2IGFL

Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSNQTILLSDGDTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 A.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA B13I2 FAB (LIGHT CHAIN)
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1991-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfL01
3V4UH 1T5WA 1J8HD 2OXHA 2SEBA 1A6WL 5I8KH 1BQHG 1CDGA 4TUKH 1F8TH 5SV4A 2IPUK 3H9SB 1YY9C 4WUUB 5FK9A 5GQBA 1JF1A 2H26B 1VESA 4P46D 2YA1A 4DOHB 1G9NL 5L2KE 3NIDE 3DBXA 5C9KA 3P73B 2HJLA 4FQXC 1D5IH 1QSEA 4PG2C 2UZXB 1IBGL 1R5VA 3VXRB 4UILL 4MB5A 3L3GA 2IMNA 5EB9A 5EORH 2GTWA 2D9QB 2PW1B 3BT2L 4N5UA 4U7SA 5M95B 5ACMA 2VZSA 2SEBB 1GL4B 1WFOA 4IDJH 1S9XA 3NIDF 2OYPA 5CUSL 3FO2B 5DD0L 1WITA 3VGEA 3QO1A 4N8PA 1NANH 3EYOB 5IFAL 1F3JA 3OMZA 1U93B 2DKMA 2EEAA 4ZFFB 1QYGH 1CLCA 3A6BL 5CEZH 3TFKD 3NGBB 1RJZA 3U83A 1TZHA 3SE4A 3SGKC 4DKFH 3MNWA 4UNTA 3MV9E 3T0VA 1RMFL 1P6FA 1WVZA 2NX5B 3BP6B 3QEQE 2VSDA 4NGHH 3QCTH 1XGQB 4OAWA 5J6GB 2K7PA 5IBTL 2A73B 4H1LG 5FM5O 1FZKB 3C2SA 4RX4A 2D7TL 1EX0A 5EC2B 2QQLL 3EFFB 4GKNB 1UWGL 5A2KH 5KJRH 2Y36L 3MXVH 4OFIA 3KPSA 3WEXB 5IVOA 5DD3L 2Z8WC 1YYLL 4UIKL 3B3IB 3BPCB 1ZE3C 1T7ZA 1J0ZA 4Y5VC 2AABH 4HWEH 3W0WA 3GSUB 4Y2DD 3AY4A 4JY6B 4YC2C 2IGFH 2FECL 4GLRI 2CLRB 3X3GL 3S96A 4KMTL 4N9GB 5KANI 1U91A 3TZVC 4LHUG 1VADA 3ARBA 2GJ6A 5DYOA 4R97B 2XZAH 5L6YL 3SKJH 4JRYB 1ZVYA 1W2KT 4BK4A 3DETD 5I30L 2E27L 5LJYH 1YUHA 2Z4QB 4X7EC 5EU3B 5DQJB 5I1EL 5HVWA 5J6HB 2IEPA 3VXRD 4LKCA 3GGWA 1ZOXA 3QZWG 9CGTA 4X7SL 3PV6A 2IPTL 1YC7A 2CUIA 4ERSH 3LMJH 5I74B 3OX8B 5EA0H 2E7MA 2YPKA 4PRPE 3C6SB 4APQB 3SGKA 2GUOB 4G8FA 5GGVH 1PW3A 1YC8A 2J6EH 2QADB 4OGAC 5BV7C 2DYPA 2VXUL 4RFEB 4DUVA 1SVCP 4MJ2A 3CFDB 3ULUL 3REVB 1N6VA 1J1PH 1M4KA 4NQEE 5MEOA 5J06A 3OHXB 4ZFOB 5CP3A 2BXZA 3HLAA 5JHDB 4MAYC 4TNVK 3QUYD 3JSSA 4NQCB 4G6AD 5TFSH 4XXDB 3PNWA 3U7YH 1U3HB 1KPRB 2FJGA 1CL7H 3VXTB 4XPHL 5HDQH 3NVQA 5KSUA 3MUHL 1KLFA 5KJRL 5BVJA 2CRZA 1KCVH 1IAKA 1LO4H 1IE5A 4NJAL 2A38A 1IZJA 2P24A 3CXHK 4Y2DB 3TBWB 4OV5A 3R4DA 4D0CA 3T1FB 4QRRD 2F8VA 1DQLH 2PTTB 4S1SH 1IAIM 1N7MH 5D71H 4KI1A 5EBGA 1FP5A 3T65B 3L5JA 3PHQA 4I2XB 1DBJL 4XNZC 5IBUB 3UZVB 2AV7B 1UVQB 3I6GB 2WINB 3KR3H 4N0YH 1HH6A 1KTLA 5DSCB 3G04A 3DOSA 3E2HC 1NL0L 2FHCA 1TJIL 5F89B 4XPAL 5E5MA 3SGJA 2VLJB 1MIEH 2HTKD 5JUEH 1U36A 4HFUH 3MRGB 5CJQH 4JKMA 4RDQG 2H2SD 4G8FB 4ZSOB 4LSQH 3RGVD 3THML 5JORB 4JM2F 4R7DA 4JRXD 1MRFL 3FHAA 3E3QC 5EOQL 2VAAB 4M1DL 5DJXB 3QH3B 3RRQA 4S0SD 3PJSB 2P5EE 2BXYA 4QTIL 5C0JA 3CVHL 4E5XB 1FSKC 2PCPB 5KOMC 2E6PA 4FQIH 4H8WH 5DJ8B 2JELL 3RWEA 2IBGA 5DD0H 1H8NA 5FUOH 3QFJA 3RVTC 1WAAF 1JIBA 1HHKA 1GZPB 2NXYB 3BPNB 5E95B 2P5WD 1VENA 1HHHA 1G7MA 2CXKA 1I8KA 3IDNA 4M5YH 1RMFH 3HMXH 5DDHA 3GK8H 3I6KA 3DO7A 4LLVB 3SQBA 3BVNB 1MHCB 4XB7A 4JFPA 5BJTA 1MREL 1KJ3L 2ZUYA 4XPBL 3EW3B 4FP8L 4FFZH 1T03L 1ES0B 3U0WH 2FEDC 4M7ZB 4K7PY 2EEDA 1X5IA 1F6AA 4KI5D 1FNLA 1JGUH 2DLGA 4R0LA 1UEMA 4Z6AT 1DCLA 1MI5E 4AZ8A 4FTVB 3OPZL 4HIIA 2YD9A 4KMQA 5J11C 5BZWB 3FQWA 4PJIA 3RZCD 1BVLB 4JGUA 5HHNA 1GZQA 1MCWW 5E8NB 3RDTB 4JJHA 1IGIL 1LE5B 3DNKA 4WV1B 5DQ9B 4RGNC 4OI8A 1A5FH 3KLHD 3TNNB 4PJHB 5AUMB 5IMOA 4MVBD 2HRPL 1K3IA 1V05A 3MX0A 4PJGA 1CG9B 5EZIL 4BKLB 3DYMA 3LY6A 3WJJA 5C0CD 1R5VB 3OR6A 3RFZC 3TCLB 3FT3A 4OZFB 1QFHA 3BMWA 4J6RL 3S5LB 2X4TB 2KZ1B 2AK1L 3CUPB 4B41A 3S96B 3C6SA 4APQA 2DM2A 3DRQB 2I9TB 2CLRA 3FJTA 4XH2B 1IQWL 1HYSD 1CICC 3ZE0E 2XTJB 4G6FB 3QJHA 4KK8D 5DJ0A 4F3FA 1UEYA 4LIQL 4P46B 2F58L 2PXYA 2EE9A 4KXZI 4H5SA 3QAZB 4WI5A 1T1YB 2A0LC 5DHVH 4NP4L 4PJ7E 1G9MH 3UBXI 4RGOH 4D0BB 1JGDA 2H41A 4C56E 5D1QD 1UWXK 5IFJB 1PZ5A 2FBOJ 3FB6B 4YIQA 2H8PA 5GIRB 4UQ2A 2CLVA 5LWYH 3B9DA 2CSPA 3V6OC 4KHTL 1CE6B 3CZFA 5HVGB 2UV3A 3BW9B 5CGYC 4JFEB 2NYYC 3MMEB 4DJMA 3RY6C 1QLFB 2YK1L 3O45A 4ZOAA 5B3NA 5C08D 4KK9C 5MENA 3VWKD 4LBEA 4MZ3A 1FYTA 4YHOL 2CD0A 1V7MH 2FH8A 4HH9B 4OM0H 2R2HB 1U93A 1FFRA 4GW4A 2BSSA 1U92A 1M7DB 1PDKA 2ITCB 4Q6IB 2J88L 2D2OA 3C5ZB 2B2XL 3NFNB 3ULVL 5D93B 3BKCH 4PRAB 3X11A 2ZSVB 3QPQD 2GT9B 1HILB 2ZCHL 1Q9OB 2X7LA 4XRCB 4JO4L 5FYJU 3BP5B 4MCZA 4ZUWB 3GI8L 3TEUA 4OLYL 1AO7A 4CU6A 1YECL 4M7KH 2BDNL 3TJHC 2FEEI 4Z5RA 2XICA 3D9AH 3BZEA 1H15B 1QFWM 1OD9A 4LDLB 3JTTA 3GMOB 4L4TB 4YHLH 2PNDA 3EBAA 4HLJA 2EYRA 2YPKB 5CBAA 1LWRA 4HUXB 1FL3A 5FYJD 5K9KA 5EU5B 4Y7MA 3MRHB 4WGWB 5HHXL 5DMGD 4JRXA 5D7SH 5ETUA 2E3VA 2WP3T 1GGCL 3HUJF 4QY8B 3LD8B 3UJJH 1SYSA 1YUHB 3O6LL 1KPVB 3QEUB 4G8IA 4UT7H 4HUWA 4EKXA 4GAGH 4HGMA 2EIZB 1DN0B 4QCIB 5I74C 5IBLD 3UPRB 1T5XA 2P5EB 1A21A 3FZUC 5ITBL 1UWEH 4XI5D 1XIWD 3V0WL 1R3KA 3SCMA 5C0GB 1X7QA 4UBDC 4Y4HA 2W38A 2VUYA 2VR4A 1CICB 1T5WB 5IFHL 1LK3H 1ND0B 2AJYL 1QRKA 4RNRB 4X6CF 4KJWD 4NRXA 1IILE 4L4VE 5E94B 4P9HL 1IKNC 4KFZC 5T3ZL 1QLEH 1U8QA 1A64A 1KG0B 4AIZA 3STLB 3VFWB 3BP4A 4M1DH 5HVHC 2DD8L 4PJ9D 1WBXA 3BKJH 1AGEB 4IRJB 2PTUA 3IFPB 4EI5A 1KJ2L 2APWA 5EBLB 1MUJA 2CJUL 4GG6B 4QLRA 4A6YL 3VWJA 2OMNA 5CZXD 1S7QA 4U1LA 5HGAA 1MPAL 4CN6A 4YHIA 5D9SA 1AP2A 4XP6H 3OXRA 4G7YL 4IDLA 1U3HD 3GO1L 3KYKL 3QEHA 1BFVL 1MIMH 5LGHL 1R24B 2ATKA 3EOAB 1XF1A 1FZMB 4U6YB 5GRXG 4H0IA 3AMLA 5CLTA 5E9DD 1A7PL 2MTPA 4K2UH 4LF3A 1DP0A 3K81A 2FBJL 2NY2B 1NLBL 3VXUB 5A2FA 4OUOA 3KVQA 1HSBB 3R06A 3HZVA 4CVXA 3JWDL 4HCRA 2FSEB 4L8SB 2F8OA 3RL1A 3HN3A 3PABA 3EZJB 3UCRA 2PW1A 2VDRL 3KPRB 4YEEA 4Q9QL 4GKZB 4MQ7B 1FGNL 2QHLA 3EO1A 3MLTA 4WI8A 2C1PA 4XTRD 2XWBB 1G7HA 2DAVA 4X7CC 3IAGC 5H35A 4RRPG 5AG9A 5EWIH 3W39A 4YDVA 3V4UL 1NH6A 1S7WA 2YD6A 1NFDB 1WF5A 1KLUA 1BVZA 1LE5A 2CR3A 4RA0C 4Z0XB 1OTSD 5DI8A 5C0DA 3D6GA 3BGMA 3BD3A 5DJCB 3HZYA 3VWKC 2EDOA 5D7LD 1XH3B 4IRSA 1SMOA 2FLBT 3HUJB 3ARUA 1IAOA 2VLME 4PUBL 5JOFA 3CFJA 5JZ7C 1BLNB 5LWYL 3DV4B 4LHJB 4G6KL 2VITB 5J12B 1GRWA 3QDGA 4WHTB 4PLJC 5FKAB 3MPCA 1T1XB 2NXYC 3BPNC 3VD7A 1EZVX 2NZIA 5B39A 3SOBH 3LPGA 2OJZL 5E6ZA 1FZJA 1KB5A 4MDIB 2WWMD 3MA7B 1NGXA 1NGQH 3O11B 3GB7B 3MV8B 5LQBL 3GO1H 4PRNA 1EK3A 1RJLA 1L0XA 4NM4H 2WQRA 1FYTB 4CW1B 4JM2A 2XPGB 1D6VH 4NT6A 3AVEA 1HYSC 1Z0MA 1I1RA 2VISB 3RBSA 4EUPG 5IMLA 1RQ5A 1IEBB 1S5IL 2EYSB 4J4PA 4QKXB 5L2KD 1OTUD 2AV1B 1Q9KB 1UXSB 3CSYA 2FEEL 1UKTA 3GSXB 4O9HH 3IRPX 1OT1A 4PPTA 5GIRA 5C1MB 5F1SA 3RWEB 4OLVH 1S7UB 3PL6D 2DM3A 1F11B 1P5VA 5J0BA 2C3VA 1RULL 3MZTA 5LVEA 3MRMB 2YK1H 2VQ1B 3IFNL 2F9BT 5DMKA 1YYLH 1MF2L 4XAKD 1T0NA 4ZAKA 1JHTA 3LHPL 4U6HA 3RVWD 2F8XC 2UVEA 2DF3A 4MQTB 5DR5H 3GBNH 1CU4H 4ALAH 3CIQA 3I85A 5EBWA 1OM3L 2BVQB 4OB5L 3WUWB 4L3EE 3VXME 4K94C 5CEYA 1KB5H 4WI7A 4JQXC 3KJ4C 5KSBB 4BUHA 5FKPB 5CIPH 4JO1L 1NFIA 4D9QD 4J3UA 4UNVA 2HAZA 3C6LA 3T09A 4JFQA 3VXSE 4A2LA 1BQLH 3QXUA 5CKGA 5C09D 4OLUL 4OI7A 3NPSC 3RZWA 3LN4B 2IPTH 4N1CA 3WV0A 2VZTA 5D7IE 1GZQB 3JWOH 3GSWA 1NFDF 2H6PB 5BZWA 2WBWB 1EHAA 4RZCB 4ZS7H 1YEHL 2LAGB 1KEGH 5I66A 3O2DA 3UZEA 4ACPA 2YKLL 3NN8A 3MRLA 5C0RH 2YPLD 1LO4L 5L2JB 2R15A 2R9HD 5IWLA 1DUYA 4NCC1 5MENB 1YN7B 1XCQB 4NKDB 3SDXA 3FONA 5AZEL 4ODHL 4L4VB 3MBXL 4UDTA 2KKQA 3EYSL 3V5DA 5BVJB 5E1AB 1T2JA 3ESVF 3D87B 4L1DA 1IARB 2HT2D 1HN1A 3WLWD 1JPST 5D1QB 2C1OA 1PEZA 5J9PB 5FGBC 3MOBH 1FAKT 1CXHA 1FZOB 2DQJL 1MFBH 1A4JB 2WBJD 3IJYB 5DO2D 5JQ6L 5DVKA 3PGFH 1A6AB 4IOFD 1JGLL 4R8WL 4NKDA 3F7YA 4ZXBB 1DUYB 1CGUA 3WE6B 1XEDA 5FM8A 2XG5A 1JVKA 3LHPH 4ZTOL 1U95B 4NJ9L 4P2QB 3B9KC 4BFIB 2DQDH 5DMIH 4PRIA 3L7FB 3MLXL 3HI5L 4Y16D 2ZZUT 3C6LC 4M8QB 1KCLA 2DQTL 5HYJE 5D8JH 1JL8A 2GSGA 3EGSA 4MQSB 1S8DB 4OD2B 1PY9A 5TDOB 4ZNCD 3AS0A 3EDJA 1S3KH 4DW2H 2XTLA 4EBQH 1P84J 1BFSA 1KC5H 4FABH 4AT6A 5J1AB 2A6DA 2ZPKH 1A6AA 3S6CA 3CC5A 4IRZH 4KY1H 5JW4Q 2AV7A 2FECI 1UADC 2XIDA 5EU3A 3JTSB 4U31A 4GRMA 3QUZA 3VFUA 5CCKH 5D96C 3ES6B 3IXAA 1NMBL 2MQ0A 4HK3N 4NN6B 4E41D 3LKNB 2HTKC 4HS3A 4XNMA 4F57L 3H7BB 2FWOB 5C0IA 4F8QA 3IJHB 2X6MA 3VXQB 4JKLA 4L5FL 3MRRA 1QSFE 1EHNA 3O3DB 5E4IA 4KAQH 3MBEA 1AGFB 2EDXA 2BVYA 3FN0L 4XP9H 1D9KD 1F6FB 4XZUB 5A3IC 4WDIA 4C56D 1RJLB 5HBBA 1D6EA 5DVMA 4IJ3C 3IS0X 3QCVH 4PY7B 4OZHB 5H37H 1RHHB 2FIKA 1EMTH 2DKUA 4V1DA 1X5LA 3DHMA 2HYMA 2R1WA 4K3HA 4Y8DC 3H0TA 5DMYA 3TWCL 2OJEA 3PDDA 3ZDXE 4HK0A 4PJ5B 3MOBL 3UYOD 3A6CL 4WWKA 5C0ND 3HPJA 3DVGA 3JV6B 1AGFA 1HINH 3N1MC 3ARWA 1Z2KA 1XGUB 3O3DA 2GHWB 4K8RH 5IB3A 5IHLB 3C6LB 1XH3A 2K9UA 3UAJD 3VD9A 3IETA 3RVVD 5EO0A 5FF6B 1UB6A 4NOFA 4P5TD 3KPSD 4IJ3B 3K80A 2R23B 4J1UA 5DUBB 5KVFH 5EG6C 5BXFB 2X40A 4XNXL 4DAGH 2DQTH 3W11D 2Z8RA 1D5XB 3ARQA 1R3KB 2ENSA 2JK5B 3U9PH 4NBXB 5F7KC 4Z76B 3OZ9L 3U79A 1Q9LB 1E6JH 3D0VA 2QBWA 4O5LL 4R4NC 4BZ1L 3NA9H 4JRXE 4Y1AE 5IGXL 4NKMB 3C60B 4PR5A 5D7JA 3GNMH 3PF2A 2W60A 4PLJD 1T7XA 4GW1B 2ZUQB 5LKNA 3V6OE 1F90L 5DT1H 3TT1H 3SDYL 1P4LB 4DQOH 1AQKH 1CU4L 4WO4B 3TO2A 5FO9B 1CLYL 3VMNA 1DFBL 4IMLA 2WLYA 4TULH 4Z7UB 4MMXC 3LEVH 1ZHNA 1KENH 4J4PC 1NMBH 4CU8A 4DEPB 4K9EH 1X5FA 2P4AB 4FQLH 1F8TL 3FT2B 5DZLA 4N5EC 2IMMA 1UA6H 1LDPH 4V2BA 4UB0H 3KPRD 1QR1B 2YRZA 4P2CG 4ZTPH 3HZMB 4OCWL 3KXFE 3MLTB 2IC2A 5GRWA 4XP1H 4Q9RL 5DQDL 1KIRB 4N0UB 2FX8H 5HHQA 3SGDI 4ODBD 1TZGH 1B2WL 2KL6A 2NXYD 3S88H 1DBMH 1R3IL 3DIFB 3S35H 3UTZA 4M00A 1LO5A 3X13A 4WUUE 3DX9B 3HZVB 4LGSB 3BP6A 5A3ID 4HWZA 4YH6A 4ZYKB 3F7VA 4KK8C 2XN9D 3IGAB 3MRLB 1DEDA 3KPTA 4Y2DC 4G9FA 4HXAL 1J0JA 1KG0A 4BK5A 4PJFA 4AM0B 5JMOC 4FQQB 4X7DC 2HFEA 5EC2A 3UYPA 1GGIL 3FRUA 5JUEL 1BIIB 2W9DL 3C5ZC 4F37K 5L6YH 5M7QA 1S7SA 5GS2H 2IBZY 4KTDH 3ULUE 4ZFOA 1WWBX 2CLVB 2WSKA 5EOQH 1NKRA 5DJYB 5GXBB 3O3AA 5GS0D 4TUOB 4L8BB 1T4KB 4URTB 1WFTA 4WU5A 1QR1A 5DT1L 1NGYA 4PGDA 3MOAH 3T04D 3NMEA 2A9NH 3RVUC 2AI0H 2BRRH 1MHPL 4LCCB 3PHOB 2OBGA 4PRID 2HFGL 3WHXB 5EU6B 1U8MB 1TLKA 3MGAA 3O81A 1CQYA 2LABA 5KSAB 4GW5A 4CDGC 3PP4H 4GG8A 3BGFC 2GTWB 5IBLC 2IAMB 2FEDD 1QSVA 3BKML 5BV7H 5FYJH 1VPOL 5EBMB 1QBLL 2EXYD 4WU5B 4UTBH 2ZCLL 1P1ZB 4KZDL 5I8CA 4OCRL 2HLFC 3GIZH 3HNVL 3KPPB 1JYWA 1R5IA 2EDWA 5DYOB 1UM4L 4NBYB 2Q3ZA 1KJ3H 3RWHA 5HYQA 4IOIB 1TZGL 5EA0L 3P4LA 4XAKE 4W6XB 4R97C 4O2FB 1I1YA 3UX9B 4X4ZA 5DHVB 3BISA 4UQ3A 2WLZA 1YDPA 4MHHI 3STZA 3HHRB 4UI2A 3RTQA 3IU4H 4S2SA 4JPWH 3DI3B 2D0HA 3MUGB 1AP2B 4QRUB 4HDIA 1NPUA 1HKLL 1K8DA 3EYVA 4XCEB 5JNYA 2CDEB 3GSQB 4TUKL 5FO8B 1V3LA 4PLKC 1L7IL 1Q38A 1MCJA 2MHAB 4LK4A 3BJLA 5C09B 3L9RB 4PV8B 3NIFE 1UWEL 2FDBP 1A5FL 4OLVL 4DZ8A 5DJDB 3OF6A 1AGEA 2P8MA 3Q6FB 4HV8A 4PRDA 5C0AD 4OD1H 3BVNA 1HINL 3IDIA 2AXHA 2XACC 1M7IB 1QFUL 5LXGH 3LQZB 3SKOA 3CNKA 5E6ID 4U6XA 1CLZH 4XZUA 1CLOH 1KTKE 5ITFA 4WRLA 5J11B 2JTDA 1JWSB 2DD8H 5CJQL 3DUUB 2NY5H 4PV9A 2AKRA 3LV3B 3QWOB 4X4YA 1E4WL 3FTGB 5KVDL 5I1HL 4L3CB 3QNZB 2OTWA 1UJ3B 4RFNC 5MERA 5DFVC 3ROLB 5BZDB 4XMPH 1RD6A 5D7JB 4M1GL 4TSAL 2F19L 1UJTA 4JRYE 4YDLB 1EA9C 3D3VB 3GMNA 4ZS6D 3T2NH 2DOCA 4F3FB 1RK1B 2EEBA 2H26A 4MB3A 2KBGA 1WAAA 4HKXB 4NQED 4KZEL 3T3MF 2AJUL 4U1IA 4CRPA 2V9TA 3QPQC 2X4NA 3UBXG 2XOTA 1ZHNB 4FQLL 3ZE2F 3FQWB 5CP7A 1S9VA 2R0ZL 5C07D 3UTPD 3TT3H 3VD5A 1A3RH 3DTXB 3WS3A 3RKPA 1CZ8H 1WZ1L 5T3XD 1U8NA 3MROB 2IGFL 1XGUA 3C60A 5IB4B 3F7YB 4JPWL 3HC3L 3LEYH 2VR5A 3BH9B 3QDJA 3P30H 5HYIA 2NY2D 3U1SH 5EUOF 4CADA 4X6BB 4Z7VF 2A0LD 1Q94B 1JE6A 1I75A 4OLEA 4FQ2L 4UOW0 3RBGA 4Q97A 4L8CB 3ESUF 1KCUH 2VYRE 1F4WH 1L6ZA 1PG7X 5F7YC 3ECBB 3K0WA 1U6AH 1FE8L 1YZZA 4KQ4H 4HUKB 4NRXB 4N0FB 4QRPD 4MNQA 2Y6SD 3N9GL 4G9FD 5EO1B 3F6LA 3GK8L 2Z93A 1AD0B 1C5BL 3MR9B 3WIFA 1DQQB 2IH1A 4KK5C 4Z7UA 1U0QA 3GSNA 3PIQB 1T5XB 4JCMA 2DQIL 2DICA 4FFVC 3IFLH 5DURD 2OL3A 2FCBA 4UAOC 4HBCL 5CJ5A 3LKRA 4ZO7A 5ICYA 2FB4H 3S98A 3QQNA 1OL0A 4JPIA 43CAB 1RK0B 1KACB 2CK0L 3BWUC 2R0LL 3EIFA 2RFXB 4EN3A 2EDJA 3VA2C 2F5BL 5I1DB 5E8DH 2DTMH 4OB5H 4NQEB 4B0MM 2BVEA 4P23A 1GH7A 5SWSE 5ID0A 5TH2A 1TVBA 1J88A 5HI4C 1C12A 4MXQD 5BXFA 3FL7A 4PJIE 2ESVB 2PO6B 3O6FB 3N1QC 5EH1A 4AEFA 3CLFL 1ONQB 3EYQC 4POYA 5E5MB 4KTDL 4IBLT 4P4RA 1YEFL 5DJYA 3QDMD 1DBAL 2B1AH 1HHGA 3S8WA 1KPUA 5HI5C 4Y5YB 4YE4H 3PWLB 5I1IH 3FRPG 2PKDA 3QUMH 3JVGA 4XT1C 2O61A 2JCCB 4HZAA 3VFVA 2D7TH 3GBNL 4JRYA 1WBZA 4I0PC 1G84A 2DMBA 4DKEL 5ENWA 3HE7D 3UXFA 1C7TA 2HP4A 2R23A 3BPOB 3E6HA 4XP6L 2YR3A 1RZFH 5IJVB 3IKKA 4QT5A 4HG4K 1XAUA 4UT6H 4LCWE 2COQA 2H2SC 3CPLA 5F9JB 4K8RC 1QUNA 3D0LA 1J8HA 3NH7H 4HHAA 1U6AL 1QBML 2BP3A 3K3QA 5FYJL 3UTTD 4MA3A 5BS0B 4U1MA 1OAZH 2AQ3A 5DTFB 3VGHA 2HVKA 1K4DB 3BRDA 4JFED 4OUUA 3EDFA 4I3RH 2O5YH 1OTTD 5IQ9B 1SBSL 1BZQK 2G75A 1BVKB 4FZ8L 4YFLI 1MFBL 2X1OA 3DLQR 1XF4A 4W6WB 3VDCA 1PQZB 3RNQB 3AB0B 3RKDC 5JPMA 4F7TA 1VCAA 4KK6C 4D0DB 1KIPA 3OB8A 3VXOB 4OF5A 4KKLD 2QR0A 3HMWL 4JZNA 2EC9T 1YEEH 3NN8B 1EUUA 4PJAA 4XH2A 3ZYJA 3EYSH 4OLXL 4YAQB 2PTVA 4HWEL 1NC2B 1AHWC 2D7NA 2B5IC 4RQQB 4OJFH 5TH2B 4Y4KC 1R3LB 4OCLC 5BRZE 3NCEB 4BFIA 1S9WA 1YEGH 4OSUL 4U1NA 3RJDA 1XR9B 3ZKXB 5JPNA 5JHDA 3T4AB 3MRCA 1EXUB 4R3SA 1MFNA 2D03L 4Z9KB 3QIUC 5EDXA 4X7TB 5I19L 1MNUH 5A16B 3T77A 2DMCA 2R4SH 3DURB 3JV4A 1U3YA 2NY6D 3VH8G 1X5HA 4RFEA 3UEZA 3CDGA 1VADB 1IEHA 2H2PD 4PJBE 2J6EL 2UYLB 3MJ6A 4DKEH 4R9HA 1AHWB 1W0WA 3MLWH 4P2QA 4M61A 1P9MA 5EZJA 2ADIB 4FXGA 1FO0H 4Y2DA 1QFWI 4Z78A 2GTZB 3SDDC 5HGHB 4AIOA 1YYMH 1QSFD 3BKJL 2GJJA 3W0WD 5I75B 1E4XI 1MJ8H 1T22B 1RJCA 4NBZB 2XZCL 1OGAD 5CSZB 1NGXB 2EDFA 5GGRY 5HYSG 1Q8MA 1A9BB 3P9LA 1CFNB 3V2AR 2JCCF 4OZFH 3W9EA 2J1KA 2YWYA 3Q6GL 4CGTA 3N50A 1JNNL 5IVXB 4JDZA 2BCKA 1KNOA 4M4RA 3L5XH 1FAIL 4F8TA 1AQDB 1MIML 3DVIA 1HHHB 5LGHH 5EIIA 1JZ4A 4JANB 4U1SA 4BSVB 3AAZA 5DD1H 4D9LH 3PGCA 3O9WA 2R1XA 3CDCA 1CDIA 1KJMA 1RIUH 1XGYL 2B20A 3IJHA 4GRLB 5F1OB 3VFPA 3B8YA 3NCYP 3BEWB 5AYUH 4YK4B 1QFPA 2FJGB 5FO7A 2A77L 5FB8B 1K5NB 5F72S 2HFGH 2G2RB 2IBZX 4Q9QH 4KI5E 2UWEF 3VCLB 2R1YA 1CXLA 4WY7L 4F7MB 1C08B 2FD6L 4NZTH 3IDJA 4OFVA 1UB5A 4OIBA 4GXUM 2P5EA 1PLGL 4Y16B 3DJ9A 4ONHA 1DDHB 4N0YL 3EYFA 4CVZB 1SBBA 2DLHA 5D6CB 5T1KD 5I19H 3S97C 3L7EB 4IEFB 1I8IB 2MKWA 1YPZF 3G5YA 3DROB 2V2XA 3IS1X 4PJAE 1JI1A 2ORBL 2UUDK 3HC0A 2PYEA 4KJYA 1U95A 5IBUG 3WKML 1W0VA 1NEZB 3PHOA 5BQ7A 3RTQC 2JIXA 2VDPL 3G04B 5SV3A 2VISA 1HWGB 2NY0D 2VIRA 3EYUH 3LRSB 1OOAA 4JAMB 4YHYB 3KYNB 4WFED 1HQ4A 3X3FL 5SWQB 2V5YA 2I07A 4QRPE 5B8CA 4M9OA 4PTTB 3MRKA 2FX8L 1I9IH 1UGNA 5ECJE 1NGZA 4X99B 3FQXA 1AQKL 3RWIA 1RZIA 5L0QB 1BAFL 1EEQA 1YEIL 1A4KA 3QWOA 4WNQA 1NAKH 1RFDH 2ICWI 2DQFA 4X4YB 3G6JB 7FABH 1A1MA 4PV9B 4HS8L 4JN1L 4M7KL 4NM4L 5JW3L 4NHCH 1CR9L 4HF5L 2W9LA 3RZCC 4PGZA 1RJZB 1NCTA 1QBMH 1C1EH 3QFJE 3VRJB 2AS5M 3WFCH 3G08B 3QXDB 5IOPA 2GITA 4LEXL 2BVOB 4NDMB 1RIUL 1MLBA 4GRLD 3TIDB 1MY7A 1GGBL 3OSKA 1ND0A 1QLFA 2P7TA 1SHMA 4JFEA 1FYHB 3RDTC 5GJTL 4PP2A 3H3BC 3QUZC 5IVZA 1IGFH 2W59A 3RWHB 4I0KA 2XQBL 3WXWH 2BY0A 1JGVL 1RU9H 3PP3H 2DS4A 4PJEF 2H1PL 3HMWH 3CH8A 3CK0L 3BUYA 1CDCA 3NH7L 4UQ3B 2AI0L 1D5MB 2R2BB 1WAAE 4RNRA 1JPGA 1JF1B 1A6UH 1R3HB 3B43A 1I3GL 3BE1H 3OKEB 5TE7H 2AJYH 3BD4A 2FO1A 1OT2A 4JHAL 4U6HB 2FL5A 1IGJA 1KULA 1DEEA 2Z31B 3Q5TA 1B4RA 3UPRA 3GIVA 1G9NH 3KYMB 3LSOA 3QULB 4UV7H 4LLDA 1OP3H 2B4CL 4S10A 4V1DE 3DXAD 1N5YH 1DDHA 4Y19B 1U3ZA 3RDTD 4QRRE 2I27N 5F9WB 4PTUB 4A6YH 4OBSA 4MCZB 5T3ZD 3MXWL 4KV5F 4QXTA 3H9SA 3CFCH 4OD3H 3L3OB 1IFHL 2XN9E 5MEQB 3U2SA 1JHLL 1MWAH 4I48A 4YHZL 1R5WB 1YY8B 2BHZA 5CUSH 4JFXA 2ESVD 2PO6D 1WWWX 1LP9B 5DJZB 1C1EL 3HI1A 5TF0A 1RZKL 4RGOL 2A6JA 5GHWH 3EOYG 2KUTA 4G7VH 2DN7A 3WCYA 5K9JH 4OKVB 3MBED 5IB2B 3LKPB 3BW9A 2XTJD 1IAII 4C56A 4Z7WE 1OAQH 3TV3L 2KDGA 2FX9L 1YECH 2EDYA 2CDEA 3GSQA 1UCBH 3HRPA 4MQXC 4LAJH 3SKNB 2I60L 4IRSB 3F62A 4BFEA 1ZVSA 4YHKH 5TPWL 2OR8A 1YJDC 4LIQE 2YC1A 2O93L 4GQ9L 1T3FB 1QRNB 1IAIL 2Y6SC 1E28B 2VMFA 5DHVA 4N1HB 4ONOA 1DFBH 4OM0L 1CICA 3BJ91 4NPYA 1HKLH 4OZGA 3GI9L 5HGBA 4WFGD 3ARTA 4ODHH 1O5DT 4QXTB 4KUZH 2ERJB 5TE7L 4M48L 4U6VH 1U58B 3FFCE 1LO2H 2X70A 3K8KA 2XWBA 4XNYL 1AGCB 2D7QA 2E7CA 3DX8A 3E6FB 2DBLH 3CD4A 4N8CH 3KPOA 4JDVA 5IMKA 2O5ZL 4IRZL 5T5FH 3N1GC 5CBEA 1RUAL 3KYMA 3QULA 4R8WH 1HQ4B 3T2NL 3DXAB 4S1QH 3UTSD 4ZMAT 3V8CA 3QCUL 3K4ZA 4QXWA 2GFBA 1OAYL 2DLIA 4DVRH 1TETL 4ERSL 2QSCH 1RUQH 4JFDA 2YD3A 4H0GA 3T0EE 5K9OB 1DTUA 5F1IA 4HAFA 4KI5F 2V2XB 3RGVA 3KHOA 4TUJA 5MI0C 1WZMA 3TIEB 4JY4B 3VI3F 3EYUL 2F5AH 3WN5C 4MXWH 4YHZH 1AGDB 4NZDA 5IUSA 5C0AB 5DA0B 4X5WB 2QTEA 5JPMB 5JXAL 1MCFA 4JFHE 4GG6F 1CE6A 4JZOB 2NX5D 1NCUA 5DRNB 3HR5B 1CS6A 1AO7D 1WISA 3QJFB 1FN4A 3V7MA 4U7KA 3T65A 5HI3C 2XQYK 3JZ7A 4WEBH 43C9A 2HFEB 2GAZB 3D5OF 2HFTA 4OZHA 5ABDE 2I60H 1BQHA 2FR4A 1Q9WA 3L3DB 4KGLA 3S3PA 1VFBB 5CJOL 3BIAX 3SJVE 3ZL4L 3JXAA 5DR5L 2X1XR 2XXMB 4HWZB 4JJ5A 1A7OH 3X14B 4QRSA 3X12B 4XNZB 3TZVB 5IEHA 4L9LB 1T6VN 4BFGA 5J13C 2FO4B 5GRYA 5IG7A 2VWEC 3LH2H 5E6IB 1KPRA 3RWIB 2AXJA 3BAEH 4MYWB 5L8JB 4GAJL 1KSRA 4C55A 1EMTL 2WNGA 3TO4A 1UKSA 2YS4A 5D1ZD 5DFTA 5GSRB 4O2CA 4NRYA 2EZ0D 2PF6A 5BV7L 3W5MA 1CFSB 4BKLA 5MHSD 3OAZH 1XCTB 1HXMA 3V6FB 4MD5B 1OQXA 1I9RH 3HS0B 4KU1A 4Z95L 3KJ6H 5HHOE 1MCCA 3FO9A 5FYKH 5C0IB 1Q1JH 2QQKL 2EYRB 5C0FB 3IDMA 4Q2ZA 4FQJL 1D5ZB 4WUUD 5D2LE 1JZ3A 2DQUH 3CVIH 1NC2A 2KQMA 2UY7A 4JQVA 3KPQA 1LDPL 4WO4A 3TO2B 4YAQA 5K9QI 3OAUL 5CZVH 5D7LB 3IFLL 5EUKB 1JWMB 4UB0L 1F4YH 1W72A 4LVEA 3PJSA 3VFOB 2B1AL 5EU7C 3VXUD 4OT1H 1NMAH 2EDHA 3V6FA 2NXZC 5GGRA 3QG6B 1MCKA 1LEIB 5J6HA 5HHMB 3NBNA 3K2UL 3LKRB 1YA5A 3ZT6A 3O2DL 4PJGE 2DQHL 5I18H 3RWFA 5LG1A 3NCJH 1INQA 3KWWA 1U8JA 4LCIL 3SDCA 2HMID 4OUUB 3G6AA 5DGQA 4JFDE 1BWMA 1N6UA 2Q86A 4PB0H 3ZTJG 5IMLB 3VGGA 5C2UB 1K8IA 5JW4M 3CFEB 1KTLB 5DSCA 4JN2A 4MWFA 4GUPB 1WIPA 4I4WA 1S9KC 1VERA 5FUCC 4M6MH 4MJID 2QQQA 4F9PA 2EKJA 4Q6YA 3NFSL 1BF8A 1PKQB 2NTSP 3S35L 3RWFB 1ACZA 3MLRH 3PNWB 5BMFL 5IIEB 1FN4B 3DX7B 4GAJH 4N0CC 4XCCL 1BIHA 2O61B 5F6IC 3OGOE 4OLWL 4PRPA 4OLZH 1QO3A 1RZ7L 5JMRA 4LSDA 5LAXA 1T1WB 3VH8B 5C0AA 2AK4A 4FXGB 3HB3D 4H1LB 4Y4FD 2EH8L 3ZHDA 1P7QD 3MCLH 3TCXA 4TQEL 2V9RA 3KJ6L 5ERWB 1XT5A 5F3BB 4U3XA 1KCRL 2X4OB 1TXKA 5DXWA 2K3TA 4PJCB 4XVJL 4F15C 4QWWC 3RX5A 1FVDB 2F15A 2GUOA 4HUVA 4KTEL 3T77B 3GMLB 4DCQB 2GJ6D 1NCNA 3WJLA 1CZ8L 1WZ1H 1LNUB 1CG9A 3SDDB 2APVA 2H32B 3NGBC 4N68A 2X05A 4AMKL 1MCOL 3BQUD 3QDJE 4HIJA 4JFYB 5GRJL 2Q87A 3QPXH 1IAIH 5MERB 4ISVA 2GSGB 2D7OA 1ZEAH 1ZLSL 15C8H 4KRNA 4G6MH 2IAMD 1KV3A 4NQTA 3HTLX 1YEIH 3SGEI 2VERN 1LILA 4G80B 5IG7B 3K74B 3MRDB 4LLMB 5F3HB 1BMGA 2CIKA 4M1CD 4MNQE 5AZEH 4BJLA 2CKBL 3G5VB 1FG9C 4Y89A 4LASL 3BSZL 5L2KA 5DJAB 5FUZL 3U4EA 4LIQH 4KK9D 4NKIH 4P2RB 3VGDA 4JEGB 2R39A 3EFDL 3UP1A 5CZKA 2ZCLH 4H25B 3OKOB 3QIWC 4EJ1C 2OZ4H 4LLYB 5FYLH 2J6EA 3MGTB 3PGFL 3EAKA 5CEXB 3IDXH 2V5MA 5GGSB 3FONB 1EHXA 1IMHC 2VABA 3HG1E 1ZLVK 1CGYA 5SWSD 3SDYH 4KI5C 4JG0H 4QT5B 5E5RB 2R8SL 1DANT 2X4QA 5IJVA 4WI2A 2B2XH 2CUHA 3LS4H 5I1HH 1MCRA 2F53D 5A2LH 3EDKA 3GDBA 3L3OA 1JPFB 1WT5C 5C07E 2FATH 2FX7L 4M6OH 3KYAA 1K4CA 3BZ4A 4MNGE 3WFDH 4P3DA 4ZTPL 1MQ8A 1DBAH 1W72B 3BO8B 4JFFD 4HXBL 4BYHA 1P7HL 3QHTC 5DD1L 4D9LL 4YXKL 3U0PB 1QSEB 1MRDL 2IANB 2OR9L 3BH8A 1FNHA 4NZRH 1UJ3A 2A74B 1C5DB 1NBVH 3ARFD 4R2GC 3U7WL 12E8L 4FFWC 2DM4A 4PRIE 1KLUB 4R96B 1UH3A 2AJSH 5JLZB 1N59A 3C09C 1MRCL 3DWTA 3IRZA 2NY1C 4PJCF 3MLXH 1FVEA 5GGTL 3R0MA 1FNEB 2FJHB 4XP9L 3OAYH 3OG4B 3C9NB 4HX1B 5DMKB 3S37X 3UJJL 3EOBB 1SJHA 2WBJC 3C8KB 5IVXE 1VFMA 2PYFB 4X98A 5KAQF 3O3UN 4KRPB 1L0QA 4ZUSA 5E24E 4JCLA 5HHVH 3ROOB 3RU8L 3OKMA 5DRZA 5BCAA 2F19H 4PGEA 3PABB 4PJBA 2IFFL 2MCG1 4F57H 1JCKA 3P4OA 3O4LB 4ELMA 2JF1A 4QRUA 5ITFB 2BNQD 1N3NA 2MPAH 5C08B 1I7ZB 2VZUA 3RVTD 3BP4B 3KPSB 3WEXA 3MLPA 4GW4B 1F3JB 4HUMB 2MWCA 4ZFOL 2ARJA 3CX5K 3ARYA 1A3RL 4NO2A 3I3BA 2CKBB 3QIWB 4WTZG 2PXYC 1CVRA 2HTLD 5D7IB 4JANA 4BSVA 2VR9A 4PRDB 3CFKB 4F58L 3EJYD 4X6DB 1ZSDB 4WV1C 4RMUA 5IB2A 2AXFA 2FB4L 2BOBA 3NCJL 3P0YL 4HDIB 2VZOA 3I2CL 3MUGA 4F80A 3WDIA 1AFVH 2VQTA 4HUWB 3VDAA 4QGYA 1OTTC 4X98B 1BFVH 1J0HA 3QHFL 5FDYA 2AK4D 3DRTA 3SJVB 5HGHA 1YNLL 1QACA 1UG9A 2ARWA 3FQUA 4NUJA 4Y4HB 2I9LA 5H8DA 2OSLB 3K8MA 4OIAA 5I1LA 3P77A 4BQ6A 1T1ZA 3H3PH 3J7HA 4Y88A 3D48R 2E7LA 3WL9B 3GM0A 5FV2A 4PJBF 4LSQL 1AXIB 3PP3K 1KEML 3QQ3B 4HJ0D 3GRWL 4Z5RB 2JJSC 3C8KA 5AD0A 4QOKA 2ID5A 5EWIL 2F5BH 3S5LG 5DEZA 1EXUA 5DJ2B 3OV6A 2OX5A 5C0BD 3U82B 2HT2C 5IKCB 1LE9B 1NAMB 5KS9E 5EOCL 4NUJB 1XIWB 1KCRH 2BZDA 2MFNA 3IXTB 4R96A 5D2LF 4IMKC 3L5XL 1UM5H 5CD5D 4UT9L 4PJCA 5J1TC 1E27A 4Z0BH 4PJ8D 3VGAC 3RGHA 2DJSA 1QFOA 3SDXF 5F88B 3NTCH 5FOBA 4JKPH 1JGEB 3RIFK 2WWMC 1G0DA 1FJ1B 2B7DT 5D5MA 4G7VL 5IR1B 1MCWM 3HKFA 1JPSH 2VLKE 3OJDA 2BHUA 4G6KH 1H0DB 4ZAKC 1JN6B 2YSSA 1AD9B 1IEAA 1JMZA 4XPFH 3RUGE 3FB8A 3B9KA 5KSVB 2EO9A 4M93B 1IC1A 4R90H 5CGTA 1B3JA 1SYVA 2ED7A 3DO3A 1OGTB 4JDTH 3EOTL 2YA2A 4DUWA 3HZMA 1QEWB 4M7LL 5JHLL 1D6EB 5KVMC 4UOJA 1U8QB 3TPUB 5A2JH 5C08A 2PXYB 1QRNE 4CVWA 1TFHA 5HHOA 1ZLVH 4Z78B 4O2FA 4LARH 3QQ4B 1WCBB 1SQ2N 3SGEH 2ZWLT 3M17A 5KG9B 1JZ5A 5LCVH 4XNMB 3X17A 2Z9TA 1X5AA 3HFML 3AGVA 1I8IA 3TT3L 1WC7A 1OAXL 3HCVB 3IVKA 1RZGB 3WO4B 3SGJC 3G9VA 3GIZL 3HNVH 1MHHA 5LGKA 3TVMD 3CC5B 3MJGX 1FRGH 4MAUL 5TE6H 2Z31A 3E2HB 1E4XH 4HWUA 3LRSA 5D6DA 2V17L 5JPNB 1B4JL 2A83A 4HULB 3MUY1 1S8DA 4OD2A 4GH7B 4MD0A 2R2BA 3D18A 3MRGA 4LSRL 1CXFA 1D5ZA 4QHMA 1JUFA 4X8JA 1TPXB 5C0NC 5FIEA 3SY0A 4XNYH 4L8BA 3MJ8A 2X41A 2NTFB 4IOSD 4XCFH 3L3JB 5KBNC 3TH2T 4XP5L 4KZDH 1QYGL 3A6BH 3NZ8A 4HQQH 4PS4H 4PJGB 4LCUA 4UMGA 2J8UE 1UB5B 1J12A 2C3GA 4K9EC 3GHBH 4X6EB 1C08A 4GKSB 1XF4B 1MVUB 4AJ0A 5FHBL 4PRAA 1WIOA 3TIDA 2I24N 1U8HA 2PO6C 4ZNEE 2HT4D 3B6SA 2BVTA 3OGCA 3OKLB 1HHJB 2DI8A 1ZLWK 1VGEH 3U6RB 4L4VA 1RZ7H 4LBEB 3SDXB 4LSSL 1EAPA 1PJ9A 3CFEA 2Z8SA 4YBQD 1WBYB 1Q9WB 3L3DA 1A6UL 1I1FB 3UTZB 1JWUA 4I5BB 4PJ7A 2R1WB 2H6PA 5DRZB 1HOCA 1OGAE 3D39E 5I30H 5GSVB 4KROD 2QHRH 4ZFGL 4ZS6C 1NANI 5E8PB 5HJ3A 4HJ0C 1OAUH 5AZ2H 4AMKH 4P57A 2ICEA 5CJOH 3G5VA 3NIFF 3MV7B 2VAAA 3ZSTA 5MHSE 1XGYH 1NBZB 4HWBH 4P59L 3VG9C 1EEZA 3GMQB 2GK0B 3UTSE 3ETBF 2R2EA 4Z7UF 3ZYZA 5K33A 1S9VB 3LKNA 3QNYA 1HQRA 5ID1A 2VDPH 1UT9A 1GHFH 1NGWA 2X4TA 2X4OA 1ZLUK 2OR7A 5HYEA 3FO0L 5DF0A 5JW4N 3RWDA 2DQGH 5C0FA 1NC4B 4DGYL 5I1DA 1DVFD 3GRWH 4TSCH 4ZXBA 4NN7B 3FCTB 4CNIA 1YEJH 5ICZA 3OTTA 3DMMA 3SDDA 1YMHB 4GT7A 4P57B 4HIEA 3O6LH 1JJUA 1J1XH 4I3RL 3CH1A 3P0VH 1HH9A 5EUOA 2OL3B 4BSWA 4L8DB 3T0EA 2QL1A 3TV3H 4D3CL 5FYLL 4WO4C 2B39A 1LK3L 3N06B 1HQRB 4LNRB 4FQJH 4UT9H 5ID1B 3NFPA 3IDMB 3O6KH 5SX5K 2HVKB 1CFTA 4WW1A 5GZOC 5IB3B 1XCQA 4P9HH 4LHUB 1HHIA 2CDGA 4X9GA 3QRGL 2ZOKA 3LEYL 3OAZK 4UIMA 2FR4B 4OF8A 1UM6H 3HC4H 2R29H 2ARJQ 3QUXD 2BNRA 4MSWB 1RZ8A 5TDPA 4B53A 1MSPA 4PJ7B 4MJ5B 5F1KC 1TZIA 4HEPG 2A6IB 2VLJD 7FABL 2EO1A 3ULSB 1JHKH 1K4DA 2WUBH 1DBBH 5DTFA 3FFCB 2GIYA 1I3RA 2X89D 4QXGH 2EXYC 3FOMB 3D2UD 3ARDB 4FS0A 4EOWL 5CP3H 3MRJA 2ZJSH 2JLLA 1JGEA 5EUKA 1IT9L 1DBKH 1NDGA 1PVHA 5IQ7L 3SPVA 1QLRB 1CK0H 3O41B 4MNHA 2CMRL 2Q76A 4QNPF 4XMKL 2Q8AL 2DTSA 4JLRA 4BSWB 2YZ1A 2W9EL 4MGXA 4FZEH 5TE4H 4G5ZL 4JZOA 5FOJA 1NBQA 1UYWL 4X7TA 2BY3A 4U0RC 3RPKA 4Y5YA 4QRPB 1Y0LA 1N5YL 5E8OA 3GMNB 4DK3A 5DEGB 4OLWH 5E2VL 2LU3A 5EU4A 1NMCC 4OLZL 5GJSH 4WHDA 4FRWA 3FAXA 1JWMA 1B0WA 2FH6A 1A6TA 2IBBA 4O2CB 3M07A 2E8YA 3IKCB 5E6YA 5ILTL 3BUTA 4Y4HC 3HE7B 2YPVL 2OQJB 3QNZA 3QXWA 4XWOD 3UTSA 4IS6B 1Q9KA 1SVZA 5T1LD 4G3YL 3FO9B 2H32H 4M43H 4HLZH 1P4BL 4LHQB 1RIHH 5FGCE 2B0SH 3U7AA 3FB7A 3MUZ1 5E00B 2ICCA 1BD2A 4L1HA 3VI4F 3K1KC 3LEXA 1QEWA 4LSUL 1MFDH 5I8OL 2A77H 4P9HC 3TJHD 1H8OA 4U1HA 1N0LA 5CSBA 3O6FD 5BOZG 4CADB 2CR6A 3TBSB 4QEGA 1FBIL 2Z8VC 3DV6A 5T33H 5A1AA 4OZIE 3QDGB 3FMGL 4WHTA 5T1MA 3S35X 1XGRA 1LEKA 4L9LA 1YEDA 4FP8H 3RZCB 3QDMB 3LKPA 1QHOA 4MA3B 3WNKA 5C70A 1VGEL 3WNOA 4PD4J 3OPZH 4R4FH 4S2SB 4L9LC 5HYJA 5IB1B 1OAZL 4L4VD 5EOCJ 3IDGB 3G6AB 4OGYL 2QSQA 1OF2A 3OKKB 1N3NB 4P48A 2Y25A 3U9UB 3SKNA 5C0CB 3BPLC 5HHPA 4U1KA 5DJDA 1N6QH 2QV2A 1HZHL 3FFDA 4XWGL 1LE9A 5KVEH 2B5IB 4HJJH 1CFBA 1OD7A 3B2VL 4PGEB 4NNPH 5FGRA 4OF3A 2WBJB 1ZAGA 1CL7L 1D5IL 3QHZH 3ZDXF 1DUZA 1N2RA 2ADJA 4X0KA 2V7NB 3FN3A 1IM9A 4UUJA 2AK4E 5F88A 5FOBB 1IC5H 3BKYL 5FYJE 3DX8B 3ZZ1A 3VJ6A 4QWWD 4TYUA 3T0BA 1CWVA 1DEEB 3E0GA 1PX3A 5DK2A 2XV6B 2ILLA 3TH3T 5KSAA 1S7WB 5GZNC 4NKQB 5E7BA 2FSEA 4M6NL 4QXUL 1UM5L 4NC1E 3GI9H 4Z0BL 4KDWA 4NO0B 1ROWA 1P4BH 1M6OA 1MCDA 1D5MA 4PJHF 1TMCB 1OSPH 4WW2B 2VDOL 5LBSH 4OFYD 5GPRA 3BHBB 4CVUA 2NW3B 3ULUC 2NR6C 2QQNL 4EUPB 2X70B 1MFEH 4XBEL 2P43B 2X4RB 1U8MA 1N0XH 5H94B 5F9OH 3TYFB 2YKLH 3C5JB 2F5AL 1EVUA 4HIHB 3MLWL 3F6IA 1F5WA 3QA3B 3QXAA 3I02A 3CK0H 5C6TH 1FO0L 2WAHA 1LGVA 4B50A 3PV7A 3VRIA 3ARGA 5E5UB 3HAEH 4F7CB 1AIFA 43C9B 2P8LB 5GS0H 4PJEA 1KBGH 2EECA 4WY7H 1AQDA 1KJVB 4NNYA 4NM8L 3ULVH 2ICWJ 1S7SB 3CVHH 1VFUA 4WHYG 2ZCHH 4GG6A 3DIFA 4LSPL 3ARSA 3F7RA 4KRLB 3BRGC 5F96H 1CFQB 1CGSH 2L7JA 1A9EB 4NRZA 3BIKA 3HE6B 4WW2A 3I02B 4BQ8A 5ETUB 1BD2B 1E4XL 3VFRA 3QXVA 5FGCB 1CIDA 5CWSB 5GGVL 3WXVH 2IWGA 1IGJB 1H3PL 2ZUSA 4N8VA 3SDAA 5HYSB 5JW4R 5I1AB 4JPVL 1U2CA 2X4RA 1SJXA 1EJOH 1A6PA 2R0WH 3MLUH 2AJZB 4IRSC 3ARFC 5I6XC 4G6AC 4MNGA 3L7EA 4LASH 3HPLA 1I9IL 4APQD 1KELL 3DSFH 5A16A 1P1ZA 1A22B 2V2WA 3SKJL 3SEPA 5FECA 4R4ND 4GAYB 5I17B 1JPTL 4DKAA 2ADJB 4OCMC 2OLDA 3UPCA 4F7PB 2BNQB 3C9NA 3O4OC 3FT4A 4CU7A 5AAWA 2OZ4L 3EUUA 2QQKH 1H5BA 4HT1L 5I1AA 4J3XA 3VCLA 4AEEA 4I13B 3PWPE 4GMTL 1S9WB 3UO1H 5FEBA 1W72H 1N0XL 4CBPA 1MJUH 2V5TA 5F9OL 1MCBA 3P4MA 2AVGA 1YNTA 1NCCH 2XZQL 1G9EA 5D6CA 2HRPH 4Z7WB 4GXVH 4PRHB 3HE7C 1FL5A 1LK2B 2ZKHL 3HRZB 3O45B 3EO0B 5F8RC 1ZA6B 3VDBA 1SM3L 1QPXA 4U6VL 4ZO8A 3QIUB 3Q2CA 1UZ8B 4OBRA 4U1KB 1GJIA 2FATL 2XY1A 3AU1A 1X4ZA 4MSWA 3H6JA 5D1QA 4CMHB 5D2NC 5ITBH 1F4WL 4H25A 5JW3H 4ZPTA 4YDKL 2WQ8A 1TIUA 5EN2B 5D1XD 3SDCC 5DUPL 1RIHL 5E00A 1WQVT 1NL0H 3JWDH 2E6QA 1P6AB 1GZPA 4XCNA 1TTGA 3C87A 1A1OB 2VDQL 2ZG1A 3RY4A 1IC4H 1UACH 3NFSH 3QQ9C 1KTRL 1YPZE 2C3HA 2VTFA 3HFMH 4XWGH 5I8EA 1FNFA 3F5WA 4N1EA 5IB5B 3RPIB 2D0FA 5IFJA 4BZ1H 3SJVD 3OKOA 2XQBH 1RI8A 1MAJA 4P4KA 4O5LH 2Y36H 3MXVL 2I26N 1BJMA 1T22A 2V5SA 1AGBA 1KPUB 4M7LH 5JHLH 1EEUA 5L8LB 3AUVA 1QP1A 3QDAA 1AY1H 3RX8A 5F9WC 5FUCE 3LZFL 1W0VB 3LKOA 5EC1A 4G8GD 1L7TH 4K3JL 4YHPB 3BDYH 5ANMA 3O0RH 4BH8B 4LCCA 4QNPE 3H3KA 5DK2B 4XWOC 1IGCL 1Q72H 3Q5YA 1I1AD 4W6YB 2VLRB 5E1HB 2EDNA 1C5DA 1N6QL 4OZFA 1T0MB 5EBWB 2VLKA 3NA4A 1AR1D 4LSTH 3RY5A 3QEQA 2E6JA 4YQXL 3UZQA 5JW5B 2XG4A 1JV5B 2XZQH 4PJDF 4YJZL 2XKNB 3F7PC 5DQDH 2CUMA 4I3GA 5BW7A 4UV7L 3MODL 4O2EA 1GPOL 1UM6L 4PJDA 3QPXL 1G1YA 3OAYK 2DIBA 3MLYH 1NCBH 1MCOH 2Y5TB 5C0EB 3KG5A 4FFZL 3R1GL 3CFCL 1FPTH 3U30B 4F9LC 4NO3A 2RBLA 3TYGL 4KHXL 3SPVB 3GSXA 3QI9C 1MI5A 1QRND 3TNMB 3VRJA 5IEHB 1EO8H 3PGCB 3SCMD 1FFPB 5D1XB 3PL6B 4OTXL 2BSRB 5JQHC 4PJAF 3MMEA 3UC0L 1OP5K 3OKLA 5I8KL 5B3JF 3MLVH 4GRWH 4ODUB 5L7XH 1BGXL 3CVIL 3JWNC 2UYLA 3B5GA 4K7PX 1BVKA 2G9HB 2HJKA 5K9JL 1CGTA 1TCRA 4WTXA 1BJ8A 3TBTA 3AM8C 4FZEL 1CFVH 1A8JH 3SE8H 4XPBH 2NXZD 1MAKA 1OAQL 5IFHH 3QCUH 4NCDA 3GKWH 4KJPD 1KGCE 5ALBH 4IIQB 4U4BA 4YWGL 3QISA 4K8RD 3REVA 3P9WB 4Q0XL 2A9NL 3ZE0F 2OK0L 1KBGL 1KB5L 5DK3A 4IMLB 3WFBH 4ZG1A 5DRWB 3SCMC 5GRVK 3B83A 5KTEL 2P1YA 3OR6B 4ZFGH 4O9HL 4J3TA 4YDVB 3PP4L 4CVZA 2VXQL 1G9ML 4XXCC 1OQOA 5DC4B 4YQXH 1KIPB 1Q0XL 5E2WL 2DBLL 1QBBA 3WIIL 4ZODA 5SWZD 4N8VG 1I85A 4UILH 4BQ9A 1Z3GL 3MO1B 3RWGB 3SQOL 3MRQA 1MNUL 5TQ2H 1LEGB 1O7VA 2FRGP 5DJ6A 1IC7H 4HIIB 4FFWD 3G6DH 4H1LA 4OV5B 4QRSB 3X12A 4G9FE 3TBWA 4JY6A 3VXOA 5C0RL 4HHAB 4P2OB 1MJ8L 2R4RH 3ARDC 3DVGB 3JV6A 4NO0D 4FG6D 3ZO0A 3TA3B 3BKCL 2ICES 1F42A 5BS0D 4D8PA 3ELAT 3GB7A 1J10A 1TCMA 1NUNB 5HDBE 4NP4H 3LAFA 5DGRA 4CUCA 3KPLB 1A1NB 4OLUH 4Q9CA 3RUGB 2FIRT 1XF5B 4BH7A 4IM8A 4AG4L 1I7RB 1MFAH 1LP9E 2P24B 4R4BB 5INDB 4GFTB 5DUPH 1UH2A 5J4MA 1Z9OA 5IV2B 4NZUH 3QIBD 4ZTOH 2QEJA 5D1XA 1JV5A 1CYGA 1IC5L 1VGKA 3BKYH 4LPCA 5DD3H 3KAAA 1DSFL 4OCNC 3SY0B 3OGCB 1OB1A 4D9RE 3MA7A 2VWEE 3IU3A 4XMKH 4KKNA 2PW2B 2ZKHH 5A40E 3D85D 3PWPD 3ILPB 1KJ2B 3W9DA 1NDMA 3VFUB 3FRPA 3DMMC 3WSQH 4Z7VA 2EXWD 5H94A 1BLNA 5F7HA 2J5LB 2HT4C 2EDEA 3PV6B 1CXKA 1DBBL 1AJ7L 3FOLB 1JTPA 5BZDA 1VEPA 3ZE1F 5KSBA 4POZD 3L1OL 1MAMH 4MQ7A 2D3VA 4UZGA 4U3CA 4JY4A 1F3RB 4X4XB 2EIEA 4WFHD 1ZWIB 1HSAA 3Q3GB 4ZUUB 2F54D 1PAMA 3OBAA 1CVSC 3VE0A 1DQQA 1HNGA 4WJ5A 4AENA 3FN0H 3IAQA 3KLAA 3FB5A 4FQPA 3GSUA 2MCPL 2JB6A 3QUMB 4KUCF 4QHLA 3DXAA 1A3LH 4JFZL 1PY4A 1H9VA 1U8LA 1S3KL 3BUYB 5E08L 4KV5E 3HE6A 3LS4L 3IVKB 1KB5B 4MDIA 1DUZB 1OWRM 1TENA 3QWQB 1AY1L 1T20A 3BZDA 3MYZA 5IQ9A 5B38B 1NUDA 3C09B 3A6CH 4PV8A 5TFSL 1S7TA 2CXGA 3IFPA 3PQYE 1I4FB 2VO5A 2YD7A 5HHPB 3CFIC 5HHMD 3WN5B 3DVNA 4LCIH 1QRNA 1KYOJ 3DUSB 1X4XA 1LMKA 4XPTL 2DJ4A 4JPKL 1A0QH 12E8H 4XNQB 4I77H 4EQ2A 5T5NG 5FXCH 1D9KB 1HNFA 3M45A 4OIIL 3O4LA 4ELMB 2ICWB 1FC2D 1G7LB 4DN4H 3VRLE 1SEBA 2XI9A 4WO4D 2VLMD 1FPTL 3B2VH 1F13A 3W82A 3CFJB 4HBCH 2OS7A 3U9PL 1XZ0B 1JGVH 1RU9L 4O58H 3VU2A 3VD4A 3ROOA 3MRIB 1HCFX 3TT1L 2H1PH 3WXWL 3VMPA 2BOCB 2XXCB 4XGZA 5HDOA 3RTQB 1J1XL 3L3IB 4PJ9C 3TM6A 4PD4K 3L3HB 1U8IB 4PLKD 5C0DB 3GSVB 4E42B 3BRFA 5DJ0B 5E99H 5J13B 1WT5A 1NLBH 3PDOA 4U1IB 5DHYA 5FHAH 4WEUD 1AXTL 3C08H 3B9VA 3WFZA 4ZOBA 4XP5H 3DRTB 3MCKA 3QDGD 2GSIB 4L9DA 2DQJH 3VXRA 4YPGB 4RIRB 3OQ3B 3IFOA 3OJMB 1F11A 1B2WH 2FYYA 2J3SA 2VDMH 2W65B 5FHBH 3QR2A 1IM3A 3WL9A 1JBJA 2WP3O 4HC1A 3N0PB 5CAYB 2V17H 4HS6A 1SEBB 3TN0D 3W2DL 2E5EA 1IJ9A 1X5XA 3FRUB 1NBYB 2EKSB 3KLSA 3QUKB 3QIWA 3C5ZA 4CJ0A 4NFBA 3RP1A 5I0DA 3QXDA 5D7KD 2C26A 5C7XL 1M7IA 2BOCA 4E9LA 2O26U 3MV9D 2ZSWA 4R2GB 4HIHA 3UYRH 3WIHA 2JE8A 3NACL 1SBSH 1OGAA 2NR6D 1WGOA 4XC1H 5F71A 4KK6D 1EBAA 1A4KB 4WNQB 2WK2A 5FCSH 2W9DH 5E9DE 1G7LA 2P49B 3Q48A 3IFNH 4XPHH 4V1DB 1EO7A 2CKBA 5IR1A 2BNRD 4Q6IA 1P9MC 2UUDH 4LLVA 4P2RA 4P59H 2C3WA 3T2OA 4YPGA 1YEEL 4PREB 1BREA 3V6ZB 1RY7B 3JUYA 5F7EH 1J11A 2DL2A 1S7RA 4RWHA 1I8MA 3NCMA 3RAJL 5FYLE 1SY6L 2PYEB 2MQCA 3VWKA 2VKWA 2W91A 1S7XA 1AI1H 1FNSL 4O02H 4OJFL 3ZYOA 5D2NE 1DN0A 1YEKH 4IOFC 4QCIA 3EJZC 1LO2L 4I2XE 4PBVC 3LB6D 5F9DC 4KROC 4PYGA 1GC1H 4GMSL 4RMTA 6FABH 1KIUA 2EYTA 1ETZA 4HCRL 5J1AA 4YDLC 1UM4H 4JB9L 1ADQA 5T33L 3ULVE 3REWA 4N0RA 3O6KL 3CCHA 1UWGH 4GOSA 1V3KA 1HK6A 1NCCL 4J1UB 5DUBA 3L7FA 4I18C 3NPZB 2VE6A 4MJ6B 5SWSA 2R2EB 5HPMB 3TBVA 3CXDL 4FQXA 1MCEA 5ADPL 5H37G 3DVFA 2ED8A 3AAZB 3HC4L 1TNMA 4H26B 3HPJB 5HGAB 3BP5A 3BWAA 3P0VL 4DKFL 4QRQB 4DOHE 4YO0A 1BD2D 1RUML 4OCRH 2AJ3B 3DETC 3H9SE 5EUOE 2Z0BA 2LVCA 2CPCA 1KCSH 3U9UA 3R8QA 4E0RB 4KRPC 4PG2A 3UJIL 1MHEA 2QQLH 4HAGA 2X4QB 5IW1B 1OTSC 1CLZL 5KSAC 2HG5B 5F6HJ 3VW3H 3PGDB 5IESH 4S1RH 1IGML 5IP4A 3QUMA 4ODSL 1II4E 4ZYKA 3ARVA 4QRTB 4F33A 4J23A 1IGTA 2IAMC 4YGVA 4M6NH 4LL9A 4QXUH 5GS1A 1DQDL 4GJTB 3Q3GA 5KTEH 4N0UA 2BJML 1FVCB 1RHHA 2FIKB 2HH0L 1JFQH 4P2QD 4EBQL 1I9JH 4PRPD 5F21B 3CH1B 4E41A 2VL5B 3U4EB 3LKQB 2ZNXA 4GAGL 4GG8B 4P2OA 1MLCA 2DKSA 1FDLH 4GMSH 3CMOL 5IF0B 1YN6A 4PRHD 4ZPVB 4UOW1 3OR7A 4PGBB 3DRQA 4M62H 3W11C 1IM9D 4HUVB 2DQUL 5D2LB 1X5KA 3G5YB 5JO5A 2DB8A 1IC7L 3NIGE 2B0SL 1TVBB 1ZT1B 5EPMA 4Z7NF 4YHPA 4KVNH 4ONFL 5E9DB 5HHXH 4HIJB 3MRIA 1MLCB 1K6QH 4R4BA 4Z7VE 2NMSA 3I3EA 2C7UA 4Z18A 3HCVA 2BSED 1GVIA 3V4VL 1FVDA 4X6FA 4P5KB 3JV0A 3RHWK 3ARBB 2R2CA 3I84A 2X4PB 4FQQA 1IQWH 4NHCL 3VFSA 4PJFF 1HYRC 5ALCH 1X4YA 1FE8H 3GSNH 2PXYD 2Q1EA 1DLFL 2EDDA 1T7YA 5K59F 5GS2D 4J8RB 1T1WA 4LOUC 2XWJB 4LSTL 4PB0L 3VH8A 4GUPA 2V7HA 4U1SB 4YR6A 3CVHA 4YDIL 1WFNA 4S1RL 2FGZA 5C0BB 2A2QT 3LN9A 4WWKB 3MODH 3MRPA 3MV9A 3MACL 4X5LA 4XHJC 2BERA 3RWCB 1FZOA 3FQTB 1EFXA 4RBPH 3RI5K 3IDYC 4YX2H 5IHUL 1DQJA 4F2MA 1CFNA 2UWEA 1FYTD 3KPLA 3MLUL 3QG7L 4G42A 4P5KA 1CDJA 5IK3A 2IPUG 3MRQB 2HLFD 35C8L 1EV2E 2P5WE 2N7BA 4UIMB 2Q8BL 3EYQD 3V5DB 1I1AB 5L2KB 25C8L 5C0BA 3SKMB 4AENB 5C6WH 4LPUA 5T1DL 2E9IA 3IU4L 3KNBB 4DTGH 2AJVL 2FWOA 3CMOH 1CD8A 4AQ1B 3C60C 4DGVL 1REIA 3RJQB 5KS9F 1WBZB 5K9OA 1KN2L 3SE9H 1S9XB 2AERT 4NQEA 2JCCA 3VFVB 3LKOB 2J8HA 2VDOH 4JRWA 4K3DH 4MA1C 4NSKA 5LBSL 2JJTC 4AIXA 3QUML 1JGLH 3ULUD 1AO7E 3ALPA 1FV1B 3DUHA 5D5MF 1B4JH 4RAVB 5I1IL 2M1KA 1BEYH 1C8PA 4YNYA 5DQ9A 4U1GB 5DVNA 4Q0XH 4EDWL 2NY5L 3H9ZA 4N9GA 4F15B 5C71A 4Q2ZB 1YQ2A 5D2LA 3VWKB 5JOPD 3C2AL 3T2QA 5EC1B 3MR9A 4M5ZL 2CDFB 3GSRA 3WIFB 2VLRE 1DE4A 1WBYA 2C5DC 1N64L 4I18A 4RMSA 3FN9A 5GZND 4NQVA 4KKBC 1SEQH 2YD2A 1EDQA 4P2OC 3B3IA 3PGDA 2EE2A 4YGAB 2E9WA 3MRNA 5EN2A 4JE4B 4U7MA 3CFBA 1UXWA 2FX9H 4MNQD 4FQ1H 1O7SA 4OCSH 3V0WH 1INEL 1F4XH 3QJFA 4W4OA 1Y6NR 1CBVL 2GJZB 1OAUL 1OSZA 3WIHH 3KLDA 4O51B 4Z7OF 3GJFB 4KK5D 4HKBB 3QDJB 4MS8D 1KB9K 4KQ3H 4PLNC 5EZIH 5JOFB 3LQMA 4NQVB 2EXWC 5D96B 4LSVL 4LCUB 4J8RA 3RA7H 3LN5B 4L8SC 2ZCKH 1BFTA 1MI5B 3TNMA 1JNJA 1PSKH 4X9FA 4X9BA 1YNTB 4WUKH 4JPVH 1G7PA 1ZGLA 4CKVX 4Z0XA 5KAQG 4JG1H 4M4PA 3DPBA 4G6JH 1X6NA 3ZT7A 2A73A 4PRBA 4H88H 4RBPK 3EZ8A 2X9XA 1ZLWH 4JO1H 4RAHA 3GMRB 5HYQB 4WI6A 3BKMH 1B0RB 2ZUWA 5I15H 4N8CL 4WCYH 1P69B 1KFAH 5E9DA 5CBEB 3L1OH 1FDLL 1P5UA 4ZFZA 4U3HA 4OFDA 3ZYIA 2Y7QA 4ODWA 4P2OD 4M6AA 3TA3D 1M6OB 3U7WH 1E4JA 1T1ZB 2FGWH 3P77B 4KH2A 3I3DA 4JFDB 4NFCA 3DX6A 1OW0A 3JV5A 3WE6A 4HK3J 1AC0A 2J4WL 3GSOA 1HI6B 5IHZA 2WINA 1E6JL 4XVUC 1ORQB 4WFFD 1I1AA 1WJ3A 2GCYA 3JTTB 2IANA 1S5HB 1RPQA 2XWTB 1JF5A 5CMAA 3C8DA 4HUUB 3NABH 3QIBB 5CIPB 3PWUA 4YBHA 1V7NH 3C8HA 5EZLA 1NC4D 1BFOA 1RIVL 3U30C 3D2UB 3ARDD 1JYNA 3KJ4B 4XMLL 1FAIH 3HRZA 1K8DB 2X9WA 4XCEA 2D31B 2P8LA 4CW1A 3F65A 3HR6A 1A0QL 5F70A 4ZD3L 3IF1B 4ZO9A 4AH2B 4Z77B 2ARJB 1QVOA 1T7VA 2BSSB 1A7OL 4JFZH 1RAMA 1CLOL 3GBML 4MJIB 4L8CA 4K55A 4HZLB 5TF1H 5CKAA 2ZG2A 5I16B 2R29L 5KS9B 3FB8B 3FQNA 3IXTA 5FYKE 4U1LB 4JQVC 5AEAA 5SX4H 3CZFB 2X42A 3QFJD 1BFOB 4CN1A 4NQXB 1X3DA 4H88L 1CTNA 5B38A 5IVXF 1QFWH 1T20B 4NHUA 3BOVA 5L88H 1AKJD 5E2TL 3CZJA 1FJ1A 5D5MB 4ZUSB 4EOWH 2QQNH 5HPMA 1T0PB 3LIZH 5C92A 4LLDB 2APXA 3MBEC 5CP7B 4YDIH 2XA8H 3KYNA 2AJZA 3WUWA 1A6WH 1S5IH 3WKMH 3RL1B 1NSNL 1X7QB 5E7FA 3C5SA 3OAUH 5CZVL 4EXKA 5ISZA 2RCSL 5J3HC 1C5CL 1VKXB 1GIGH 5CWSA 1R5IB 4CJ1A 5DHXB 4OZ4B 3IKCA 3LDBB 2Z4QA 3BZFB 3H2WA 3S37H 1GGCH 3BO8A 5IT2H 3AXLB 3GIVB 5I1KL 1EEYB 3BQUC 2G5BA 4NN6C 4GW5B 3QUXA 4OZFG 1BBDH 4LLQB 3TYGH 4U2YA 2AJVH 3T3PF 3K2MC 4P3CH 1OPGL 3IB4A 1F4AA 4FXKB 4RGMB 2P45B 1MJJA 1P4IH 5FAAA 3RX7A 4IMKA 3NCFB 4RGNE 1OF2B 1YEGL 2Q20A 4J2XA 1UB6B 5ACZA 1ZVSB 2YBRB 4R0LB 4TSBL 3ZKMC 2YZ8A 3ET9F 3AU1B 2P8MB 5C8JB 3FHQA 4NOBA 4NNXB 1OCWL 1AD9A 3MLRL 5BMFH 3T4YA 2DM7A 4MHHG 1VDGA 2A6IA 3FQNB 5F44A 4LLYA 1T80A 1KLGA 3HI6H 3T0DA 4Z7NE 3FQXB 2IPKA 1FL5B 1AIFB 2WUCL 4G8IB 1F3DJ 4GBXB 2CIIB 2AW2A 4OGYH 1XFPA 4JAMA 3WN5A 2DJUA 3MCLL 3X3GH 3CMGA 4CMMB 2W0PA 5GGSY 5J7CC 2I9TA 4AEIL 1TJGL 3CUPA 3ISWA 4XB8A 3DHJA 4F7PA 1QQDB 3KPPA 5LGJB 3KXFA 2VDNH 1KOAA 3O6MH 2CRIA 5DVOA 1NLDL 1ACYH 4OZIB 3JTSA 5FYKU 4YHMH 4KQ3L 3BMVA 4YC2B 3TBYB 1R0AL 4H5SB 1ORQA 3Q1SH 4PY8J 2YRPA 3QH3A 4TVPD 2VIRB 3MRCB 4K71B 3FFDB 2W0KA 1Z6JT 5E56A 1X5JA 2EDLA 1SY6H 4WV1A 4UDUA 3ZTNH 1BX2B 4E42A 1DVFA 5FO7B 5HD8C 1RZFL 1NGYB 4PGDB 2BX5A 3VXSD 1P4LA 1DLHB 1JRHI 2ATKB 1CDUA 3EOAA 4GKOA 5FUZH 4DN3L 3QDME 4XPTH 4PS4L 2NLJB 2Q6WA 1ZTXL 1H3TA 5FA4A 4NC2B 1QO3B 5D7KE 1A02N 3SKMA 2DRUA 2KPNA 1ZXQA 3MACH 1NUGA 3RNQA 2A9MH 3ZDZF 1CTOA 1LEKB 3PL6C 4M9PA 2JK5A 4Y19D 2N56A 1G7JB 4JO2L 1Q9OA 2X7LB 1I85C 3PUCA 3V95A 4S1DC 3KLHC 3NCBB 1H3WM 1PGRB 4LCWD 5CEZE 3G6DL 2ZP0T 1VEMA 3IDXL 2QKIB 2IALA 4S0TD 3RVVC 1F97A 1A7QL 2V7HB 4ZXBC 5DZOA 4LMQI 1VFBA 4V1DD 4KUZL 1GGYA 5E99L 4DGVH 3KYOB 3OXSB 5JDSB 1IGCH 4IS6A 4MJ5A 1G7IB 3HAEG 4M3KB 4TTDD 2W65A 5DJ8A 1NGZB 4X99A 2JCCE 4P49A 3DURA 3JV4B 1S7VA 5IROA 5L88L 4NUGH 5AZ2L 4HS8H 4YXHL 3S4SG 4K3EL 3RNKA 1MAML 4P46A 1HIMH 2HKHL 2VDML 4O4YH 5DJXA 3KDMB 1MEXH 5ICXA 1VFAB 1XR9A 4L3EB 3T8XB 2YUWA 1AGDA 1KT2A 2RR3A 3WNLA 1TETH 4HJGB 5ADOH 1MCHA 1QNZH 4OCXH 5D7JD 4MAYA 2R0WL 2WMPA 1Z5LA 3FQRA 1GHFL 4PGBA 2DWEA 1PD6A 2LU7A 4PGCB 5IW6A 5IGXH 1U3HC 3MRBB 3MV7A 1YMHA 1F6AB 3GNML 4ENED 2NY3C 1J1OL 3UDWC 2XZCH 3QWRA 1N4XH 2VL5A 4HKJB 3SBWC 1D5XA 5C07B 5TQ0H 4JKWA 2Y4SA 1Q0YL 1HDMA 5EULV 4ORGB 1OPGH 3MV11 2IQ9H 5CILH 5E8NA 3RDTA 3QYCA 4HWNA 4JFPB 4PP1D 1JNNH 4CMHC 3S3JA 5IVNA 3FQTA 4G8EA 1B6DA 4WFHE 2UY6A 3UMTA 2BVPA 1MJUL 4LSVH 2MCPH 5EO1A 2ED9A 1JI2A 1MQKH 4HW6A 5AYUL 2QSVA 5EZOL 2XPGA 2UZYB 2VABB 1RZJC 1HXYA 2FZ3A 3RKDD 5EIIB 3DXAE 3OB0H 3OJVC 3V5HB 3R8BB 5HPOA 2NY4C 4F58H 4C83A 4JM4H 3E6HB 3DV6B 1RZ8B 2C1OB 4JHZA 4EXPX 5I9QC 3WJLC 1FHGA 3NOIA 1BOGA 2C7UB 3D69A 4D8PB 1XGQA 4MA1B 1G1CA 4OZGF 5FA3B 3D1MC 3EO0A 3UTOA 4NQSB 2CDGB 1JHKL 2WUBL 2ESVE 3MRBA 3QHFH 4GS7C 3PXJA 2YUXA 3RIFF 2ZUUA 2HTLC 1IKNA 4M61B 4MJ6A 4U0RB 5E8EA 4M93C 1T0MA 3V7AG 2YUVA 2YXFA 3GSWB 3GMPB 1K2DB 4LLWA 2PCPA 3VXNB 4NQCA 5TE4L 1XIWA 1G0XA 2W0FA 1BWWA 2W9EH 1BJ1J 1KIQA 2DYPD 3PWLA 5GISL 3D3VE 5DEFB 3QT2A 1FFQA 1RK1A 4D9RD 4ESKA 5EFIA 1NGPH 5ICZB 1R0AH 2BNQA 5D1QC 3TJEH 3L3JA 5BW7C 4LDOB 4NSKB 3KPOB 4JDVB 3QFDB 2YEZB 2Z35A 4LLWB 1HE7A 1I9RL 1BVLA 5HHNB 3BXNA 2HWZL 3VG0H 1IGIH 2C4XA 3ALWA 2YN5A 3BDYL 2OSLA 3KNBA 4ZPVA 3W81A 1TJGH 3U36B 2R69H 1VGKB 2QR0B 1S7RB 5FHAL 4P9MH 5DUML 3VXSA 3MREB 1KCVL 2HN7A 3U6RA 1G7QB 1JPSL 2BC4B 1BGXH 5B4MC 1BQHB 4BH7B 1VSCA 4H1LH 3VFGH 4JO2H 1P2CB 1FL6B 5AG8A 3NPSB 2VQUA 5INCB 4TNWF 3CSYB 1FCCA 4KHXH 5BVPL 1T89C 4QRQA 1UQSA 2Y9RT 4M5ZH 3BESR 1MCPH 2RAMA 1F90H 4JN1H 4NYLB 4ZOEA 4F7CA 2AEPL 2NLJA 2IALB 2NTFA 3TPUA 3S34H 1A7NL 2BY2A 5ACZB 1RUKL 4AL8L 3EYOA 1MHEB 3ZE2E 3CAFA 1A2YB 4TQEH 1CGWA 3BQUB 3PWVB 4B5EA 1NFKA 2E7LC 1T1XA 1HDMB 4ORZC 4BZ2L 4Y1AB 1G7JA 3TA3C 1NAMA 2YSSB 3ZSSA 3SCMB 3UROR 4TOYH 2GFBB 4LLQA 4LVOB 3QEQD 2D4FA 1YQVH 5BRZD 1HHGB 1AH1A 3MNZB 1MFCL 3CGTA 4PJ8A 1NC2D 1ZT7B 2NW3A 3OJ2C 5D7LA 4LQ1A 2PYFA 2R0LH 1V7ML 1NAML 3P73A 2ESVA 2PO6A 2VLRA 3UDWA 15C8L 4YHNB 4P5TC 4HJGA 4EN3C 1MOEA 5HD8D 3RI5F 2OK0H 1N59B 4NPYB 5AYQA 3A67L 3GEWB 4W81A 3WLBA 3MC0A 4XAWH 1PEWA 3WFBL 5CD3A 5DLML 3CLFH 5F7FA 5F7WC 2NZ9D 4KTEH 3GSVA 2I25N 4U6XB 2PN5A 3FO1A 4YHYC 5HJ3B 3EFDH 5GGVY 1PLGH 1IRAY 1MHHB 1R24A 2QLVB 5BO1L 3WD5L 3QEHB 2XTJC 1HIML 5HDBF 4UAOB 4Q9RH 4HCRH 5HHOD 1GC1L 4WHCA 5IB5A 3VWJC 4DZ8B 1WWCA 1GOHA 2Z92B 3WFEH 4KKBD 3M17B 1QSFB 3RWJB 1H0DA 3MXWH 4L8SA 3WUZA 3KPRE 4G6ML 1BF2A 2YWZA 4TN9A 2JB5H 4NZUL 2Q8BH 4N0FA 2VN7A 4OQ1A 3RY6A 4C54A 2IFGA 1HHJA 2HT3D 1PYWB 4LVOC 2NY6B 5D7SL 4AIZB 2CK2A 4OF7A 4HH8A 3QO1B 3QDJD 1KF9B 4LDEB 4UT7L 4JQIH 1NBYA 2EKSA 4JFFB 4NO3B 3T2PA 3G5XA 1NFDE 1ODAA 3CX5J 3N85H 4QHKJ 4Y4FA 5DFWH 4AEIH 5F1NB 1XGRB 3U7YL 3HLAB 4YBLC 4AG4H 1A14L 2M26A 1RIVH 1J87A 2IQAA 1U3JA 2VH5H 5CIPA 3ILQD 1VPOH 4JFDD 1B0GB 2QADD 3UBXB 4OGZA 3G5ZA 1A9BA 3QI9B 3WFDL 5I8CB 1CR9H 4HF5H 3MJ8B 3NCYS 3HZYB 3C6LD 3BD5A 2J7LA 1SJHB 1G7QA 5ELIA 3DBXB 5GGTA 1R5WA 3CLEL 1CIUA 4H20L 1NAMH 4P5TB 3M8OH 4C59B 1IGYB 3GUTA 3PXHA 5MEQA 3TC9A 1LO3L 2AK1H 1T21B 4MX7B 2ADIA 4ODSH 1E6OH 1P7QA 3FAWA 3WSQL 3UTSB 3WS6A 4NQCD 1JFQL 4DVBB 3OKYA 2FYYB 4DN3H 2OTUB 4O00A 3B2UC 1IM9B 4MZ2A 4UUJB 1GAFL 4OCYL 4OZIA 4NC0B 4QTIH 1EGJL 1DR9A 5HI5D 5EU4B 1QQDA 2B1HL 4HX1A 4XXCA 3BZ4B 4R26L 1PKOA 3HG1A 5HVHB 5EU6A 1LO0L 4Z7VB 2OP4L 4KKAC 1M71B 4L3ED 3ARFB 4MX7A 3G6JF 4CVXB 1P4IL 4FMKA 2VLKD 4LRIC 2VZ1A 4QTHA 4PRHE 3F58L 3P4NB 4A6YA 1A7BA 5FCUH 4DZBA 4XX1G 1MLBB 2Y1VA 3BEWA 4MD4B 4M7ZC 2YPLB 1T4KA 2OZ4A 3ZKXC 3IETB 5MEND 3WHE0 3HMXL 4PUBH 5DZNA 2DLTA 4KVNL 3VFGL 3I9GL 4NHUB 4D9QE 2NX5E 2BNUA 2NY2C 4ELMF 2J8UB 1CI5A 4LPXA 1CT8A 4K7PH 1JRHL 1LO5B 4LVNB 3UTPE 5EBLA 3RU8H 3I50H 2P5ED 4K94L 4JO4H 1F58H 4PBWD 5TDPB 5C8JA 3NZHL 5GS1C 3GI8H 1BZ9B 2ZSWB 1MHCA 4LPTA 1EH9A 2ZJSL 2G60H 1IQDA 2OL3L 4N5ED 1A7NH 3QA3A 3QXAB 3FO1B 4XCYB 4ZXBD 1JYXA 4NYLA 1X9QA 1BBJA 4LHUA 3OWEA 4IRJC 3H42H 5HGDB 2JIXB 1DBKL 3VFNB 1DE4B 1EVTC 1ITBB 2ORBH 5I6XB 3HG1B 1ORSB 4MDJA 1DANU 4PJ9B 5DJ6B 2OMBA 5IJKC 4Y5XA 3ABZA 3TBSA 4GG6E 3FB6A 4YIQB 3WKNA 4ORGA 4YHML 4WW2F 4BM7A 1WV7T 4YBLB 3FOLA 2WUCH 5CJXA 1H3GA 5CINL 1S78C 3MJ7A 2FJFA 5DVLA 1ZT7A 4OCYH 4TVPL 1IVLA 4M1GH 4TSAH 3EHBD 5KANG 1CXIA 1YMMB 1L7TL 2DIAA 1V7NL 3BP7B 3O0RL 1X44A 4WJ5B 5FDWB 5BOPA 5HYFA 1J5OH 4N8VB 3SDAB 4RGND 2OP4H 3MQIA 5FYKL 3T0WA 5IM7A 4PBXA 2IJ0C 5KSAD 1K2DA 4LCCC 3S5LA 1ZGLB 5F3BA 4OSUH 2VLJA 4X4MA 4ODVH 1CGVA 4GRLA 4HGWA 5BRZA 2EH7H 1XF3A 1IBGH 4PR5B 3FOMA 2AQ1A 3ARZA 4R7NA 1WIUA 2D7PA 1UVQA 4FQ1L 4OCSL 3VXMD 4QYOB 1MJ7H 3U0TB 4NRYB 1XF5A 3QIUD 2BRQA 1F45A 4FG6C 4J3VA 2ZNWA 2QSCL 2BNRB 1RURH 3LS5L 5JZ7D 4BQCA 1EAJA 1MRCH 5CFHA 1G9MC 3VA6A 2BVOA 4NDMA 3P9MB 3OXSA 4R90L 4UIKH 4YHOH 1L9NA 1P7KA 3MRPB 3ZKMD 5E0QA 2R1XB 1N64H 2ADGB 3NIGF 5BS0A 4MNQB 1JZ8A 3K8LA 5F3HA 5GGSA 1HHKB 3NACH 32C2A 2QKIA 1T2QH 2CDFA 1JNLL 3GSRB 4G9DA 1MIEL 4Q6IC 1AI1L 1FNSH 4O02L 1U8PA 4NGHL 1J0YA 4GBXD 4DFHA 4XNXH 1DQMH 4W4OC 1FQ9C 3WFEL 3NCCB 2NY3B 3WFHA 4JFOB 4ISVB 2XWTA 4KUCD 4PTTA 4M7JL 5T3XH 1I7UB 1U8LB 2BNQE 4O2EB 3MBEB 3VXSB 2AABL 2FJHA 2HFFB 4NJ9H 5KSBE 1FCGA 1AHWA 4FQHA 4LSRH 5DRWA 4XC3L 1YNKH 3BEVA 4L8DA 3PQYD 2A74A 4BELD 5E03A 3BSZH 1D7FA 1GOGA 1J05B 4XHQA 2IADB 1J1OH 4EN3B 4XCFL 2OI9B 3MNZA 3EJYC 4TSBH 2A6DB 4OM1L 2FJFB 1ITCA 1ZHLB 1Z3GH 5IW6B 3TVMB 3GHBL 2LQRA 6FABL 5J89A 3E6FA 4FZ8H 3AY4C 1T89A 1TCRB