2IGFL

Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
b'DVLMTQTPLSLPVSLGDQASISCRSNQTILLSDGDTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA B13I2 FAB (LIGHT CHAIN)
publication title Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 A.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1991-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfL01
3V7AG 4TUJB 2VOTA 4Y4FA 4LVHC 3L7EB 4JFFB 5BVJA 3L3DB 3FN0H 3DO3A 1SJXA 3QA3B 3EOBB 3QQ3A 3KLHD 1R0AH 1XF5B 3DMMA 5EOQL 4OZGB 3ELAT 4PG9A 5EC1B 1CFVL 2VAJA 4OF0A 5HGBA 3BW9B 3TYGL 3B9VA 3GMQB 4UV7L 1YA5A 3WMSA 4G9FE 4HKBB 5JA8B 2I60L 3KPSA 3UTSA 3BUYA 1FN4A 2YPKB 3CC5B 3LKPA 3MACL 5FUCC 1EBAA 4KDVA 3EO9H 3ZKSD 2YN5A 1YNTA 4P23C 3IGAA 5B39B 2YK1H 1OGAA 1DSFH 3QHFH 3BIAX 2QHRL 1E28A 5F7WC 3MLVL 3V6ZA 3PQYB 2X40A 5ALBL 3QH3B 4LSSL 4R90L 1C7SA 3HE6D 3DUUB 3DI2B 1TENA 3C87A 2AP2A 2D7MA 3ULUE 4HH9B 1S9WB 4N8VA 2Q20A 3D2UB 4Z7OE 1S8DA 5D7IE 3HI1A 4FTVB 2XXMB 3U7WH 3T1FB 4QEGA 5I71C 3LPFA 3O6MH 5E94A 1SEQH 1UYWH 3HN3A 4PG2C 3MREA 4XMKH 3T4AA 1AGDB 3VW3L 1LMKA 3M8OL 3BKML 4LKCB 5EIIB 5HGAB 4XP1L 1F6LL 2Q3AA 4F7PB 1UJ3B 1GGIL 2ESVD 4L4VD 3GBNH 2W0PA 4HPYL 5TE6H 4RISH 3P0VL 4HFUH 4MAUL 3DHMA 3BO8A 4GXVH 1EV2E 1IGYB 2Q76B 4PG2A 2Q87A 3G9AB 1I3UA 2ERJC 1P1ZA 4R7NA 1R3HA 4J3OC 4PLOB 2BY1A 2P5WE 5DZOA 3BP7B 4YAQA 1A47A 5IB1B 1ZWIB 1XH3B 3L5IA 3PV6B 5EZIL 4IDLA 3WSQH 2O61A 4FQXB 4GXUM 3DYOA 1QP1A 3ARWA 1ZT1A 4ZS7H 1LD9B 2VLKE 3IDGA 4AMKH 4WU7A 3QUKA 1HH9B 1ADQL 1JHLL 4BKLB 3A6BL 4LVOC 1KTRL 4NNXB 4RRPA 1AJ7H 4P4KC 4D3CL 5GRJL 5ESAB 1M7IB 5IVZB 5KS9B 5KN5B 5FGBC 3G5YB 2W59A 5ICXA 3ZDZE 4OLXH 4YEFA 3F58H 1ACZA 1CDJA 1R5VA 3C08L 3QUXB 4ELKB 1BQHB 2Q3ZA 2VRAA 3ZDYF 2QKIB 5DHVH 1AIFB 3JSSA 2VDOH 5CHNA 1K4DB 1CL7I 3O6KL 3WN5A 1OVZA 5C0CA 1FG2B 2MHAB 3MLTA 3SCMD 4LIQL 4PJEB 4XPGL 2A6IA 5DURD 2FHCA 1BD2D 4KKCC 4IMLB 4JFXB 3DYPA 2V17H 4JJHA 2GJJA 4RMQA 3VA2C 4P4KA 4EBQH 4OCXH 4PJCA 4DN4L 3JV6A 4X98B 3VFUB 2PXYB 4FQ1L 4MQTB 3BZFA 2C3HA 4OCRL 5BV7H 4GAJH 1KB5A 5GSVA 3MV01 5GGSB 2YWZA 1HILA 5EU6E 5I30L 1CGYA 1A3RL 3SN6N 1G7HA 4FABL 3K0WA 1G9ML 4QYOA 4OLVL 1RAMA 1JNHB 1A7QH 1A6VL 2ZUTA 1RK1B 4G6FB 3OKDB 4JN1H 4QRUA 2X89D 5BXFB 1WCBA 1S78C 3RA7L 3QUZB 5L2KE 1GVIA 1TXKA 5TFSH 2XWBB 1L0YA 5L2JB 1OPGH 1K2DA 3FZUC 2X4PB 5C0EB 4U31A 3O9WB 1ROWA 1DE4A 4R2GC 4YFLF 5B4MC 3SE9L 1NKOA 2E3VA 3BP6B 1EFXB 4ZODA 4FQHB 1HNGA 1DBBH 3WL9A 4YXHH 1FGVH 3IS1X 3H2WA 2BVTA 3UTPE 4HZAA 1KEGH 4PJHF 3NFNB 1ZA3A 3QWRA 4O2FA 4XAWL 5A3IC 2DDQL 3MROB 4IIQA 3H9ZA 2JB5L 4M9OA 4K9EH 5HBBA 3SDAC 4XXDA 1BZ9B 1L9MA 2XNAB 1YMHB 1VA9A 1MY7A 2F5BL 1EO8L 4NWTL 4JM2C 4G9FD 5JR1L 2HJLA 4HMEA 5L88L 3W5MA 4Z78A 5F9AC 1G0DA 3T0EC 4ZDHB 3G6JF 2IANE 1A6AB 3WHXB 5SX4H 4QGYA 2CMRL 1KIPA 3RWCB 5TDPB 5HYJE 1JZ6A 4RBPH 4KKLC 1CDUA 3L3IA 4U1JB 4Z7WF 5A43C 5C0BA 2AQ1A 5HHME 3MV9E 2OL3H 4UIMB 2D2OA 3FFCA 5IB3A 1IJ9A 1PX3A 4PJFA 4JY5L 4WUUE 5E03A 3QNZA 1AR1C 5HYSB 3WV0A 1U3YA 3QNXB 4UQ3A 3T0EA 1IC4L 3E1F1 2NXZD 1FRGL 4H25B 1MHEA 5LBSH 1UENA 3LCYA 2DKMA 2HKFH 3KR3H 4TPRH 3VFRB 3KYMA 2P8MB 1R3KA 2VLJB 3V6FA 4MD4A 2W38A 3KHOA 4W4OA 2XWJA 3HNSL 1U8NB 4NM4H 1ZANL 1ZGLB 1QFWL 4G7VL 4UDTB 2R2EB 1NFDF 2B4CL 5HSFA 5T5NF 2VYRE 3BN3B 3TO4C 4KZDH 2H1PH 3LSOB 2XACC 1WTGT 6FABL 3B5TA 4JN2A 1YMMB 1MRCL 1P84J 1DZBA 4JKLA 1J0ZA 3HC3L 3DVIA 4UIKH 1JWMB 3T09A 1IQWH 1I75A 4OGXH 4WU5A 3B2UC 3DX6A 4LASL 4TQEL 4MJIB 1AGFA 3VXQB 4JFFE 1YEIH 2DIJA 4DGVH 3JZ7A 3CFDA 2VLKD 3S3JA 1XF2A 4LPXA 5HI5C 4OZGE 4JKKA 3RWFA 3SY0A 5J4MA 4X4XA 2P48B 2XA3A 2CRZA 3W9DA 4GRLD 3MLRL 3M07A 3TO4A 2FLBT 4N0UA 3TA3B 1XR8B 5E95B 1LP9F 4JPWL 4JVWA 4AEHH 3HR5A 4QTHB 4YHOL 4O02L 5FUOH 1QFUL 1NCWL 3P4OB 1CTOA 4ETQA 3DHJA 2NY0C 2ATKB 1P4IL 2VH5L 5SWZB 3X11B 4NIKB 3FN9A 3AREA 3PQYE 1OWWA 5ILTL 4WNQA 4QNPE 5SX5K 2NR6C 5EWIH 4BZ2H 4KK5C 3JV0A 3MZGB 4J4PA 3MJ9A 3VDCA 5IQ7L 5I1CL 5EDXA 1SHMA 5C0FB 4KTDL 1XCTB 4FTVE 1FVDA 1I85C 4Q9QL 4KQ4H 4ZFOL 1MAKA 3MO1A 4KXZI 5HHVH 1ORSB 3NIFE 4IHOB 3VXSB 2IPTH 2OR9H 5DK3A 1IVLA 5I1AA 2EH8L 4U0RB 1L0XA 3UPRA 5DUMH 4I5BB 2BSRB 5EU6D 5F6IB 5C9JA 1DQQA 2H3NA 3RGVD 1S7XA 5MERB 4I1NB 1RZ7H 3TPKA 2XXCB 5CUSL 5TE4L 2AXGA 3TBTB 5FV1L 1SMOA 3T2NH 5ISZB 2VMFA 3MNZA 4RGOL 2GCYB 2PW1B 5D72L 1I85A 3PHOA 1NDMB 5B38B 2X2YA 2VQ1A 4EI5A 15C8L 5CIPB 4H20L 4LHUB 5K9JH 5L2KD 1CL7H 4I0KA 3L5XH 1IBGH 1H9VA 4I13B 3CCHB 4TOYH 2GTZB 1DQJB 5HI4C 3PWLB 2JJVA 2IPKB 4BQ8A 5AUMB 4L3CA 2VXQL 5JIPA 1Q94A 5A16B 1WZ1L 4LSPH 1QO3A 4V2BA 4JRYB 4F15C 3UTPD 2PNDA 5ACLA 4WWKD 1X5KA 1A6UL 3C6LB 5KJRH 4EIZC 2PTVA 4JQXC 5CEYA 4MB3A 2Y06L 3T0XA 2YPLA 2PO6D 5KS9E 5E8DL 1PZ5A 1LNUB 5J8OA 2C1PA 5LWYH 5C71A 4A6YB 4X0KA 1FIGH 2Y5TB 2IAND 5GHWL 5C0GB 4M3KB 3ILPA 3PNWA 1ZXQA 3KS0J 3MA9L 5HYJD 1OT2A 4CN1A 4OZIF 1A6PA 1BF2A 1YEEL 3L95A 5D7LA 4NJ9L 2X9YA 4PJEE 2NMSA 3MV9D 3WS6C 5FKAA 4JQXA 4QT5A 4ZNEA 1SEBA 3EBAA 3TH4T 4WUUD 2OBGA 4OUUA 4OCMC 3PDDA 1T0NB 3O3EB 2A9MH 4U6YA 3VCLB 1T7ZA 3EO1B 4D8PA 5D1XA 5FO8A 2V9QA 4TULL 5JIIA 1W8NA 5DMGD 4S0TD 2G2RB 2JCCB 4NKOB 3GI8L 4OAWA 3O2WL 4WO4D 1YECL 2H26B 5ADPH 5BCAA 4Z8FH 3MPCA 2B5IC 3WS6A 1T5WA 3U6RA 1JN6A 1PYWB 3MV8B 2EDLA 5JOPE 3FO9B 1QSFB 4F2MB 1IT9L 1T5XB 5IBUG 1KN2H 3U79A 3LKSA 2CR3A 3INUL 3MOAL 3MJ8B 3ESVF 1HCVA 1A1NB 1DR9A 3NFPB 4HBCH 4OGZA 4PY8I 5DK0A 3JWDC 3V6OE 1MWAA 4Z7UB 3QI9C 3ULVC 4HFWB 3V5HB 1BQLH 4C4KT 3VGBA 1G6RA 4P2OC 1OSPL 1RZ8A 4I18A 4K07A 4Y7MA 2VABA 1ZLWK 5IM7A 3WFBH 3QPQC 4JFFD 2MCG1 2ZCHH 3FFDB 1T7XA 1NFIB 3T04D 1JHKL 4UT7H 2EDRA 1VEOA 2VWEE 5D2NC 5F3BA 1VGEL 4BELD 2GAZA 3GB7B 2AJXL 2B0SH 4MD0A 5E2JA 4ZPTA 3EJZC 2VC2H 2P5EB 3QI9A 3DXAA 4JDTH 4M8QB 1UQSB 1S7UA 5HHPB 5MHSD 1XIWB 1BGXL 3U1SH 4WW2B 3H7BB 1LO5B 1FGNL 1WVZA 2ZJSL 4LEXL 2X4NB 4LPVA 4YBHA 5F7KC 3PQYD 1VFUA 2WBJC 4PLJC 3H42H 4ZFZB 4IRZH 3NGBC 4F7EB 1A6ZB 4WI3A 1SJVA 2WQ8A 4CW1B 5LCVL 2R69H 4IRSC 4P46C 3D2UD 4C56D 1YEGH 4FTVD 3JWOL 4OLYH 4G8IB 2Z9TA 1M6OA 1MHCA 3BP4A 1BAFH 3O41B 2HN7A 5DD0L 3RWDA 5EBWA 4GUPB 4S2SB 5IROA 3SO5A 3BGFB 5ETUB 2VLJE 4OJFH 5DMYA 5FHAL 2WBWB 2X4TA 4AENA 2EDEA 5F7DB 1R6VA 3AB0B 2Q8BH 1HSBB 3D85A 3L3HA 4KJWD 4IRSA 5GGRB 3K4DA 3VGFA 1Z6JT 2EDNA 4P46A 5GGSY 5IMKB 3TBSB 4RCAA 2F58L 5SX5H 3OR6B 4GG6A 1KGCD 2AS5M 2F53B 3V4UL 5IESH 3C8KB 3GI9H 5ITFB 3BRGC 1YMME 2PYFB 2Y9RT 1OF2B 2UYLB 2AEWA 3GUTA 1JNNL 4NQSA 2AQ3A 4POZD 3IDMB 1U8LA 1NCCH 3PV7A 5CD3A 4NC2B 3GK8L 1FH5H 4MQXC 2ZG3A 3JV4B 5SWSA 1IAIH 4MJIE 2HJKA 4NQVB 3MV7B 3VFNB 4FQXD 4KXZH 1UA6L 2BSED 3VE0A 1CF8H 4Q2ZB 3DSNA 1JV5B 4PIRF 3S5LG 4EZMA 5DI8B 4U33A 2LQRA 3MRRB 2FWOA 3O45B 4FQ2L 4XVTH 3ZL4L 1A64A 4LPWA 2R8SL 5HHQA 1SYSA 2I5YH 2MWCA 3QG6B 4PRIA 2Z8RA 4JCLA 4XWOD 1I1RA 5I6XB 2XN9D 4WY7H 3GZKA 1RHHA 3UBXG 4HH8A 4Y16B 3ECBB 5ICYB 3QXWA 4U0QB 1B88A 5SWZE 4L8BA 4NJAL 4PJIB 4U1MB 4BH7A 5DJ0B 1HHHB 4EOWH 4H5SB 2QR0B 2WLYA 2A9NH 1BBJA 3V0VB 4OLWH 3TVMB 2E9WA 5I8CA 1TPXB 4PJCF 1J88A 4XVUC 1JWSA 2BXZA 2DB8A 5EU5B 2H32H 1PG7L 4LCWA 4OFYA 2YR3A 2AXHA 3VXSE 1SVCP 2PXYD 2FJHA 1IC1A 5KANG 1CFQA 1QRKA 3NACL 3QUMA 1TTUA 1WBZA 5D7SL 4QHNA 1A4KB 1F11A 5T1LA 4CRPA 4JPVL 5IEKB 5GJSL 1ETZB 3OKMB 2Y7QA 2WAHA 3F65A 1FJ1B 4EVNA 2A73B 5GQBA 5F1KC 4G42B 5HYQB 5ISZE 4G6FD 2D0HA 3WO4B 2X7LA 5FGSA 3HC0A 5TE7H 5IFAH 3W9EB 4GRWH 3DVNB 2H9GA 3E6HA 2PCPA 3QUZD 4FP8L 4I0PB 4ZS6C 3UO1H 3ES6B 4KI5C 1ZEAH 1Q9KA 1K9TA 3DBXB 3CFCH 3O9WD 4KZEH 3T8XA 3VFMB 4YUEL 3P77B 4LIQE 1EFXD 2YRPA 3BE1H 3BQUC 1A6WH 1IKNC 1NFKA 3F7YB 1BVKB 3U0PB 5T3ZL 4JRYE 4U3HA 5ALCH 3H9SB 1I1YB 3HAEA 2PYED 1TZGL 5F9OH 3MYJB 5I1IH 4KJYA 3QDGA 4PJ9D 3W81A 3QUYC 3SKJL 1WISA 4JPIB 3OXRB 4XPBH 3R4DA 3UBXI 4NCC2 3Q6GH 4Z18A 1ZHNB 4XBGA 5J11B 2D7QA 2IWGA 4OFDA 1CFNA 1BJ8A 3VFPA 1U8PB 4TNVK 3NPZB 4NN5B 2NX5B 2OS7A 1VFBA 1IKNA 3RWIB 5DD1H 4X4ME 1CK0H 1FO0A 4HJ0D 5BO1H 1AH1A 4PJFF 1K3IA 4NQEB 4GLRI 4KMLB 4ODWA 4NUGH 3QEHA 4TVPD 1BPVA 1R3JB 1RZKH 3QJHB 1ZLWH 5FIEA 5C70A 2Q86B 1MOEA 5T1KD 1JF6A 5KANI 4NUJA 4U6XA 1V7NH 5IBLC 1IC7H 1FZOB 3SGKC 3GKZA 4ZUTB 5DTFB 2AKRB 5JTWA 4K7PY 3DOSA 3HC4H 1C5BH 3ARSA 5IFJB 1EHLL 2D4FA 1TTFA 2Y4SA 4P0DA 2JCCE 3G6AA 5F1NA 2VLJD 4GS7C 4TTDC 1DANU 4K71B 4U1KB 4UT6L 2DQCL 2FR4A 1UWEH 1W0WB 3SDYH 3IDJA 1K8IA 3ROLA 1N4XL 3QRGH 3MV8E 1EAJA 1QSFE 3NH7L 5I73C 4MXQD 4LNVA 3O3BB 5FA4A 5IB4B 4EN3C 2VDRL 5MP6L 2XPGA 2NY4B 1MJJB 1ONQB 3IAQA 1YMMD 3MOQA 1LQSR 1PKQA 4Z7UE 4RZCA 3RZWA 1CZ8H 3LN4A 3HFML 4DEPC 4J3TA 1FFOB 4OD2B 4Y5VC 3RTQB 4MJID 5E9DB 2BVEA 4GRMB 2J8OA 1A9EA 2AK4B 2J5LC 1NANI 2GTWB 4XCFL 4HC1H 1NC4B 3VI4F 4EN3A 2KKQA 4H1LB 4QXGL 3TO2A 2BOBB 3TA3D 2VSCA 1B90A 1D6EA 2HLFD 4CJ1A 1JTPA 2P5EE 2VDMH 4JRWA 4QHLA 3BPNB 5GS0C 1MF2L 4PJGA 2HRPL 3PHQA 4PJDB 4XNMA 1KPVB 1CFSB 1BHGA 2GK0B 3BMVA 5SWZD 5IUSA 2YD5A 5HXMA 1X5JA 1UJTA 4R8WL 4XP6H 4HKXB 2BDNL 5FCSH 2BVQB 2IEPA 3T3PF 3GO1H 2Y6SC 4PJXA 3KYNB 5J7CC 2O93L 2DQHH 3GGWA 3PDGA 4Z0BH 5IW1B 4YHYB 4LSUH 4HK0B 4C83B 3ARBC 3REVB 3VXSD 1C5CL 2YUVA 1ZLVK 2GT9B 1JIBA 4HAGA 5KVDL 1W72H 1GC1L 3KYOB 4UINL 4M6ML 3ROOB 4DGIL 1WT5C 2IQAB 1NGZB 3S3SA 1L6XA 1INDH 3V0WH 4KPHH 4DTGL 5ISZD 4I3GA 3A6CL 2DAVA 5DC9B 1F3DJ 1FNEA 2F53E 1ES0B 5GGVH 3U9UA 4LHUD 1WIPA 1UB5A 4O2CA 3ARBA 2Z8VC 3BZEA 3ALWA 1H3VA 4MNHB 4Q6YA 4MJ6B 1KTKE 5DGQA 1FL6A 5MEPA 5L0QC 4I2XA 4YXKH 3IDYC 3CVHA 1I8MB 3T0DA 3TZVB 4WDIA 1RZGB 2RQ8A 4HDIA 1WT5A 4UDUA 5DDHA 4P4RA 3MV7E 4WTZG 4OM0L 4JRYD 3GBMH 4G6JL 1EK3A 1I7ZA 4JLRB 4XC1H 1QR1A 3ZKXC 3VU2A 2X6MA 3C6LD 3TFKD 4WGVB 2F19L 3U4EB 4GQ9L 1VERA 2XA8L 4HSQA 2FX9H 4Q6IB 3P40A 5IHUH 5A40E 1U8KA 4DN3H 1AD0B 5FKPB 3VRIA 1JNLH 4WVRA 3IXAA 1Y0LB 5C0IA 3D18B 3QXTA 2NY5H 3FQUA 1HDMB 3P73B 4DJMA 4GQPH 3N1PC 1F4XH 4GMTL 3IFLH 1OWRM 4PJIE 3AY4C 4M6OL 2VTFA 1SBSH 1OTSC 3DRTB 4RNRA 5D6CA 3ISWA 3CK0H 5E99H 4EDXB 1HSAB 4OCYH 4K23L 4LAQH 3LQMA 2KZWA 2FIRT 4NPYB 4YBLC 3TBWB 1FNSH 4XCEA 5DJZA 5EBLB 5FECB 1NAKL 5I1KL 3VXOA 3SJVA 5ITBH 2H45A 5HVFB 4HUUA 2DBLL 4EI6A 1R24A 4HWZA 2VLMD 4MNGA 3KJ4C 1F4AA 3HPJA 2CLZA 2NYYC 1OAZL 1K85A 3CX5J 1NGPL 1OAUH 5I8EA 1FZMA 4OGAC 3RNKA 5AD0A 4JO2L 3SCMA 4DQOL 5K59E 3SKNB 1BD2A 5FHBL 2J1KA 4PTUA 2OZ4L 1RZFL 3O2DA 3EJYC 1A14L 3UP1A 2AV7B 3CDFA 3P2TA 5E0QA 1N8ZB 3P4LA 4NDMB 5C0DA 2ZUSA 1YJDH 1QNZH 3LMJL 4K2UL 5A1AA 3EO0B 4NGHH 3S8WA 3ARPA 5H37G 4K94H 4GLRH 4BFIB 5HHOA 1FVEB 1WITA 4H8WL 5GGRY 3QDHA 4OF3A 2KQMA 2A0LC 3OHXA 4I9WD 1RIHL 3UPCA 1G7PA 1S3KH 4HS8L 4TUOB 5BS0A 4DZBA 3TESA 1J0KA 4EUPG 5H35B 1JGDA 1QYGL 3LKOA 3MRMA 4OCSL 2WINB 4E42A 25C8L 2V5YA 3DRQB 4NZTL 1KJMA 4OCWH 1JF1A 3R1GL 1G7QB 2ZCLH 4NQDB 2RFXB 1AXSB 1EGJH 2DLHA 3ULVF 1BFTA 4M4RA 3WCYA 2QQKH 2R0LH 1U93A 4UQ2B 2JJTC 2P5ED 4XBEH 4X9IA 3QDMD 2WBKA 3P0YL 4ODXB 1HZHH 5AWNL 2NX5E 4OSUL 3S6CA 1QSEA 1CDHA 4JAMB 1XIWD 1RJZA 4NRYA 4MA8L 2CQVA 5GGUB 1JNJA 1YEHL 4NQEE 4MA3A 4YDVA 1G9NL 3TH2T 4P3DA 3ULUC 4OI7A 4Z9KB 3P3YA 4GO6B 1U8JB 1GJIA 4XP5H 1Z9LA 1DQML 2WSKA 4Z0XA 2KQNA 1J11A 3PWUB 4PJHB 4K8RC 5E8PA 3OPZH 2ITDB 2EEDA 3PGDA 2WQRA 1DVFC 4WWID 3S36H 2W9DL 5E08L 3GMLB 4OTXL 5MEOB 3HPLB 1B0GA 4LEOA 4Y89A 1E6JL 4RGNB 1D9KD 2CGRL 3BPOC 3IVKA 1YYLL 5DD5L 3BAEH 4ODUB 4GW5A 5CBAA 3MCKB 2DLGA 5GZOC 3HHRB 4M3JA 1AP2A 5DRXB 1ZKAA 5D7IA 4GG6F 1N26A 4M43L 2APFA 3BRDA 1JK8B 3HNVH 1MIEH 4JR9H 4YDJA 2W0FA 5KSUA 4GKZB 4TUKH 5FO7B 2F53D 3FRPG 1DVFA 1D5BA 4HV8B 3P4NB 4NHUB 2YD6A 3NCYS 1A7RH 1XGRA 3WFEH 2J4WL 2M2DA 5GGTH 4ONFH 1ZLVH 3BP5B 3MRDB 1ZK9A 1AO7A 3BXNA 5EPMB 4QRTA 1I3GH 4X9FA 2P4AB 1RZIB 5I76A 1HXYB 3X3FL 3UDWC 5GISL 1E0OB 4MX7B 1NEUA 2ZWLT 5IF0B 3VJ6A 4OF8A 4C55A 3FOMA 1OLZA 1NFDB 3ZYJA 1T80A 1QLRA 5CZXD 2NW2B 1G7JB 1KLGA 3MGOA 3VXMA 2P5WA 3OAYK 3V5DA 4RFEB 4TSAH 2FD6H 4PJDE 1RMFH 4NP4H 1Z9MA 1DJSA 4Y16D 2DQJH 1BJ1H 2GITA 4LOUC 4I3RH 5HGGS 5GRUL 4YHNB 3MRCB 3S96B 5HDQH 2ZKHH 1I8LC 4GRLA 4KAQL 2IG2H 1GRWA 3PP3K 3TVMD 2XI9A 1AE6L 1BQUA 1RUQL 4XNXL 3UDWA 3MODH 1N6QH 2ZNWA 2HMID 3MLZL 1MNUH 1TVBB 2VDLH 3IU4H 4R7DB 3SE8L 2LTQB 2R29H 3D69A 4PTTB 3EW3B 3WIHA 4JFDB 3ARDB 4HWEH 3DJ9A 1RJCA 1KPRB 3VI3F 2CKBL 2BFVL 1AI1L 1TQCB 3LKNA 1P2CB 1MFEH 1LP9B 3EYSL 4YX2L 2NW3B 3BKCH 5F9JB 1X7QB 2BJML 4PRHB 1NBVL 2RJMA 3OBAA 4PUBL 3H7LA 1S7RB 4BH8B 3OXSB 5FM4A 3I50L 3RVVC 3U9PH 1UXWA 1I8LA 5JQ6H 2UZIH 3DX7B 3MRQB 5IMLB 2X4SB 1R5IB 1T1WA 5GGQL 3T2OA 4ZXBB 3SDCB 4O58H 4KHXL 2FIKA 2VXVH 3GRWH 2VXSH 4I0PD 1HQ4B 3SGDI 2R0ZH 2G5BA 3LD8C 2LU3A 5EU6A 2APWA 1E4WL 2VITA 2ZUXA 4LVNB 5D2LB 3MLYL 4CVXA 4YQXH 1LEGB 4XZUA 2WUCL 3A67H 4NBZB 4HJGA 4KRPC 1KJVA 4HF5L 3DV4B 5IJVB 3H9SD 4MLIA 4QRPB 2VERN 1JCKA 1JZ7A 2X41A 4LSDA 1OARH 3LEVL 1KEMH 4ZUWB 1FV1B 5CZVH 1CLYL 5BZDB 2VDPH 4ENEC 4Y2DC 2I07A 4KI5F 4WUKH 3LEXB 3QQNA 4H88L 4JFQB 2CK2A 1WV7T 1C8PA 5IHZA 4UBDC 2EIEA 4HGWB 3MLWL 1J1XL 1KB9K 4YPGB 1F3JA 3BEWA 4O9HL 3F6IA 4E0RA 3S7GA 5ACZA 4Q0XL 4TVPH 5F7EL 2ID5A 2NX5D 3QWOA 2WV3A 2HVJB 2CIKB 4IM8A 1YEJH 1KB5L 1T21B 5F7UA 2D9CA 1OGTA 4NQED 1LWRA 5C0RH 1MI5B 4I4WB 4M7KL 1VFAB 4P9ML 4ZFGH 4FFVD 1CD8A 1R5WA 2FBJL 5IFHL 1K5NB 3TN0B 2P24A 1JGEB 1KTLB 2IANA 3W2DL 5EOQH 1FFNA 5CILL 3RNQA 3TYGH 1H5BA 1RJYB 4WO4C 1F6AB 1YQ2A 5CFHA 1SJHA 2I60H 3NCFB 2CRYA 3CFJB 1QFWI 4U1IA 2WIMA 4ZUSA 4X4ZA 5L9DL 5LJYH 1FAKT 3VH8A 1BBDL 1J0JA 4O5LH 4ISVB 2ZSWB 1OSZA 3MACH 3G5VA 3A0OA 2XY2A 3ARGB 4FMKA 5IHLB 2H2PD 2QHRH 1UM5L 3MLVH 2GJZA 2J7LA 5ALBH 3W11D 4JGJA 2R23A 2NY4D 4R90H 3R06B 5LG1A 3JVGC 4NRXA 1LK2B 2ICWI 2CUMA 1E27A 3OG4B 1JPGB 1LO2L 2A77L 1XGUB 3FB5B 5EO1B 4WO4A 5IWLC 4UU9B 2AV1A 3DIFA 1JUFB 2G5RA 1GGYA 3H9HB 2AEIT 2NNAA 4WFGE 3RTQD 5E9DD 2BSSA 4ONHA 3VW3H 1NAMB 1XGYL 3EIFA 3WS3A 1IEHA 3M8OH 3BIBX 2VZUA 3BKMH 3QCTL 2DQTL 5E4EC 3ZE1E 3RWHA 3OAUL 2AK4D 1RY7B 4XP1H 4NQDE 1EO5A 1NC4D 5HY9B 3F12B 5FYJL 1GGIH 1MREL 1UM6L 3NABL 4PJGF 5JXAL 5HDBF 2YD8A 3JVGA 5EO9A 2O5YL 4HPYH 1F42A 4MAUH 1F6FB 5H37H 2Y72A 3L7EA 4JFFA 3GDBA 3QA3A 3EOBA 1YPZB 1XF5A 4PLKD 3RL1A 5EC1A 4Y4FB 2EICA 4PJXF 4P5TB 3KPLB 3BW9A 5BVJB 3FMGL 4PJ7B 4PJHE 5EZIH 4HPOL 4PG9B 3MLXL 4EUPH 4JKPL 3S4SG 3QZWB 2YPKA 1ADQH 1JHLH 3CDCA 2E7BA 4MVBC 3A6BH 1H3GA 5D8JL 3UTSB 4AZ8A 5B39A 2AEPL 4RGNE 1FN4B 1Q72L 4D3CH 1QBBA 5GRJH 3TLRA 4Q97A 3OAYH 3PQYA 2YKLL 1YNTB 3BN9D 5C0AB 3IGAB 3QH3A 1OGAB 1JTTA 3DUUA 1E28B 5CIPH 1S9WA 3C08H 4LVHB 3V6ZB 5K33A 3D2UA 4P9HH 4FTVA 4X9BA 3T1FA 1IILE 3HI6L 4LFHD 1KJ2A 3O6KH 4BUHA 3VWJC 3HI1B 1BX2B 3PP3H 4LIQH 1F4WL 1JPSL 4XPGH 2XOTA 1I1AC 1Q0XL 3ZSSA 3ZT6A 3GIZL 5I16B 5HGAA 5EIIA 1T03L 3DPBA 4OLZL 5BOPA 1JWUA 5C07B 1WWCA 2HAZA 3TZVD 2DM4A 4DN4H 5IMOB 2MQ0A 4FQ1H 4P23B 4DW2L 1OTUC 1OAXL 1BVLB 1ZVSB 2Q6WB 3V8OA 5I30H 2DLTA 4GFTB 1A3RH 1J0HA 4FABH 4K55A 3U48A 1J10A 3EOYG 3L3KB 3RHWK 2Q76A 5D96C 3VWJA 1NFDE 4YHML 3LQAC 1X9QA 4OLVH 1KF9B 5FYLE 4LLMB 5I71B 1A6VH 1TQBC 3BO8B 1I1AA 1RFDL 3QUXC 4WI6A 5EN2B 3MJ9L 3KLAA 3MRIB 5IB1A 2BERA 1XH3A 4X8JB 1P1ZB 4R7NB 2HLAB 4MJ5A 3RA7H 1CD1B 2OK0L 1LD9A 5BZWA 4BSVA 1JGVL 2VZ1A 2D31A 4NNXA 3SE9H 1ZT1B 3VD5A 2Z31B 3IDGB 5ESAA 3CFBB 2R2BA 1M7IA 5IVZA 3ZSTA 1BLNB 5KS9A 3G5YA 3RU8L 2GQHA 1TDQA 4XAWH 2DDQH 4JFDE 2JB5H 3QUXA 4V2CB 5BQ7B 3CFEB 1BQHA 2IADB 2CD0A 1V5JA 2QKIA 4NNPL 5FM5O 1CTNA 2LE9A 5EZLA 1YY9D 4DZ8A 2F5BH 3DX8B 4D94A 1FG2A 4NWTH 5JR1H 2R9HD 5L88H 4R0LC 2BHYA 4PRHE 4WI5A 4IMLA 4JFXA 1UC6A 4DFIA 1S5IL 3LS5L 3UTTB 2D3VA 2CMRH 4N0FA 3OKEB 3FQRB 5C6WH 4LVOB 3UXFA 1I8IA 2PXYA 4JCMA 4P4KB 1WWAX 5CJ8A 4QHKI 1I1FB 2ICEB 4W68A 2A1WL 5GGSA 3R0MA 3BZFB 1XGQB 5D2LE 5EU4B 3W82A 1JNHA 4XPAL 1IC4H 5JW4N 1G7HB 4PD4K 1FRGH 4QRPE 4WFGD 5IW6A 4ZO6A 4QYOB 5BXFA 2OJEB 2VWEC 2HT4D 3QO0A 3KYKL 3QRFM 3HNSH 3KDMB 4NQDD 5ENWB 4N1HB 1ZANH 3O9WA 4G7VH 1FL5A 2B4CH 4UNTA 1K2DB 3BP6A 1EFXA 4FQHA 4DAGL 4J6RL 2GSIA 2DQIL 1HQRB 3BKJL 1T3FA 4ODVL 5DEZA 4LPCA 6FABH 3NFNA 3IJHB 3T77A 3MROA 4XCYA 1MRCH 3ZHLA 3NMEA 1FNFA 1HKFA 3WFDL 3HC3H 5KVGL 1Q0YL 1MI5E 3DYMA 4YJZL 1BZ9A 2XNAA 1ZA3B 3AS1A 2XTLA 3OWEA 5GRZA 4OZHB 4PB9L 4LASH 1GZPB 4TQEH 4XXDB 4YDIL 4OD3L 4ZDHA 1A6AA 3WHXA 3W5NA 1BWWA 2HJLB 5IVNA 5F89B 5KTEL 5TDPA 1A8JH 1MJ8L 5IKCA 3CD4A 4R2GB 3MLRH 4RGND 4JJ5A 2DTML 2X4OB 1KIPB 4RMUA 3MRNB 3ULUF 4UIMA 3VG9B 3R8BB 4Z7OF 4JPWH 5D7IF 3L3IB 5TF1L 4O02H 1MWAL 1QFUH 1NCWH 3N9GL 1OAQL 4PP1D 1G6RL 3C5SA 5FYKL 5HYSA 3FFCB 4Y19A 3OF6A 1P4IH 4ORZC 2VH5H 3SDAB 1LO0L 3QNZB 5ILTH 5GIRB 2JB6B 4H0GA 1ZOXA 3EDFA 4LPUA 4JM2B 1OP9A 2P8MA 3GSQA 5IQ7H 2Z8WC 5I1CH 4KTDH 2VLJA 2F8OA 3EFFB 2BY2A 4BFGA 3GSNB 1MHEB 4Q9QH 3PGCB 1U8NA 4X5WB 3PF2A 3IETB 1R3KB 5ABDE 3QO1B 3V6FB 2R2EA 1CVRA 3JWDL 5DD6B 2AGJL 1PJ9A 2XWJB 3ULVL 3L3JB 4GJTB 3WLBB 1FFQA 4BA8A 3KXFA 5LKNA 2YS4A 3TA3C 4JREC 1J1PL 5TE4H 5CUSH 1P53A 3STBA 3JUYA 3NCYP 1JWMA 4JN2B 4N0RA 4WIQA 3WUWB 4RGOH 4MAYC 4Q58C 3U30C 5D72H 3WJLC 3V0AC 15C8H 4MJIA 3VXQA 1T6VN 2FX7L 4H20H 2GEEA 1X5LA 1YPZE 3IT8D 3AS2A 4UILL 3DX6B 1JTOA 4RQQA 4KK8D 2YHGA 2VXQH 2MCPL 2YA2A 4PJ7E 5IOPB 2W9EL 1WZ1H 3OKKB 3SY0B 1XR8A 3TA3A 1FBIL 4X4XB 4PV9B 4NHCL 3TO4B 4ZNCD 3P4OA 1A6UH 4JFDD 3ARDD 4L5FL 5JORA 3QHTC 3UTSE 4MAYA 1WICA 2ATKA 5KZCB 2Y06H 3SO3C 3T3MF 3VMPA 4S1SL 4YHKL 5AG9A 5JXEC 1I8KB 3QXAB 4YBQD 4ETQB 5E8DH 4ZOEA 5C0AE 5E6IC 1J05A 1OGAE 4YH6A 3MMEA 4R97C 4PRHD 32C2B 4KGJA 5C0FA 1X5ZA 5GHWH 1XCTA 3MA9H 3MJGX 3DVGB 4ONOA 5LBSL 5IIEB 4PY7B 2L0DA 1ORSA 1YEEH 3SDCD 3KPPB 1C5DA 3VD3A 2JLLA 2J88H 4N5EC 1LDPL 4LKXB 1W2KT 3UPRB 5FUCE 2B7DT 5JXEA 3MRFA 4ODBD 5C07E 3LAFA 2GY7B 3D3VB 4Y5XB 2NY0B 5E6IA 3TBTA 5C9JB 5ISZA 4QRPD 4TULH 2BVPB 2GCYA 4MDIB 1CGSL 5B38A 4MS8D 1NDMA 1H3UA 4LHUA 2HTLD 2F15A 1YECH 4EEEA 3UX9B 2GK2A 1T1XB 3TV3L 3OG6B 3CCHA 3PHOB 1NGXA 4L8CB 3IXTB 1PLGL 1DQJA 1EJ6A 2RB8A 4LCIL 2IPKA 2UUDK 3B8YA 1QFOA 3OQ3B 1WUNT 5A16A 1IT9H 2CDGA 5F7HA 3INUH 3MOAH 5C1MB 4L3CB 2NZ9D 3DGGA 4B41A 1Q94B 3QUML 1QO3B 4WHTA 3FJTA 1MI5D 2UZXB 3LZFL 4Z5RA 3HCVB 1OSPH 1INQB 5CEYB 1U36A 4NSKA 1OLLA 4QRQB 3TN0D 2BY3A 5IB2B 4A6YA 3TCXA 1JYNA 3AAZA 1HHKB 1P6FA 1JHKH 4KUZL 5DFVC 3ILQC 4KV5E 5C0GA 5C0JA 4LLVA 5C9KA 3UTQA 3U2SA 4OLUL 4X4MA 1VGEH 2GI7A 4JO4L 4KJPC 2AJXH 1MUJB 4BK5A 4YFLI 3L95B 3UTTE 4F15B 3KJ6L 3UJTL 5CCKL 5E2VL 3HB3D 5JIHA 4XAKE 3MLUL 4XNUL 2AJZA 1T0NA 5F1OB 4QT5B 3O3EA 1BGXH 3OJ2C 2ZJSH 1FGNH 1KLUB 4I0CC 4LEXH 5D1ZC 4YIQB 1ZA6B 4E9LA 1OOAA 2HRLA 1DBKL 2FJFA 5IMMA 5LCVH 4D8PB 3FB7B 2G2RA 4P2CG 4RMVA 2NY7L 4PY8J 1PEWA 4CMHB 5F7YC 3JWOH 2H26A 4IJ3C 3T0AA 1UVQA 3I75A 4P2RD 1ULVA 2RBLA 4TSBL 3Q5TA 1TZHA 3VFVB 2DWEB 4OAWB 2SEBB 4XPHL 1KSRA 1KCVL 3MV8A 5DD0H 3FO9A 1J7VR 1QSFA 4L1HA 2K1MA 4F2MA 1T5XA 3ALXA 1JN6B 4L4TB 1FO0L 3MJ8A 4G43A 5FHAH 1IE5A 5D1ZA 1A1NA 1P5UA 3NFPA 4YO0A 4Z7UA 4FHBD 4HFWA 3V5HA 4HS6A 1EHXA 4YPJA 4QGTA 2BCKA 3D25A 3ARXA 3G9VA 2F58H 4XC3L 1FP5A 3ZMRA 3V4UH 4KTYA 1U92B 3FFDA 1NFIA 5HD8D 1JNNH 1IAOA 1D5MB 1FSKC 4Y4FD 1ZAGA 5GZNC 3I3EA 4P5TD 2V7HA 3Q5YA 3ULSB 2B5IB 3BD3A 4P48A 5KVFL 2GUOB 3GK8H 5TQ0L 3BYYA 5ANMB 4LSQL 3GB7A 4OZHE 4Z6AT 1BM3L 2YUWA 5D6DA 3O8XC 2QSTA 1UA6H 2N7AA 2P5EA 4U1SB 2E6QA 4B53A 2Z91B 1FG9C 3UTSD 1UQSA 4ZPTB 2NTFA 3ZL4H 3UEZA 4LCUB 5CJBA 4M48L 1YNLL 4PRPB 4CN4A 1WF5A 2R8SH 2X4NA 2BNQB 4P2OB 4ZFZA 5I1DB 1CLOL 4F7EA 1A6ZA 3HZMA 1OGAD 3AB0C 4ACPA 4FOMA 4GW1B 3B9DA 1DQTA 2IQ9L 1KENL 3NIFF 4HZLB 3FFCE 4LSVL 2VE6B 1R3IL 3RY5A 4G8IA 4NJAH 3O41A 5DWUL 3O8XA 1ZSDB 1J86A 4OBSA 5CJXA 1JYWA 5D2NB 1H3TA 4UT9L 1TITA 1PY9A 3BP4B 4GUPA 4S2SA 1A7OL 5ETUA 1BEYL 3AMLA 4NZRL 5JDJA 1PG7H 1MQ8A 1T89C 4OZFB 5C07D 4P23D 5F7DA 3O81A 4BQ6A 1HSBA 5GGRA 3NACH 4QCIA 1PQZB 4OUOA 4DCQB 1B0RA 2X4TB 4AENB 2AXFA 2WBJB 4W6WB 5D7SH 5IMKA 3TBSA 3NGBB 3OR6A 4JPVH 2F53A 5ITFA 1YUHB 2PYFA 5BVPL 1OF2A 3I6GB 4GG6B 1MCCA 5I0ZA 5E6ZA 3L1OL 5IJKC 5I6XC 4F7TA 4G7YL 3ZE0E 3ZE2E 3JV4A 2EKSB 5KSBB 1T89A 3MV7A 3KGRA 4FP8H 5CD3B 2D0FA 2OXHA 3NAAL 4MGXA 2ADFL 4LRNL 1D6VL 1T2QL 2B0SL 3MRRA 4QWWC 4YUEH 1CICC 5KS9F 3GFUA 4HUKB 3B5HA 2NLJA 2DBJA 1P4BH 1OD7A 5BMFL 3NIDE 5T3ZH 3QG6A 1TZGH 2P1YA 2DMBA 2W9LA 5IJKA 3G08B 5HHQB 3QNYB 4LNRB 4Y16A 2LU7A 3ECBA 1QSZA 5ICYA 3SKJH 4PRIB 4PJIA 1TMCB 4U1MA 1RHHB 5DJ0A 1HHHA 3VXNA 2UUDH 2QR0A 3V0VA 5DXWA 1BAFL 1AQDB 5C0CD 1CICA 4BFEA 3UTTD 4YE4L 3CVHL 1MLCB 4JRXB 4XAKD 4X7FC 3ESUF 4U49A 1QLFB 1ZS8A 2VUYA 2P7TB 1JWSB 4P4KD 4C58B 3PGFL 4LCWB 2E9BA 3STLA 4HD9A 1A4KA 2FJHB 2Q7NA 4JM4L 1LGVA 5DZNA 1ETZA 3OKMA 1CFQB 1FJ1A 4ERSL 4MD5B 3D3VE 1OHQA 1N0LA 1F11B 3SBWA 5HYQA 1MCHA 1EHLH 4NC1C 1ORQB 2DMCA 3CXHK 3W9EA 4LLQA 2NQCA 4DWHA 3DVNA 4U1GC 3JWNC 2ITCA 4Z95L 4KKCD 2EXYC 2DQCH 4UT6H 4I0PA 4POYA 4YC2C 1DBML 3DBXA 2MSPA 1IAIL 3P77A 1RI8A 1N4XH 2ATPA 4LBEB 4B0MM 2HFTA 3NH7H 4XPTL 4F3FB 2VXUL 4Z7QE 4N8VG 3T8XB 3U0PA 1BVKA 2VDRH 5F7LB 1XCQA 1I1YA 4RMWA 5MP6H 4XVSL 5GS2H 3EYOA 1NDGB 2E27L 4XWGL 1IFHH 4HKJB 1NMAL 2DD8L 2ED7A 3B9KB 4JPIA 3HFMH 1CCZA 1JGLL 5JW4M 3WBDA 1P9MA 4KJYB 1KYOK 4NKQB 2X70B 4O4YL 1A4JA 1K8DB 1S78D 1OP5K 4X6EA 3FZUD 1NBZB 2YEZA 4V1DB 1FCGA 4XCFH 3HZYB 1D5ZA 3RWIA 4R2GD 5B4MD 5CEXB 3D5OF 3CUPB 4IOFC 4QXGH 3VFPB 4NQEA 3BQUB 1VFBB 5TDOA 1P7QA 1XMWA 1R3JA 1UH3A 3QJHA 4MWFB 1FO0B 1MF2H 4RSVA 4RDQG 1X44A 2HRPH 3GJFK 4U3CA 5A3ID 4ODWB 3QEHB 3MX0A 4ZOBA 1FZOA 3FFCD 1NUNB 3SDAD 3QUYB 2OJZL 5DTFA 2AKRA 3PXJA 5CP3A 5JOFB 3CX2A 5IFJA 3O0RL 5KSVA 4WFHE 4PRBB 4JM2D 4R8WH 2BDNH 5GRXG 1CDYA 2ADIB 3O2VL 3NCJL 2R1WA 4U1KA 3UZVB 4RRPG 3VD4A 4S1DC 1U8OA 3OJMB 1UZ8B 4HXAL 1RIUL 1C5CH 3SQOL 5F1NB 3BDXA 4Y0GA 4KKLD 3RL2B 7FABL 4GW4B 4FFYL 5KVDH 3IDJB 3O3BA 1GC1H 3ROLB 4U2ZA 4M6MH 4UINH 4L4TE 1FFPA 3TCLA 1ONQA 1A6WL 2F74B 3RVTC 1AR1D 4MDJB 1GZQA 1JP5A 3CVIL 4KK9C 1IEAA 4DTGH 3A6CH 2V2WB 2L7UA 4KY1L 1W8OA 4OD2A 4RZCB 3U46A 3LN4B 1RQ5A 4GRMA 3S36X 2XZAL 1AY1L 1AGEB 2YBRA 3S3PA 1NC4A 1V3KA 4IRJC 5ANME 4H1LA 3KPRB 1T04B 2EYSB 2BOBA 4PREA 1QPPA 4OM0H 4G6JH 4W6XB 5I73B 5ID0A 3DUSA 3ULUL 1NBYB 1UWGH 3TO4D 1CK0L 4EN3B 2PKDA 4XNZC 1C12A 3UAJC 4M6AA 3ZKQD 1KPVA 3QSKB 1D6EB 4K8RL 4NO3B 5KZCD 1BIIA 2F19H 4OF7A 4PRPE 4PJGB 4GQ9H 5E7BA 2XA8H 3BWAA 2BNQE 4DEPB 3WKML 2W65B 2QADB 4Y5VB 4HKXA 3B2UD 4M6NL 1X5AA 1CLCA 5T1DL 1CFBA 2DICA 3KYNA 4IRJA 5IW1A 2W92A 4GMTH 5HI5D 4QF1A 4M6OH 4HK0A 3RX8A 5HYEA 2J5LB 3K2MC 3REVA 4C83A 5D2NE 4ZTPL 5GS1C 2GT9A 3GHBL 2PTUA 3FN3A 4OBRA 1BJ1J 5D1QC 5FK9B 3BPCA 1T20A 4K23H 5D5MB 2DQDL 5BRZB 4HW6A 4NQTA 4WW1A 3KYOA 4UZGA 3ROOA 5EOCL 1HINL 1NGZA 1NAKH 5A2LH 5I1KH 2DBLH 2GY5A 2D9QB 2NY0D 3MBXL 5DRWB 4DUVA 3U82B 3THML 1OAZH 3NIGE 1J87A 2H8PB 2DIAA 4JO2H 2ENYA 2NR6D 1ES0A 2W0LA 4DQOH 2R1YB 4KK5D 5D9SB 5DJ6A 4KROB 4XCNB 5FHBH 3V4VL 1BIHA 5GS1A 1FNEB 4GG6E 4MJ6A 4QO1A 1QHPA 5DHYB 5FOJA 3SGEH 1X5YA 2OZ4H 1RZFH 4O2CB 1F90L 4JQIL 3RDTB 1A14H 2W60A 4PJBF 4YDLC 5KSBE 1RZGA 2X1OA 2GIYA 1RUKL 1WTLA 2V2XB 1EX0A 5MEPB 1NC2B 4P3CL 4I2XB 2GKIA 3LMJH 4K2UH 3MRJB 5F1IB 1CGUA 4WDIB 1HOCB 3QPXL 5EUOB 1IC5L 1UFUA 2ARJB 4HUVA 2BSTA 3F62A 2VDML 3U4EA 1I7ZB 1LVEA 4H8WH 1QR1B 2ICCA 4Q6IA 2R0WL 1FL3B 1RIHH 3B5GA 4HS8H 2X4RB 1TCMA 2AEQL 5DJDB 3CZJA 3RY6C 1Y0LA 3D18A 2B2XL 2UWEA 1CBVL 2YPLD 1S7WB 1QYGH 4FXGB 4OCSH 2XG4A 1HDMA 1VFMA 25C8H 3P73A 4NZTH 4PRAA 3VRIB 4PRIE 4AG4L 3IXAB 3R1GH 5HI4D 3GMMB 5DJAB 5L0QB 2C5DC 1LEKB 3DRTA 1BZQK 4CVZB 1GXEA 4ZO7A 1HSAA 1XT5A 4POUB 2EE6A 3P0YH 4PBXA 4RNRB 4NPYA 5AWNH 4JRXE 4OSUH 5EBLA 1MELA 1U8HB 4QTIL 5GJTL 3BD4A 4MA8H 3QCVL 3TGXA 1W72L 3DTXB 3VGAC 4JY4B 1YEHH 2NY5C 4E5XA 1G9NH 4LCWE 4RAUA 1UZ6F 5E8OB 3VXOB 4WFHD 4N9GA 1UACL 1DQMH 2I9LA 1OTTC 5JHLL 4NQCB 1R24B 4HWZB 1NAMH 1SJEA 1OP5H 3L7FA 5I8EB 5J1SC 1FZMB 3RNKB 2W9DH 5FUZL 5E08H 3HUJB 4OTXH 4M7JL 4XNYL 4JFHD 2EE3A 3RP1A 1E6JH 2OP4L 5TJWK 5TGBB 3TM6A 2CGRH 3E6FA 1N8ZA 4NDMA 3WHE0 5DD5H 1Q9OB 4Z7UF 4L4TD 3EO0A 3I9GL 1V3LA 3V4PL 3GJFH 4YBLB 1DN0A 4LLDA 2GFBB 4BFIA 3SDDC 4M43H 1FVEA 4KKBC 1N3NA 5KSAC 4P2QA 1B4RA 1EDQA 2QSCL 4DOHB 3IDUA 3J8F7 4TUOA 3RKDC 5HHOB 3L3OB 5ECJE 4JG1L 5ERWB 4CJ0A 2EDFA 2WINA 4DN3L 4WHYG 3DRQA 3QIUC 2J4WH 5BS0B 4DZBB 3FRUA 2RFXA 4K94C 3FAXA 3QBTB 3MGTB 1J9CT 4OF5A 4JVPA 3AXLB 4UQ2A 4CMMB 4G8FA 4R26L 5EU7C 1MH5A 1WFNA 1QA9B 4ODXA 3RVXC 3X3FH 3UPAA 4V1DE 4ELMA 1YEFL 3S34L 3I02A 3VXRE 5JQHC 5KSAA 2YD3A 5GISH 1U93B 4JAMA 4FQCL 1CQYA 4PRPD 5GGUA 3DXAD 4CADB 2BNQD 1QSEB 4P2OD 5LAXA 1JGUL 2R0KL 4N90E 1U8JA 4X4YA 3OJDB 3QIUA 3EKCA 4OFIA 3QPQD 4MA3B 4YDVB 2VDNL 4FMFA 1EBPA 3MFGB 1U6AL 1NLBL 5DT1L 3GMLA 3CSGA 5GRUH 4D9RE 3HPLA 1PG7W 4KAQH 4X6BB 1MLBA 2AJVL 1AE6H 1RUQH 3C6SB 4XNXH 2R56L 1M05A 3EJZD 3MLZH 3SE8H 4ODUA 3MCKA 1OB1B 5F96L 1H3WM 3IVKB 3FONB 5DC4B 5DRXA 1QSVA 2CKBH 2BFVH 4ZOAA 1JK8A 1AI1H 4GKNB 3S35X 3RWJB 5EZJB 3BESR 1ZHBA 2WBJD 4PLJD 4S11A 4GKZA 5FO7A 3EYSH 4YX2H 1OL0A 3D85D 4HV8A 2BJMH 4IRSD 1NBVH 2DLIA 4P46D 4PUBH 4YDJB 4NHUA 1C16A 3EOTL 4PB0L 1KIRB 3I50H 5HGDB 4QHUB 1DVFB 2X05A 5JO5A 2EH7L 3MRDA 5FB8B 3L9RB 5GGQH 1XGRB 4ZD3L 3CZFA 4KHXH 1DEDA 3BPOB 5EPMA 2RGSA 3P9WB 4PYGA 1RZIA 1AO7B 1ZHKB 1E4WH 1N5AB 4OKDA 1IGFL 4R4BA 3O4LA 3QXDB 3FCTB 5IF0A 2XQYG 3MLYH 1FDLL 1NFDA 3KPRE 4NYLB 2WUCH 2NW2A 1G7JA 4HIEA 4HF5H 1ZLUK 4RFEA 2VKWA 1MY5A 1TQCC 4PJIF 4BSWB 3LEVH 1CLYH 1KLGB 3MGOB 3VXMB 1KJ2L 3E8UL 4PJGE 4PRID 4H88H 3LY6A 2MQCA 3FQNB 3DGCR 4DKDC 1HEZA 3SE3A 5FM5M 1J1XH 3MLWH 3MRCA 4MQXD 1RPQA 3S96A 4O9HH 1U8QB 3NZHL 4CU8A 4M00A 4HLZG 3OKLA 3LN5A 4Q0XH 1TVBA 5F7EH 4ZXBC 4JRXD 1Q9LB 3G5XA 1IZKA 2BNUB 4UTAL 3SEPA 5GGTA 1AHWB 1KB5H 1KPRA 1Y6NR 4P5KA 4LCWD 2C1OB 3IFOB 5K59F 2EO9A 3D69B 4M7KH 1U3HC 5D5ME 3N85L 5C3TA 1P2CA 4P9MH 5BRZE 3I84A 5C0NC 1N2RA 2FBJH 5IFHH 2EZ0C 2VDKL 1X7QA 4XP4L 3RX5A 1IRAY 4BH8A 1P4LA 3GJEB 3W2DH 2ZUQB 3M17B 3DX7A 3BISA 2LVCA 3MRQA 5CILH 1ERNA 2VLRA 5IMLA 2X4SA 1R5IA 3BYTA 4ZXBA 3SDCA 4UMGA 5AYUL 3NTCL 4CDGC 4XX1G 1KB9J 1HQ4A 5L9DH 4XVUD 1BBDH 5HHNB 1M71B 1U3HA 1IGML 2DI7A 2EDKA 5D2LA 5CD5C 1WZKA 3WHE1 1GIGL 2IBGA 1UM5H 2NZ9C 2XFXB 2VITB 3HG1B 3LQAL 3U0WL 2FHFA 5IJVA 4GKSA 2MTPA 4I2XE 4IMKC 4QRPA 5EUOE 4CVXB 4XZUB 4B5EA 4HJGB 4ZUWA 1LO2H 2A77H 1MCJA 1PZUB 4OQ1A 5BZDA 3QULB 3LH2L 2OMNA 2XQYK 4U1HA 4F57L 3LEXA 2COQA 1ZGLP 2YMXL 4YPGA 5D7JC 1F58L 1XGYH 4NKMB 4FQIL 1X4XA 4OV6F 3QCTH 5IHZB 2DQTH 3BEVA 4K3DL 4ZS6D 1KCLA 3OAUH 4KI5D 1MFCL 1AFVL 1F3JB 3BEWB 3C2AL 3LD8B 1AKJB 2YSSB 4AH2A 5C8JB 5FYJH 1T21A 1UM6H 3K8KA 3NABH 1X6LA 4IMKA 5JXAH 3PP4L 3QWOB 3BQUD 1MI5A 4R96B 4K3HA 4XPFH 4XHQA 1VFAA 3Q48A 4KRPB 4N90D 4OM1H 2O5YH 5IG7B 1OAKL 2EDTA 3ARGC 1K6QL 1OGTB 1K5NA 3TN0A 1UKQA 2GHWB 1HYSC 4OT1L 3N06B 1KTLA 2CR6A 4ZTOL 3QUYD 1INEL 3VFSA 4Z77A 4Y2DB 1CE6B 5INDB 1G1CA 2P24B 4D9RD 1NSNL 1RJYA 2BMKA 5LGJA 1F6AA 2UY6A 3PJSB 4YLQT 4NQCE 5CGYD 2ICWJ 4HPOH 4M1DL 1QFPA 3MLXH 3CU7A 4JKPH 4U1LB 3ARFC 4ISVA 1U8IA 3HUJE 4ZUSB 1X5IA 5D8JH 2AEPH 2UV3A 1Q72H 4NKDB 1Q8MA 3ARGA 1GHFL 2CJUL 4KWUA 3FKUS 2YKLH 5F9WB 2CLRB 3R06A 5TQ2L 3TT3L 5IBLD 4G8GB 1JPGA 5JNYA 1SM3L 1XGUA 3FB5A 1Z0NA 3WNOA 1JUFA 3HI6H 3LDBC 2YUZA 4KMTL 4QKXB 1MCKA 4DOHE 1E27B 1KCRH 3PL6C 3ME0A 1WBXB 2DM2A 4BQCA 4WTZA 1JPSH 1XGTB 1WIOA 1Q0XH 3GIZH 4TTDD 4XXCC 5SX4I 3D6GA 4HIIB 1T03H 1LE5B 5BS0E 2EE9A 2V5SA 3OAZK 4NO0A 4ONHB 4OLZH 3WS3B 4DW2H 1KUMA 5DLML 3EYUL 4MZ2A 1OAXH 2UVFA 4EN3D 4DK6A 2R1XA 1UXSA 1G9EA 2EO1A 5GXBB 3LKRB 2BZDA 4HG4K 1IARB 1YPZA 4YHMH 1QSEE 2ZOKB 1RFDH 3KPLA 4P5TA 3W0WA 3MJ9H 3WKNA 1CGVA 3MR9A 4XXCA 3CFKA 4LRIA 3T4YB 4BJLA 5I0DA 1G0XA 2DMKA 4PJ7A 3RL1B 3QEGL 2OK0H 3KPNB 2Y1VA 2H6PB 5E4EB 3QZWA 4WHYH 1MQKL 3K4ZA 4TN9A 3PHSA 1JGVH 5CAYB 1CE1L 1LDSA 1JJUA 1NEZG 2DM7A 2O5ZL 3HAEG 1MSPA 4O5LL 3FQXA 3QG7L 1ZLUH 3K80A 4QXWA 5C0AA 5GS0D 3RU8H 4J12A 4ZYKA 4P57A 2FB4L 4JZNA 4NNPH 3CMOH 1KG0B 3BWUC 3EYFB 4D0BB 5DJYB 1BX2A 3MBEC 4MSWB 2Y6SD 1ZT4A 1KJ2B 3T08A 5EFIB 1QEWA 3C5ZB 1S5IH 5I16A 3LS5H 5DVNA 4OLEA 5CJQL 1NKRA 2FZ3B 3P0GB 3ARBD 4RAVB 5C07A 5F72S 5IMOA 4P23A 2JK5B 4TYUA 1GCFA 1NC2D 1BVLA 1JWUB 1ZVSA 2A1WH 2Z31C 2XKNB 1AO7E 2Q6WA 5EORL 1ADQA 3S35L 3L3KA 4K7PL 3DETD 2UWEF 3MBEA 1LE9B 4XPAH 4LLMA 3IJSB 3GMRA 5EN2A 2LFGA 3MRIA 2PUQT 3VWJB 4X8JA 3PIQA 2HLAA 5IK3B 3HNTL 1CD1A 3VXME 1I1AB 2OSLA 3KLAB 3X17A 3KYKH 3P4MB 3KAAA 5BOZG 2XWTB 4EIGB 3HRZB 1U8MA 4MJ5B 1P6AB 1NJ9B 4KGLA 4BZYA 1IEBB 2Z31A 5BZWB 4TNWF 1LEIB 1G9MC 1VSCA 1WFUA 5F3HB 3H0TA 4IEFB 4BSVB 2AI0L 3CFBA 3GMOB 4J6RH 4DAGH 4XVJL 1BLNA 2NY2C 1ED3B 1VACB 2D31B 2DQIH 5E8EA 3BKJH 4D0CB 4ODVH 3S88L 2NY1C 2R2BB 5BQ7A 3CFEA 2CK0L 2IADA 3WFDH 4HHAB 5D96B 5IP4A 5KVGH 1Q0YH 2HFEB 5HPMB 1I4FA 3SJVD 3DX8A 1TQBB 1BF8A 4QHKJ 1UB6A 4J3UA 4B7IA 4P9HL 4PB9H 4YDIH 1CLZL 4OD3H 5EZLB 4PD4J 4DZ8B 3IDXL 3UTTA 3OKEA 5KTEH 3T3ME 3FQRA 5F7FA 1MJ8H 1OTSD 3RZCC 3IJYA 4N0FB 2DTMH 3PDOB 5CEZE 1Y6MR 4HJJL 1PD6A 4HLZH 1I1FA 1U3ZA 1A9BB 3FRPA 5TF1H 2ICEA 5FGBA 1MWAH 1I8IB 5C09B 1WWWX 1OAQH 3N9GH 3ZT7A 1XGQA 3RX7A 1G6RH 3WNNA 5BJTB 5FYKH 4X6DB 1RK0B 1AQKL 5EU4A 3B2VL 3P30L 3AFLA 3HG1E 1LO0H 2NYYD 4CVUA 3GSOA 4A6YL 1MFAL 3ZE1F 5HHOD 4I77L 4OGAD 2EIDA 4R0LB 3WEXB 3PWNB 2OJEA 4LDOB 5IW6B 5BS0D 3RZCA 5JPMB 1QACA 3KDMA 1MCOL 2OTWA 5HDOA 5ENWA 2CUIA 4X6CA 4NN6B 3EJYD 4N68A 5JW5B 3QO0B 1FZKB 3MRKB 3JWDH 3D0LB 2Z92A 4ELMF 2AGJH 3ULVH 1JFQL 3J7HA 4F33B 5KW9L 2XZZA 5J3HC 1FL5B 2EXWC 3O6FC 5DHVB 1HQRA 2IH1A 1TCRA 3EOAA 2YA0A 3IJHA 3VG9C 1J1PH 2GSIB 1EAPB 3WIIL 1S7QA 1T3FB 4F9PC 1OD9A 1QSED 2A0LD 3T77B 5BW7C 4XCYB 1G84A 4OZHA 1GZPA 4CKVX 2FX7H 3Q0HA 1QQDB 3OAZH 3ARQA 4UILH 5F89A 4KRLB 3CU1A 5B22A 3O6FA 4EXPX 2MCPH 3BJLA 2X4OA 2W9EH 1AGBB 1FBIH 2HVKA 3MRNA 1T66C 5IKCB 3AU1A 3GNML 4JQVC 3WE6B 2DYPB 2AJUL 4HKZA 4NHCH 4JJ5B 2Q7YA 4L5FH 5IV2B 5BW7A 1EERB 3SDAA 4S1SH 4YHKH 2DM3A 4NZJA 3ULUD 3WFZA 1XGPA 5I66A 5GIRA 2JB6A 1CXHA 3C5SB 4Y19B 5DVLA 4JM2A 2VN7A 5I1JL 4K8RD 4G8GE 1NL0H 3EFFA 4UTBL 3LPWA 3GSNA 1DVFD 3GBLA 3PGCA 4DUWA 5E5UB 4X5WA 1OQXA 3GSQB 3IETA 3QO1A 2ICWA 4JQVA 3O4OC 5DJ2B 5DD6A 1UCBL 1WAAE 3QYCA 3ALPA 3L3JA 2VL5B 5FM8A 3WLBA 1LDPH 1AO7D 1UT9A 5GS3A 3O6LL 5GZOD 4GG8B 4M9PA 2JJSC 5DQDH 5EIVA 3KXFB 5J56B 4MB4A 1U91A 5JZ7C 3WUWA 4DKAA 3V9FA 2ED9A 3PWJA 4HUWB 4F7MA 1CGSH 4X5LA 4P99A 3FT2B 5I1EL 5JA9A 3VXMD 1VKXB 2P5WD 1QHOA 3PWPA 2E9JA 3TV3H 3WLWC 1CGTA 2WWMC 1PLGH 1RU9L 2CUHA 4LCIH 3VRLF 5A2FA 4WCYL 5FGRA 5IOPA 2P8PB 3C09B 1DBJL 3OKKA 1J12A 1G7LB 3O3UN 4RQQB 5DVOA 3MCG1 1WSST 2JJSA 1J1OL 4PV9A 1PG7X 3CJJA 4RMRA 5J1TC 4JO1H 2R4SL 3H9YA 3QUMH 4ZFOA 5I1LB 4JREB 3VXPA 3LZFH 1NMCC 5JORB 1I8KA 3QXAA 4KH2A 2FJGA 4MAYB 4Y5XC 2WK2A 5I1HL 3U30B 1RIVL 32C2A 1DBAL 4KUZH 4HXBL 1YNKL 3SE4C 1J05B 4YR6B 1VDGA 3DVGA 3MMEB 4LOUD 3K2UL 5IIEA 4PY7A 2YUXA 4OLUH 3IU3A 4JO4H 3KPPA 4APQC 1IAII 5CEZD 3MGAA 3L3GA 3BDYL 4HEPG 2DIBA 5D2LF 4LKXA 4QOKB 1C5DB 3KJ6H 4M1CC 3UJTH 5CCKH 5E2VH 4PGJA 5C7XL 3MLUH 4XNUH 1GGTA 2P44B 3D3VA 4Y5XA 3HG1D 3HAEH 1A3LL 1C08B 5DR5L 3EDJA 3SO3B 1P7HL 3MRFB 1DBKH 1UM4H 2XQBL 2BVPA 4XMPL 4MDIA 3SE4A 5E6IB 3FTGA 4R97B 5EUKB 3K74B 1EVUA 2NY7H 2QJDA 1AC0A 2DI9A 5EBMA 4LMQE 3RVVD 3TP4A 1MCRA 4IOIB 1T1XA 4LDEB 3K7UA 3WFHA 4TSBH 3NZ8B 4L8CA 3IXTA 3T0BA 4GKOA 4RA3A 1XZ0B 4XPHH 1XR9B 1KCVH 2GJ6B 1S7VB 1NGXB 3VDAA 1FO0H 3TPUB 1AKJD 1HCFX 5L8LB 2CDGB 3ZLQC 4PJBB 1QRNA 3TC9A 3DGGB 3HCVA 4KRPD 1INQA 5ICZA 3QFJE 1IQDA 3UJIL 4WHTB 4XC3H 3IF1B 4QRQA 5H2BA 1DL7L 3EHBC 1WEJL 5IB2A 4Z5RB 1I3VA 2ZG2A 1HHKA 1J0IA 4ENED 4Y2DD 4NSKB 5FDYA 4KTEL 3WJJC 5ADOL 5KVFH 3AAZB 4UBDD 4CMHC 4R4FL 4JZJC 5TQ0H 1SVZA 1DANT 3KS0H 4LSQH 2A83B 5C0JB 1BM3H 4LLVB 5E8NB 2FH6A 1MUJA 4HQQL 2ORBL 4PJAB 5E2WL 5T1MA 3WFCL 3UTQB 2CXKA 3U2SB 5B8CC 5HHMD 3UC0L 1CR9L 4R4NC 1E4KC 1BREA 2IAMC 4NQUA 4BSJA 2J88L 4IDJL 4H0IA 4OI8A 4M48H 1YNLH 2BRRL 1KLUA 4YIQA 1ZA6A 5IVOA 2AJZB 4JG0L 1CLOH 4ZAKC 3MRBA 3MRPB 1BZ7B 2X10A 1FFRA 2HTKC 5C09E 3FB7A 3RRQA 3WJJA 2IQ9H 1KENH 4ZFFB 4X6DE 2FJFB 4JZJA 4KRMB 4LSVH 5IMMB 1R3IH 3U36B 1BFOB 2VB5A 5DWUH 3VFVA 3C60C 2DWEA 3BH8A 4ALAL 4E41B 4UT9H 2SEBA 4S10A 5B3NA 2VUOA 2FEDC 1UVQB 4JFPA 5B8CA 3NFSL 2WP3O 2WW8A 3I75B 3B6SA 1A7OH 1E4KA 3MXWL 4ZSOB 1TZHB 4FFWC 1BEYH 4HWBA 4NZRH 1VESA 4L4TA 2Z8SA 1T6WA 2AJ3B 5C2BL 2HT2C 8FABB 3HE7C 3STZB 4G43B 1GPOL 3DWTA 4HGKC 5I75C 3EDDA 5D1ZB 4YO0B 1Z5LB 1KFAL 1YPZF 4LQFL 4YHIB 4OV5A 1U92A 2JF1A 3GSWA 5BVPH 4HS6B 4QY8A 2D7PA 3C60A 2X09A 2J12B 2BCKB 1W0VB 3D25B 4J23A 1EO7A 3T65B 2CH8A 5IVXB 1D5MA 4IJ3B 3L1OH 2YXMA 1G7MB 4X9HA 4PJ7F 3ULSA 1F4HA 2LVEA 4LK4A 4G7YH 2GUOA 4KJQC 2WANA 4CVWA 5ANMA 1KTDB 1IAOB 2DWDB 2C3VA 1EFQA 3DUHA 5JDSA 2V7HB 3VGDA 2VQUA 3HE7A 5C08A 2JE8A 5EOTB 3NAAH 2JTDA 2ADFH 4LRNH 4U1SA 1D6VH 5GS0H 3RWEB 1T2QH 1YZZA 2Z91A 2QQNL 2X9WA 5DS8B 4LCUA 2IFGA 5DSCB 2NCMA 2CSPA 4PRPA 1TVHB 3DURB 5BMFH 4LCYB 2BNQA 1IGCL 2NXYB 4P2OA 5I1DA 2NTFB 4M03A 2IMMA 5IQ9B 5DRZB 3NCMA 4GW1A 3DLQR 4HZLA 4ONGL 5CSZA 5EC2A 3HZMB 2FL5B 2VE6A 1FSKB 3MLSL 1D5XA 1ZSDA 4Y4KC 4AIXA 5D2NA 2AJSL 4Y19E 5B3JE 2AABL 3O8XB 3C5ZD 3ARRA 4YE4H 43CAA 1I9JL 3CVHH 3P9LA 1S7SA 2H2SC 1RZJL 2N7BA 3C5JB 4OZFA 4MVBD 2UZYB 3PGFH 5C6TL 1TZIA 1PQZA 5IR1A 1ZV5A 4DCQA 5M7QA 4DVRL 2ICES 2WBJA 4JM4H 3GM8A 3CSYB 1YUHA 4QCIB 5HVWA 4ERSH 4Y4KA 2OXGA 1B0RB 1MEXL 2AXFB 3SKOB 3I6GA 3KXFE 4OZ4B 3MA7B 1BWMA 4RWYL 1F8TL 4KK6C 3VWJD 4GOSA 3VH8G 3HE6B 2EKSA 5KSBA 2XTJC 3WIFA 1I1AD 4Z95H 4F7TB 5DFWH 3DO7B 1DBMH 3B9AA 4NFCA 1MCSA 3IAGC 1CIUA 1OTUD 4HK3J 4XPTH 2VXUH 5GPRA 2HH0L 3BFOA 4WTXA 4XVSH 4KV5F 1F3RB 5ESVB 2P42B 4HWNA 1UWXK 2NLJB 3G08A 4RIRB 3QNYA 2E27H 4XWGH 4LNRA 4UAOC 1NMAH 1KT2A 2DD8H 3UYOD 4RFNC 4XP9L 1JGLH 3MUZ1 4CGTA 2ESVB 3E0GA 3HI5L 1X6NA 2VR5A 3QUXD 4WI8A 3QQ9C 4LLAA 4O4YH 1EJOL 3PXHA 4L4JA 5CJOL 3T0VA 1AQDA 3CXHJ 4WTWA 3LOWA 3VXNB 1MLCA 1VEPA 4JRXA 1QLFA 1CICB 2P7TA 5H94B 43C9A 1ZS8B 4QOKE 3HTLX 4FNLL 5C09D 4G6ML 2K3TA 1ND0B 5HYFA 3LQZB 4MD5A 3STLB 4JO3L 3U4BL 2OJZH 2WZPD 5E5RB 3O0RH 1ORQA 3B9KC 5A2JH 3O2VH 4O00A 3NCJH 3G6DL 3OR7B 4X6CF 4GSDL 1DFBL 5B39G 3VMOA 1F4YL 4LLQB 5JOPD 1B4JL 4HXAH 1RIUH 3SQOH 2ITCB 4X80L 3RKPA 1DUYB 3D39B 4LBEA 5I15L 7FABH 1UCTA 2GJ6E 4DFHA 1X3DA 4CNIB 2C4FT 4FFYH 4F3FA 2OCFD 4U2YA 1N64L 2ATPB 2FX8L 1Q1JL 1NGYB 2R4RL 3OKYA 2IALB 4KQ3L 1FIEA 3DX9A 1NDGA 1P4BL 1SY6A 1I9RL 4KUCF 5KG9B 3CVIH 4HKJA 4PJBE 1XCQB 3V7AE 4HIHA 3B9KA 4OZHF 3D9AL 3VXTB 3QIBC 1GGUA 3EYOB 5J89A 4KY1H 1ODAA 2X70A 2QLVB 5FF6A 3IDNB 3QISA 3HRPA 4NCC1 4F8TA 1K8DA 4U1GB 2BP3A 2XZAH 1AY1H 3KVQA 5A2KH 5I17B 5CGYC 4YHLL 1NBZA 1A4JB 4V1DA 4YC2B 3VXRA 3T2QA 4X7TA 2BVYA 3HZYA 1X5XA 1WC7B 4TRPL 3E2HC 5CEXA 3CH1B 3CUPA 4X6EB 5ID1A 4DGYL 4LQ1A 2YEZB 4HCRA 3BQUA 4PJAE 1D5ZB 3ULUH 4MWFA 3O11B 4HIXL 2I27N 3QIBA 4OFPA 5TDOB 1P7QB 4K8RH 3QIWC 4PGCA 3QUYA 4JM2F 3NCBB 3CAFA 3OKOB 2GSGB 3WDIA 5JOFA 3WKMH 2J8HA 4Y19D 3OF6D 4PRBA 5GSRA 1NGQL 1QOKA 4Z7VB 1ACYL 1HI6B 1LK3L 3LHPL 4M6NH 2J6EA 3RGHA 5T1DH 2ADIA 2A2QT 5KSVB 4B7LA 5L6YH 1UZ8A 1K3ZA 4E41E 1UZ6E 4ZTPH 3GHBH 2R1WB 3RL2A 4GW4A 4OGYL 4JANB 1CU4L 1U8OB 4ZSOE 2YRLA 2DQDH 1BQHG 2MKWA 1KN4L 5EOCH 3Q6FA 4JFOB 1HINH 2F74A 2EYTB 3BZDA 1MRFL 3NA9L 4MDJA 3KXFD 1T2JA 1MJUL 3MBXH 3SGKA 3ZE0F 3CMGA 3ZE2F 4AT6B 1FFPB 3BIKA 3RIAF 3TCLB 3THMH 2V2WA 3MRLB 4U05A 1EPFA 1CS6A 5JUEL 1GZQB 1IFHL 5J9PB 5DUPL 1IEAB 2XT1B 4S1QL 4KHTL 3V4VH 2A6JA 5E1AB 5IVXE 2QADC 3U46B 1AGEA 3MFFB 4RMTA 1ZVYA 1F90H 3MNVB 4JQIH 3NIDF 5CMAB 3KPRA 1T04A 2EYSA 1RUKH 4N1EA 1MVUA 2YBRB 4P3CH 1G7IA 1NBYA 3CLEL 3QPXH 1RSFA 1IC5H 3KNBB 4LAJH 1HK6A 4PREB 1OP3K 5ID0B 4NO3A 3DUSB 2IF7A 3RVUC 1JMZA 1C12B 4QHMB 2R0WH 3PUCA 4BUGA 2V2TB 4MAYD 2W65A 2AEQH 1BIIB 4Y5VA 3TNNA 2B2XH 4HUXB 1CBVH 3FB6B 3BWAB 4JB9L 4OKVA 5TPWL 3P11L 2BHUA 1EVTC 2CO7B 1MCWW 2FGWL 1YDPA 4AG4H 4NO2A 1V3JA 3RWGB 4KROC 5DK2B 3CPLB 4U6VL 2LU4A 4IRJB 2J8UE 1EMTL 4QF1B 5FK9A 1OCWL 3CDGA 5D5MA 3RDTC 5BRZA 3CLFL 4QOKD 2BNRB 3UJJL 2QQLL 1UWXH 4XNZB 3BPCB 1T20B 1RURL 3DSFH 4QTIH 5GJTH 1CT8A 5FYLL 3QCVH 4ZQKB 4KMQA 4WW1B 2C3WA 5DRWA 1Z2KA 3QR2A 2OQJB 4PGDA 1Y6KR 5JXED 1UACH 2H8PA 2BHZA 4WFFE 2DS4A 5E6ID 3K1KC 4YGAB 3WO3B 3DETC 5DJXA 5JHLH 4X6FA 1U58B 1F3DH 2R1YA 3LKQB 5D9SA 2WWKO 4XCNA 5HVHC 5DHYA 3TIEB 5LXGL 2C3GA 4X7SL 5FUZH 5IBUB 4Z7QF 4M7JH 4XNYH 5DJ6B 3RDTA 2OP4H 5GS1B 3RAJL 2NY6C 5D1QB 3EYQC 4J7RA 2V2XA 4N5ED 1NC2A 4Z76B 5HYSG 3UCRA 1IAKA 2W60B 3I9GH 3MRJA 5F1IA 5EUOA 1HOCA 3V4PH 2ARJA 4X7DC 4UB0L 1WZMA 5KAQG 1UWGL 3OMZA 1D7FA 2QSCH 5HHXL 3NOIA 1FL3A 5DD3L 4HUVB 1HNFA 3IS0X 2BSTB 2X4RA 2X1WL 1A2YA 5DJDA 1T83C 4M93B 4JG1H 4YFEA 1S7WA 4FXGA 4Y2OA 3RVWC 1ZHLA 4FG6C 4OFKA 2ESVE 3SOBL 3P9MB 2UWEB 2PTTB 3GMMA 5DJAA 2MJWA 1LEKA 4PRAB 4YDLB 4CVZA 4R26H 2C7UB 2OTUB 1YEFH 3S34H 3F7VB 1QPXA 2OM5A 1U8HA 2VR4A 4FQCH 4LGPB 3DTXA 4JY4A 1I9IL 1T83A 3NCCB 4X5XB 1URLA 3CFIC 3KG5A 5E8OA 1JGUH 2ARJQ 1L0QA 4RGMC 2R0KH 4NQCA 4E5XB 3MRHA 4RAUB 1FYHB 1IM3B 2VDNH 4M61B 5DFVD 4N9GB 3ILQD 2I9LB 1ZLSL 1WBYB 1U6AH 1NLBH 5DT1H 3AY4A 3HUJA 4YDKL 1SJEB 5FOBB 1DQDL 2G9HB 3L7FB 4KJPD 5TGBA 2AJVH 1V7ML 2R56H 3BZ4B 5FGCB 2F5AL 4TSCL 1I3RB 1G9NC 1Q9OA 1H8OA 5MEQB 3MV8D 5K9OB 5F96H 2APBA 1QSFD 3E6FB 4MZ3A 2GFBA 3FB8B 4WGWB 3D39E 3ZT5A 3VGAB 5D1ZD 1DN0B 4LLDB 4HMCA 1AR2A 3X13B 3QQ4B 3L3OA 1N3NB 4P2QB 5DA4A 5ERWA 3EOTH 4PB0H 1N5YL 2ZG1A 1LO3L 2Y36L 1KV3A 2EH7H 4PFEA 1M1SA 3RPIA 3S5LB 4ZD3H 4U6HB 4NC1E 1EZVY 3MGTA 3I6KA 3AXLA 3FRUB 4MCYA 4CMMA 1QA9A 4L8DB 1IGFH 5CP7B 4G8FB 1MH5B 3DMMC 1FDLH 3SDDB 2C4FU 5J6GB 5B38G 4ELMB 4CADA 3I02B 5KSAB 3UBXB 3AUVA 4LHUG 1EXUB 4XCCL 3OJDA 5D7KE 4D9QE 2B20A 1FPTL 3IRPX 3BD5A 5LAXB 1KJ2H 4X4YB 3E8UH 4NZUH 3QIUB 5GZND 1RUAL 1NCBL 4OIAA 1NAML 1F2XK 2Y07L 4Z7VE 3NZHH 4X6BA 3C6SA 5JW4Q 3O8XD 3IFPB 4Y4HC 2JJTA 1YEKL 3VGHA 1MLBB 1OB1A 4HMDA 1OP3H 3B3IA 3FONA 3NIGF 3ZKNC 1M05B 5DO2C 4UTAH 3FT3A 2DRUA 1OY3B 4G6AC 4AEEA 4GKNA 3RWJA 5EZJA 3N85H 4WFFD 1VGKB 4N1CA 5EO0B 2VDKH 4XP4H 1A7PH 1ZHBB 2XY1A 1KIRA 5HGDA 3HMXA 4K3GA 4QHUA 5KSBF 2BOCA 2KH2B 5DMJB 1C16B 4Y4HA 5FB8A 3L9RA 4KVNL 1T7YA 4IBLT 5I1GL 2M8XA 5AYUH 5JO5B 4C56B 3NTCH 2PF6A 4M7LT 5CLTA 1A21A 1ZHKA 1GAFL 5AG8A 1N5AA 3CZFB 3MV7D 1I9EA 3QXDA 1IGMH 3FCTA 1TJGL 4BYHA 4NYLA 1B2WL 1QR4A 1GIGH 3U0WH 3LQAH 4R4BB 3O4LB 4F58L 1T1ZA 4PJ8C 3EYVB 1J8KA 1AHWC 2IFFL 1KPUB 4BSWA 1E4XL 3EZ8A 4HIEB 2EIZB 3LH2H 4DKEL 4F57H 1A5FL 1NGWB 5J6HA 3GKWL 3FQWA 3FQNA 2D03L 2CKBA 3FHQA 2YMXH 1F58H 1MFDL 3U0TB 5K9KB 2ZCKL 2HKHL 3QJFA 2ZUQC 1U8QA 4FQIH 3WD5L 1IL1B 2VLLA 2CPCA 1HEZB 4K3DH 5FCUL 1MFCH 1AFVH 3C2AH 3GSUB 1Q9LA 4QWWD 1CICD 2BNUA 3OKLB 4PJ8A 1Z0MA 3SPVA 3LN5B 4XGZB 1AHWA 5DJ8B 4QLRA 2G60L 3PP4H 3WN5C 2C1OA 3IFOA 4AY0A 3G5XB 2FHBA 4MQ7B 2DQFB 1NCAL 2BNRE 4XHJC 1FYTB 1MJ7L 1OAKH 2VR9A 1CXFA 4PP2B 1E6OL 1K6QH 1YYML 4P5KB 5HGHA 5KOVC 4ODHL 4OT1H 5D71L 4ZTOH 1INEH 1N2RB 2ZUVA 3GJEA 3M17A 2UY7A 1EEQA 1NSNH 2WP3T 4DVBB 1VADA 3RUGE 1P4LB 4KC3B 2XN9B 4M1DH 5F6HI 2VLRB 3OKNA 4PRNB 5DC0A 5HHNA 1M71A 3D39D 3DNKA 5IEHA 3WXWL 1GHFH 2XFXA 2CJUH 1YN6B 3HG1A 1U3HB 1L6ZA 3RBSA 2ZP0T 1MCNA 1RD6A 3LV3A 5TQ2H 5EB9A 3TT3H 1A0QL 1SM3H 4GKSB 1IM9A 3QULA 3TJHC 5E00B 1CYGA 4KMTH 3E3QC 1PEZA 2FECL 4JFYA 4JHBA 4U1HB 4NKMA 4ZPVB 2LAGB 4PRDB 4L29A 1T0MA 2EXYD 5F8QC 4IIQC 2UWEE 1AKJA 2YSSA 2DI8A 3Q3GB 4MXVF 3BEVB 5C8JA 4YNYA 4MB5A 5DLMH 3EYUH 4R96A 3U7YH 4UNUA 4AH2B 4U1NB 4EKXA 5D7KD 4JKMA 5IG7A 4MCZB 4D9QD 4J2XA 4HBQA 1P7QD 5F9WC 1WK0A 3NN8B 5HVGB 3BGMB 5E5MA 5IB5B 4Y2DA 1CE6A 5INDA 4EQ2A 2PYEB 3PJSA 5D7JB 3VFSB 4Z77B 5CWSB 3BT2L 2O5XL 4PJ9B 3QEGH 1L7TL 1H8NA 2BMKB 4U1LA 5LGJB 1MQKH 1HHGA 4YHZL 2YN3A 1CE1H 1EEYA 3RI5F 2O5ZH 1KULA 2APVA 4IOFD 4NKDA 3QFDA 1QBLL 1U8IB 5FGCE 3QG7H 3TJEL 2CLRA 2PN5A 1QFWM 2CRMA 4BZ1H 1PDKA 4G8GA 4W4OC 1GGCL 3LN9A 2FB4H 4AEIL 4HG4J 2DQEL 3REWA 1UH4A 3GSRA 5DZLA 5JNYB 1WBXA 5T1KB 5CBEB 2Q8AL 4PGBA 2I24N 1XGTA 4P2QE 1KIQA 1RVFL 1WAAA 4PR5A 4MLSA 7CGTA 1LE5A 4HIIA 4HIJB 3UYRL 4F7CB 4I3SL 4S1DD 5CJQH 1KC5H 3ARFB 3TIDB 5F8RC 5DGRA 2ZSVB 4G80B 4X7CC 3OL2A 3IFNL 2DQUL 4P59L 4NO0B 4NT6B 1IKFL 3GSXB 4OQTA 4Y5YB 1YQVL 1N6UA 4X9GA 4M5ZH 3HR6A 5T3XL 2BVOB 3LKRA 3MXVL 5EORH 5KOMC 1NUDA 3RVTD 1MCPL 4J3XA 4XPFL 1CN4A 3S35H 2VN4A 3QDJB 3MZTA 4K7PH 4OM1L 1MFBL 5IWLA 4KK9D 2R1XB 1UXSB 4ELME 3LDBB 2ZOKA 2I9TB 2CLVA 3PL6B 3KPOB 3T4YA 3GSNL 4KKAC 3HNTH 3KPNA 3W0WB 2H6PA 1MCFA 2KBGA 3MR9B 2X4QB 4P49A 3CFKB 5D5MF 3C5ZC 1J8HA 4IRJD 4Z7NE 3AREC 3FOLB 2HT3C 2AI0H 5JPNA 2K7PA 3HS0A 4XVJH 1ITBB 1V3MA 5EU7E 2BNRD 4AIZB 3HLAB 4J4PC 3UAJD 2LV4A 3S88H 1HXMB 5D70L 3FQXB 5GGVY 2CK0H 4ZYKB 2VZ3A 1KG0A 5M94B 3OTTA 1QG3A 4D0DB 4P57B 3EYFA 4D0BA 3KYAA 2ENSA 5DJYA 4ESKA 5FV2A 4JZNB 4MSWA 1CLZH 5MHSE 4KDWA 1MCIA 2GW5A 5AEAA 5DEFB 5EFIA 1KCRL 3C5ZA 3IDXH 5I9QC 3MJ6A 1Z3GL 2FZ3A 3ARVA 2E8ZA 4RAVA 3S37X 1ZT4B 3ETBF 1O0VA 2ZOLB 1QEWB 5FO9A 5EUOF 5D1QD 3M45A 2JK5A 4C56E 4HJJH 4EI5C 2XKNA 5TF0A 3OX8B 2P43B 1CDCA 1AQKH 3B2VH 3P30H 4EUPB 3L5WB 2FEEL 3O4LE 1LE9A 4AL8L 3IJSA 5JLZA 2RAMA 4A6YH 1MFAH 4I77H 2P49B 4H0HB 3Q5OA 3MBEB 5IK3A 2WMPA 1TTGA 5ELIA 3GMRB 3P4MA 5IBTL 1MCOH 4NQXB 2XWTA 3PIQB 4D9LL 3HRZA 1NJ9A 2OSLB 1KGCE 1IEBA 1LEIA 4WJ5A 1JFQH 5F3HA 4R3SA 5KW9H 5FEBA 3GMOA 1EEZA 3EJJX 4JFEB 3MNWB 1U8MB 3SDXB 3N0PB 1ED3A 1VACA 2VXTL 3QFJA 1T4KA 4D0CA 4LF3B 3DROB 3H0TB 4HK3N 3SGJC 4K3JL 4M7LL 3VRLE 2YPVL 3LEYL 3WIIH 3FT4A 5E8EB 4HHAA 4LLWA 2HFEA 5HPMA 2PETA 1FYTE 4ZUUA 5I74B 2NZIA 3HUJF 3CMOL