENED 2VDKH 4L29B 4ZAKA 3SQBA 1T7VA 2X2YA 3GMLB 4HBQA 1TJHL 4LHQB 1HINH 1T7ZA 5D8JH 3CSBA 4NWUL 4MB5A 2DBLL 3DUSA 1CDIA 4WRLA 4NO2A 3BWAB 5BMFH 2IADB 4OZHA 2ATPA 4IRJC 1JHKH 1X5YA 3VGEA 2XA3A 4IRZL 3FKUS 2VDOH 3VE0B 4K94L 5BO1H 1FHGA 1KIQB 2VDQH 4L8BB 4A2LA 1S9KC 3OKNA 5DFVC 1D5MA 1OPGL 4YNYA 1VFAB 4JY6A 4HD9A 4GKOA 5F7EL 1G7LB 2AERT 5BVJA 5L88L 5FKPA 1AO7B 1DR9A 4P2OC 5SX4H 1JIBA 2FX9L 3JTTA 3TPKA 3RUGF 4ONOA 3U6RA 2XKSA 4I18C 2UY7A 1X5FA 4PV8B 4IRSD 1CXEA 2BX5A 5AZ2H 1N5YL 3OKEA 1P9MC 3ALXA 5E8OB 5HVFB 2WQ8A 5EB9A 1EMTH 4NQXA 5F7NC 5TQ2H 4ISVB 3BI9X 1N8ZA 5JDSA 5GGSY 4KROC 4OZIB 1DDHA 2EKSA 2V17L 3PDGA 2ADJA 3L9RB 4PY8J 3TJEH 1M6OB 3FT3A 4E41A 3B9KB 4YBQD 3REVB 2NY1C 3PWJA 2IH1A 3DV6A 3EDDA 1UKSA 4IBLT 2AEIT 2X4QA 2A6DA 5B8CA 3I2CL 1F4XL 5CJQL 3QWRA 4KY1L 4GO6B 3E1F1 4RGMB 4WGWB 3ZKQD 3V6OE 4M7ZC 5ECJE 4JO3L 2FX8H 1M7IB 4GT7A 4J3UA 3JSSA 5CJBA 1MUJA 4WUUB 4Q6IB 4GG6F 4I2XE 4DWHA 1J9CT 1FFPA 5EOTB 1D5BA 1L7TL 4P9HL 3GSNH 1S7WA 2LTQB 2JJSA 5IBLD 3VW3H 3RNKA 1CFSA 3QUXB 3LEVH 3V6ZB 1A7PL 5IM7B 1IAKA 2DM3A 2NY3D 5J4MA 2XTLA 4X4YA 4JPVL 4QGTA 1S7UA 2XICA 1PJ9A 2UWEF 4N90D 5HDOA 3MROA 1Q0XL 2ZPKH 3EYVA 1KFAL 1FBIL 3NZ8B 2ARJB 4YDLC 4S2SB 5I9QB 3EYQC 3VD9A 2VLRA 1CT8A 1QQDB 3MODL 3U82B 1I9IH 1Y18A 4ODWB 2PETA 4UI2A 3SQOH 2EDOA 4RRPG 1IC4H 5I75B 4RISH 3IDNA 3G6AB 2ZUQB 3VXOB 5IW6B 4LPYA 1FE8H 1WFOA 4XB8A 5DS8B 1Q9LB 4JLRA 2W9LA 3E6FA 2CO7B 2XNAB 3CK0L 3MLWH 5LKNA 4HH8A 4P5TA 1KTDB 3TCLB 3QUML 4RWHA 4BQ6A 1UM6L 4F7TA 1VEMA 4NDMB 5JOFB 3ARDA 5C0CA 2H9GA 3HE7A 4ZXBB 2BVYA 3LQAL 4NQDE 1J8HA 3MRLA 1H3WM 1BD2D 3CH1A 3ARFC 4BSJA 3DI2B 1IGYA 3MYJB 1E4JA 3CXDL 4M61B 1J87A 1XIWA 4OCWL 3ARBC 2G60H 4XB7A 1VPOH 3KYKH 5DUPH 1F3JB 4JEGB 1E0OB 3EJYD 1CE1H 1M7XA 5C7XL 2DI9A 5FEBA 1K85A 4PJ9D 4OM0H 1MIEH 2ORBL 4I9WE 4UINH 3HUJB 5J11B 1MLCA 4CN6A 5IVXE 4O02L 4L9DA 2VH5L 1O7SA 2GK0A 4L4VD 4GKSB 3RWEB 3U0TA 2GITA 1OQOA 3O4LB 4OLVH 5FB8B 1NL0H 2RHEA 2A6KB 4HG4K 5EOQL 4H5SB 1BBDH 5I74B 3MLYH 5C86A 1S9VB 2X44D 1FV1A 3QSKB 1X7QA 2BC4A 2XKNB 3B9AA 2ED9A 4U6YA 1M7DB 1ORQA 3U4AA 4LCWD 1DL7H 1N0XL 4MVBC 3L5WA 1PG7W 2WW8A 5CWSA 3UPRB 4LEOA 3BZ4A 1N0LA 4OV6F 3GMRA 1CCZA 1DEDA 3QEQB 1W72A 4EN3B 1ZSDB 3DWTA 5DMIL 4ELKB 4IRSA 4KQ4L 3G5ZB 2QQLL 3TT1H 1G9NC 4KK5C 1OARH 1Z9SA 4N5EC 4K2UH 4YHNB 3HRZB 3UTSE 4Z95H 3RWCA 2DQEL 5H2BA 2VZOA 4R90L 3BP7B 1XF2A 1AFVH 4HLZH 3GK8H 4KRPC 5B8CC 3RX8A 5F3BA 1H3XA 2XY2A 2IG2L 1KJ3L 5I71C 3WYRA 2VQUA 5A1AA 3MCLH 5DLMH 4GUPB 1PX4A 4K3JH 1PY9A 5D1QB 2JB6B 3U1SH 1NMAH 1I1FB 3RDTA 2H32B 3QIBB 4TTDD 4CVXB 1C7TA 2BY1A 3FT4B 8CGTA 1S3KH 1IGJB 3EFDL 3GM8A 1SYSA 2BMKB 1JRHH 4IOFC 4N0UB 5KSBF 4MSWB 5GS0C 2LE9A 3AC0A 1IC5H 1RIHH 4TUKH 4ELMA 4UV7L 4YGVA 1DE4B 4ODTL 1YEIL 1ZT7B 4JCMA 3QUMA 5GGUB 5IB2A 4N0FA 3VRLE 5F7UA 2FIKB 2I5YL 3BPCB 2OTWA 1JV5A 4UT7L 1KT2B 5EU6D 2P5WE 2M26A 2YA2A 5L7XL 2Y5TB 3V6FA 3GSWB 3DTXB 1RJLA 4JHZA 4HSQA 2XACC 3ILPA 4XPBL 2DQJL 1BFSA 4L1DA 2C5DC 3GMMA 4HUUB 1OSPL 4U1NB 4HF5H 5T1DL 5M7QA 3RGHA 4ZNCD 3FQWB 5E8EA 3BRFA 3MJ8A 4R97C 5HJ3A 4IMLB 5SX5K 1QFWH 3N06B 4M5ZL 3EHBC 5ADOL 2EC9U 5EUKA 1HYSC 2X9YA 3ZE1F 4RFNC 4KK9C 4W81A 4G6JH 3GSUB 2ZG3A 5D96C 1IC1A 4I0PD 2WP3O 5F7DB 4OIBA 1DQDL 1RULH 5GS1A 4JPWH 3T2NL 4ZFZA 5JTWA 4P5TC 4OT1L 2I26N 4HUWB 4NPYB 1EIBA 4FZ8H 5HHVL 4HAFA 3WDJA 4Z7QE 3CFIC 5INDB 5TGBB 3MV7E 3V7AE 3O8XA 3UPCA 4QEGA 1IGIH 2IQ9L 4M93C 3WIIH 3H9HB 3QUYD 1PQZB 3L3JA 4ZUUB 1XF4A 2BNUA 1A7QH 2FYYB 4J1UB 3TN0D 4WFGD 5I66A 3KS0H 2UUDH 3TVMC 3UZEA 3C8KA 5J1TC 2BSTB 4HPOL 4PIRF 3FB7A 5DEZA 1HHHA 1R3LA 1BM3L 4Y8AA 5CZVL 4RMRA 5C09E 1JP5A 2X40A 3SKNB 4OCSL 3MV11 3MOAL 4Y5VA 5GGVY 4K55A 1U8MA 3IFNL 1CLOH 1N64L 3EYUL 4DGVH 1KACB 4PJ9A 2NY2D 4Z77A 2VKXA 3RTQB 1VACB 3VFWA 2XN9D 4JKWA 4NWTL 3VGFA 2Q1EA 1JPST 4YJZL 4DUVA 1MFEL 4JVPA 5B21A 4CAGA 1HSAA 25C8L 3PHOA 3S88L 3D39E 2L4OA 43C9A 1ZV5A 2DI7A 2NY0C 1NGXB 4PJEE 4MCZB 4V2CB 4FQIH 3LEYH 3X11B 4HJ0D 3OAYK 2R0LH 1CD1B 4LHUG 3PIQA 5CCKH 5CEXB 5I1DB 1G7IB 1ZWIA 1FVDA 2P48B 4LCWA 3MTRA 3OKLB 3VXUE 3OJDB 1FPTL 1GHFL 2IAMB 2PTVA 1OL0A 5JHDE 4Y4KA 1QRNA 2YR3A 3LMJL 4AT6A 2OM5A 2PF6A 2Z35B 4TVPD 5IFAL 2X4UA 3TGXA 1O5DT 3JBG7 1NC2B 4FQ2H 4JFOB 3VXPA 2ADFL 3QCVL 3PWUB 2AEWA 3FFDA 4ZPTA 2NXYC 3BUYB 3GIVB 1WFNA 2F15A 3MUGA 3O3UN 3KYMA 4HV8B 4TUOB 4H25B 5JR1H 5E2VL 3DHMA 3IFOA 4MA7L 4PJ7E 4POZD 5HHMB 5LG1A 3RDTC 2J5LC 4XAKE 1CU4L 4Y5XB 1MVFA 5A2KH 4RAHA 3DMMB 3RZCB 4PS4H 5FOBA 4H20H 5EIIB 5I1LA 5HHNB 1NUFA 4Y19D 4LAQH 1AI1L 3BKMH 1YY9D 5ANMB 4O2CA 4JAMA 2ZUSA 4O58L 4ZFFB 4FFZH 2EC9T 1T66D 4OZHE 3BD3A 1J1PH 3ULUH 35C8H 5DYOB 4DQOL 5JQ6H 3ILQD 2ZOKB 4OFIA 4LVHB 5C9JA 3NGBC 1PX3A 3ZYOA 4MA3B 4UBDC 3GBLA 1LO2L 4PJ5B 5CZXD 3FT2B 4WV1B 4U1GB 2F53D 4TVPL 5LWYL 5DJ6A 5JLZB 5E2UH 5F8QC 4AQ1B 1WUNT 2NPLX 1T7WA 4HK0A 2EO9A 1RUMH 5GXBB 2COQA 2P5EA 2Q7YA 1EFXA 1UWXH 4GW1B 3RPIA 3P2TA 2HJFB 3S35X 4WDIA 3IDMA 5EBGA 3PP4H 1FDLL 1B2WL 1HZHL 2CXGA 2YRZA 1T0NB 1AGDB 5CIPH 1MRFH 2Y07L 5DUML 1A14L 1K5NB 2YRPA 3LEXB 4HKJB 4LSPL 4PJFA 1SY6H 1MCWW 3OJ2C 3C87A 4ONGL 2EDEA 5GJTL 4I0PA 1KN2L 4E41E 1XF5A 5LGJA 3SE3C 2F9BT 1FORH 4U05A 5HDQL 3WLBA 3O8XC 1GPOH 4RZCB 5DJXA 5E6IB 3X14A 1MJUL 3L7EB 5DGRA 3Q1SL 4NBXB 1FNHA 4QRRD 3TPUA 4HS6A 1CXKA 5IMLA 4OF7A 3NTCL 3IVKA 3I6GB 3D18B 5EU3A 1MFBH 1YDPB 2CKNA 5GGVH 3P4NB 3QUYA 1DBJH 1E4XL 4IRJB 3K74B 4PJBF 3SDXA 1WCBB 2ILLA 4LBEB 4KH2A 4PJAB 4HIXH 4UDTA 3TN0A 1Z3GL 2NY5L 4P4RB 3LKSA 4XWOD 5F89B 3QUKB 5DJ0B 5DZOA 4Y5VC 4HUXB 2HT4C 5KANG 1GGBH 1IAII 5ESAA 1VGKA 3TV3H 5HVHC 2EYSA 1FZKA 1M4KA 4OZIF 3RVUD 5EWIL 4Z18A 4P2OB 4KK6C 2JKXA 4H8WL 1LO3H 3BEVB 2XN9A 3KPPA 4GAYB 4XC1H 5DJ8B 4I18B 4KPHL 5EC1A 5GZOD 4HIJA 1P7QB 4BM7A 2X1QA 3MFGB 3DROA 1YQVH 3BEWA 2AK4B 4FFYH 2NW3A 4DUWA 5L2JA 3IAGC 4TOYL 1T1WA 3BDBA 5D2NC 3VXTA 4KROB 3JWOC 5EBWA 3RVVD 2VLRE 4TRPH 4M03A 5E5MB 3U9UB 5ADPL 5BV7C 2NY1B 4LLWA 1EGJA 4BK4A 5C8JB 3W39A 1AR2A 4KI5F 1IILE 5F9OL 3WUWB 4JHAL 5AYUH 1K8IB 4LARL 3EYOB 1NJ9B 2J4WL 3U36B 4U7SA 3BISA 4XMLH 2Z92B 2FH8A 1BEYH 3B9EA 3RVXD 3VMNA 1QPXA 4M7ZB 4KJWC 3V7AG 1EO8H 4OQTL 3LS4H 5C0CE 2B1HH 2DQTL 2FH6A 1NLDL 4GRMA 2R1XA 3DYOA 1HHGB 2B8OT 1NMCC 5IFJA 1FSKC 2H3NA 3W2DL 1J8HE 3R06B 5E5UB 5MEND 2X4OA 4NHUB 2AP2A 2BVQA 2DTSA 2FATL 4NKDA 1VENA 2CIIA 2VDNL 5TE7L 3VRIB 3BIKB 4KRNA 4PR5A 3NFNB 1PYWB 5DSCB 2CRZA 1EV2E 2V6HA 4Y19A 4ZTOH 2B4CL 4U1IA 2EDWA 4OSUL 2RQ8A 2KUTA 4Q9RH 2HP4A 1QBML 3VWKD 4DZ8A 3MA9L 5JPNA 1UB5B 4Z7NE 4ZYKB 5EORH 3S96A 3KR3L 4YDLB 5EG6C 1Q8MA 4LL9A 3K80A 5DHVH 1ETZA 9CGTA 4UQ3B 3CXHK 3SE8H 1BIIB 1D6VL 2ZUYA 2F53A 3AB0C 2AVGA 1TETH 3MCKB 5DWUL 1CDYA 1XZ0A 5CGYD 1P4IH 1RVFL 3WS3A 2B5IB 3MRHB 4YHOH 1UXWB 3F65A 5L2KB 3QFDA 4YLQT 1AC0A 1SBSL 2FX7L 1S7SB 4NM8H 2VXUL 3R1GH 3HUJF 3D0LB 5T1LA 4KDTA 4JG0H 2DKUA 2CH8A 3ARFB 4Y4HB 3HPLA 3HZVA 4KJYA 4NN5C 5A16A 3ARBB 2R56H 4HC1H 5DVKA 3AMKA 4BH8B 4FZEL 3NIGE 3C6LD 1JUFA 3FQNA 4NO2B 3DX9B 4FTVE 2AXJA 3L5XL 3BWUC 4QRRA 5DMKA 3DRTA 2Y6SD 1AD9A 1P4LA 1FCCA 1MIML 2Z9TA 1NAMH 3L5JA 4X80L 3KS0J 2V2TA 1CDHA 3ARQA 2OR9L 1F13A 5ESQB 3F7VA 5C6TH 4JY6B 3UTQA 4D2NA 5I30H 4U0QB 3V7MA 4E0RB 4BA8A 5FCSH 2ZSWB 4P2CG 4M7LH 1NDGA 1ZANH 4G6AD 3ZL4L 2YZ8A 2XWJA 4OQTA 4P2RB 2DD8H 4HWEH 4W68A 1BAFH 4F7CA 4F57H 4QHLB 1BWMA 3MRCB 4FQXD 1T5XB 1WAAF 2AJZB 4N90E 1OM3H 3IDUA 2QHLA 4GBXD 4X6DE 4QCIB 1MFCL 1OAYH 3LSOA 4YEEA 4GXUN 5BS0D 4MNGA 3GMOB 1GZQB 3PWVB 1QACA 2VLKA 1NANI 3UDWA 3HC4L 1FCGA 1MI5B 5DHYA 5KVEL 5BJTB 2BRRL 4KRPB 5HGHB 1QKZL 4K8RD 5I71B 3F6LA 3MRBB 1FRGL 5L6YH 4Z7WF 2HAZA 4X6EA 1KB5L 4HWNA 5GISH 4F33B 4BQCA 2VNCA 2G2RB 3FN3A 3LKNA 4L8DA 5CP7A 4KVCL 4DAGL 3MGTB 5IHBA 3D69B 5AUMB 1T03H 2R1YA 5FYJL 3MLUL 1Z9LA 3SE9H 3QI9A 3CC5B 4NJ9L 1RZ8B 4MJ6B 1ZMYA 1A5FH 5KTEH 1YMMD 3UJJL 4OCRL 4PRDB 5HYJB 4DK3A 4P4KC 1X5GA 4XPGL 3T0EA 3D25B 5CILL 5MENA 3T65B 4X7TA 4PRNB 1FNEA 3B2VL 4JDVA 4LDEB 3KPTA 1BFTA 4U6XB 2IPKB 4OCYL 1F5WA 5CMAB 2X05A 4S1RL 3WUZA 4HJGB 2JJTA 2PW1A 3VI4E 5LGHH 2R2CA 3MACH 8FABB 3MJ9A 5KSVA 4JFXA 1I7ZB 2QR0A 1FYTB 4OLXH 5JW4N 2XZAH 1VKXB 4P48A 2JTDA 4ZUVA 4K8RL 4ODSL 4M4RA 1F90H 4GRWB 3WJJA 1H15B 2H26A 4R97B 2VDMH 5FO9B 3OAUH 4KUCF 4LSUH 4HGWA 3OGOE 2VABB 5BW7C 2DIJA 2CPCA 3DECA 2MPAH 3F8UB 1X5JA 2ICEA 1P5VA 4KMQA 4P5KA 4NO0B 3UBXI 5D96B 3HHRB 3QEGH 3WEXA 5GIRA 1QSED 3B3IB 3H7BB 4LCWE 1MCPH 1KLUA 1IKFL 4ZPVB 3OGCB 1TJGH 3MA7A 4AEIH 3IFLH 3WXVH 1MY5A 1QRNE 1OLZA 4IM8A 4NZUH 4MCYB 2YMXH 3MRPA 1ORSB 3T4YA 1FZMB 4YFEA 3C9NA 3LKPA 5DMYA 1FC1A 3AS1A 2EDFA 1NC4D 1OOAA 4G7YH 4RBPK 1JPGB 1NAKL 1U91A 3MFFA 4LDLB 2X4RB 3TVMB 4JDZB 2X4SB 4YZFE 2DDQH 2XWTA 5JORA 2FSEB 4LMQE 2HKFH 1F42A 4X9GA 3S3PA 1QLEH 4DN3H 2CLRA 5T5NF 2IFFH 1AE6H 4WI4A 4UT6H 1L7IL 2WQRA 1RUAH 2NLJA 3C6LA 2PW2A 2EXWD 3LKRB 4YIQA 4CGTA 1LEGB 3T8XA 1I1AD 4DW2H 5EU5A 4JFFB 1CGVA 5A2FA 3QG7H 3VXNB 3X3GH 3W81A 1DLHA 3NPSC 4OIIH 5IEKB 3MRFA 2PCPA 3G6DH 3B5HA 5F6HI 5F3HB 4LPVA 1KB5A 4J8RA 5DQ9B 2NY0B 4WTWA 3AY4A 5DJYB 4LLDA 4PJXF 1YEKL 4CVZA 4NQCD 5CWSB 5DD0L 4JN2A 2YUZA 1CS6A 4EVNA 4DTGL 5JOPE 5FUZL 2WANA 5CJXA 2CDGB 2FEEL 4W4NA 5CBAA 3MMEA 1MHCB 1BREA 1YEEH 1DJSA 2P5EE 4FFVC 4FQXA 1LO0H 2KBGA 2WWKT 3OTTA 5J3HD 1J5OL 3MXWL 3TJHD 4GBXA 1F2XK 3DV4A 2FO1A 5BS0A 5ISZD 2VDLH 1HIMH 5F7LB 3RAJH 4KHTH 1VFBB 4OF6A 2NXYB 3DUUA 2AKRA 4BSVA 2VZVA 4PJFE 4M6OL 4YHLH 4NBYB 2JCCA 3G6JB 2ICWA 4OFKA 4GH7B 3OPZL 4LLYA 3DIFA 1KNOA 4PG9B 2FL5B 4FTVB 3BH9A 3FZUC 2J5LB 4WI2A 4P2QD 1ZTXH 5IR1A 1D5XB 1ACYH 3GJEB 3VFUB 2W9EL 2W9DH 1I8MA 1YC8A 3QI9C 3FN9A 4LCCA 3VFMB 4ZFOB 1AJ7H 4LLMA 4G8GD 1UWEH 1MREH 2VKWA 4WWID 4XNMB 2H32H 3OX8A 5A2JH 3ZO0A 2E6PA 3T0EC 3WFHB 3NGBB 5IWLC 2Z31C 1S7XA 4M6NL 3PL6D 4OF8A 32C2B 4WFGE 3EYFA 1HXMA 2ICES 3QXAB 4FQQB 4NGHL 4WEBL 3Q3GA 4G42B 5DRWA 1T20A 1EAJA 1QVOB 3HAEB 4PPTA 3QDAA 5ILTL 1ZT4B 1RJYA 2BSSA 2CLVB 1JZ4A 5A43C 2NY7L 5BVPL 3GMMB 4X6DB 4I3SL 1DN0A 4MB3A 3VFTA 5IGXH 4KKCD 3OXRA 1GZPA 1KN4L 1T83A 4WI9A 5GGRB 1KPVA 1X4ZA 2W0FA 2EDNA 2XN9E 5J9PA 1W0YT 1INDH 4PLKD 5E8DH 5FV1L 4BQ9A 2EH7H 4NN6C 3IJHB 5BRZD 4F9PC 3V4UH 5HD8D 1M05B 4LNRA 1I3UA 3VFVB 2F54D 3U46A 1YEFL 4IS6B 5E7FA 1NBZA 1ZT1A 1YECL 2HVKB 3O3BA 4HLJA 3QDJA 5JW5A 2K3TA 1LEIB 4O51A 1UCBH 4LCUA 4ZUTA 3QQ4B 5GGTH 1UJ3C 3KPQB 1QSEA 4PJAF 1Q9OB 5JZ7D 1RHHA 4PUBL 1LO5A 5IEHA 2OX5A 4IEFB 5K9KB 3STBA 3QA3A 3ARSA 4WU5A 4GG8B 1NC4A 1WJ3A 1U8IA 5HGBB 3G5VB 2F5BH 5I1AB 3NAAH 4CW1B 1FNAA 5DDHA 1YA5A 4Z7OE 4NO5B 4JG1L 3QNYA 4Y5VB 1BQHA 1QUNA 3IJSA 4K7PY 1OT2A 4LSVL 4ZFGH 1U8JB 5EU7C 3QWQB 5C0BD 4DKEL 1B4JL 2XIDA 4L5FH 1G9MH 4J3OC 5AD0B 1JJUA 4LASH 5JNYB 3G08A 1MQKL 1IGTB 4OFYD 3BKCH 3OKDB 1P1ZA 1Q94B 3QHZL 5KSAD 2R0KL 5IBUG 1I1AA 1XCQA 4UU9A 2Q8BH 5FOJA 1X6NA 4PD4J 1OP5K 1S8DA 4Y19E 4X83A 4APQD 5JOEA 3TO2B 3O2VH 3IXTB 5I19L 5MEPB 2R2EB 2C3GA 2XRAL 5TH2A 2VDKL 3PWNB 3LKOB 4QTHB 5D2NB 5SX5H 1QLFA 1T0MB 1HINL 3OB0H 4NQCA 5D8JL 5T1MB 1NH6A 1NUDA 1MRDH 5BV7B 5KZCD 2VO5A 2F53E 1QRNB 3EGSA 3O41B 3T2OA 5BMFL 3V79C 3QBTB 4XT1C 3U48A 3DVNB 1EZVX 3HS0B 3OXSB 4PJDF 2FJGB 2VDOL 1MCCA 5BO1L 4XXCA 1J1XH 4HDIB 1UB6A 2Z93A 3O2DH 5I0DA 5T1KD 1R3HA 1VEOA 4RNRA 5ISZA 5A2LH 1A6TA 3BX7C 3E2HC 4P3DB 3SKMB 3QUZB 1J12A 1HH6A 4WEMB 3CFDA 2V5TA 3IDGA 5F1IA 1FLRH 4Y2DD 5I8EA 1NMCB 4TTGA 1FSKB 1VADB 3UJTH 4CMMB 1PG7L 1WLHA 5IJKA 5DK2A 3OAZK 1N6QH 1RHFA 2QJDA 4EI6B 3O6FA 4NRYB 2PKDA 5AZ2L 4BFEA 1I8IB 4P2QA 3BFOA 3MRGB 2AJXH 1DQJA 1EMTL 4ZDHA 2IH3A 4JM2D 3FO2A 2ITCA 3N85H 5TQ2L 1SEQH 4AIZA 3TBTA 5KBNC 3N1FC 4OI7A 1GGIH 4QRRE 2R2HB 3FFCD 4UDUB 5DURD 1URLA 4IIQA 4NJAH 5D5MB 3TJEL 3PGCB 2BVPB 3ZE0E 3LN5B 4OI9A 2YSSA 1H3TA 2AQ1A 4PJCA 5HHOD 3AS3A 2GIYA 5I73C 4RA3A 3QWOB 2ED8A 4KV5E 2PTTA 3V0WH 5DVOA 1T89A 3CFJA 5CP3H 5E4EC 1ZLWK 3VXQA 3AXLA 1MCIA 3AB0B 4LHJB 3STLA 5ACLA 3OAYH 3NIFF 3MBEC 2VLJB 3I75A 3VDAA 2FX8L 3S8WA 3EYSH 4Q6YA 5TDOA 4C56A 4S1DD 1CICC 4F80A 4MXVE 4PJ8D 2FIRT 1MHEA 4HS3A 2VL4A 4KZEH 5BRZA 4ETQA 3GSNL 4MNGE 5DI8A 2JK5B 1HHIA 3S5LA 4JFPB 3VW3L 2VLKE 3H3PH 3LEVL 5HYSA 1IQDA 1T22B 2P43B 2YOCA 2NY4D 4FG6C 3I50L 4U2YA 3T0BA 2FNBA 2IWGA 5C2UB 3FOMB 2VQ1B 2ZPKL 1WBYB 2ESVD 1IEBA 2D03L 4OGYH 1D5IH 1AIFB 1JZ7A 4J2XA 4X9IA 1H0DA 3AM8A 4AH2A 2ZZUT 4G6FB 1F3RB 3O3DB 1TIUA 4MAYD 2IGFH 3S37X 4MNHB 4NC2B 1Z6JT 4X5LA 4YO0A 3SQOL 3VI3E 3VXMB 1P4BH 3U4EA 1IC4L 4RISL 4NO3B 2AV1A 1FE8L 1AGFB 2N4IA 3DXAD 3WLWD 2M8XA 4QXUH 4OD2B 1UQSA 4HH9B 3T0EE 4RGNC 3MLWL 4X6BA 4AM0A 5MENE 2O5ZH 2X70B 4QHMA 4U6VH 2W65A 3FQXA 5D7LA 4X98A 1N3NB 3BD5A 1Q0YH 5F70A 3HKFA 5CD5D 3HC0A 2XT1B 2QTEA 4OFYA 5KSAA 1NCBH 3GSRA 3RL2B 2C4XA 5C0EB 3DX8A 3VXSD 4JRYD 4APQA 1R0AH 4CRPA 4GJTB 4R6UA 3CDYA 3OR6A 2APFA 1CGYA 5CS7A 4NZJA 4GSDH 2G60L 5DUPL 1VPOL 3KYKL 2V7NB 1WIPA 1CE1L 3D2UD 3QHFH 4XCCH 2I07A 5EIVA 4Z7VB 4OM0L 2A74B 2HTKD 1MIEL 5E8PA 4Z76B 1QEWA 3KLHD 3T0AA 4MD5A 3MJ7A 1BECA 1JWSB 1FL6B 5F8RC 4OZGA 5F44A 1KULA 2VIRB 5JW3H 2OS7A 5JDJA 3QAZC 3EFFB 4JZOA 4OLVL 3VA2C 1NL0L 4J3WA 4GXVH 1T1YB 3QNZA 3MLYL 4R3SB 1JPFB 2QQNH 3K8MA 5T1KA 4EZMA 5JPMB 2WK2A 1DL7L 3DURA 1U3ZA 5EUOF 1RK0A 3O6FC 4M6MH 4Y2DA 4OGXH 4C4KO 3U7YH 4P4KB 4GRWF 3D9AH 4Y4FC 3TBWB 3X13B 3TNMA 4NUJB 3ULVF 1MLBB 2DJ4A 4C55A 1F4HA 4HEME 1NCAH 3GSNA 3TT1L 1L6XA 3HG1B 3DO7B 5IUSA 1OARL 5D1XC 1FAKT 2VZ1A 1ZHKB 2V2WB 4K2UL 4IIQC 5EFIA 4NKMA 4DZBB 4JM2A 4Z95L 3SPVA 5IMOA 1TTUA 4XX1E 4ZQKA 5JPNB 5HGAA 5K9QI 2QBWA 1UEMA 5DQJA 3VFPB 4N9GA 4L3ED 3B5TA 1N2RA 4WFHD 4POYA 2VXSH 1ITCA 3MCLL 4JO1H 5DLML 5HHOA 1A7NH 4K3JL 5IROA 1OTSC 1JWUB 1K2DB 1MJ8L 4JFEB 5GGQH 3FOLB 4RDQG 3U1SL 1M1SA 4JVUA 1QO3B 4MNQB 2FECI 1S3KL 4E5XB 5DA4A 4YHKH 3RKDD 1AR1D 1JRHL 4ZO8A 5EDXA 4X0KB 4WO4C 2IBZX 1JGDA 4JRXB 4RQQB 4PJ8A 1IC5L 1RIHL 3S4SB 4TUKL 1QSFB 4DKDC 4NT6B 4R4FH 1WWAX 3WE6A 4S1QH 2R0ZH 1BVKB 1BZQK 2G5BB 2WZPD 3KLAB 4RGOH 3OZ9H 2AXGB 2J6EH 1A3QA 2LVCA 1NSNH 5T1LB 4G43B 1EXUA 1FFRA 1G7MB 5BS0E 4XRCA 2R29H 2APVA 4HUMB 1HOCB 1YYMH 1XMWA 2OP4H 1X44A 4PRPB 4FOMA 3RX7A 2C26A 2GQHA 1OW0A 3EO0A 4IJ3C 1FN4B 5HI5D 1N5AA 2JCCE 2VZTA 3KG5A 1FGVL 3AM8C 3A67L 3GB7B 2NNAA 3QDMD 2WLZA 5CGTA 5D9SA 1GSMA 3GMNB 4R2GC 2ESVA 4HF5L 5CJ5A 5L8KB 1TCRA 1PEWA 4HUKB 1I75A 1LDPH 5GSRB 1PKQA 4JY4A 4KGLA 4BSWA 1QFWL 4CJ1A 4MAYA 5KS9A 4Y2OA 4YAQA 4G6JL 1YN6B 3O81A 1NQBA 3MUJA 1RULL 3UTZB 3HI1A 2QSQA 4JPWL 3UEZA 3BIAX 3RIAF 1ZGLA 2EICA 3OKMA 3DXAA 1I9RH 4A2MA 1OT1A 4XBGA 5B4MD 4NNYA 4PGZA 2Z91B 5EZJB 3EO1A 4JREC 3WIIL 1DUYB 1QFWM 5E0QA 1INEH 4JPIB 1CXFA 4P9HC 4WNQA 1A7QL 2EEDA 5GGSA 2DLTA 3X3FL 1J86A 3QZWA 2UZYB 1IL1A 1IM3B 2J8UF 1IGCH 2OZ4L 3KPLA 4JRYA 1CQYA 3BKYH 1R5WA 5D2LF 3L3IA 1U95B 1MCWM 1AHWC 2NXZC 3PQYE 4XPHL 3ZKNC 3BPOC 5FYJU 2WP3T 5IKCA 1OSZA 2J7LA 3QXUA 4R4NC 2C1PB 1B4RA 3KPMB 5JA8B 3WKNA 4LLUB 1CLOL 1NKRA 3D2UA 4U4BA 1G9NH 1RZFH 4Y16A 1U8PA 4W6XB 1OTUD 3QDJE 3BSZH 4QRQB 3OL2A 1DUZA 1QSEE 4JDTH 4XI5C 1ZEAH 3BD4A 2W0KA 3DUHA 1MNUH 1E6OH 1DBKH 1WFUA 4Y1AB 2WWMD 4ODVH 2HLAB 2LV4A 1I3RB 3LEYL 4IOIB 2L0DA 2R0LL 2XTJC 5CCKL 4PGDB 4JHBA 3T1FA 2ZP0T 3BYTA 3NCFB 3WN5A 1UA6H 4M1DH 4P57A 5C0ND 4FXGB 1MWAB 3ULUD 2Z31B 3P0VH 3RPKA 1KTKE 3SDCD 1U3HC 4NFCA 2PO6D 3O9WC 5GS0H 2DMCA 4FQ1H 4LPWA 3TIDA 3H9SB 4WIQA 1AXSA 4FQ2L 3DVGA 1JCKA 4C54A 3MRQA 4M9PA 2R2BA 5AAMA 5JR1L 3GJFB 4NN6B 5GRXG 3M1BB 1MJJB 3EOBA 4X4MA 4XAWH 1S9YA 4P99A 5D7IB 4K3GA 4E9LA 3CAFA 4NUGH 4GG6A 1H3GA 1DP0A 4PS4L 4K7FB 4H20L 1H3PH 3L3GA 4PRID 1CDBA 1KF9B 4LAQL 4NSKA 3NPZB 2H2PD 3BKML 3FQTA 5E9DE 2H8PB 3CFKB 1NDMA 3QIUD 3SGEH 1UJ3B 2AW2A 3DETC 5GGRY 2C7UA 2YBRA 4FFZL 1CVRA 5EC2A 1RUPL 1NGWA 1QBAA 5IW1A 1J1PL 3BZFA 3ULUL 35C8L 5JQ6L 4GOSA 4KRLB 5CSBA 4G9FD 2DQDH 2UWEA 3NIDF 3BE1H 3SKOB 1KLGB 4WHYH 1U92A 4DVBB 1MHHA 4Z7UF 1VFOA 1S9XB 3MGOB 5ISZE 3IAPA 5E2UL 5IQ7H 4U1KB 4QOKD 1X5AA 1KPUB 2M1KA 1JF1B 2ERJB 1RUML 1LDSA 3RGVA 5DJZB 2CMRH 3I02A 2ZG1A 5FECB 4YX2L 4RMUA 2XZZA 2WBJB 1NGYA 3PP4L 5GZNC 1ZA3A 3QDMA 4M62H 3CCHA 1TENA 3D3VB 4QRUA 1E4XI 1TXKA 1HKLL 4P2QE 3ZTJG 3PDOA 4LLVB 5C0JA 1PDKA 2SEBA 4Q0XH 4KFZC 4PGEB 1MRFL 3FRPA 2CK0H 4MDIB 3GNML 4TYUA 4BKLB 2WSKA 4AEEA 4EUPB 2D7OA 4M8QA 4J8RB 5D6CA 5D7JB 3BO8A 4NKIH 4HFWA 3UAJC 4LF3A 1MCHA 3ARZA 2HTLC 4XX1G 1AKJA 3IXAB 1XT5A 2JE8A 3EDFA 3MRMA 3T2PA 1FORL 4P46A 3PWPD 4PJCE 4JKMA 2F5AH 3T0WA 1OF2A 3LIZH 1HQ4B 1GPOL 5J13C 1XR8B 2YXFA 4D94A 2XPGB 3OMZA 1AGEB 3U30C 1UYWH 4JHWH 2OSLA 4XCNB 5FM8A 5K9OA 1MH5B 2CLZB 4H1LA 3KYNB 2HJLB 1MFBL 2FHBA 4BELD 5GGVL 1DBJL 4C56E 2DWDB 3QH3A 4UMGA 4HIXL 4I77H 1W72H 3B6SA 5E99H 4HBCH 5C0AD 3SJVD 2D0GA 5KN5B 5C0FB 2GSIB 3HE6C 3UBXB 1GGBL 1RFDH 4JB9L 2QKIA 5BRZE 4Y16C 3E2HB 1TPXB 4LPTA 3TV3L 4KKBD 3BN9D 3WHXA 1I7UB 2NW2A 2KPNA 5D5MF 5DMJB 1LO3L 3OKOA 4V1DB 4XC1L 5EU4B 1BFVH 4WCYH 1W0WB 2BCKB 2CD0A 1G0YR 4XVJH 2GFBA 1TQCC 4GLRI 4KKLC 3CFEB 4XGZA 1A2YA 4FFYL 4N0YH 1TLKA 3WN5C 2X7LA 5JXED 2MHAA 3T4AA 4PRBA 4TRPL 4A6YA 5HI4C 4LEXH 4QYOA 4U6HA 3V5DB 3GHBH 2YUXA 5FFLA 2RAMA 3T3PE 5AYUL 3ARED 5I73B 3NA9H 2J8OA 4I0KA 4XMLL 3SDCA 2DQFA 5E4EB 1BEYL 3IS1X 3ES6A 5DFTA 3WFZA 4ZD3H 2A0LC 2PO6A 1H5BC 3MBEB 4RA0C 5D7LE 2DYPD 1ES0A 2YPKB 4F9LA 5C9KA 1EEYA 1EO8L 2ZOLA 2HLFC 2XG4A 4YE4H 3LS4L 4LQ1A 1CICB 3HAEH 4KXZI 1U8NA 3PQYB 4MQXD 1RV6X 2NZ9C 4M7JH 1RUQH 4NNPH 4JQXA 4XBPB 5TF0A 2QADD 5FA4A 1P7KA 4GW5A 4TQEH 2GJ6B 4U33A 2NYYD 3H3KA 1HHKA 1DVFC 1ZT1B 4QWWC 3H42H 1HCFX 1OAUH 5IB5B 3HR6A 3MRDB 4QO1A 1T21A 4LLQB 2DLHA 4HZAA 5HDBE 4ZS7H 1SY6A 4WI7A 1CGWA 4ZTOL 3QIUA 4Z5RB 4ZOCA 1IEAA 3L7FB 4Q9RL 1KSRA 3PJSA 4OZGE 2AXFA 4WU5B 3P77A 4M6AA 4JFHD 1CDGA 5EORL 3UTTE 2OTUA 1J88A 1ZLUH 2N7BA 1A4KB 5F6HJ 3VXRB 3SE8L 4JFDB 2X6MA 4N1CA 5C70A 2AJUH 1NBYB 5GSVB 3RGVC 4PJGA 5KOMC 5FDYA 4S0TD 3HZKA 4XCYB 1KCVH 4MZ2A 3RL1B 3FONB 1TETL 3BH8A 3RWDB 5ENWB 2XTJE 5DD5H 3KPRA 3ZKMC 5E2TH 1RZIB 5DRNA 5FGBC 3C2AH 4EXPX 2JIXB 1P4IL 4RGNB 1C5DB 3HB3D 3L3DA 4YHOL 1E27B 3MO1A 1T1ZB 1BQHG 4G8EB 3ROOA 4Z7VF 4NM8L 3V8OA 3R1GL 5BXFA 3X17A 5KW9H 1OAXH 1IM9B 2D7NA 4QF1B 4P46C 4UZGA 2Q76B 2R4SH 1JNLH 4OAWB 5I8CA 1OAZH 1V3JA 1AO7D 1EA9C 2Y7QB 5C08B 2R56L 3LRSA 1CFQA 4HC1L 3PWPA 5E9DB 5HHOE 1NFDB 3UTPD 3CXHJ 2AJ3A 4NKOA 1RJZA 5H35B 3MLPA 1ONQA 1GXEA 1A21A 3NCBB 1QYGH 1QR4A 2GJJA 4R26H 1NAML 3FQUA 3JWOH 1I8LA 1FFNB 1MEXH 2ITDA 3QAZB 1DEEB 2BFVH 2BSED 3DGGA 4X6CB 5BV7H 4LCYA 1JYWA 3GMQA 5C6TL 2HFEA 3B9KD 1A1OA 3I6KA 3S35H 4XH2A 3SJVA 5I30L 1K8DA 5JIKA 4HKZA 1MAMH 1U8LA 3W11D 1CIUA 3SDYH 1CIDA 1R24A 1F6FB 2AK1L 2UV3A 4M7LL 3DGCR 1ZANL 4N0CC 4HWEL 5GRWA 5E00A 1BAFL 3HZMA 5IB4A 1HDMB 4XWGH 1KEGH 4F57L 4Y4FB 5DTFB 4D8PA 1J05B 3CZFB 1ND0B 1Q9KB 3SGKC 2WIMA 2XWBA 3OKKB 1C08A 1OM3L 4WUUD 4U1SB 3N9GL 2CR6A 4PRHB 1OAYL 5CEYA 2ESVE 4GRLC 4X7FC 1K4DA 5TDPA 5EO9B 5D1XB 3P9LB 4PY8I 4U1HB 1DBBH 4Z78B 1T3FA 1CG9A 1VEPA 4MD0A 1EEZB 1RJCA 1EERB 3RY5A 5JXEA 2V7HB 4HJJH 4TSBH 4OUUA 4X99A 5KS9E 3HZYA 2VR4A 1E4KA 2AV7A 4EI5C 4PP1C 3QUXD 4N8VA 5ABDE 5KVMC 2XZCH 4YPJA 1OP5H 1INQB 4U1JA 5JMRA 4O2EA 1I3GH 4D3CH 5L6YL 3F12A 4IOSD 4QT5A 4EDWH 4M7KH 3QJHB 1WBZB 5GISL 1Y6MR 2CK2A 3WXWH 2X9WA 3ROLA 1F3DH 2B0SH 4D9QE 4H0IA 1T03L 2DYPA 3B8SA 1XGPA 5I1EH 3SE9L 4JQXC 5F9JA 3L3KB 4WO4B 1A5FL 5KTEL 3UO1H 3VH8B 1I4FA 5IV2A 2IQAB 1JZ6A 5ESVA 1S7RB 4JFQB 4F7EB 3LB6D 3O6MH 5D7KD 4JRYE 4H8WC 3DRQA 3M17A 1JPTH 3KJ4C 5DRZA 1NGZA 15C8H 5TPWH 5LGHL 4ALAH 3MACL 4JJ5B 4XP1H 1UVQB 4XXDA 4IJ3B 3LCYA 5DJDA 4FFWD 3S5LG 2ZCHH 3QO1B 2I9TB 5C0RH 3QPQD 4XNYL 1DQQA 4OLXL 4ZXBD 1A22B 2XZAL 3WFCH 5HYSG 4N1EA 3BN3B 3CH8A 4R2GB 1F90L 3I6LD 5FUCC 1SMOA 2VDML 4UQ2B 5C3LD 3VD3A 4LSUL 3BXNB 2APTA 1TZHA 4RAVB 2MPAL 4P0DA 5E70A 4WTXA 4L29A 1HQRB 3NBNA 1JI2A 1HNFA 4XNQB 3GMLA 3QEGL 2K9UA 2P7TB 3MJ6A 2CRMA 1RSFA 3PG2A 1MCPL 4AM0B 3LN4B 3M07A 5D7LB 1TJGL 1MCNA 4UOJA 4AEIL 3IFLL 3BWAA 1GVIA 2IADA 4N68A 4NZUL 2YMXL 3EW3B 1A3RH 3O4LD 4RFEB 4KQ3H 1ZLWH 2DKSA 3VFOB 3P11H 1TQBC 4QY8B 1MY7A 3VE0A 4G7YL 3CSYB 4YR6B 1KIQA 3WHE0 4L8BA 1T5WB 4Q7DA 1VFAA 2XA8H 2W60B 3BHBB 1G7LA 4QHKI 1AHWB 2NXZB 1AO7A 4DN3L 2HKFL 3LS5H 1QLEL 2HT3D 2OMNA 3RWHB 5M95B 3QEQD 2IFFL 1AE6L 4X4ME 4UT6L 3FB6B 5F1SA 1RUAL 4PV8A 3NA4A 4GG6E 2W38A 1I8LC 2Y5EA 3BESR 5E8OA 43CAB 4DW2L 4R4BB 3QG7L 4TUJB 1BJ1H 2RIKA 3UTTB 3X3GL 3OHXB 4ISVA 4OIIL 4HQQH 3WS6C 5DJAB 5ETUB 4OZIA 2X5PA 5J12C 3AU1B 1MPAH 3L9RA 1A7BA 1M6OA 3IDJB 3B9KA 3REVA 4WWKC 5I18H 2UWEE 1XH3B 5D1QD 1LD9B 1IE5A 1HEZB 2ICCA 3DYMA 3QIBD 4J4PC 2FRGP 3SGDI 1BBJB 4HPYH 3WO3B 1YEEL 2BY0A 1U3HB 5I0ZA 1LO0L 1M7IA 3O9WB 3TNNB 2W0LA 3QDME 4WUUA 4Q6IA 3QIWC 5FF6B 2VDLL 5K59F 1HIML 3RAJL 4KHTL 4MXQC 3P30H 5EOTA 4YHLL 5TFSH 4DFHA 2GCYB 3QUXA 3V6ZA 3L95B 1DSFH 5IM7A 2I9LB 3MOBH 4H26B 1ZTXL 4K9EL 1RZGB 4FABH 1F6LL 2W9DL 1Q72H 4RCAA 1SBBA 2JJWA 4XP4H 4HWZB 1CZ8L 5F7MC 3RP1A 2CJUL 5C07B 1AJ7L 2ARJA 3CDFA 3EZ8A 1UWEL 1WFTA 2GUOB 4S2SA 3VRLF 3MLXH 3DSFH 1MREL 3QR2A 2EO1A 1QQDA 4PJHB 2A77H 2PYFB 4ODWA 5KSUB 4P9MH 2C3XA 3SCMD 3O3EB 3G6AA 3NH7L 4LGSB 3VXOA 2QSTA 5IB3B 5IW6A 5DS8A 1Q9LA 2MTPA 1PZ5B 2NZIA 4LU5H 2YA0A 1ZHLB 1BD2B 4C57C 5HHQB 1RU9H 3D1MC 2XNAA 1XGRB 3WFBH 1KTDA 5IGXL 3TCLA 5JQHC 4JQVA 1XR9B 2GY5A 4NDMA 5JOFA 5EO1B 4CN1A 5D6DC 1MCOH 4OCMC 4ZXBA 1INDL 2DQCH 5E8DL 3S36X 2EH7L 4M5YH 4XNUH 3W9EB 1AD0B 3V4UL 3OKYA 4G8IB 4Z7QF 4YBHA 3MYJA 4J12A 2DIAA 4M61A 2IBBA 2DRUA 1F3JA 4DOHE 4D0BB 4D0CB 1UCBL 1SJHB 1OD9A 1OAQH 1KIUA 2DKMA 2FR4B 4KK8D 2C3HA 4R0LB 3HUJA 2DS4A 1HK6A 7FABH 1VESA 3RWEA 1FC2D 4GKSA 4KDVA 3U30B 1JPSH 3GGWB 3O4LA 5ICYB 1FZJB 2G9HB 5FB8A 5E56A 2A6KA 1UXSB 2DLGA 4J3VA 4OBRA 4H5SA 1FIEA 1K6QH 4XC3L 2F5BL 1S9VA 3NAAL 1EH9A 2XKNA 1M7DA 3A6OA 4MS8C 3UC0L 3UPRA 3C8HA 2IAMD 1II4E 3HE6B 3K46A 3QQNA 4ZFGL 2PNDA 3QHTC 3QZWG 3QEQA 4L5FL 1G9ML 3VRJB 4EN3A 3QEUB 1ZSDA 4X8JB 4ELKA 4NFDA 2H6PB 3BKCL 5FO8B 4PGBB 1EJOH 3G5ZA 4LQFL 1BJMA 2WUCH 4LSTL 2Q8BL 3HCVB 5EO0B 1NC2D 4YHNA 3HRZA 3E8UH 2VSCA 3RUGB 3O2VL 1J1OH 4HK3N 2FBOJ 3VD5A 1F11A 3K4AA 3BP7A 2VLMD 3NOIA 4HLZG 4OCXH 4ODXB 4QHUB 3T1WA 5HHMD 3BJLA 5SX4I 1SMAA 4I9WD 4MWFB 1OLLA 3G04B 4GUPA 5D1QA 1NFIB 1CN4A 1MRDL 2JB6A 3DMMD 3RZCD 1I1FA 2XFXB 2H32A 4PJGE 3QIBA 4F37K 4BFBD 2IANB 3RNQA 4CVXA 1OGAB 3FT4A 1IGJA 2FJFB 3KPRE 4KI5C 2GJZB 2BMKA 4PB0H 2IMNA 5EU6B 2WIIB 4O4YH 4WW2B 4N0UA 1MWAH 4RMQA 4OLWH 1H5BB 1J1XL 1I1YB 4ORGB 4CU8A 2XI9A 3O2DL 1DE4A 2ZKHH 4EBQH 3MJ9H 1ZT7A 3SDDD 5FGCB 5GGUA 1FLRL 2AXHA 2FIKA 2BHYA 3BPCA 3UJTL 1QOKA 1KT2A 4P5MB 3N1GC 1N6QL 3QYCA 3O11B 2Y5TA 3GSWA 1DVFB 3DTXA 1R6VA 3F7QA 1F3DJ 3PWPE 3UTSD 1FNFA 2AJXL 3GJFH 4HUUA 4YDJB 3ULSB 4U1NA 3N85L 4L8SC 4LSRH 5A3ID 3FQWA 3P3YA 4ZO7A 3MBXH 2YXMA 1GGIL 2CUHA 3PP3K 4IMLA 3TYGH 3KNBB 4PJIB 2VJXA 2VOTA 3T0DA 4NJAL 3GSQA 3PF2A 5CLTA 5GGTA 4F8QA 4IDJH 3GSUA 1D9KD 5DJ2B 5F7DA 4HK3J 2X41A 4D0DB 4PFEA 3V0WL 1BQUA 4LIQE 4X7DC 4HUWA 4NPYA 3RGVB 3VGBA 3ZHKA 3T3ME 5INDA 5TGBA 1IGFH 1JN6B 3EYSL 1EZVY 1ZA6B 3BPNC 3H9HA 4OD3L 3RVWD 4KJQC 1MCKA 1PQZA 3W0WB 4IRJD 2NY2B 4I8DA 4UTAH 4OD1H 2FYYA 4J1UA 3G5XA 5L9DH 4KZEL 2BSTA 3ARXA 1BQSA 5DFVD 3H3PL 4LSSH 5GJSH 3SKNA 4DVRH 3ZT5A 3FRPG 3QFJB 1RMFH 4P2OD 2VITB 2E27H 3RTQA 1VACA 2UZXB 4EUPH 4OGYL 1D5IL 4LCIH 2H41A 3STZB 1P7QD 2MWCA 3PABB 1R5VB 1SM3H 2IGFL 3JVGC 3C60C 5D1ZC 2AK4D 1NGXA 4MCZA 4KROD 5HGDB 3X11A 1P4BL 2YN5A 1S78C 1CD1A 2YN3A 5CEXA 1LNUB 5HBBA 5I1DA 1G7IA 2NY1D 2DQIH 3LD8C 3MV7D 4KKNA 3OKLA 4G5ZH 3OJDA 4LVEA 4QXUL 4EN3C 2IAMA 4U49A 1G7QB 5I1CH 2O5ZL 4U6VL 3ZLQC 2EXYC 4JQIH 2CDFB 1Q0YL 3TBVB 3M8OL 1BJ1J 2Z35A 4DEPC 4TSCH 4ZO6A 1NCBL 1LK3H 1N4XH 1NC2A 4JFOA 1OVZA 1R0AL 5JXAH 3PWUA 3BUYA 4GRLB 5SV4A 3JWNC 1EEQA 3GIVA 1Q1JH 4HV8A 4TUOA 4H25A 4GSDL 1NCUA 3CMOH 3LQMA 4QTIH 4JFHE 4RFOH 4PV9B 1PG7X 3QCUH 2DQHH 2GHWB 3QHFL 2EZ0C 2Y72A 4XCCL 5EZIH 4EI5B 4Y5XA 2R15A 4IHOB 3DMMA 3RZCA 1U0QA 4TNVF 5EIIA 3CX5J 3ARRA 5HHNA 1JTPA 5JW3L 4JCLA 3MPCA 5SWQB 4FP8L 5ANMA 2VC2H 1JNHB 2XXMB 5BZWB 4ZFFA 3MRKB 3R0MA 4KKCC 1NLBH 5CP3A 1YEGH 2V2XB 5DYOA 3BGMA 3EYQD 1GGTA 2QQNL 3CVHB 4MA3A 5C0DB 3K81A 4OKVB 4PJ5A 3MUHL 3FT2A 4WV1A 1FQ9C 1HWGB 4HULB 4HIIB 4M6ML 4OGXL 2NR6C 4KC3B 3U7YL 5JLZA 2YUVA 1J18A 3RI5K 4M00A 3D9AL 2BNRB 5KSBB 1CL7L 3QDHA 1Z0MA 2VR9A 3KJ4B 5JIIA 1AO7E 1BFOB 2IPUK 4GW1A 2HJFA 1T7XA 1E28B 3N1QC 5J6HB 1NCAL 1CFTB 2WWKO 4PLJC 5ICXB 1B88A 3PJSB 3T08A 1T0NA 4AEFA 3P73B 1AGDA 5L2KD 1CLZH 2WMPA 3S98A 1KTRL 1K5NA 5EBMB 3IETB 4OZIE 1QSVA 2VXSL 3RWFB 3ARFD 4JO1L 1A7NL 4XVUC 4LKCB 5GGQL 3ARBD 1UH4A 3GKWH 2VUOA 4KTDH 4C4KT 4RZCA 5E6IA 3L7EA 3CUPB 5LXGH 4UB0H 5HY9B 2P8MB 4B5EA 4YHKL 4M43H 4WGVB 3I6GA 3D18A 1MVUB 2PXYC 1AXTH 4L3AA 4FQHB 3CSPA 1YDPA 5CHNB 3HMWH 3P4MB 3P4NA 4R4FL 4IRJA 1E4WL 2R0ZL 3BMWA 1PKOA 1WCBA 2GYSA 4LBEA 4RGOL 5CEZD 4PJAA 1ODAA 2J6EL 3EDEA 3B8YA 1NSNL 2X42A 1TQBB 4P4RA 5F89A 3QUKA 5DJ0A 5B3NA 4HUXA 4P59H 1TZIB 2VWEC 1YYML 2GT9B 2OP4L 4MQ7B 3FTGB 3RTQC 3MREB 4MVBD 1KPRB 1D3CA 4J7RA 4FQLH 1JNNH 1G6RB 2IBGA 3VWJC 2P45B 1QR1B 1T04B 3LAFA 4P2OA 1AXIB 4KGJA 3BEVA 4GAYA 1XFPA 3IGAB 2VUYA 3RIFF 5DJ8A 4I18A 5GRVK 1P7QA 3VD4A 5F71A 4UNVA 4ELMF 2ED7A 4KK5D 1LQSR 1C1EH 1FFOA 4N5ED 2IPUG 5FDWB 2AK4A 2VN4A 4LAJH 5CJOH 1MI5D 1YNKH 3REWB 3V0AC 2M2DA 5J12B 1U8LB 5E5MA 4KRPD 5FV2A 2O5YH 3U9UA 5C92A 1ACZA 4OZFB 4WWKB 5C8JA 1NFKA 1I9RL 3WUWA 3WKMH 1K8IA 4RAUB 3EYOA 1NJ9A 5D7KE 3U36A 4LP5A 3OG4B 2Z92A 4NIKB 4PP2B 3HI6H 3ARYA 4YHPB 2MCPH 1X5XA 4JZJC 1INEL 5F7YC 3X12B 2IBZY 4JO2H 2C1OB 4RWYH 2HH0L 1C12B 4IOFD 2OJEB 3C09C 5GS0D 1IGCL 2ZSVB 1KCUH 3BKYL 5I1HH 1HHGA 3NCCB 5F96H 3QIWB 3I6LE 3OF6D 5HYJD 3R06A 1AGCB 3S97C 3VGHA 4NHUA 3VWKB 1VFMA 3S37H 1UM5L 2BXYA 3MNVB 1G9NL 3DI3B 2CKBB 3NFSL 1A6VH 1EX0A 2AJSH 5FKAB 4NZTH 2WINB 3VRIA 3BIKA 4XNZC 1MCLA 3BSZL 3ZDXE 3NFNA 1PYWA 5DSCA 3NACH 4JDTL 3WNNA 1FYTD 3O0RH 4N8VG 3IFPB 1JGUH 3A0OA 3HUJE 1ZEAL 4YDIH 4LPXA 1ZHNB 3SGJC 1MNUL 1E6OL 4K23H 5F1KC 4ODVL 4X8XA 1A1NB 1GC1C 1UB5A 3H0TB 2AI0H 4ZYKA 2V9RA 3EHBD 5CBEB 3O4LE 1NEZB 1VERA 2AJVH 1HYSD 4UUJB 1JVKA 4KK9D 1UA6L 4NO0D 4UQ3A 3TO4C 3T0VA 1BIIA 5DRZB 3IU4H 3P0VL 5ICZB 4MYWB 3B2UC 3B43A 1VA9A 1W8OA 2DTMH 3MCKA 4P5TD 4L8CB 2J6EA 4FQ1L 5C0CD 3QEQE 3RWIB 3OQ3B 4MX7A 3MRHA 3K8KA 1RIVH 2NTSP 4TSAH 4ODHH 2DAVA 1QRKA 1UXWA 5L2KA 1DLFH 1V5JA 2WM0A 2ATKB 2RCSL 1S7SA 1MF2H 2OR8A 2FO4B 3SO3C 3TVMD 3D0LA 2W0PA 3LKQB 3ARFA 4XAWL 1A02N 4Y4HA 5E6IC 5EULV 4NUGL 2X4NB 4D9RD 4N8CH 3ARBA 1B6DA 1K3IA 4XTRC 3BGAA 4BH8A 1H3PL 3GI8H 5HVGB 3VDBA 3D6GA 1HXYB 5KJRH 5MEOB 3DX9A 1CFVH 3NVQA 3MNZB 2FD6L 3MRJB 4JFFD 4OTXH 3VFRB 2Q6WB 1RURH 5EBLB 4U1LB 2ZUWA 1A6AB 2DQDL 4N8PA 2GTWB 3BE1L 4N0UE 2NY0D 2FGZA 4YHZH 4NRXB 3BDXA 3ZYZA 4E0RA 2KQMA 4EJ1C 5IQ7L 4Y5YC 2ZSWA 1ZVHA 3GHEL 1A6ZB 4PJBB 2CMRL 6CGTA 4P2RA 4HT1H 1O0VA 2Y06H 5I1JH 3KPSB 4M62L 4QHLA 3MRCA 4F7PB 1A6UH 3QG6B 1T5XA 1N7MH 1UC6A 4HEPG 4U0RC 1HN1A 1JYVA 2AJZA 1C8PA 1U8HB 4Q0XL 4QCIA 4HFUH 2GSGB 4MDJB 4W6WB 2CK0L 4BJLA 1VHPA 3GMOA 1AY1H 1GZQA 3BP4B 3PWVA 4NKIL 2OMBA 1B6UA 1DANU 2BVOB 2NXYD 1MI5A 4LSQH 3SE4A 1CVSC 5BJTA 3HMXH 5ACMA 4P23C 5IQ9B 5HGHA 3SBWC 4WW2F 3JZ7A 3PGFL 3LIZL 4MJ5B 4FTVD 3RDTD 4I3RH 2ADIB 4HKXB 4Z0BH 3MRBA 1YMMB 1HNGA 3ZDYE 3BP5B 2ZG2A 1JHTB 3ZDZE 1PD6A 1UYWL 4JHWL 1UGNA 4FXKB 1CFNB 4F33A 3F5WB 1CFBA 2G2RA 2BHZA 2ICWJ 3MGTA 3D69A 4PLNC 2Q8AL 3OR7B 1LVEA 5AUMA 4PJFF 2DM7A 3CC5A 4I77L 1RZ8A 1W72L 5E99L 4HBCL 4MJ6A 1LK2B 2QL1A 3I9GH 3VFSB 4JKLA 3BT2H 2WBKA 3BZEB 1MHPH 4PRDA 4UBDD 3BP6B 1TFHA 2XOTA 3OF6A 5HYJA 1RFDL 3EDJA 4Y88A 4MGXA 1W0VB 3D25A 1TVBB 3SHSA 4YWGH 3T65A 4PRNA 3ZE2F 4K3EH 5ESQA 4PJIF 5CMAA 3LN9A 4U6XA 2IPKA 5A40E 5ALCH 5INCB 4HJGA 2YPLB 1IEHA 1OWRM 2IALB 4WJ5B 1MQ8A 1U58B 1BFVL 1C5BH 2VWEE 2QQKH 8FABA 1EDQA 4G6KH 2EIDA 4WCYL 1A9BB 1U6AH 4JFZH 2XV6B 1I7ZA 1FYTA 3SDXF 1VKXA 2D7PA 2P8LB 2ORBH 4L8SB 1H15A 4N0YL 5SWSE 5FO9A 2V9TA 4NNXB 2VABA 4LEXL 3TZVC 4NHCH 3BQUC 2EKJA 3O4OC 4WI3A 4Z6AT 5ID1B 3GHBL 2VTFA 4M3KB 4NO0A 4QLRA 1J0YA 1FO0B 4ZFOL 4ESKA 1LE5B 2WV3A 3NA9L 3V4VH 1M71B 3B3IA 1BJ8A 3H7BA 3QT2A 3O8XD 2B5IC 3HLAB 4ZD3L 1E6JH 4CDGC 4ZPVA 3OGCA 5I8KH 1U42A 4NQEB 3KXFB 5F7FA 1RZ7L 4MCYA 1ORSA 2IJ0C 1BVLB 4KU1A 1FZMA 3BPNB 4YE4L 1KB9K 5ITBH 4S10A 4M7JL 1RUQL 4NNPL 1IMHC 3K8LA 5FK9B 1JPGA 2QQLH 2IPTH 4Y4HC 2OXHA 1N59B 1YY8B 2X4RA 3TVMA 4JDZA 2F58H 2X4SA 2Q86B 4QHKJ 2VLME 3H42L 1OAUL 2KKQA 4PBWD 2HT4D 2FSEA 5E7BA 3D48R 5HHME 4OFVA 4ZS7L 3P40A 3EJZC 4IMKC 3LKRA 4KK6D 5DUBB 1LEGA 5I15H 4YXLL 4QGYA 4OGAC 3DLQR 5FXCH 2V5SA 4JFFA 3VXNA 1HYRC 5E03A 5ANME 4BZ2H 5IEKA 2BHUA 3C60B 3K2UH 3L3OB 5F3HA 5D1ZB 1QNZH 5KAQF 3NABH 5DQ9A 5DJYA 4CVWA 2AJUL 1JYNA 1X5IA 1IAOB 4LOUC 4QHNB 1OB1A 3NN8B 4PJ5E 4Y4KD 1WK0A 5DD5L 1OP3H 1QRND 3LOWA 1OWWA 1SYVB 3LD8B 1WBXB 5E2TL 2CDGA 2LQRA 4JZNA 3C2AL 5FO7A 1DQML 2HRPH 1MHCA 1T1XB 1ED3B 2BNQE 4RDQF 1AGBB 1KJ2B 4X5XB 4DEPB 1SJEB 5KW9L 3SE4C 4KJWD 1F11B 1OAXL 2HKHH 2R4SL 1JNLL 5FYKE 1OAZL 1VFBA 5BQ7B 3U4BL 4G8GB 3G6JA 3NZHH 4X9HA 4PG9A 2FL5A 4FTVA 4B53A 1J8KA 1YQ2A 1KJVB 1JFQH 3RNQB 1EHLH 1D5XA 3PL6B 3GJEA 4O2FB 3VFUA 1QYGL 4R26L 3VFMA 2X9XA 3JWOL 4FMFA 3CLEH 1NBQA 3C5ZC 4ZFOA 3KHQA 2BFVL 1KUMA 4Z7WB 5BV7L 4XNMA 4QXWA 1OD7A 1I9JH 4ZS6C 1UZ6E 5JOPD 1QG3A 5DMGC 1MAML 3WFHA 3SDYL 3A6CH 2VAJA 4PJAE 3SKJH 32C2A 3QXAA 4FQQA 4G42A 2P5ED 3HAEA 1QVOA 1RK1B 1EFXD 1ZT4A 1FVEB 2VLJD 1KEGL 2CLVA 3KDMB 5CZVH 2F54B 4X6DA 1C16B 5FUOH 3MLVH 3RX5A 5GGRA 3MOAH 2A6IB 5EZOH 3ULVC 5DEFB 2X4TB 3OB0K 4KV5F 1REIA 3GSQB 2HFTA 1T2QH 1FP5A 1F2QA 3JUYA 1JE6A 2FJHB 3IJHA 4HJJL 1JL8A 2EDRA 4TSBL 1MFEH 1U93B 3WHE1 4MHHG 1M05A 3BVNB 2AK4E 2XZCL 4L9LC 3VFVA 1CWVA 4IS6A 1CGXA 1I3GL 3V5HB 4D3CL 2HVKA 2FZ3B 4M7KL 4EDWL 1LEIA 3QQ4A 3SE3A 1XGTB 2B39A 3KPQA 3RRQA 1Q9OA 3WXWL 3TFKC 3QO0B 3EZJB 2B0SL 1P6AB 2OQJB 4G6FD 4GKNB 3Q5YA 4BK5A 5I1EL 2ENSA 5K9KA 4QRPB 4TNWF 5I1IH 5C0BB 2Y1VA 2PXYB 3UO1L 3G5XB 4GG8A 4HWBH 2MQCA 3VXMD 5E6ZA 2ZUVA 5GPRA 5CKAA 3L6FB 5HGBA 3G5VA 5I1AA 3O6ML 4CW1A 4XBEH 1FL3B 4NO5A 1JPTL 1MFNA 2I27N 4LFHD 4MQSB 15C8L 4PJDE 1U8JA 3CDGB 5LBSH 5TPWL 2VDRH 4ALAL 4XP1L 4N0RA 2L7JA 2Z0BA 5AD0A 2ZCHL 3VWJB 5JNYA 1IGTA 3MV8B 4S1SL 5FM5M 2AEQH 3WFCL 3OKDA 1Q94A 2DICA 5BZDB 1WIUA 5SWSB 1PZUB 2F8XC 1LP9B 5KZCB 5HDLA 5SWZB 3TO2A 2F74B 3IXTA 5MEPA 3MQIA 2R2EA 5SV3A 1S9WB 4HWUA 5HTSA 3ARGC 5C0IB 1TJIH 3GUTB 3PWNA 3LKOA 4H1LH 4U3XA 1AC6A 4QTHA 2HMIC 3MR9B 3PP3H 5D2NA 3TWCH 4DQOH 1T0MA 1LWRA 4YHMH 5T1MA 3HFMH 5T3XE 4M48H 3QDGB 4ZNEA 1KENH 4K3HA 3O41A 3U0PB 4E42B 5C3TA 1OGTB 4XCFH 4ZSOB 5IJVB 3ESUF 3HPJB 1GOGA 3DVNA 3HS0A 3LRHA 3OXSA 4PJXB 1RZJL 1A3RL 2FJGA 4KQ3L 3P11L 3P9MB 4JZJB 4HDIA 2B2XH 5L2KE 2XA8L 2QLVB 3C09B 3SKMA 4P3DA 3QUZA 1KELH 2E7HA 3NIFE 4M8VA 4AYFA 3VFNB 5DEGB 5GRJH 5MHSE 3FFCB 5DURB 3B9VA 1VADA 4KKAC 1BF2A 4CMMA 3QP3A 1KXVC 5L8LB 5DC0A 4J3XA 1H9VA 3QXVA 4EI6A 4NRYA 1R3JB 1JK8B 1I8IA 3AREC 3TCXA 4A6YH 3HG1D 3GBNH 2MOVA 3MRGA 2N56A 4XNZB 1EGJL 4MLSA 5JMOC 4WW1B 4NRZB 1QFUH 2R2HA 1ZS8B 2Q3AA 3BGMB 4UDUA 5GHWH 2AJYL 1MPAL 5D5MA 3PGCA 3VGAC 2BVPA 1I8KB 2VMFA 3LN5A 5I18L 4Y0GA 3R8BB 3OV6A 3PWLB 4HZLB 3I3EA 4JFED 3QWOA 1XGQB 5CEZE 5IVNA 1BP3B 1U8KB 3TO4B 4NQVB 2UYLB 4XVTH 5IF0B 2EEAA 2BNQB 4HPYL 3NFPB 5B38B 1MSPA 3CVHH 4HXAH 5HGGS 2VLJA 4Q97A 3BMVA 1F97A 5I2IB 4P2RE 1ADQH 5B39B 2DIBA 5IHUH 2NY4B 1WICA 5HYFA 3GBMH 3PV6B 4WTZA 1UEYA 2OK0H 4KPHH 3P30L 5T1LD 3B83A 2JK5A 3N50A 1S5HB 4JFPA 5TFSL 5B3JE 3SO3B 3UYOD 1DSFL 3PV7A 4PRPD 1MI5E 1T22A 2GKIA 4PB9H 3MOBL 5I16B 4AJ0A 4I5BB 3FOMA 4FABL 2VQ1A 1WBYA 4JPKH 1G7HB 1FZOB 4XP4L 1AIFA 3RA7H 1ZVSB 5DR5H 4JHAH 2DI8A 5KG9B 1UZ8B 2PYEB 4LARH 1RQ5A 3MLXL 3O3DA 3DSFL 4MNHA 4YPGB 3IKKA 1CBVH 2D7QA 4OUOA 2A77L 4JJHA 5IESH 4QRTB 3VXMA 1R3IH 1H3VA 1YEHH 1GAFH 4NO3A 1IKNC 1AGFA 4BFIB 3VXSB 1YEJH 4LU5L 4OZ4B 2A9NH 3TH2T 5HYJE 1J0ZA 3MRRB 3ME0A 4OD2A 1RU9L 2BVEA 4Y5YB 4HH9A 2GI7A 4KMTL 2X70A 3WFBL 3DPBA 2YHGA 3W2DH 5HVWA 1N3NA 1BOGB 3ET9F 5E94B 1JGVH 4LRNH 1A47A 1KBGH 1MCOL 1IZJA 3F7YB 4FFVD 3RL2A 5TE7H 4I13B 4XNUL 1FFOB 4U0RB 1WC7B 5C0EA 2VISB 1JTTA 4ZG1A 1FYTE 2VLKD 1G6RH 1LE9B 1PAMA 5C2BH 4GRWE 3MV9B 4PTUA 1PVHA 1YJDL 1FNSH 1DN2A 5HPMB 3HR5B 3MA9H 1JBJA 2V7NA 3BPLC 3QXDB 1HHJB 3KR3H 1OAQL 4XCEB 4Z7VA 2VE6B 4P23B 2A74A 4GQ9H 4GQPH 3FB8B 4Z76A 1X5LA 2VLLB 3EO9H 3FZUD 1JWSA 1FL6A 1IBGH 4LIQH 3MUZ1 2JJUA 2VIRA 1V7NL 3O6LH 4JKKA 7CGTA 2CDEB 3EFFA 4OZFH 1JPSL 4Y1AD 5J89A 3QI9D 1NBVH 1KIPB 1VDGA 2A6JB 5GS2H 3QUZC 1T1YA 2H1PH 4OGZA 4ODUB 4R3SA 4OF0A 1JPFA 1A6PA 4BH7B 3BW9B 2PR4H 5JPMA 3FQRB 1B3JA 3T0ED 4EOWH 3L1OH 4PJDB 4CNIB 3L3HB 3ARWA 2FX7H 2Z31D 1F58H 4KJPC 5TE4H 3VD7A 2EDJA 4P4KA 3TBWA 3X13A 3C6SB 4L3EB 2FBJH 1CI5A 4NUJA 3SDAC 3G9AB 1IQWH 3B5GA 3RHWF 1MLBA 4D9RE 1EJOL 2UVEA 1UCTA 3B4NA 3H9SD 3HG1A 3DO7A 2WUCL 3GDBA 1ZHKA 2V2WA 4DZBA 3E8UL 3NCJH 1J1OL 3IDXH 2CKBH 4JANB 4JFFE 4OCXL 3L5XH 4YHIB 3VFPA 1A4JB 2EDLA 3Q5TA 4C58B 4GW4B 4ZUSB 4LVNC 5K9JH 5BW7A 3TZVB 1JWUA 1K2DA 3BQUB 3O4OB 4JFEA 3FOLA 4X9BA 1YPZB 1IC7H 1KCLA 1QO3A 2EDHA 2ZJSH 4MNQA 2BZDA 2HT2C 4QRSB 4E5XA 3AVEA 2DOCA 3IKCB 2W91A 4PB0L 1EJ6A 4JGUA 4MX7B 4O9HH 4O4YL 4CN4A 2YA1A 4X0KA 1MWAL 1T6WA 3ZHDA 4RQQA 4JRXA 4M1CC 2WLYA 4KRMB 3S4SA 1JI1A 2R4RH 1QSFA 4NT6A 4Q2ZB 1BVKA 1WSST 2G5BA 2ZKHL 1CYGA 2FHFA 3KLAA 3L5HA 5T33H 4EBQL 3MJ9L 5KVFH 2AXGA 2R1WB 3HNTH 4G80B 4G43A 5EIQA 1G7MA 1VCAA 1HOCA 4PRPA 1FN4A 1LEKB 1CE6B 3G6JE 3GB7A 3TIEB 3T2QA 5DJCB 3EKCA 3D3VD 3GMNA 4AY0A 3MCG1 4LSRL 2OL3B 4S11A 3MBXL 1MFDH 5GSRA 1FRGH 3TYGL 3GSOB 4UV4H 1CTOA 3FB5B 1J7VR 4R8WH 3WFEH 4XVSH 4XMPH 4LHUA 4IDJL 1YN6A 2Q87A 4UAOB 1D5ZB 3UTZA 5FYJH 1U9KA 1MCFA 5DC9B 1RIUH 2C3VB 1N26A 4KVNH 1IGFL 4GAGH 1MCBA 2Z91A 5EZJA 4R7NB 3WDHA 1JGEB 2J88H 1DUYA 5F1NB 2E5EA 4JPIA 4X4XB 1F4YH 4UTAL 4OD1L 2A1WH 3RKPA 1CDJA 5L9DL 2ZWLT 4PJCF 1IM3A 4UT9H 5KANI 2DJUA 1U95A 1TMCB 4MA8H 1YNTB 4J3SA 5M94B 5DD6B 4LSSL 4K9EC 4ODSH 5HPOA 2C1PA 1G1CA 3KPMA 4DVRL 4XP6H 4LLUA 3BRGC 4JFYB 1RMFL 3IYLW 3HNVH 5GQBA 2E27L 4V1DD 3IRPX 3V5KB 4LCIL 1P84K 2Y4SA 4QRQA 4NP4H 1T80A 1SM3L 4F2MB 3QULA 3KPOB 3UJIH 3DBXB 4U1MB 1HSBB 5JA9A 5F7WC 4Y1AA 4YHYC 2HLAA 5CSGA 3C5ZB 1I3RA 2BXZA 4AQOA 4IOIA 1UADC 4P49A 4PGDA 4HMEA 2DQIL 1HI6A 5MERB 4FXGA 3S36H 1MWAA 3BOVA 3T77B 5IWLA 2Z31A 1LO4L 5I1CL 3TBYB 1L9MA 1WZKA 4JQIL 1KC5H 3KWWB 3VCLB 1P53A 4I48B 5AWNH 5CIPB 5IK3B 3GSXB 1CR9L 2O26U 3MBED 2CUIA 3CPLB 4TSCL 5EUOB 1S5IH 3H9SA 1LK3L 1N4XL 4X5WB 1YUHB 3EOAB 1CICD 3PQYD 1DQLH 3TA3C 5JXAL 1MCJA 1GOHA 4PRIB 3DX7B 2FB4H 2LU7A 1Q1JL 3QRGL 2BRQA 2GJ6D 3ELAT 3GJFA 3CMOL 4U6TA 4QTIL 3M1BA 3BIBX 4RFOL 3MC0A 1BPVA 1MJJA 1CL7I 3QCUL 2DQHL 3K1KC 4F9PA 3QDJD 4O5LH 4FQCH 5D7IA 4L9LB 4G9FB 3JWDL 5IMMB 3O6KH 5D2NE 3LY6A 4K7FA 3V6OC 4FG6D 3GRWH 2H8PA 3CFKA 3WIHH 4ZNEE 1UJ3A 3Q5OA 2VC2L 4QOKB 1PLGH 3H9YA 1FO0H 1NLBL 3RIAK 3RY6C 3MLZH 3ZHLA 3U9PH 3D0VB 1QD0A 4JFDD 3SKOA 1KLGA 4WHYG 1KTLB 2BP3A 1HILB 4MJIB 5HDBF 4DVBA 1S9XA 3MGOA 3LV3B 2FWOB 4U1KA 1I9EA 1KPUA 1EAPB 1LP9F 1YZZA 5ID0B 1JF1A 4H0HB 1CLYH 3D5OF 4KUZL 4OZGF 5DJZA 4OLZL 3DO3A 1JZ2A 3U2SB 5FECA 1F4WH 2EIZB 4XHJC 3ARTA 2WBJA 4RGND 4HIEB 5BCAA 3D3VA 2D4FA 1F8TH 2G5RA 2QEJA 2D7MA 1CLZL 4LLVA 5C6PB 3ETBF 5H37H 4PGEA 1NCDH 1Q9WA 4F3FB 2R9HC 4MDIA 1IM9D 3SGDH 4BKLA 1JGLH 4EUPA 3VFGH 5D7JA 5ITFB 5IVZB 5D5ME 1OB1B 3Q2CA 3IXAA 4G8FB 3ARGB 3GKWL 4KTDL 1WT5C 5E9DD 1HQ4A 1XR8A 1FIGH 5LXGL 4JZNB 4NC1C 1A7RH 4UB0L 3WNOA 1FGNH 5FO7B 2XPGA 2BERA 1AGEA 3RVTC 5DO2C 4JM2F 2AAVA 4XCNA 1MH5A 2CLZA 4PREB 2DB8A 5E2JA 3KYNA 2HJLA 1AXTL 2VLJE 1B0RB 3HMWL 3OJMB 3MSPA 2DWDA 2MJWA 5BVPH 1EFQA 2LAAA 2UZIH 5KN5A 1IJ9A 2JB5H 1UT9A 5C0FA 2GSIA 4C83B 3UBXA 1U8QB 3OJVC 1KJ2H 4OV5B 1FNGB 4FQLL 2E9WA 1JNNL 3O6FD 1I7UA 3CLFH 3IU3B 3RWGB 1RUKH 2J8UB 2G75B 4Y4FD 5D2LB 1A1MB 4V1DA 1P5UA 5EU4A 3QQ9C 1ZLUK 1TITA 4HX1B 1W0WA 2BCKA 5MEQB 4Q9QH 4PRHD 3AREB 1OCWH 3GFUA 1C1EL 5D1XD 2KDGA 4YFLI 5DHVB 2YRLA 3CFEA 4HMDA 1YMHB 3JXAA 5CJOL 3VU2A 1YNKL 2Y25A 2O5YL 3VGAB 4YK4C 3GSVB 3V5DA 3VXME 2FHCA 3AGVA 3WKML 4MMXC 1OTSD 4MJ2A 4UIMB 3KYOB 4WHTB 2DWEB 5HI3C 3HI6L 2MCPL 4C56D 3E6HB 1NUNB 3R4DA 1XGUA 4ONFH 3MBEA 2YPKA 4AMKH 4DKFH 4JO2L 4GMSH 3WV0A 3HAEG 4WO4D 1CICA 3PQYA 1KCUL 5I1HL 3RBGA 4XBPA 5F96L 3QHZH 4XZUB 3HC3H 5JHLH 1BX2B 5TF1H 2GJ6A 4K71C 3S37L 4PGJA 1B0GB 5H94B 2BSRB 5DK0A 5J57B 5J8OA 1A6VL 5IB5A 2AJSL 3MRDA 4LLQA 4NZTL 5F88B 1JMXA 4Z7VE 3UP1A 5E08H 4CVUA 1NAMB 3NACL 3O0RL 4HIHB 4XHQA 2CGRH 1JGUL 4Z5RA 4YDIL 2R23A 4R2GD 3L7FA 4K23L 2A38A 5I76B 2AI0L 3RVWC 2GAZB 2AJVL 4J6RH 1JZ3A 4G7VH 1A4KA 3VXRA 2F8VA 4JFDA 4F7MB 3AS2A 2ERJC 1NBYA 5GSVA 2P24B 3IU4L 3U0WH 5IW3A 2F19H 2WBJC 4XCYA 3RL1A 2DTML 3FONA 3RWDA 5D7LD 3SGEI 5ENWA 4NKQB 4CADB 4F8TA 1RZIA 5I8OH 1GGYA 2JIXA 3C5JB 1C5DA 4Z7UB 3QPXH 1G7PB 1RIVL 4TSAL 1E27A 4EDXB 4ODHL 1PG7H 1YEDB 1DLFL 1T1ZA 3KPNB 4ZUWB 3RFZC 3HG1E 1RZKC 4G8EA 5D7JC 5LAXB 1MF2L 1YN7B 4FHBD 4YDVB 2NTFB 1IM9A 1ZE3C 4QF1A 2Q76A 4P3CH 2N1KA 4J23A 1BWWA 4OAWA 1U8OB 2NXZD 5LJYH 4YH6A 3ZKND 1D7FA 4N8CL 2Y7QA 4R4ND 1TZGH 5C08A 5E9DA 4AZ8A 1I7RB 2DBJA 3GI8L 3FO0H 1NFDA 3BPLB 4R7DB 4Z8FH 1BZ9B 4NOFA 4JFEE 5KJRL 1CFVL 5EPMB 2LAGB 2W07A 4W4OC 5H35A 3DX6B 1WQVT 5TDNB 1TVHB 4MNQE 4XPFH 1JHKL 4OTXL 3QB7C 3UTTD 4WU7B 1RURL 1FFNA 4XI5D 1DEEA 4FQJH 5J6GB 2VDQL 2OR7A 4X6CA