2IGLA

Crystal structure of e. coli yedx, a transthyretin related protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
HMAQQNILSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin-like protein
publication title Expression, Purification and Structure Determination of Yedx, a Transthyretin-Related Protein from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2006-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2iglA00
2H4EA 4DERA 1KGJA 2G3XA 2PABA 3DK0A 3FC8A 2G9KA 3IMVA 4L1TA 4Y9FA 5CLZA 5AKVA 5IHHA 5L4MA 2B9AA 3TCTA 1DVXA 3A4DA 2TRHA 4WO0A 4TQHA 3D2TA 5CR1A 1X7SA 5JIMA 5FW7A 3P3TA 4PWKA 4KY2A 4IIZA 4TLUA 2B16A 4FI7A 4WNJA 1RLBA 3DGDA 5K1JA 1FHNA 4TLTA 1F86A 3DJZA 1THCA 5CM1A 3GS0A 4AC2A 1G1OA 4HJSA 3NESA 4PVNA 4HISA 4TLKA 4D7BA 4Q14A 4I87A 4N86A 4TL5A 1BM7A 5E4AA 4I89A 5AYTA 1DVUA 5L4JA 1ZD6A 3GPSA 3Q1EA 4PM1A 3I9IA 3P3RA 1TT6A 4PVLA 2IGLA 2TRYA 4QRFA 1X7TA 1ETB1 3CN4A 4YDMA 1SN5A 3HJ0A 1IJNA 3NEXA 5FO2A 1SN2A 2G4GA 3CFQA 2QGDA 3KGTA 5AKSA 2H1XA 3KGSA 1E4HA 2ROYA 4WNSA 3DO4A 2G5UA 2GABA 1IE4A 2NOYA 4FI8A 4ACTA 1TTCA 4PMEA 1BZEA 2H0FA 2G2PA 3IPBA 5CLXA 5FW6A 5L4FA 5A6IA 2H0EA 3IWVA 3I9AA 1DVSA 1THAA 4TNGA 2B77A 4TQPA 4Y9EA 4Y9BA 1BZ8A 3OZLA 2F7IA 4IKJA 1TLMA 5HJGA 1OO2A 3QVAA 4IK7A 4PWEA 3DJSA 4PWHA 4ABUA 5JIQA 5AKTA 3NG5A 1TTAA 3CN2A 2B14A 4ABQA 1ZCRA 3ESOA 1GKOA 3DK2A 5EN3A 3GRGA 4TNEA 3KGUA 4TNFA 5CN3A 4N87A 1QWHA 4MASA 5BOJA 5JIDA 2WQAA 4IK6A 2G3ZA 4IKIA 5K1NA 3BSZA 4ABVA 4Y9GA 4PMFA 5CNHA 4N85A 1TYRA 1TFPA 2QGBA 3NEOA 3U2IA 1BZDA 4ABWA 2G4EA 3DJTA 3P3SA 1KGIA 3BT0A 1E5AA 1SOKA 4PWJA 1E3FA 3U2JA 1DVTA 2F8IA 3CFTA 3GS7A 2ROXA 1DVQA 3DIDA 5EZPA 3TFBA 1Z7JA 3CN3A 3CFMA 1F41A 4DETA 4QYAA 3D7PA 4TLSA 1IIIA 3P3UA 4HIQA 3IMUA 3GRBA 2G2NA 2QGEA 4QXVA 4TL4A 3GLZA 3ESNA 3IMRA 3CXFA 5L4IA 3GS4A 2H6UA 1ICTA 3IWUA 5AL8A 3IMSA 4PWGA 5E4OA 1TSHA 3I9PA 5E23A 3OZKA 4ANKA 3CBRA 2QPFA 4IKKA 3CN0A 5TTRA 1Y1DA 4HJTA 5CLYA 4PWFA 1BMZA 3CN1A 3IMTA 4TQIA 1TTBA 4Y9CA 1ETA1 3IMWA 4DEUA 1DVYA 4DEWA 4YDNA 4DESA 4PWIA 3B56A 4FI6A 4TM9A 3W3BA 1SN0A 3IPEA 3SSGA 2FLMA 2QGCA 2FBRA 4PVMA 5DEJA 2QELA 4TQ8A 2B15A 4AC4A 5AL0A 3CFNA 4HJUA 2H0JA 4MRCA 3A4FA 3DJRA 3M1OA 3A4EA 1QABA 4L1SA 4MRBA 2GPZA 4TKWA 1FH2A 3NEEA 1TZ8A 4I85A 5DWPA 1SOQA 5FW8A 1GKEA 1IIKA 3ESPA 3FCBA 1U21A 4IKLA 1DVZA 1TTRA
chains in the Genus database with same CATH superfamily
1ZIAA 3WTSA 3QZWG 5HGBA 4LO9A 4GEIA 1WFIA 1ZGLM 5F8QC 3ESVF 3QZWA 4XO4A 1BOYA 4FFTA 3BAXA 1MFAL 1NCCL 1GZQB 4G72B 4RMQA 1T7VA 5IHUL 3IKCB 3CXDL 1AGBB 4XMLH 5DD6A 1KJVB 2N0MA 3GXMA 2EIDA 2NRDA 1K6QH 4GXUN 1BQSA 3E1F1 1XMWA 3Q8FA 4ZS7L 1FHGA 4ZUWB 1A1MA 1EJOL 1KPRA 3HB3D 4UQDA 1DEEB 1NMBL 1INDH 1SDYA 3W56A 1AHWA 4R5TA 2DQJL 4GIPD 5TFSL 3CC1A 3SE8H 2FQEA 5DYFA 4HS6A 4HPYH 4LVOB 1FE8L 5IBTH 3T1FB 3BISA 2WBJD 3ZTJH 3BW9A 1NBCA 3EOTL 2NT1A 1KB3A 4DESA 2CR0A 3C9NB 4OI9A 1MCFA 2NY5H 2WNWA 2GK0B 3KMDA 5T1LB 4N68A 5BO1L 5I1EH 4RSVA 1XSOA 2YN3A 5ADPH 2UWEA 3K2IA 1MF2H 4LHUB 2OMTA 3RB5A 5K9KA 3CHRA 1N68A 1FFRA 3T2PA 1P69B 1WISA 2EIMB 5J6SA 2VZSA 1MCLA 1RI8A 2XX0A 3Q9PA 4PJGF 5DJAB 5JDSB 4NQTA 5JW5B 1NBVH 2Z92A 4ELMB 1FIEA 3DXAE 5GSVA 3KBFA 1E8WA 1J8HE 2F8VA 1TJHH 4YX2L 3ILQD 4PJBE 4OIIH 3OTTA 3H7LA 3HZKA 3NN8B 3C2AH 1PJWA 2Y3NA 3D06A 2DRUA 1T1YA 1W0VA 1MFNA 2VDMB 1DVFC 2HRGA 2DAVA 1WA2X 3EJYC 3JWOC 4G1MB 1EEYB 1O6TA 3QH3B 2O26U 2CR6A 4NKDB 3D39A 3DPDA 1BMZA 5CJQL 4MDIA 1CIDA 2Y25A 1NIAA 1MXGA 3KDMB 4I3SL 4FI6A 1TCRB 2XFXB 2OMZA 3WUWB 5I26A 5KSAC 4C55A 2ZOLB 1IGJB 5LN4A 1N59A 1T2QH 1IGTB 5L2JA 1B6DA 1ZEAL 5DHEA 3T0EA 1ET7A 1TG8A 4LT7A 3NFSH 3PXJA 5CWSB 2AK4D 4MMXB 1GKEA 1FQ9C 1LP9B 3BPNC 2CKBA 1KJMB 3L3GA 4UYQA 1JF5A 1F5WA 4ODXB 3Q9QA 3MLWL 3MYJB 4Z0XA 5I6KA 2FSDA 1V3MA 3MBEC 1WBZA 5D6CB 5C0DB 4MJIB 5JIMA 3IU3A 2V5RA 2VLLA 3PUUA 3VXMD 1MFBH 1XL4A 3CFCH 1G6VK 2ADIB 4IU2A 1TLKA 4IRJA 3BGMB 1Q72L 4PJIF 4A7GF 4UM8A 2BH0A 5ITBH 1RIUH 1JTOA 4ODWB 4YE4L 5CMAB 4Y1AD 2DM2A 4R7LA 1EO8H 1BGXH 1I9EA 2E7BA 5AAMC 1LEIB 3B6SA 3M88A 4WSJA 4JG0H 1ML0A 4PJ5E 2ZWLT 2UYLB 2K0RA 1Q9OB 4CNIA 4KX7A 4APXB 2GJZB 2FX9H 5HSFA 3SKOA 4C83B 4UV7H 4GKOA 4OLUL 3CSGA 2NY6B 3K72A 3KWUA 4MMYA 3GDCA 3RUGE 1SYSB 1W0YT 1FI8C 1BQRA 2ARJB 3UP1A 4LCWB 2ZCKH 1A6WH 4PGDA 3RTLA 3DUUA 4H20L 4XWOC 3PHOB 1NCTA 3C60A 4V2BA 5FOJA 1I1AC 2XBTA 3OMIB 3L3DA 1QSED 3MXWH 4FZ8L 4KVNL 3SGJA 2IBGA 4HIEB 1AHMA 5D7JA 1ORQA 3OLEA 5CN1A 2C9RA 3BPLB 2QLVB 1AGDA 4JHZA 4OI7A 3CX2A 5FM8A 1S46A 2VW4A 1JZFA 4GI8A 4HCGA 4ZMXA 5JOEA 1Q1PA 1WAAF 3C87A 4MLSA 4O2FA 1P1VA 2YGVA 3U7WL 5C2BH 2J12B 2XY2A 3S97C 3PQYB 4XXWA 3IMSA 3OPUA 5CEZE 5MI0C 3I9PA 1EAPB 5CEYA 2ESVD 2PMZA 2R59A 4HIXH 5C71A 4PY8J 2CO4A 1VEPA 5MEPB 3RGVA 2EDYA 4HSAC 3VG0L 4OLEA 4IBLT 3I50L 4K7PY 5BVJB 2E6QA 2H32A 4RWYH 3ZRCC 3MKKA 4AJYV 2EIBA 3CZEA 4YH6A 4PJBA 2GVYA 4JFFA 4BA0A 4QKTA 4EN2A 3TXAA 3K6NA 5LWYL 1H15B 5EZIL 3TZVB 3KLSA 2R2HA 1U4EA 2FO1A 1PYWA 3VB9A 4J4PD 1WFTA 4LFHG 3T8XA 3CHQA 3QISA 3DX8B 3FTGA 4JDZA 4DERA 3EDFA 3G5VA 1FWXA 3O3UN 4GAGH 4YHLH 3NA9L 2A9NL 4HZ1A 4GSXA 2FJHA 4NSKA 1W72L 3D2TA 3LRLA 1NBZB 4GQ9L 4U49A 2NY4B 2EE3A 3GSXB 1OF2B 2ZJSH 4RGOL 5D4JA 1W8EA 4OQTA 5HDLA 4AYFB 5B8CB 2BWIA 3TM6A 3TWCH 3GQFA 4ZX3A 4GMSL 4NPYA 5C0JA 4LOUD 2Y2WA 4HZLB 3CPLA 3BIBX 1CR9L 3P9MB 4KNSA 4Z77B 1EFXD 1KTDB 1XSIA 4YSOA 1E2VA 3IGAB 4PRPD 2EADA 5IBUB 4JRFA 3PG2A 3I85A 4J23A 5A2FA 3FB8B 2H47C 3MJ6A 2QBWA 3BH9B 2VXQL 1T1ZB 1H3PL 2XCMC 2X4RB 1DFXA 3QDGB 2C4XA 2FB4L 3OZLA 3S35L 1SQMA 5MP6H 4JHVA 1WBYB 2NW2A 1ORSA 3KNBB 3UTSA 2DMCA 1F6FB 2YGOA 3CN2A 2LV4A 1CBVH 4WO4A 5DHDA 5MEQB 3GZPA 4XTRC 3ZTNL 1BBDH 4H0IA 2G30A 5TE4H 1TKWB 2IBBA 2H6PB 2HKHL 3TV3H 2YPVL 3CZSA 1DBBH 4KRPC 1EV2E 5AVZB 1IEBA 2IXQA 5D1QE 1DFBH 3CDZB 5SV3A 1RZJC 3KPLB 2F8IA 5EEYA 2FATL 1SMDA 3RUGA 1JZ7A 5AG8A 4YHKH 1R4XA 2YBGA 3KPRD 3Q7JA 4P46B 3S48A 2DMBA 4X9YA 2NY0B 4H8QA 1L9SA 1F8TH 5DFVC 5L4IA 3OGOE 4OLVL 4TNVK 1OGAD 4CGUB 5C6WH 1KUMA 5F88A 2Z8RA 5ID1B 1JTPA 1H8NA 2DTML 2WUCL 5FOBB 4A2LA 4XN8A 2X38A 2IGFL 3TV8A 3UIZA 5ADOH 2UX7A 4I18C 4PJXB 1LQBC 2DYPA 3O6FD 1B6UA 3BSZL 1NGPH 1MHPL 3WS6A 1T03H 3UMNA 2X6MA 5A40E 1IVTA 1X5AA 3ROLB 5AALA 1A1OA 5D2LE 4G6JL 3MRCB 1FGVL 2H1LM 4Y2DB 4O51B 4XWGH 5FDYA 1U21A 3IE9A 1IUZA 4BK4A 2HLFD 2VR7A 4LLVB 4EKJA 5KSBA 1OANA 3RWDA 2CQVA 4J3TA 4FFWD 1MCWW 3VXOA 4L1BA 1C16A 4JUTA 3KWWB 2NTSP 5FYJL 3CH8A 5HYSG 1HINL 1OAZL 2B9BA 2V33A 3MRNA 4M6NH 4XNAA 3LKPA 5HYSA 1V54B 2NY1D 2CBPA 2R27A 2JIXA 1XTMA 4BINA 5KYNA 1EGJH 1KBWA 3Q6FA 3C6LC 1AE6L 3LS4H 2M83A 1PZ2A 1DJXA 3GBMH 1TO5A 2XZAH 4OCRL 4WNQA 2FJUB 4F33A 2Y07L 4NYLA 1L9RA 4R83A 4M1GH 4GSDL 5B1JC 2J1ZA 3B34A 2WINB 2A83A 1UJTA 1QQDB 3AABA 4MCZB 5FO2A 1KJ2H 2VZ1A 3CFQA 3PPSA 4NEHB 3ATEA 5T3ZL 2ROYA 4GO8A 1PFCA 4PJBF 1A4BA 4JL2A 3AM8C 4YK4C 3OPZL 2OYLA 4BFIB 1E42A 1FH5H 4IOFD 1LD9A 4HJJL 2LABA 4BEIA 4DP1X 4NQCD 3U2SA 5ENWA 3TPKA 1VGKA 4B3VA 5B39B 4N9OB 1MHHB 2QVKA 5F3BA 3T1WA 3DRQB 2IH8A 4GPVA 5J1SC 2CRMA 4U1JA 5C1MB 3HG1A 3QO0A 1PZBA 4NN5C 3V52H 3GMOA 4LKCB 1JXJA 1DE4A 1XR8B 5B1CA 5BOJA 4F24A 5I18H 2PTVA 4NFCA 4M7ZC 1ED3B 2IADA 2YHGA 3QNXA 4L29A 4KI5C 4DK3A 5E2WL 4HOWA 2F0CA 1GGTA 4F15B 5GJSL 2MCAA 2EDNA 3QPQC 4JFOA 2AVFA 4XPAL 4KTGA 3QZLA 2HN7A 2ADFH 3F04A 4XRCB 1A25A 5ETUA 4DPAX 2K6YA 4PSRA 4YOKA 4Q74A 2NY7L 4XNBA 1T0MB 3EGXB 3LH2H 4PLJC 2MSPA 4N2DA 3SDAA 3IWUA 1N64L 2JVUA 4FYQA 1B9KA 2ZICA 1M9WA 4R7DA 5IMOA 4DGIH 1HI6B 3ABKB 4Y16A 3OKMB 3RL1A 3LMJL 2BVOB 3DVNB 3V4VB 3IDIA 3EJUA 4N3UA 3W0WA 4JHUA 2NUPB 5AAPA 3QJTB 4Y5YB 2J55A 1IC1A 1E67A 2J5LB 1INEH 2BZ7A 3A6CH 2YAHA 2YMXL 4BXSV 2QEJA 4IMLA 1H5BC 2X4OB 4GRWE 4OV5B 3CSPA 4UT6A 1FVEB 4M6ML 4U1LB 1ACCA 3CAFA 4WUKH 4S1RH 4XAWL 2AXWA 1UYWL 1VFMA 4KX8A 3R0NA 4OSUL 3TTYA 1F0LA 1JZJA 4KO7A 4L18A 4P5KB 3KXFD 4I1RA 3RUGF 1S5IL 2XVBA 1MFAH 1DLHA 5IHUH 1WIPA 3CXDH 1Z66A 4PJDA 3HPJB 4YNYA 1RZIB 3KPOB 4WI8A 5IJCC 1VESA 2UY6B 1K3ZA 5EU5B 1HSAA 1VZIA 2NMSA 4IU3B 2JKXA 4ZS7H 5TE7L 3PABA 3T77B 5CZVL 1EJOH 3S36L 3VNZA 2QQKL 1WZKA 4B27A 4BZYA 5JIIA 3ZTJG 1NMBH 4U1GB 4JX0A 5DUBB 2DQJH 5DXWA 2CGRL 5TFSH 2KI6A 5HTSA 3T0XA 3VXQB 4FTVD 5I1DB 1FE8H 3MJ7B 2HJLA 5DEFA 5HGHB 4FYSA 3EOTH 4JRYA 2ZSVB 4GAYB 1T1WA 3FFCA 4PMEA 1IEAA 1I8LC 2X3CA 1QVOA 4XP4L 2L7UA 2XIIA 5ALCL 4BKLB 2ZSWA 3WDIA 4E9QA 1UEYA 5BO1H 5KSBF 1AQMA 1BD2B 2VDKB 1WZMA 3FT0A 1U8HA 3LNHA 3MRQB 3O8XD 5DEZA 5DSCB 2R7EA 5IWLC 5C3TA 2WQUA 4LKXB 1R5IA 1P84J 5A2BA 1CICD 1NAMB 4OF3A 4B60A 1YVLA 4HKXA 1QD0A 1F6AA 1JN6B 1KYDA 1G7HA 2F2HA 1FBIL 5FO7B 3QR1A 1AOZA 2AGJL 4AX3A 3RY6C 5HPMB 1HWGB 3TX4A 2YAMA 3BD5A 2CLZB 4CDGC 1U3HA 5E6YA 1BAGA 2V8LA 4P59L 5HHPA 3SKUD 3D7PA 4H25A 1P0SE 4KDTA 3APMA 2OFQA 3B9VA 3T4AB 4XN7A 2FR4A 1HHHB 2NT0A 4UQ9A 3BFWA 4K94C 1UD3A 3PREA 4F7EB 2Z91A 2WXOA 4P2RD 2NNAA 2BP0A 2ZAIA 1BQUA 3K71B 1NDMA 1J0KA 5CJQH 4QTHA 3RFRA 4KO6A 2APWA 4MX7B 4M9PA 5FS5A 5I0ZA 1F3JA 2FIKB 3N42F 4I3SH 5ISZE 2DYSB 1XZ0B 1ZS8A 3GSRB 2EVIA 3B3IB 1TVHA 3VD0A 3LX9A 1ZEAH 1GAFL 4Y5VC 3QEQD 3MRJB 1S7VA 4E42A 5FW8A 2WUBL 4PS3A 2H2PD 2VQTA 3LB6C 4XI5C 4TLTA 1ZV9A 2XV0A 3GGWA 3MLWH 3UBFA 2IWKA 5F3HB 2F1EA 2DQEL 4KKLC 3V0DA 2M8XA 3N1MC 2WLNA 3QEHB 4WO0A 4ANVA 1W6WA 3L3HB 3NJFA 5EZJA 4BRJA 3S3BB 4F92B 3LQZB 4X6CE 3LKRB 1IGML 5F7HA 1Q72H 2ZX7A 1RH8A 2J21A 2ZUQB 5I1LB 3WN5C 4YSEA 2DICA 1YAZA 2YLKA 5FYLD 1UASA 4YE4H 4I0CC 5F9DC 4JFEA 3ZW3A 2EXYC 2ITFA 3TEWA 5DJYB 1CYGA 3GPSA 5LUMA 2DBJA 2OMUA 4L9LB 1DBKL 4HU8A 2BZDA 4QHUA 1A5FL 1BFTA 2Z92B 3VE0A 1GSMA 2CWRA 3SBQA 1HNFA 1UUNA 4PJCA 4QUOA 1JPSL 5CJ8A 5JDJA 3QIWC 1OT4A 5EO9B 1NM4A 4NGHL 1BEXA 4UQBA 1IJ9A 4OLUH 3IJSB 1Z1WA 2IG2L 5AOJA 3AY4A 4HPOL 4B7IA 1QSFA 2Z1PA 4PS4L 3HC4L 4QRPB 1JPFB 4MD0A 5E9AA 3PNWA 4XPHH 4NIYE 3VXUA 3WEXA 2CM6A 1BX2A 5J3HD 3ALPA 5AKTA 1UD4A 3CZFB 4OJYA 5FO9A 1TTAA 3D4YA 4YE0A 3BQUD 1YMHA 3CK0H 5CIPH 3X12A 3CSFA 2Z8WC 3ZE1E 4FZ8H 3NJLA 4KVNH 4G6FD 3MLVL 3KR3H 2HTKC 2CLRA 5JOPD 1E8XA 3FXIC 3QXAA 3TO4A 3VFSB 2TSAA 4XCCL 1E40A 1N59B 4ONHB 3BYYA 2HT2D 2V9TA 3BDBA 4I4WB 3K6IA 3WJMA 2W95A 2EDKA 3VDAA 2BSDA 2HFEB 1TQCC 5CILL 3VDCA 5CEZL 5F7LB 3U7WH 3OR6B 2IV8A 3E38A 5DJDB 1A7NH 3WLWC 1LE9A 4HIQA 2A6KA 1ZJAA 2VDLL 2JKSA 4QRSA 4FQCL 4WFHD 2CZNA 1T7YA 1JHTB 4M5TA 1XH2A 3LZPA 3MNVA 1WA0X 4F27A 2VYRE 5ESAB 2F53B 4HWEL 3VG0H 2LVEA 3I50H 1XEDA 2G9HB 4MNQA 5GQBA 2P9RA 4Z3JA 4HUCA 1G7QB 1LILA 2C7FA 4OM0H 1MWOA 3TJEL 4JKPH 5F70A 1GL4B 2P5WA 4NN7B 3FRUB 4LLWB 5D8JL 5LNDA 5LWYH 4G8IA 4KK6D 4Z1PA 1J5HA 1XCTA 4BH7A 3VXNB 3QWNA 4WRLA 3TNNB 3QEUB 3HRZB 2X2IA 4TRPL 3WNPA 4HHGA 4WFGE 5IB5B 5I1HL 3N41F 2I9TB 5ESVA 2N1KA 2XXMB 2A38A 2DKMA 2ADYA 2FSEA 5GISL 4Y5XB 3NA9H 4FG2A 3RWGB 2A9NH 3S2CA 1U95B 4GQ9H 2O5NA 4ZBJA 1Z2KA 3CQPA 4FLQA 2N7AA 4RGOH 1JWUA 3MA7B 3HFFA 4GLRH 4XMXA 2HRLA 1NC2A 4ETQB 1YPZB 4GMSH 1XCXA 2IJ0C 2NDFA 1KCSL 3J2PA 1CR9H 2HFGL 4I87A 1XBRA 2K8QA 5D7JB 3ASNB 3D2UD 2JELL 3IMBA 5CHNB 3T2QA 3INOA 4NM4H 2DH3A 1QA9A 1KLUB 1X44A 2WW8A 3CLFL 4CAGA 4LCYB 3VGAC 3H9SA 2IH3A 2DQDL 3NMEA 1V7ML 2XETA 1T66D 3V9FA 3GSWB 2R2EA 2YUZA 4XP6L 2VXQH 3GJFK 1H3PH 2COVD 1WHOA 3BO8B 2FB4H 5C08A 2YO3A 3S35H 5I1CL 1S7QA 2IALA 4NO2A 3EH2A 4ZNEE 1IAOB 5LBVA 2NQ3A 5D1XD 5E1AA 4D9QE 5MENA 2VAJA 5AKRA 3NZ8A 4ZUVA 2NXZC 3E6FB 3G7TA 4AEFA 43CAB 1UC6A 3ZTNH 1FN4A 3VXRB 3V7AG 4ZUSB 5DHVB 1VFAB 3S3SA 1P1ZA 4G5AA 4PJHB 4Y19A 5D5MA 2HKHH 2YPVH 1WZ1L 4ZUUA 4YSCA 2DQFB 2XPGB 1KGCD 4GRWF 4L3CB 4P3CL 1HHIB 5IP4A 5CO1A 1JGIA 3U2JA 2FATH 3HZVA 4YAQA 2J3SA 3M07A 1XF3B 2NY6C 4LSRL 4NWUL 2ROXA 1MPAL 4NRYA 3RHWF 3F65A 3HVNA 2PTTA 3UAJA 2YA2A 4NO5A 4MD4A 4FQLL 4JBSA 5EWIL 3UG4A 2O4EA 4OLVH 2AXFB 3DUSB 3SDXB 1PU0A 1D7CA 4HIPA 5F7YC 2DTMH 1OHZA 2WUCH 4W9LC 5GRZA 2J1YA 1IL1A 4XCEA 2IGFH 3NBNA 4MWFB 3GMQA 3BPLC 2EECA 4H8WC 3B56A 2VLKA 2OL3L 3BSZH 3TCLB 3V5DA 1MHPH 4X7EC 3PRZA 1KYAA 5JXEC 3IXAA 1KNOA 5I2IA 4G6JH 4XCYA 3SYCA 1MI5A 1FGVH 3HS9A 1TZIB 3UYOD 4Y4HC 5EU6E 2ZUXA 4XPBL 1PZDA 2LHAA 3UC2A 4FJYA 4A7SA 5BW7A 2YPLA 2H3NB 1DVZA 1LO3L 3HG2A 5BOZG 1WD8A 5HHQA 1QBLL 1BMGA 1HE8A 1OB0A 5FYJH 2MNWA 3B5GA 1BZ7B 3ATAA 4LLQB 1OAZH 5I1AB 4KMTL 3TPUB 4JPKL 1XXDC 1R5WA 4X8JB 3WENA 2FEEL 5C09D 1C5BL 5GS1B 4O58H 3IGUA 4G1EA 2AC0A 4X98B 1AE6H 3GO1L 1KJ2A 1GPOL 2Y07H 3VQ2C 2ZKYA 2IMNA 3HUJE 2Y1ZA 5EV7A 3FB7A 3TZVC 3UYPB 2P5PA 1KBVA 1E9PA 3Q5TA 4PJ9C 3TA3D 5T3ZH 1EH9A 3T09A 3S8GB 1BQHG 3FFDA 5G5DA 4AQ8A 3OPZH 1TEGA 3AREB 4YPGA 3HN8A 4JDTL 4HJJH 2PP8A 1PBYA 3IFPA 5DEGB 4ZW3A 5A6IA 2RA1A 4QY8A 4AH2B 2D0FA 2CO6A 2IQAB 2GK2A 5HJGA 2OCJA 2X87A 3FYEB 1P9MC 1U8IB 3EJZD 4HQQL 3BZEA 1S7SB 2IPUK 2E7HA 3B2MA 1ZCRA 2QTVA 4ZDHA 3F83A 4QRRE 2XBDA 5E2WH 2Z35A 3EO0A 2LW3A 4X9IA 5D7IE 5BQ7A 2IAND 1LO5B 3N43B 4PGCB 5EBMB 1Q8MA 4XPAH 1IVLA 3X3FL 1U2CA 2RTTA 1ZE3H 3O4LD 3ES6A 3PP4L 3BUYB 4X6EB 4WWOA 5F9JB 2NXYC 1H6EA 3L2MA 3U30C 3V5HA 4QYAA 5FCUH 4AK2A 3MJWA 2JLPA 2NY7H 4JRWA 5AVVB 3KL5A 1VPOL 2BIMA 2OR9L 4LCCB 5IJKA 4X6CF 1R3KA 3LKPB 4HHAA 3F7YB 1YEFL 1X5YA 1BVKA 5E8NA 4DAGL 3RWIA 3ARGA 4IKKA 4F9PA 3LMJH 4Y0GA 3ATDA 2DQCL 1UZGA 2ZXQA 3MRDA 3TBWB 3VWKC 4FLHA 4DPCX 5CZKA 5J13C 4G9FE 4QRTA 1VLXA 2DQUH 1IAIL 2DD8L 3ZZSA 1ILUA 5ICXA 3PFUA 5DJZB 4TQ8A 3BXNA 1RP9A 2Y1YA 3VWJA 4HK0B 2VSKB 4XAWH 5IVXE 4NFDA 1FDLL 2X53A 3NGBB 5C0GA 4OSUH 4P46C 4CC4A 1SYVA 3ZLQC 3V0EA 3S8WA 2DKSA 4PIRF 1O6SA 1RSFA 5AEAA 4Q9QL 4PJAE 3W9EA 4KH2A 1YDPA 4G42B 2BO0A 2YXVA 4HIIB 1EUTA 1O9VA 3N1GC 4M7JH 1OAQL 1JXFA 1M2OA 4QGYA 2E74C 2WQWA 3F2LA 1S9YB 3ZE1F 1AS8A 1WJ3A 4ZMLA 1N6VA 1TQBC 2BHFA 4PVNA 5CZVH 5D7LD 3UZEC 3S36H 1T5WB 1T22B 1COBA 2QQKH 4F1ZA 3L9YA 2EH8L 3FU6A 3VU2A 1DJGA 2AXGA 2H3XC 2CGRH 2JJTC 3F85A 5ILTL 3HI1B 4EDXB 2NYYC 3O41B 4Y2DC 1SFDA 4PRHA 1AC6A 1JZHA 2Y22A 3D85B 1UXLA 4LMQI 2XRAH 3WFBH 1C5DA 4AWJC 5ETUB 1GRWA 2QSCL 2Z7WA 4RFNB 3SPCA 4PP2A 1I7UB 4KJPD 4X6BB 4ACTA 3FTVA 3V0FA 1SJHB 5ALCH 1OCZB 3IVKB 3X1NA 1NGZB 3I9AA 2NQDA 2FO4B 1WBXA 3ETBJ 4IK7A 4M8UA 5JZ7C 4XBGA 1IAKB 3QCTL 5DC0A 3H9HB 4QWWC 2Q1EA 1CFMA 2HRPL 4I3GA 2EIZB 1N9PA 3QDMB 4Y4FA 4B6ZA 3BKYL 4KGLA 5K39B 1XGYL 1OTTC 5G55A 5C0IA 2AGJH 3MLRH 1C7TA 3VM5A 4YSPA 5MERB 4J3OF 1KGIA 2N7SA 4ZS6C 3QUML 1JV2A 3QP3A 2ZPKL 3ULSA 2L04A 4ZXBD 1NFDE 5IROC 3QXVA 3MV11 1BA9A 1ZDQA 4P59H 1CXIA 1NGXB 2R0ZH 3QDAA 1F11A 1C9SA 1QRKA 3DIDA 1DQLL 4C57C 1OF0A 2UZXB 4RRPG 4PY7B 3GKWL 4RRPA 3VDBA 2XWBA 4P5MB 1E8YA 1KCVL 3QHFL 2X42A 2DL2A 1I9RL 3BEWB 3O3AA 2FCBA 2FK9A 3CFUA 5D1ZA 1LNUA 1RUPH 3VJ6A 1KG0B 3LRSA 3HN3A 4OGAC 5KBPA 3S4SG 1FG2A 1JZIA 4LCIH 4AT6A 4O02H 2FH8A 3I6KB 2YK1L 1HH6B 1UJ3B 3S4SA 3D39D 2I60L 2ADJB 2PW1B 3KLQA 3COOA 5L2KB 4HHWA 4LLYB 1GAFH 1HESA 3FQUB 3IDNA 3GMPB 1RZ8A 3RWFA 1BVOA 3REWA 3SBWC 3VRJB 3P4NA 2WUBH 4ANXA 4KUZL 2I9LB 3SDCD 5B7FA 1QBML 3WEOA 4A66A 3FO1B 1A4JB 3T0ED 2DQEH 3UH8A 3K4DA 4F8NA 1OT2A 2GIYA 3IRZA 1ZGLA 4JM2A 3SKNA 1IGMH 4XMZA 1R5VA 5JR1H 2JLLA 3N85L 5EZLB 1AR1C 1M6OB 4PJ7E 4Y5YC 4AIXA 2XG4A 5DVMA 4XNUL 2PO6C 2ZF9A 4IRJD 3DARA 2JCCE 4MA1B 4NS0A 2G2RA 3OGCB 3K6OA 4ZSOA 1A5FH 2F6AA 4IRSA 1JPSH 2XTJC 3SHSA 3BE1L 2AJ3B 1J0IA 2E5EA 4CVWA 2GIXA 3H0TA 4NGHH 1D6VH 1JE6A 1L5GA 4R7VA 5ANHA 4JRXB 2O61A 1HKLL 2IG2H 2PXYC 3ZK0A 3CTTA 1QAWA 4PS4H 4PR5A 2QSQA 2QKIA 1S8DB 1EFXB 3QR2A 3PIQA 3CZNA 1MCHA 5J11C 1THAA 3H42L 5CIPA 3SJVB 3NQIA 3CMGA 2J56A 5DO8A 4JQVA 4XOEA 5FUCC 2ED7A 4OT1L 2NNAB 2WYIA 3NYKA 1BIIA 3ILPB 4R3SB 1YMME 5CGTA 1FL3B 2KYIA 2NSQA 2CIKA 3KH4A 4RIRB 2N4IA 5GSRB 3MLVH 1MUJA 2EXTA 4Z7NE 3VFVB 4MB5A 1CLZL 2JB5L 4GW4B 5FDWB 4XCCH 5DUML 1AZCA 2QDVA 2QJDA 3KM2A 4N85A 4PRNA 4JVUA 5FUOL 4HW6A 3TIDB 5ES4B 1HJBC 3C60D 1E5AA 3UCRA 3W9DA 2J5WA 4Y7OC 3FTYA 5CILH 5JOFB 2AKRA 1GVIA 3CFJA 5EBGA 4L3EA 4GBXB 2E56A 5F9WB 2JJSA 1JGLL 1L0YA 2J88H 2VDLH 5JPMB 3RP1A 4FQCH 2XV2A 5IR1A 1MQKL 1BDYA 1MDTA 4NI3A 2IC2A 1CD0A 3T5WA 3JWOL 5IJBC 2YSSB 1JNHA 4WEEA 4WW2F 4OF6A 4HWEH 4KROC 2IAMA 4WDIB 2P5EB 2QQLL 2PCFB 2DLHA 2R9HD 4F8LA 4Q9RL 1ZT1B 3QFJB 3TJEH 4HFUL 1KPVA 5E03A 5IZ7A 1AQDB 3MLXL 4R8WL 3QO1A 5C0BE 5D8JH 3RGVD 5HYEA 2OMUB 4GW5A 2R69A 4AM0Q 3NZSA 3CHOA 2D8KA 1RJLA 3JV5A 1VACA 5BMFL 4TRPH 4TSBH 5I1HH 1IM9B 2FAUA 4Z76B 3ZGHA 2D2OA 4JFFD 2DWDA 2E7DA 3T4AC 3ESPA 3F6IA 3K5SA 5GISH 1K9TA 3DX3A 4RNRA 1HT6A 3RTQB 2X4NA 2SODB 4LSDA 2W65A 5ECGA 4AEIL 3I6SA 4M8VA 3PNWB 2DWYA 3CWGA 2WLLB 5HYJB 2NNRA 4LFHD 5CEXB 2BP5M 1G0DA 3BGFB 4XC1H 1ZV5A 3JBG7 2X2HA 4U1MB 4BH8A 2HFGH 4RGMC 4WTZG 5H2BB 3EOBB 2JELH 5JYLA 2BCMA 2H8PA 3EDJA 3LKNB 2YXMA 3DSNB 5D7IF 4MDJB 1A66A 4N5ED 2WZPA 2CCLA 4CSPA 2VXQA 35C8L 5KTEH 4YC2B 1V7MH 1NTDA 3LKOB 5F96L 4R0LB 3C6SB 2ZXWB 1SN2A 4XP6H 5E5LA 2VMJA 3L5WA 1ZSHA 1ROWA 4MVBC 3VG9B 2CHWA 1BAWA 3L3KA 2VLJE 3V6OC 3ZSTA 5I1CH 1BECA 1MCSA 5BZDB 3PGDA 1LVEA 1CG9B 1AGCA 2PYFB 2ZUQC 4PG9B 1Q4NX 1SUHA 2YPVA 3VD9A 4MNGA 5HP5A 5F0PB 4Z18A 5B7EA 3B2UD 3BH8A 1WZ1H 4WFED 3UTPD 3UTSD 1FFPB 4L9LC 2FT8A 2BCKA 1AMXA 4WO4D 2X6AA 1HYSC 4P3CH 1H3GA 4AXWB 1OE2A 2EINB 4NRXB 4HG4K 4DP7X 1H8LA 4N3TA 5IVXF 2A2QT 4LSRH 4NWUH 3BN9D 1MPAH 3OXRB 3C8KA 1CDUA 4UUJB 4K3HA 2GT9B 3G6JE 3NT0A 4IMKC 1TZAA 3S3JA 4FQLH 5FM5O 5EWIH 4EN3B 4PJAF 1CLOH 3FSWA 1RU9L 1PMYA 4MSWA 3V6ZB 3TEUA 3BH4A 4BYHA 3M7FB 3R8BB 2FEJA 4XN2A 4BSWB 5INDB 5SWSE 2QDWA 5I8EA 4ZPTB 5DMKA 3FN9A 1FZJB 3OB0K 1A9EB 1L9NA 4JO8A 3L2LA 1T4WA 1MLBB 2K1MA 2WD0A 1IBYA 4XZ4A 4BK8A 1HTYA 2OL3H 3T0DA 3L6FB 1JXGA 1NINA 8CGTA 3MQIA 5AW3B 1OTSC 2RIKA 4PVMA 3NJIA 3LRMA 2OXHA 4NUJA 4XO5A 1ZLDA 4XPBH 2DYPD 4ANUA 1LO3H 1P7BA 2R51A 1QBLH 3KM1A 3KPNA 1K5NB 4YXLL 1BAFL 3PDOB 1ZAGA 2HKFH 4W9JC 3JV6B 1EDHA 2DQ6A 4KMTH 5G4MA 4RISL 1DQQB 7PAZA 1C5BH 2JXMB 5DC4B 5IQ9B 1X5XA 5I82A 1OP5H 5C0BA 3RNKB 5DR5L 3ULUD 6PAZA 1A6TB 2CE6A 5K1JA 2E8YA 1MJJA 2CJ3A 4NHUA 3GO1H 1GPOH 2D31A 2XKUA 4NN7C 1CE6A 3KXFB 2W0PA 2ZYRA 1FNSL 3PXLA 1ILSA 1PY9A 2JIXD 3WELA 1CDBA 3HRZC 3WEAA 1E5YA 5CCGE 1FC2D 4G9DB 3IAPA 1ZHNA 3NCWA 4BQ8A 1NFDF 2CK0L 1HDMB 3JQOB 2W8CA 3VFUA 2NZ1A 3OKLA 1HHGA 2GHWB 5I5MA 3ARWA 3N40F 3DV6B 4Y5XC 2E4TA 3MRGB 4JDTH 2BS9A 4OCSL 2LE9A 3M1BA 2FWOB 1S7TA 1AOHA 2DQGL 4GXFA 4UQ3B 3MA9L 4GKZB 1JWMB 2H41A 5FGCB 5FECA 4UIMB 1JZ5A 4EOWL 4HQQH 2XXGA 2OXGA 1T1XA 1S7XB 4YO0A 1QR4A 2FLRT 1YEKL 2NTFB 2P46B 2ZF8A 5T1KB 3HG1D 3NIDB 4GRLB 1GZHC 1I1FB 3FQTA 3X3FH 1ID5I 1YEGL 4FQXC 1UD6A 3L1EA 2QFPA 3O8XB 1R3JB 1RZJL 1BVNT 3P9LB 1ZHKA 3PP4H 4N90E 4XMVA 1O5PA 3RZCA 4MGXA 5KBLA 1AC0A 2XN2A 5A6MA 1ROCA 2VMEA 1A7OL 1D5RA 5DRXB 1MW0A 3MC0A 1XBDA 2WCGA 5TGBA 1FYTB 4JY6A 1VPOH 2OR9H 5CGBA 2A4ZA 5A7BA 3MUZ1 3N50A 3RJDA 4ATTA 5F7DA 1FNLA 3VW3L 2VXUL 3QXUA 1YNTA 4ZMYA 1YEFH 5GS0C 1BXVA 2C3VB 2OMYB 4DAGH 3HR5B 3K8MA 1E9QA 4PJ7F 5KANI 3SDAD 1FLRL 1FFNB 2FECL 5E6IB 2JCCF 1YEWA 2DD8H 4U6XB 4RDBA 2FX8L 5IM7A 4GKSA 2F68X 2CRIA 1P2CB 4P2RB 4TMPA 4Y16D 5EC2A 3DYOA 5D1QD 3L4ZA 5EH1A 2Q7YB 5DHMC 2CUAA 3W0WD 1FDLH 1A64A 2FTAA 5J06A 4ENEC 4AGNA 3FFDB 4AV5A 2M1KA 3B2XA 1BQHB 1S9XA 2C7UA 1BJ1J 3GSNL 3LHPL 3M45A 4FQ2L 1O7VA 2C9PA 4Q9QH 3DGGB 2AW2A 4EI6B 1G7LA 4JN1L 5JQHC 3U6RA 1SJMA 1PDKB 4FCHA 4RESB 1EXHA 1OAQH 1J0ZA 2UY7B 4IHOB 1E28A 3IF1B 1CS6A 2FEDC 2WM0A 2Q76A 3OR7B 1JVLA 1Y1UA 3C09B 2WVVB 3BAIA 2N1TE 4EZJA 3UAEA 4Z7NF 1IQDA 3GLDA 4MJ5B 1FZOB 4P23B 2H5UA 4XPFL 3UTTA 2Z4QA 4WUUB 4JHBA 3VGGA 2NX5E 1DQML 4JVWA 4P04A 5GRVK 5IMMB 5ILTH 4NDMB 2EC8A 4OLXL 1GYVA 1AKJA 3X14A 2ADGA 4K7PL 4PVLA 2HT4D 4HC1L 1S78C 1UH2A 3NCEB 1ZLSL 3KCPA 3KS0H 4PJFE 1PF3A 2QSCH 3QQXA 4CBPA 1X5IA 1JWSA 2D9CA 1WS8A 5E9DE 5KG9B 1SHXA 2VLRA 3OWRA 1G0XA 4TTDC 1WCQA 4RSYA 3QB7C 3FQ4A 2Q0ZX 4P4KA 3QG6B 4X5RA 5EOTB 3R06B 3CFDA 3T3PE 4JRYD 3N04A 3QCTH 1L9QA 1AXSA 3FFCD 4JZNA 5FEBA 1KXQA 3P2BA 1BVKB 4GP4B 2HRPH 3D6GA 3X1FA 2DJMA 4APQA 5JHLL 3BKYH 3T0WA 1XGYH 4K7PX 4QD2E 3DYPA 3GBDA 2F18A 3IAQA 1DLFH 2ZPKH 1JTTA 2C5DC 4FNSA 2H3KA 4BWUA 5GGSA 4DPRA 2BRRH 4ODHL 2ZG2A 4TPRL 1U8PA 5FB8A 2XIDA 1XHHA 1K8IB 2FNBA 2ZWKA 4YSUA 3F64A 1U8QA 1B4RA 1DJYA 2P24A 4GKNA 3GKWH 4X6DA 3WYRA 4F93B 1U3HD 5FAAA 5C0RL 4R96B 3TYFB 4FQQA 3ARTA 1KCVH 5HDOA 3NPSB 3NCMA 3QHFH 2W07A 4ZX4A 1I9RH 1QEXA 3L4YA 4NM8H 1HZLA 1PZSA 5MHSE 3AB0B 4E9XA 4O02A 32C2B 4Z7QB 4GKLA 1CGVA 2BDNH 4HUWA 5BRZA 3BP6B 5EPMB 3NSFA 3TJHD 4PRDA 1X5GA 2I60H 3CFEA 1IILE 1KB5L 4JQXA 4WKXA 4MQSB 1T4KA 5SX4H 1JJUA 4C56B 3NH7L 4M02A 3RKPA 2AABH 4I2XB 2UXVA 4KUZH 5J6HA 4KK5D 5KSVA 1QBMH 4OZIB 2QKSA 4H2AA 1YY8B 3MR9A 4X99B 8FABA 1AGFB 5DCCA 2OSLB 4LCCC 4U6YB 2HX7A 2ZCLL 4F2ME 1FNEA 3LNGA 3UEQA 1G1KA 3ILQC 5FFGA 1MCRA 3F3HA 3N85H 4PRIB 1JYNA 4AEHH 4L4VE 4WIQA 1YA5A 1LLAA 3A21A 1KY6A 1XCQA 3VRIA 2XN9B 2BP8B 2J4WL 2WXJA 3ARFB 4XNUH 1T0OA 3LPPA 1PZ5A 5IB3A 3II1A 1NANI 1G84A 3MX0A 2A99A 4X5XA 4URKA 4RH4A 4GW1B 5L4JA 5CKAA 2A73A 3SEPA 3UG3A 4KV5E 4LSVL 3BE1H 3W39A 4HDIB 1AZRA 2WXIA 2YAQA 3BIKA 3MRHA 4JFED 4UT9L 1JZ2A 5KWYC 1HKLH 4YQXL 4XHQA 2OZ4A 3MV7E 1GC1C 3IM1A 4PP1D 2VXSH 4ZTOL 2GFBA 4AQ1A 5IW3A 2D2CC 2KLTA 1UH4A 3OJDB 3A47A 2ICEB 2B77A 3MPCA 4OT1H 4TQPA 1Y6NR 3TVMA 1YYLL 4C59B 3MREB 1SOXA 1N7ML 3MRIA 5IF0A 1QSFD 3CCHB 4JJ5B 3VJ6B 5I0DA 2EYRB 1MVFA 3P4OA 3QRLA 4J8QA 1DSWA 2X2UA 3ABZA 3VXUD 2JB5H 2YD8A 3HZ3A 2GJ6E 4N87A 5A6LA 3GTTA 1L9OA 4WFFD 1FFOB 4H1LH 4R97B 5FUOH 2VW6A 4PJFA 4X4XB 1KTKE 5IIEB 4KKCD 1I3RA 1D5XA 4YLBA 3OHXB 4IS6A 5D1XB 1RZ8B 5E9DA 4QNPE 4W6XB 2WO3B 4P2OA 4UMGA 1JGUL 4S2SA 2KT6A 1MW1A 4PWJA 1B0RA 3TO4D 5CD5C 3LD8B 1QRNB 3AUVA 1JGLH 3TN0A 4TUOA 1S3KL 3SGDH 4JGNA 1MQKH 4K94L 1PKOA 1PY0A 2VZVA 4NCDA 3G08B 1ZRUA 3JWOH 4YUEL 2OYPA 3CXFA 1WITA 2QQLH 3B9EA 3UBGA 4Q9RH 2L8AA 3EYFA 5JUEH 5HY9B 3FW6A 1T83A 2BNUB 3MLXH 3HR6A 2EDHA 3ATBA 3ARUA 1HXYB 4PV1C 3T6WA 4UV4H 4POYA 2HJKB 1HH9B 1J5IA 4MNQD 3G5YA 5BMFH 1SN0A 5D7KD 1KTLA 5H4YA 1MY5A 2P5WD 1OHQA 5HXMA 4QR7A 3FCSA 4RAUA 5DWPA 1QLEB 2CJTA 3K0WA 4EI5B 1KLGA 3EJSA 4HGWA 1KTRL 3MGOA 2DTSA 4HKBA 4AEIH 1UATA 4YZWA 4UQCA 3L9BA 4E41B 1Q9KB 2ITDA 2GSGA 4LVNB 1MVUB 5FA3A 4DZ8A 1BQKA 4FJ6A 4ZAKB 2GG1A 5F1SA 1RXLA 5DGQA 4JZJC 5I19L 5B22A 3DO7A 2B59A 4G70B 2P8MA 1UJ3C 1TQSA 3TH4T 4XNZC 4E5XG 4BHUI 1JPGA 5LJYH 1NC2D 4H5SB 3VFRB 4E5XA 2GITB 2E47A 5LAXA 5CCJA 4ELDA 4ZUTA 1PG7W 2WXHA 5K69A 3LZFL 5FLUA 1OD9A 1NCDL 3UC0L 5E1HB 1URIA 1V3JA 2HVJB 4AZ8A 5CGYD 4HUKB 2XTJE 4TNWF 2R0KL 3H9SD 3UGXA 4ZYKB 3RDTB 3MV8A 4J4PC 4KH9A 1LEKB 2FHFA 1WFOA 5INCB 4EIBA 4OZGE 3MRPA 3PWJB 4HUUB 2HG5A 5C08D 1SJEA 2WLHA 3RPBA 3AROA 4G43B 1Z9MA 3FAWA 4V11A 3VXSB 4AGQA 5MEND 1Y6MR 4C8XA 3U7YL 1HSBA 3GHBL 2FT6A 2EVJA 5EIIG 4WWKB 4KKAD 5E00A 4Y19D 2X9ZA 4DKAA 3KVQA 1AP2A 1RZFL 3CMOL 4HXAL 2WSDA 3APCA 4JFSA 1OAKL 1W72B 4LOUC 2EC9U 1XH1A 4Q2ZB 4WV1A 5J6GB 1MCBA 3LV3B 2GBTA 3QIBB 4BJLA 1MCPL 1S9VA 2Y0SA 4V1DA 1AI1L 1BEYH 4FFVD 3TFBA 1RU9H 5FLVA 5BVPL 3HZYA 1AQKL 2DEWX 5GZNA 4YR6A 2KUTA 3FQXA 3DMMA 4EDWL 2F7QA 4G8AC 3DIFA 3O4LB 4KFZC 3IETA 3UAJD 3LXAA 1BPVA 5E8PB 5IVOA 2XTSA 4GUPB 4J2XA 2F74A 1E4JA 1KFGA 5E6RB 4FN0A 3NUKA 2W60A 3CBRA 5GGRA 1J1OL 1OB1B 2V0AA 1AO7B 4FFYL 3SDDA 3ULVC 5IVZB 4OLYH 3BGAA 5EDSA 2VLME 2DWXA 2NY3B 1ETZB 2K70A 5KVDE 1KXHA 5FPIA 3TBSA 1HL5A 1U92B 2E8ZA 2XA3A 5KOVC 3QIUB 4HH9A 4PJIB 4J1UA 4KUCF 4U05A 1G5AA 4N0RA 3RFZA 2VLKD 4O5LH 4PJFF 1K8DA 4DEPC 4B7LA 4YXLH 1QX1A 1BAFH 1YN7B 2ZYHA 3RDJA 3KWXA 1JZ8A 4JFPB 1MI5D 4JREB 3F6JA 1VEOA 4RISH 4NKQB 3TS8A 2EO1A 2G3MA 1KXVA 1MOEA 3T3PF 2OSXA 2YPLD 4RQQB 4Z3GA 5DR5H 3WNOA 3DRTA 1X7SA 3MV9E 4MAZA 3ZL4L 2ZOWA 1TJGL 1JNNL 5ITFB 1QBBA 2VITB 4FXKB 4RCAA 2UZIL 4ZT1A 4AUUA 1FNSH 2H9GB 2BCKB 3CX5J 1J0HA 1I7TB 1S9KC 4YDVB 5JHDA 3FOLA 4PG2C 2ISDA 2CK0H 2HMID 2IIJA 4PM1A 4L0YA 4Z7UA 3V0WH 4X4ZA 3Q06A 1NBYA 2YD3A 4R2GD 4WFGD 4HFWB 2Y6TE 3GIZL 4CMMA 5L0QB 3JYCA 4PQXA 5HGGS 2DQGH 4HCRL 5IJVA 2LTQC 3MA9H 4NQDA 3RVWD 4OZHE 4AYSA 1CFSA 3QQ4A 4IM8A 4LE8A 1TTFA 3DURA 2Y7QB 4TNGA 4EOWH 4OIFA 4K3DL 1EJFA 3LH9A 2C9AA 2V9RA 3CXHJ 1SDAB 3DJSA 1VZGA 5BUGA 4JKLA 5IFJB 3QQ9D 5GGVY 5AENA 1YEKH 1T2XA 2A74B 3LN4B 4WQOA 3U0PA 4ICXA 2DQIH 5E6UB 1NC4A 1FNGA 3Q2NA 4PJEB 2BFGA 2DH2A 5A16A 2NY1C 3KJ6L 1YEGH 4YC2C 2Q10A 3B7UX 2B5IB 3MLYL 1CVRA 1RZJH 4N9GB 1U8NB 4LSSL 5M94B 3IB4A 2YD1A 4ZFZB 5BO0D 4Y4KA 1U9KA 1HS6A 2LFGA 2D7PA 2WBXA 3WBDA 3B2VL 1RD6A 1E4KC 1A7OH 3VG9C 4UILL 3RJQB 3ZDYE 2J6EH 3NSXA 3NSDA 3PJSA 1VERA 2VSMB 3OQ3B 3SKMA 3P9WB 2HUEA 3WFCH 1IGFL 3DBSA 3U4BH 3VW3H 2VXUH 2BMKB 2WOYA 3C5SA 3EO9L 4FULA 4NQEA 5KS9E 4GMTL 3SQBA 4D9QD 1EXGA 4IOFC 1AANA 4PGEB 1FLRH 1A9BA 2DN7A 1M2VB 2PPEA 3MMEB 4Z7VE 1ZLUK 2DQTL 2QQQA 1OTUD 1HN1A 1ZHLB 1WA1X 3I3EA 4H8WL 4LEBA 1CE6B 4IIQB 2FX8H 1YO4A 3FHEA 2DBLL 3HBQA 2AERT 5AUMB 3VU1A 1EBPA 1KELL 3ARGD 4X7DC 3D33A 3T71A 4KV5F 3L5HA 3QDHA 4L4TE 3FRPG 4WLCA 5SWZA 3BZ4B 3FRPA 4FNLH 1DUZB 4FQ2H 5D4IA 1QABA 2Z7UA 3GSNH 3LHPH 4EN3C 1HJCA 1QO3B 5E95B 4XP5L 2MOVA 2EE0A 1RURL 1OD7A 2WAQA 3UZVB 3VWJD 3I6LE 3FO2A 4F58L 1RLWA 4LQ1A 2PR4L 3K0YA 1TTRA 4JN1H 3ARSA 2Z0BA 2C3XA 2F54E 1YY9C 1JHLL 2LU3A 4NO3B 3QJFB 3QRFM 4YDLB 1LEGA 2WXRA 2TRHA 5I9QB 3SDCB 3G6DL 1G7JA 1CTNA 2VMCA 4XPFH 1F86A 1D5IL 2YC1A 1DQMH 2BNQA 1J0YA 4OLXH 3PL6B 5C07E 5MEOA 4NERA 1W9XA 1QFWM 2DM7A 2XI9A 4OF7A 3EOAA 4QNPF 4J6IA 4YZFE 3RVVD 4RDQF 2NSMA 4KHXH 1ZLSH 2X9YA 3FO0L 2QPDB 1P6AB 4N6QA 5AVTB 5KVFE 5J12B 2YPKA 5C0FB 2X4SB 5L8LB 3HVDA 2D7QA 2DB8A 5JPNB 1F4WH 2CM5A 1JIBA 4PRHD 4ZMAT 3EO1A 2AJSL 1CXEA 4X5WA 2V2TB 2PLTA 3PHQB 5FW6A 5ANMB 3J8F7 4FXGB 1IKFL 2AV1B 2LT9A 2IOIA 4U6HA 1SXCA 3D3VB 2X12A 4IBZA 3FO9A 3BWUC 4GH7B 4ADGA 1KGWA 3O3DB 3QJQB 3L3OA 4W6WB 5CN3A 4G6AD 2XQYG 3HAEH 2ZYSA 4WW1A 4X4ME 3WFHB 3TBYA 4HWNA 2PYEA 4QYOB 3SOTA 4ODHH 4TPRH 4F9LA 4Y4FD 5T33L 1J8KA 1Y18A 2AQTA 5EU3B 4NUGL 2G0KA 5M95B 1VEMA 2ZCHL 2PP7A 4XR8C 4N4YB 3MFFA 4XODA 5C0RH 4DT2A 5DC2A 4AIEA 4D0DB 3U6RB 4OJAA 4G6KL 2J2ZA 2NNFA 2W0KA 4QT5A 4UDTB 1PG7L 5DRWB 2FT7A 2JWYA 1WO2A 1HIML 3IYLW 4ZX6A 3CVHH 4HS8H 3JV4A 3L2NA 1UUSA 2BOLA 1KB5H 1ZSDB 5JNYA 3O8XC 4MXWH 1IC0A 2F58L 5D1ZD 1XH3A 2XKSA 4IGBB 2MQGA 3X11A 4GG8A 1CICC 2E9IA 5DFTA 5DRZA 3T8MA 4OKVB 3P0GB 3OZ9H 3FT9A 4D0BB 2OX5B 1EEZA 2KC0A 4K0OA 4NKIL 5C0CB 1I8MB 5EF1A 4WENB 5A7EA 2IPTL 3MRLB 2VRAA 1FAKT 2ZCLH 1HHJA 3CHPA 3R19A 2A6IA 2YAOA 3IEAA 3LHAA 2NR6C 4XMKL 1INQA 3V9EA 2VDPL 2Y3AA 5FK9B 5FR3A 3UBXI 3DXAB 4DP0X 2E9WA 3QI9B 4MD5A 1J8HB 5FYKE 5L4MA 4OZGF 4F7TB 3QUHA 4U6TA 3VFPB 2PUQT 2NCMA 4AKQA 4N2KA 1WDAA 2N0KA 1JGDB 5E6IC 2J4WH 4WNJA 4JM2D 5DS8A 4RWHA 3LEYH 4NT6A 5DURD 3OJ2C 3DJZA 3VTTA 3ZY7A 4F8TA 4NQQA 4KJYB 4HKJA 1A22B 1XR9B 4TUKH 3EUUA 1A4KA 1FCGA 1KBGL 3HHSA 4V2CB 2BOBA 4P3WA 1AQ8A 3SY0A 2BXZA 4LSVH 4UT9H 3V7MA 3MUGA 1H3XA 1QWUA 2R1YA 2Z6FA 4YQXH 5E8OA 2J8UE 2CXKA 1Q9LB 2F54A 3FT2A 4DJMA 3HJ0A 5GGUA 1ACZA 1FZKB 1V8HA 4ZTOH 4U7KA 3HKFA 4IRSD 1MEXL 1TFHA 4FKEA 4P4RA 3ARXA 1NLBL 3TCXA 2JSFA 3B9KA 4B53A 1NIFA 1XIWB 5EUOE 4H1LG 4P5RA 4BFOA 1N7MH 1DUYB 4YSAA 4N28A 4PJ8B 4P23C 4AZUA 1IBHA 1CMOA 2R15A 4M1DL 3QDJA 4NP9A 1DQIA 4JE4B 4AQEB 3DBXB 3NFPB 2V3FA 4UB0L 3TEXA 1OM9A 1IKNA 3WO3B 2QADD 1TYRA 4UDUA 3RX8A 1JGUH 2JJVA 4MZIA 3HCVA 4IEFB 2K4WA 4P49A 5F1IA 2O6FA 4HKZB 1W0WA 3F5WB 4A55A 1VADB 1S3KH 4NUPA 3GMRB 4K94H 1FRGH 2CIIB 4DETA 1UB5A 4YUEH 2JKRM 2YD4A 2CO1A 3UJIH 4L3ED 4PJ5B 1RZKC 2AEQL 2C1PA 3T0AA 3JSSA 1IAII 1V7NL 4UBDD 5HHOA 1MLCB 4JPSA 3CSYB 5C6TL 2BSRB 5E23A 5DVLA 1RL1A 3KLHD 2WKGA 3RWEB 4WJ5A 4WSGA 4ZO9A 2IAMD 5IV2B 4JQIA 1J9QA 3ZQXA 3BQUC 4KK9D 1XGUB 3M17B 5HJDA 1UXWB 1ZK9A 3MBEA 1RUQL 1U8JA 2AJVL 1NFAA 2QGCA 4HMEA 4JANA 2AJZA 5CJBA 1FV1B 5C3LD 1MWAL 1D5ZB 1Q94B 3ECQA 3IDXL 3P73B 4JHAL 2XPZA 2VCOA 4MRBA 4UNIA 5LXGL 1CIUA 1JPTL 2MMXA 3QJHB 3PUCA 4KXZH 2JB6A 2HT2C 5HDWA 1OM3L 3S37H 3T3ME 4OZHF 3EFFB 3NPSC 4W1TA 2EEFA 3IDMA 1RJZA 5D2NA 2Y06L 5B7MA 3AB0C 2MKLC 2I27N 5TDPB 4OQ1A 1LMIA 1MCQA 2XDHA 3S7GA 5I19H 2G3NA 4UZSA 4XC3L 4G82A 2WB1A 3EFDL 3SPVB 1G7IA 5AAMA 4PREB 3T65A 4JFXA 1DBML 2WMPB 4EO5A 3RL2A 5CZXD 4UOZA 1KCWA 5EU7E 4B9YA 1NSNL 1O9ZA 3L7FB 2CNZA 2G5BA 3P02A 1EDQA 4UTCA 3LZFH 5AYTA 5I66A 2VDLB 1NOAA 1NCDH 4M5ZH 3SE4C 3ZDYF 2ALWA 3MJ9A 4H7VA 3QPXL 1CE1L 3IFOA 2WZPD 4HVBA 4YGVB 2N3JA 2P7TA 2R0KH 3PV6A 4KK6C 4NZDA 3ABLB 3I84A 3S6CA 3ZN6A 5FV1L 1I1AA 3P4LA 3QC5X 1OP3K 4LSQL 3VGEA 4DFHA 5KS9F 3S3DB 2ICWI 3FN0L 3IDGA 1YZZA 2AK4E 3ARFC 2NYZA 5D9SB 1BVLB 2EKSB 2IBZX 4NHCL 5F71A 3WJLC 5DUPL 2XKNA 1CFVL 3HE7B 3U7YH 3GHBH 2J8UA 4WCYL 4L8CB 1ID2A 4R9HA 3WNIA 3VXME 4QHMB 4M3HA 1DANU 3O45B 4HXAH 1RZFH 3CMOH 1OAKH 3AITA 3ZQ9A 1MHCA 1MIEL 3HE6A 4QHLA 1KZQA 2XPYA 1AI1H 1R34A 2YAEA 4FD0A 4OTXL 1NEUA 5BVPH 1MHEA 3TA4D 3WNNA 1AQKH 2ICEC 4ZFQA 5I1IL 1WT5C 1CGTA 4HCIA 4Y1AE 5EDXA 4ZZKA 1T66C 4L0PB 4EDWH 2GSGB 1P7QA 1NAML 2BNRB 2V3DA 2Y2TA 3L3JA 3QG7H 4N6RA 4UAHA 1YAIA 3FCTA 5E4IA 5KVDL 1ZVSB 5LGJA 2C4FT 1J1OH 3N44B 1TSHA 4FFYH 4PBVC 3ETSA 3OZKA 4R97C 3SCMB 3WIHL 2OI9B 5KN5A 4H8PA 4FGMA 1IBFA 4G7YL 3U46B 1G9HA 4L8DB 1G9MC 5D1XC 3OHXC 2VR3A 4WKZB 1JK8B 5IQNA 1UA7A 3ME0B 4DEWA 1A21A 4YZFF 3DOSA 2W0FA 4JGJA 4JKWA 5K9QG 1TEFA 3V6FA 3MLPA 3LD8C 4XNYL 4XX5A 2C9SA 5DD1L 5DFWH 5EOCH 1QASA 4AC4A 3Q01A 3V2AR 1OY3B 2R29H 1QSEE 5IEHA 2P42B 3WIFA 5I6NA 1T89C 2X4TA 1X9LA 4CJ0A 5ACZB 1U3YA 4JPVL 4GG6E 1TJGH 1JNNH 3DPBA 4KTEH 3BDXA 4AMKL 1NCGA 1I8IA 1CUOA 3DGDA 2UZIH 1ZTXL 5AVUB 3SOBL 3W11D 3A3YB 1GOFA 1QATA 2BY1A 1P4IH 2Y7LA 4XXCC 3RVUC 4B3EA 5C0BD 5BXFB 4JJHA 4H13C 4XH2A 3VAEA 1ZVHA 1EHXA 5A2CA 3S98A 2Y2YA 5ALBL 4BDVA 1AD0A 2IMMA 2NCEA 1ZD6A 2ESVE 2WYHA 5EIIB 5T3ZD 5ID0A 4EI5C 3OKYA 4JE0A 1E4XI 1F4YL 1EAJA 4ZJ9A 4LCUA 3V8OA 5H35A 4RLDA 3OXSA 4HCRH 2QGDA 4LP4A 4HIHB 4PV8B 5CP7B 5L9DL 4K55A 5E70A 5FO8A 3Q3GB 1I4FB 1T21B 2IFFL 4ZAKC 3ECWA 4K3DH 4LBEA 4M61B 4DIXA 1SEBB 3BKJH 5D2LB 4ZD3L 3WL9B 4EBQL 1GR7A 3ZO9A 2I26N 4QRUA 2ZUUA 4M6OL 5DHXB 1E2WA 2OL3B 3BWSA 3LJ3A 3PU7A 1SHWA 5KBDA 1EZLA 3MGTB 1RJYA 2CDGB 4JFYA 4KXDA 4A39A 4CU8A 4Z7OE 1RAMA 1R3LA 3KJ6H 3ZZQA 1KLFB 5ABAA 5JIDA 4BGLA 3E6HB 1UHVA 2ENYA 2J6EA 4LSSH 3WN6A 3D69B 1ACYL 2EXSA 5LG6A 4GI9A 3B2VH 3P0YL 2P3YA 4UILH 4JHWH 2GB2A 5DJCA 3PWPA 5F7FA 2XWTA 4XN5A 4H88L 3RDTC 2ATAA 4NQVB 1J05B 4U2YA 5T5NF 1IGFH 3TA3C 3RZCD 2I7SA 2ODIA 3PGCA 3CFMA 1I7RB 3EO9H 4U1KA 4GMTH 3UBXB 1QI3A 4MS8D 1F2XK 4PRPE 1IBDA 2BSSA 3N41B 4AY0A 1NCWL 5EOQL 1F1DA 5J7CC 2HPOA 4H8WH 3HS0A 5IEKA 2KDGA 4RAVA 2DBLH 3EYVA 4NZ8A 3EJZC 4ZW6A 4DKDC 3O3EA 4UF7C 5HHMD 3H4HA 3GSNA 1X5JA 3SZKC 5E1GA 1Z5LB 3CDCA 2PWDA 4PLKD 3SE9L 4ELKA 3QIBC 4X83A 2J8UF 1JXDA 3MJ8A 3FQWA 4QOKB 5IMKB 3HS8A 4KOBA 4MLIA 4XP5H 1RURH 4J8RA 3E80A 5B1BB 3VI4A 4F58H 4RX4A 4LPTA 2ZIDA 3BPCB 4NKMB 1AXTL 2HJFA 4DK5A 4E9RA 1NCIA 1A6VH 4X8XA 2AQQA 1KIPA 5EUOF 3BHBB 5JMRA 4HLJA 4JFDA 4OB5L 3Q05A 3ZYOA 4NLHA 2VISA 2FH6A 4NOBA 1N5YL 2F7PA 5B1JA 2YUVA 3ABGA 4D7PA 1T3FA 1VF5C 1IM3A 5DRNA 2MOGA 2NLJB 3KPRE 4RFOL 4ZPVA 4U1NB 1HXMB 3ML9A 3AM8A 2BVPB 3QIUC 1M9SA 2V2XB 2X9XA 2Z93B 3CC5B 4LSPL 3HIZA 2BSBA 3DX9A 4GRMA 2AHIA 1OGAE 2EEXA 2FNWA 5KVGE 3UTTD 4ZFGL 1VKXB 4KNTA 1NIEA 3WMQA 1WF5A 4JMXA 2IGLA 4F5CE 2G75B 3GNMH 5BZWB 5LBSA 4JREC 3IFLL 1WCBA 1SDDA 4D3CL 1AKJD 5C0EB 4NQSA 2OTPA 2EDBA 2AJSH 1RHHB 2IVFC 4D2NA 3ZKSD 4XNQA 4GRWB 3QA3B 1IKFH 3MO1A 3VUAA 3HAEG 4YHZL 4PTTA 4EIGB 1TTGA 1F2QA 2VLRD 2VUKA 3HAEA 2ZG3A 3EYOA 1BZQK 1MFUA 4PEEA 3L48A 1SF5A 1A8JH 1G7MB 1OE3A 4NNXA 2D7MA 3BP4A 4N0UB 2Q9OA 2VN5A 1NCBL 4RVBA 5IB4B 2GW5A 3Q5YA 2XY1A 2VJXA 2GTWB 3MROB 2FL5A 2LAGB 2MQ0A 2QR0B 2DZEA 4CW1B 1Z9OA 3NIGE 4J39A 3H56A 4APQD 5T33H 1QFOA 2X0UA 3BVNA 3GIVA 5L0QC 4TNVF 5J5EA 2OJ1A 4U1IA 1MG3C 2WNGA 1OL0A 1XFPA 2X6UA 3T3MF 1TZHA 1OPOA 2V17L 3RI5F 3O11A 1FFQA 5EZPA 3W5NA 3BP5A 1I1RA 1TU2B 4G6KH 5DYOA 5GS0L 1LQSR 1MAML 5I1KL 3CVHA 3E9UA 2ZKHL 1PG7H 3PWVB 4MHHG 3RWHA 3VX1A 5IB1B 1XV8A 2FWSA 4JJOA 2NW3B 5ECJE 1AHWC 1H5BA 1HIMH 1PAZA 1G7JB 2ERJB 2A74C 5KZCD 2ATPA 2RFXB 5JW4N 4H26A 5GIRA 2L7QA 2B5IC 2F58H 2G60L 5ERWB 3GSQA 4P2YA 4NQCE 5DZLA 4A2EA 1E7VA 4K3JH 1W2KT 4K5PA 5BRZD 1Y6KR 5TJWK 4LP8A 2WVUA 1E27B 2NZ9D 5CBEA 2YBRA 4KX9A 4UTAL 4DP6X 7PCYA 3ZT5A 1N0LA 5JLZA 2O5XL 3LEXB 2R1WA 2IPTH 3RWJA 3A4FA 5C0AA 4S1SL 4OH2A 3P4MB 4XMKH 3C8HA 4OCXL 4ZXBC 2VDPH 5CKGA 5DTFB 4WEMB 2YSTA 2BSCA 2DQMA 2CHNA 2ZAHA 3BWAA 3CZJA 3O9WB 4JDVB 2ICWB 4W9EC 5AKVA 3RURA 2WLIB 4U6HB 4IIQC 4WF7A 4X50A 4X6FA 3QUMB 1YUHA 3C8DA 4IBYA 4DP2X 4ZFFA 1ZT7B 4UT9A 1CFNB 1KBGH 2Z31B 4G80A 5EC1A 1QLRB 4P3DA 5HGAA 3LIZH 5IW6B 3MLTA 2HFTA 15C8L 43C9A 2ZXAA 4JPIA 1VFOA 2VR9A 4G8EB 5TK2A 3K2UL 3HLAB 3JT2A 1CFBA 1H9VA 3SE6A 1J5CA 3QUZA 1I1CA 2O30A 3B1UA 5ISZB 1OT1A 4CC0A 3RKDC 3WV0A 2VQ1B 1MEXH 1EUUA 3BP7B 2CBQA 1HC1A 4QIRA 4ZFOA 2Y1VA 1NLBH 3PWNB 5CBAA 3FUHA 3V0JA 4YDLC 5A2LH 5I9QC 3QRGL 1ITBB 2BY3A 3SDCC 3HC2A 3IPBA 5HVHB 2WK2A 3VI4F 3H2PA 3EZJB 1RKRA 4KJWD 4M1DH 2E9GA 3RY6A 2E0PA 3HPLA 4CBZA 5K5YA 5C8JB 3TVMD 3PL6C 3I6GB 3EGSA 4KRMB 4UB0H 2MIZA 4YBQD 4X6CB 4GIOA 1A1NB 2EDQA 5DRZB 3EG9B 2P8PA 3EBGA 2CH8A 1E7UA 2WY3B 3CBJB 4IRJC 3VFMA 5GXBB 4J6RL 1WICA 4MQ7A 2J43A 3VXPA 3NFNB 5E9DD 4QRAA 4P2OD 4QO1A 4ISVA 4JY4A 4X0KB 4CVZB 4FXGC 1MCOL 1UCBL 5IB2B 1HHKB 1OXYA 3JZ7A 4A2HA 2VW7A 5KYUA 2AEQH 3DHPA 3V95A 1V7NH 4XPGL 3TN0D 1M1XA 4GG6F 4FTVE 4B9IA 3T6XA 5C6TH 3WHXB 3KPSA 4Y5VA 5EBWA 2X28A 2A6JB 1HCFX 5LLIC 3WFEL 1F97A 1KEML 4JFQB 1Y1DA 5I17B 2YEQA 1QI4A 4G8GA 1XAKA 2OBGA 2XNAB 3QUYB 3QORA 1RUQH 2AJVH 1GGBL 1MWAH 1IGYA 3A24A 3IDXH 1WIUA 1P4BL 3QWOB 4JHAH 3ZE1B 5E99H 4DOHE 4HUVB 3LKQA 1XWVA 4LLMB 5LXGH 4CVXA 5E08L 1IX2A 1JPTH 1CT8A 1OM3H 1M7UA 3WN5A 3C60C 3CDYA 1U6AL 5AD0A 2YMOA 3QHTC 4NO0B 3SGJC 5I75B 2Y06H 3KYNB 2A6DA 2BXYA 3LRGA 3V4VH 1Z32X 3GSVA 1I8KB 3THML 4XC3H 4TN9A 2FGWL 3EFDH 4H1LB 1YUKB 1TXKA 1BFSA 4QRQA 4D9RD 4KO9A 1B4TA 5F3FA 3DVIA 1DBMH 3ML8A 3W57A 4XX1G 4Z7OF 4F8QA 2EO7A 5J4MA 3JT0A 3AS1A 4FMVA 2WO4A 4IGBC 5AOIA 1NSNH 4B9GA 1WFJA 5IGXL 2DEXX 4URTB 3SGEI 3RVTD 3IKCA 1DVFB 3FF7A 3RA7L 3RVXD 1AGBA 1KSRA 3QPXH 1CE1H 5D6DA 1KJVA 5JHAA 3SYAA 2Z0UA 5KUKA 1GC1L 3RGVC 1SN5A 5JXEA 5AW4B 1QI5A 5GZOC 4LSQH 3QI9C 4ZUWA 3ZE2E 3ARQA 2E27H 1DEEA 4QJ5B 2CO3A 3FN0H 5KSAB 1YN6B 5FA4B 1GS8A 3QEQE 3BAEH 4R2GB 5M7QA 4NHCH 4YHPB 3ZKMD 3MV8D 3T1FA 4XBPB 1CFVH 4WCYH 2B14A 5AYUL 1R0AL 3C9NA 4FHBD 4RMUA 2D3JA 1EIBA 2GK0A 1IQWH 1EEQA 5T1LA 2A77L 1GOHA 3WKQA 4E0RB 5KYWB 4LHUA 4C4BA 4NNPL 4AYGA 3UJTH 4JKMA 4N5EC 3FT3B 5FFOA 1XIWC 2Q7AA 4NQXB 4CU6A 2EILB 4R7NB 1SNRA 1U3JA 3BVTA 2IWFA 3IN0A 1D5MA 4FFYA 4PJ8C 5DJAA 5JDSA 2GKIA 1NAMH 2WC7A 1A6AB 1SMAA 2WJ7A 4V1DD 4ZOAA 4ELMA 1HL8A 5JW5A 2Y36L 2XXCB 2OJEB 1A47A 3QZBA 3STZB 3S96B 5FGBA 3K1DA 1GCFA 1A9VA 5GZND 2F5AL 1J48A 3F7RA 3DMMD 3QZPA 4G7YH 5AZ2L 3NN8A 1IO4C 4TQIA 2EXWD 4ODSL 4PW3A 1VDGA 2R29A 3SDDD 4YHNB 4XNYH 1V05A 1EEYA 3QH3A 4G1MA 1R19A 2UXFA 4PBDA 4QHNB 4WO4C 5ACMA 1NIBA 3IT8D 2O6DA 3KDMA 3WUWG 1QOKA 1TCRA 2XFXA 3WUWA 5JOPE 1QFUH 2X10A 2B2XH 2ZOLA 1IGJA 3FT1A 4YHOL 1IGTA 3BVXA 3CZKA 5CWSA 4N0YL 4MMXA 2KQNA 5IW1B 2V37A 1LP9A 1ZTXH 3SOBH 5AB1A 1KJMA 3VI3E 1M7IB 4EZLA 4BSVB 1NAKL 4ODXA 3VGHA 4PRAB 4YHML 3MYJA 1PZCA 4DGVL 5D6CA 5C0DA 1UT1A 4WFHE 3TT3L 4MJIA 5SV4A 3MRBB 3NIGF 4I7ZC 5ALBH 1PD0A 4HCRA 1UWFA 4TVPL 2ADIA 5T5FL 4U1HB 3K81A 3BGMA 4JRLA 3BC9A 1F4YH 4TNWK 1OSYA 3HC0B 1XF5A 1KPUB 5JHDD 1UA6L 1N18A 3T04D 1TEYA 2ZZUT 2VC2L 1W80A 5L9DH 4ODWA 3VGDA 2HB0A 5CMAA 1OLZA 3QRBA 5TH2B 3H3PL 2DLIA 2X40A 3NVQA 4ZD3H 3POCA 4Y89A 1ONQB 1EANA 4M6OH 1NEZB 3WS6C 1LEIA 4HF5L 4DQAA 4U1SB 4NQDD 4CL7A 1IE5A 5EU6B 2UYLA 1TLMA 1Q9OA 4UTBA 4APXA 3WKMH 4XMUA 2ITCB 2GJZA 4C83A 1HX0A 1Q1JL 3LNIA 1ADQA 4RGND 5IG7B 3PDDA 2OMWB 2XZCL 1ACYH 1SYSA 5EORL 2ARJA 4WW2B 4LCWA 3JTSB 3P0YH 3D07A 1BXUA 3L7EB 4H88H 5L6YL 3PHOA 4YBLC 4KKZA 3AGWA 5B3SB 2R0LL 1QNZL 1MJ8L 3HUJB 4HIEA 4Y4KD 3DETC 3X1GA 3D4CA 3ILEA 1DQDL 3H9YA 1LE5B 5CN2A 1WUZA 1NCWH 5EOQH 2YQGA 3ULVL 1ZY9A 2X4UB 5ICZB 3L4XA 3D1MC 3HE7C 5DO2C 3VQLA 4NQED 5HDBE 1L0PA 4HEME 4JKNA 4KNUA 2X88A 2BJML 5IUSA 4Z7WE 2WLZA 3ZHLA 3PQYA 4YEEA 4JPWL 4NXKA 4U6VL 3SE9H 1EAPA 4H8UA 2CHXA 3S8FB 4XO3A 1CL7I 2IPKB 3EJTA 4TUJB 2EIJB 5MEPA 4F7MB 4QRRB 3L45A 2PCYA 3V0IA 5BVJA 4MXQC 1AXTH 4ONGL 5B3JF 4HWBA 5D7IB 2MHAB 3VFNB 1S7WB 3E8VA 2CDFB 3FUNA 4J3UA 1M6UA 5SWZD 3V0VB 2AK1H 2ZOKB 1KZYA 5LGHL 4OB5H 1KGCE 3IFNL 4LEOB 1H15A 4Y9FA 3UADA 2RHEA 4KRPB 1N5YH 1BJ8A 5CCHE 3TZVA 1U42A 1R75A 3NSJA 1ET5A 2QMJA 4A7TA 1DVXA 2OI9C 2VO5A 3K7UA 3RE0A 3DX8A 3WE6B 2YXFA 2B16A 4RFOH 5KVGL 1DZ0A 4ELMF 2JNZA 1JZEA 3O3BB 2VLMD 3QFDB 3KE0A 1FNAA 4LSPH 1GHFL 3TESA 1AG0A 1NBZA 5C0ND 1U8OB 1DO6A 1CK0H 3SDAC 4ZFGH 4DN3L 3GSXA 4P5TB 1OF2A 3IBEA 3NCBB 4ORGB 5E5MB 2CBTA 2BNQD 2GY7B 5B8CA 4AYFA 1D9KB 5JIHA 3IFLH 1PZ3A 4FNPA 4WI7A 3U1SL 1KV7A 1AYRA 4G9FB 4Y2NA 5D1QC 7CGTA 5DS2A 4HZLA 2FZ3B 1NJ9B 4CVUA 3P9MA 4I18B 4Z77A 1XSKA 1KTDA 2HYMA 5F7EL 3IGAA 1VIWA 5IVXB 1HCZA 1CFTB 1MH5B 1OQOA 2WKOF 3FB8A 2PWHA 4L0ZA 3QZOA 3BH9A 2V5TA 4PJAB 1NCBH 1T1ZA 1WWBX 4R4BB 1DJIA 2X4RA 3ATFA 3QDGA 4PI0A 5CJXA 3A67L 1LP9F 1WBYA 3G5ZB 3MUHL 4JN2B 1WD9A 5GS2D 1WP6A 5T1MB 1U8KB 5C09E 3L9RB 4DSYA 2FX7L 5MEQA 2W80C 1KTCA 4DP8X 5C3IA 2PYED 3H7BB 1TKWA 2PPAA 2GEQA 2H6PA 1TNMA 3C6LB 5GS0H 3VWKA 4M62L 5I1KH 2JKLA 2ZKHH 3CDZA 5CSBA 1F56A 3IMRA 4JFZH 4OZ4B 2NY5C 2G60H 1V55B 4P46A 3WXWL 1AGEB 3S37X 3WAJA 4YK4B 4W9CC 3U6XA 3IMTA 3SKJH 4UTAH 4PV9B 4MBRA 2APTA 5ID1A 2O5XH 2HUHA 3CFBB 3KWTA 4LVEA 2ZAGA 2Y72A 5FOBA 2DY2A 2XYBA 2XV6B 3MCG1 3DJ9A 1UZ8B 5LG1A 3WSQL 2XWCA 4PJXA 1EQWA 1TQTA 1WVZA 2IANE 4M7ZB 1XEUA 3UZEA 4O9HL 5HI5C 5IMLA 1BF5A 1NFDB 1FC1A 1RCYA 3ROLA 1WC7B 3MRCA 1KWGA 4Y2DA 1TVDA 4O51A 3LIZA 1D3CA 1U3HC 1EJ6A 3KEDA 3C5ZB 4LLVA 3KJ4B 2DQHL 4G71B 1VSCA 4HWZB 3KWWA 1EBAA 3MRMB 15C8H 4KJQC 5IHBA 4KKQA 4RMSA 3FCGA 3K2UH 2VM3A 3TJHC 4KITB 1YQ2A 3OL2A 4XXDB 5F89B 3OJVC 2QZ5A 2OV0A 4FP8L 1J1XL 1UOLA 3IJHB 1UGKA 3QRGH 2DM4A 2QPUA 5TDOB 2F54D 1K4CB 4N1EA 3MNZB 1S7UB 4FG4A 3VTAA 2WINA 4DH2A 4MCZA 1QQDA 4F8PA 1B0WA 4WU5B 1KB5B 2E9JA 3KGRA 2ZG1A 1RK0B 3B9KD 1M7DB 2ATKB 3KLAB 2W9EL 1IKOP 3KYOB 4BFIA 3HTLX 2PWGA 1A3LL 4EPSA 4ZG1A 4YVNA 3TURA 5KAQG 4TNFA 5B39A 3QDJD 1MHHA 1FYHB 3DRQA 5IFAL 4PJ7B 1OIOA 1ND0B 4J6RH 2E7CA 2AI0L 3CD4A 3GLAA 2WWMC 4LKCA 2F61A 4DK6A 1PD1A 1XR8A 1TOXA 5A2JH 1H6UA 1ED3A 2JCCB 3BZ5A 4MA8L 1JCKA 1MCOH 1UCBH 2QFRA 4KAQL 2HCZX 3ETBF 4Q6IB 1OGSA 3EJYD 1OW0C 3QQNA 2YRLA 4XPGH 4YLQT 1IARB 4XP1L 3PWLB 2WANA 4FS0A 4PP1C 5BV7C 3LPOA 3HEIB 1UD8A 3UX9B 1GGUA 1TCMA 1DP0A 4W93A 2BW5A 3G9AB 3SBWA 2GQHA 2Z3FA 3WFEH 4EQ2A 1KEMH 3EFOB 3O6KL 3VI3F 2PF6A 2VERN 5AB2A 5D71H 4IRZL 1T0MA 3EGXA 5HHOD 4GUOA 1BLIA 3WNKA 5I5IA 5PCYA 1GGBH 4ZOEA 2D3LA 2X1QA 1DVYA 5FM5M 2WLMA 1YMMB 1P4BH 1BCIA 3D12B 4YXHL 1FAIL 5GHWL 2C3WA 1QZ1A 1HI6A 3BCDA 3F12B 2ED6A 1SOSA 3HG0A 3KCWA 4Z7NB 5E08H 1A02N 3OKMA 2BVOA 3DVNA 3V4VA 2NUPA 4JFTA 5DJ2B 3MBED 5AVSB 2OZNA 4Y5YA 2UWEE 3V5KB 4I9WE 3THMH 4POUB 4OV5A 1A7BA 2ERJC 3WDJA 2W38A 3ELAT 1FVEA 4U1LA 2NUTB 4NBZB 3P54A 4X7SL 4EUPB 1KIRB 1HQ4B 2OSYA 5FC9A 4AQAB 3T2NL 3FB6B 2YUWA 4PW9A 3U36B 2CR3A 1RLBA 2WYTA 3MAWA 4P5KA 4G7VL 2PXYA 4MMZB 4ZW7A 1UM6L 4K5LA 2BVQB 5IGXH 4L37B 1A4CA 4BWWA 1NFIB 4FNTA 3NESA 4PBWD 3RA7H 3IGFA 3HPJA 2WWOA 4QEGA 4NZRH 4RMRA 1RZIA 3KPOA 4L8BB 4OD1L 4PGBB 4X80L 3LH8A 1GC1H 4JO1L 5I6OA 3A6BL 3R1GL 2UY6A 4A7QA 1GJIA 5EU5A 5K93A 2HX8A 3FH5A 4A6YL 4IU3A 2EDEA 1M71B 3NCJL 1A2YB 1A8ZA 1C8QA 3T77A 4UM9B 5HYFA 3QNZB 3N0PB 4ESKA 1E4WL 3D39E 4X7TB 2MTAA 3MUJA 5DUBA 3ARDD 3A23A 1OCOB 5KVEL 8PAZA 1AH1A 1AD9B 3VXQA 1KCKA 4XWOD 4XB3A 2VJ0A 3UMTA 5I1DA 1USZA 1I1AD 3MJ7A 3EDEA 5HGHA 2Z31C 3BVWA 3EXJA 1IZJA 3PWUB 3IK2A 2ZSVA 3KYMB 4GAYA 3T0EE 1PW3A 1ZHBB 1KIQB 5TDNB 4Z7WF 1GKOA 3AT9A 1U91B 3B43A 4OGYL 5FYLL 4BKLA 4FLOA 2A77H 4S0SD 5K1NA 3AY2A 1BD2A 1OK8A 1SVCP 3BUDA 4GO9A 3MRQA 4Q6YA 5DSCA 1JF1B 3FNKA 6FABL 1TMCB 1GGCL 4LKXA 1CVSC 1N19A 3UXFA 4DO4A 3IDJB 1NAMA 3BQVA 4JW3A 1X7QB 4J5VA 1Y0LB 1UB6B 1JN6A 3QZNA 5FO7A 3DVFA 3HE6D 4FZEL 1RZKL 1FL5B 1U2YA 5HPMA 5CGYC 4DP9X 2CMRL 4QXVA 2CLZA 1TZGL 2F5AH 5EEZA 5KBMA 1J1PL 2VLJB 1GY2A 4Q7DA 1B9ZA 3QIWB 1P7QD 1T0PB 2EQDA 3SYQA 4K4KA 4ODSH 3T4AA 1X5ZA 3TC9A 1HHHA 2VXTL 4JY5L 2X89A 3ASOB 4F7EA 3UEZA 2WQ8A 3K71A 1KYOK 2ZYIA 2OQJB 2TSBA 1BG9A 1LO0L 4MX7A 4N24A 3MSPA 2FIKA 3D25B 2R23B 3KL0A 4KQ3H 5DK3A 1IC7H 1XZ0A 3GSRA 4JAMB 3B3IA 3D18B 3JVGA 3O2VL 1U58B 4YHOH 5HPOA 4N0YH 2VZ3A 2WZ6A 4FFVC 1SXZA 3MRJA 3DTXB 4JCMA 3G6JB 1EHKB 1IV8A 2CSPA 2Z8SA 5LQBL 4WI0B 5T3XL 1M57B 1NAKH 4KVCL 3KS0J 4MDRA 1TQCB 3MLZL 5F3HA 3QUYC 3TT3H 5EB9A 1BJMA 3QEHA 1TJIL 2VL5A 3P0VL 3V6OA 3L3HA 3SE3C 4TVPH 3LQZA 5SWSB 3LKRA 1OSZB 2E6PA 5IBLC 1A6ZB 2W94A 5I1LA 1DVUA 1UA6H 1NGWB 1XCWA 3FJTA 2VC2H 5I0VA 5I75C 4LDLB 4YDMA 2Q20A 1KACB 3A5VA 3H3PH 3KGTA 2WNXA 3HFML 4NUQA 1BWWA 5DJYA 3FAXA 5AQ0A 1R46A 1D5MB 4L9LA 3U6XS 4ZMNA 4OM1L 3NZUA 4HF5H 3X2QB 2G2PA 5B21A 4XTRD 4MB3A 4U3HA 2KH2B 5EO9A 3U0WL 4JFWA 2KERA 4JFFE 1LHZA 3IJSA 3CDFA 4K5OA 1Q1JH 2YQBA 5CU5A 3TO2B 5BW7C 3AG1B 1X6LA 3U1QA 1KYOJ 2XZCH 4QRPA 3LDBB 1JPFA 2K8MA 4IMKA 5EORH 5IHLB 1WGOA 3GTVA 3VSQA 2ZP8A 3BUPA 4FXLA 3CZFA 4R7XA 5L6YH 4ABWA 1IZKA 4GXUM 2R0LH 1QNZH 4XVOA 1MJ8H 3SDXE 3UACA 2HMIC 4J3OC 2CU9A 1DVTA 4XNMB 2WQVA 1A4AA 3GB7A 3VFSA 1YJDC 3PWPD