2IH3A

Ion selectivity in a semi-synthetic k+ channel locked in the conductive conformation
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Ion Selectivity in a Semisynthetic K+ Channel Locked in the Conductive Conformation.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 46
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ih3A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ih3A02
4UTBH 2WINB 5ABDE 2HFFB 4PLNC 2WLYA 2FNBA 2B1HL 2ZUVA 3FHAA 3FRUB 4AIZB 3VH8G 1IAII 3CFBB 4LRNL 4LKXB 1ZHLB 3NTCL 4LLYB 3MLYH 1GH7A 5F6HJ 2VITB 2HVKA 2Q86A 3ZKXB 5BVPL 1U8HA 1XIWC 2HLFC 4R9HA 1I9EA 5FGCE 4LNRB 3LZFL 5GS0L 4TNVK 4GRLA 1S7QA 2OMNA 4NJAL 3UC0L 2NY5L 5IW6A 4QGTA 1SYSA 1QHPA 2OTPA 3MRFA 1NC4D 1HYRC 1UYWH 3FB8B 4BQ9A 3V52H 5DJDB 3DUUA 2GJ6B 1MEXH 4X6BB 5DMKA 1T21A 3KS0H 2HJFB 1T2JA 3D85B 2R9HD 4PR5A 4YXHH 2UY6A 1TIUA 4HGWB 2WINA 4OIBA 3MMEB 1WAAE 2HFFA 3CFEB 5KSBA 5LXGL 3L5IA 4X5WB 4AIZA 3DV6B 3C2AH 3CFBA 3QWQB 4LKXA 1V8HA 4YHLL 3QA3B 5CILH 1QSVA 2F53E 3Q6GL 3VGBA 4OF3A 1ZHLA 2E27H 4LLYA 2YA2A 2VITA 1FC1A 3DI2B 2KUTA 1FGVH 4GXVL 4LNRA 5FHAH 1KPUB 3BQUC 4WI2A 4RMUA 4DFHA 2M1KA 1KB5B 3H9YA 1TZGL 1HHKB 4NFCA 1JYWA 2XN9B 5B3JF 3FB8A 4JO1H 5E99L 3PQYD 3BPLB 4FNLH 5DJDA 1KULA 4UU9B 5C70A 2GJ6A 1FH5H 4OD2A 4X6DA 2GTWB 4X6BA 5MENE 3DVFA 3T8XA 4U1JB 2HJFA 3D85A 4HGWA 5EA0H 3JTSB 2K7QA 3MMEA 3CFEA 1P4LB 4PTTB 2YWZA 4JRYE 5D71H 3RWFB 2DMCA 2BSSB 5ALCL 4X5WA 3VFGH 2NY6C 3DV6A 4IDJL 4JPKH 4ZXBB 4R4FL 3PHOB 1EMTH 3INUH 4EUPG 4IS6B 3QHZH 1IGFH 2NW3B 3MRBB 1IILE 4Y4FD 4GMTH 4NQCB 4PJFE 4XC3L 2OI9B 3MBXH 2X89A 1NGYB 1KPUA 1IAKA 1IGIL 5D5MB 1H3PL 4FZ8H 4KTEL 5KSAD 1EHAA 4HPOL 1KB5A 5E4EC 1NMCC 1C5BL 1ZGLP 1HHKA 1UJ3A 4N0YH 4LHJB 3N9GH 2XN9A 1UXSB 3I50H 4O5LL 2W91A 3DETC 3HE6A 4OLXL 4QOKE 1PLGH 4UU9A 1MHHB 4PJ8B 1CFVH 2DQJH 2GTWA 3T0XA 5IVZB 5C0BA 4U1JA 3AMLA 1DQML 1YY8B 3T4AB 4L4TD 4QCIB 4NYLB 3JTSA 1I1AC 4QHMA 3KPSE 4PGCB 4PTTA 1P4LA 2BVPB 4X8JA 3RWFA 4OSUL 4DAGL 2BSSA 15C8L 3CXHK 3F5WB 4ZXBA 3PHOA 3TM6A 4DUWA 3DO7B 4AL8H 4EDWH 4Q6YA 5F6HI 2OR9H 4IS6A 4BSJA 3S35L 3T3PE 3DXAD 3TC9A 4KZEH 2DDQL 3QJHB 4JKLA 1DSFH 4XPFH 1NGYA 2WIIB 3LN5B 5D5MA 5DTFB 1X9QA 4U7KA 4QEGA 3ZKND 4C54A 4PRBB 3KR3L 1S7WB 3V5DB 4I0PB 3EYQC 3GRWA 1CGXA 3U83A 1BAFH 1MHHA 4NPYB 3UX9B 4PJ8A 4HC1L 5IVZA 1YY8A 4MGXA 1T89A 3T4AA 4QCIA 4NYLA 2OL3L 4PGCA 3RIFK 3FAWA 1A5FL 3STZB 2BVPA 3N85H 1ZE3C 3QUYD 1I8KB 4HBCH 3F5WA 3TA3D 2X70B 3QULB 4X4ME 1DBBL 1OAXL 4LASH 3DO7A 4LLUB 5CBAA 5CZVH 1CDBA 3WNPA 1CDJA 3X11B 4AM0B 1QLRB 4FA8A 5HYSG 2XRAL 4JQXA 4QNPF 4P46C 3LB6D 3QJHA 4JLRA 2WIIA 3LN5A 2ICEB 4UZGA 1WT5C 1RIUL 4TQEL 1QYGH 3QRFM 3SEPA 3BESR 3EZ8A 2FZ3B 4PRBA 1QSED 1S7WA 3V5DA 1XF1A 1J11A 4K3HA 4MQXD 3WIFB 2X5PA 1YEJL 4JG1L 2Y6SD 5JIPA 4D9RE 2DD8H 3O4OC 1CBVL 3SDXB 4JO3H 3VFUB 2RIKA 4X6CF 3ZHKA 3STZA 4FP8H 2ICCA 5E2UH 1I8KA 1EDQA 4JR9H 2X70A 3QULA 1G7PB 3NPSC 1MCSA 4MHHI 5F1OB 4ESKA 3QDAA 3X11A 4AM0A 3KLSA 1P4BL 1QLRA 1IC7H 5K9JH 1UG9A 5E08H 4I2XB 4OLZL 4XBEH 3WNMA 2ICEA 1M7DB 2BOCB 3HFMH 3T0EC 5DLML 2DM2A 4A6YL 3A67L 2FZ3A 1OTUD 4GRWB 4F37F 4U0RC 5E6IB 4M3KB 5E70A 1WLHA 5F72S 5TQ2H 5F7MC 4PJDF 3NIFE 3BAEH 3AS2A 4XXDB 3T65B 3W82A 3ARFB 5T3XD 1CGTA 1H8NA 2D9QB 2HG5B 3G04B 4CW1B 3C6LC 3DTXB 1BF8A 1G9EA 4LSPL 3AREC 3SDXA 3IDYC 1QR1A 1WQVT 1NFDB 3VFUA 2VC2L 4Z7NF 1DVFC 1KG0B 2UWEF 4X4XB 1CQKA 2WBJC 4TVPL 4FQHB 2X4UB 3MRNB 4KAQH 1KCRL 3FTGA 2YK1L 1MHEB 4MB5A 2H41A 3PDDA 4Z7UB 1WFNA 4JFED 1B4JH 2HJLA 5I1LB 4I2XA 4TSCH 1AD0A 1AGBB 3G6DL 1M7DA 2GHWB 2BOCA 5DQJB 1OP9A 4U3CA 1OM3H 2VDQL 1E0OB 4FFVC 3UBXG 4EBQL 5E6IA 2X42A 4JKKA 4OV5A 4ALAH 4N5UA 3LSOB 2AQ1A 1R5IB 3DV4B 3M8OH 2YC1B 5HI3D 5GGTL 1KIUA 4XXDA 3T65A 1MCKA 2HG5A 3G04A 4CW1A 3DTXA 5CZXC 2BSRB 1SY6A 2DTML 1NFDA 3UTSB 2ITCB 3ZKQD 1KG0A 1UACH 2H2SC 1UM4H 3LQMA 1INEL 5D7KD 4X4XA 4ODVL 1YY9D 1WBZB 4XMLL 4FQHA 3MRNA 5E94B 3TZVC 3VGFA 3W0WE 1MHEA 3V4VL 4Z7UA 1H3UA 4XAKD 4BKLB 3B8YA 1ZTXL 3HZVB 3DYMA 5I1LA 1FLTX 3U7WH 3C5SB 1AGBA 1GPOL 1RZFL 5DQJA 1QBMH 1I85C 3S37X 5D1QB 2G75B 4I77H 1MFDL 4HIEB 1HI6B 1MAKA 3OGOE 4RMSA 4ZPTB 4D0DA 3LSOA 1R5IA 3DV4A 3QIWD 2YC1A 2D03H 3G5ZB 4TNWF 1BBDL 3RY5A 3VGAB 3FQWB 5IB3B 3RVWC 1F90L 5EUOE 3VRJB 2BSRA 2LABA 2MNUA 3MODL 4IRZH 3HTLX 3UTSA 4LPTA 4O00A 1T22B 3MFGB 1KFAH 2ITCA 2DIJA 4N90E 5B4MC 4LDLB 4WWKC 3MLXH 2ARJB 2FH6A 4FQXC 3CMOH 3IFPB 4O4YL 4F2MB 2R1WB 2Y06L 1H3PH 5CJQH 1K6QL 2VLKD 2J8UA 5T1KB 1CFQA 4IRSB 3EIFA 2ERJC 4R6UA 3VH8B 4JGUA 4XNQB 1XF5B 2PXYB 2DQDH 5D2NE 4M43H 3PJSB 4BKLA 2BHYA 4HQQL 4M7LH 4Y4HB 4MB4A 4FFZH 35C8L 3GO1H 3C5SA 5L8LB 4LCUA 1W72H 1Z0MA 3OF6D 1DLHB 1GIGL 4FXKB 2G75A 1TETH 2HN7B 1I9JL 3GJEB 1HI6A 2DIBA 1L6ZA 4OCSL 4KKCC 4ZPTA 3ZYOA 2F8XC 3G5ZA 2NTFA 3FQWA 5IB3A 2R0ZH 1OLLA 4WO4B 3VRJA 3RY6C 3RZCD 4WI3A 3MV7B 4Z7WB 1T22A 1W0VB 2P1YA 3RA7H 1DANT 2D7OA 2ARJA 2VXQL 4UT7L 1ZLWH 5I18H 3IFPA 4U4BA 4F2MA 5EH1A 3ZT6A 2EDQA 2R1WA 2F58H 4YE4L 1FBIL 5JOFB 5J6HB 5T1KA 3D69B 5HD8C 4IRSA 1U3ZA 1UH3A 3VH8A 3FCTB 1A6WL 1FNHA 1XF5A 2PXYA 4M03A 5KZCB 3PJSA 4NO5B 3LHPH 5J12B 3K4AA 4H20H 4WFFD 4Y4HA 4FRWA 5FA4B 2IEPA 3C5ZC 4LSSL 1AP2B 1RZJH 2VLMD 4LSUH 4DKEL 1MFNA 4OLUL 1DLHA 1IQDB 4FXKA 2HN7A 3GJEA 1K8IB 4PYGA 4IJ3C 5HTSA 4Y1AB 3ALPA 3WFEH 1WZ1H 3T0EE 5FM4A 1HHGB 2BY3A 2DQUH 4WO4A 5DJYB 3VFSB 3ARUA 5F6IC 3U1SL 3MV7A 3S98A 1LDPH 1W0VA 3KAAA 1CK0H 5IBTH 3LQAH 4DKDC 2J5LC 1VFMA 4P59H 1U8LB 4GRLD 3QUKB 3VXPB 3HUJE 2RCSH 5DHVA 2KL6A 1ZLWK 5I1KL 1MCRA 5J6HA 3D69A 5ACLA 1R6VA 1A1NB 1DZBA 3FCTA 3HC4H 4YFEA 1A9EB 4FFWC 3O8XB 1P9MA 1MNUL 1EO8L 4NO5A 4L4VE 4MXVE 4OLEA 4Y5XB 5FA4A 2ZJSH 3KJ4C 2D0HA 4HWNA 1VA9A 4OZHF 43CAA 1EVTC 4ORGB 4X8XA 3ABZA 3HNVL 1IQDA 2F8OA 1KB9J 1O5DT 4H25A 4JFFE 4Y1AA 2GI7A 4ZSOB 2KQNA 3GMMB 1HHGA 5DJYA 3QCVL 3VFSA 1I8IB 3L3IA 4LPYA 3OG4B 4L9LB 4GUPB 1LO2H 1HXYB 3HMXA 3J7HA 4JB9H 1U8LA 2AJXH 2DKSA 4QWWD 4DVBA 3QUKA 2R0WL 4ZUWB 2UY7A 2Z35B 1TFHA 4JQIL 5DEFA 4PBWD 4AZ8A 1A1NA 1HOCB 3S97C 4AENB 1S5HB 3ARQA 2FJHB 1A9EA 5IFHL 5CINL 3O8XA 4WFHE 4TNVF 4EUPA 1WFTA 2GJ6D 2GK0B 2P43B 4Y5XA 3RUGE 1BQHB 5F9DC 3ZT5A 3B9AA 1A6UH 3NGBB 2QSCL 1NANH 3D85D 1IEBA 3GSWA 4ORGA 2HAZA 2F9BT 4D94A 4G8GB 3FO2B 5BS0E 1BFOB 2O5XL 4JKWA 1JWSB 2HTKD 1KCVL 4Y4FC 4EXPX 4HIXL 4ZSOA 1G6RH 1VEOA 3GMMA 3KPLB 2AXGB 1CFBA 5IVOA 5D1XB 5KSAC 4P0DA 1I8IA 1MCPL 1X5IA 3X3FL 4L9LA 1A3RL 4GUPA 4YZFE 3S5LG 5F89B 1HXYA 3S8WA 3JVGC 1UM5L 2X89D 3C08L 4M48L 4ZUWA 3WHXA 1H9VA 2Z35A 4UV4L 2HJKB 3B5GA 5ALBL 4JPVL 5TE7H 4JRXB 2YD2A 1HOCA 2XN9D 4TVPE 1S5HA 1Z9LA 4X7SH 4XPBL 2FJHA 4ODTL 3GHBH 1Q0YH 2WBKA 2GK0A 4X9HA 4KRLB 1BQHA 1YNTB 2W9EL 4IM8A 4PJCB 1A7OL 1QFUL 2D2OA 2EDHA 3ZTJH 5MEOB 5EBWB 3SBWC 2W38A 4ISVB 1RU9L 4RBPK 2LU7A 4AMKL 3THMH 1D6EB 4G8GA 1BQSA 3FO2A 1BFOA 4K7PY 1JWSA 5J89A 4W68A 3MLUH 3R0NA 4LHQB 4ZXBD 1UCTA 4ZPVA 2AXGA 5D1XA 5BOZG 4M5ZL 1R3LA 3PGDA 5IHUH 2HVJB 4NQCD 5F89A 3E6HB 2E5EA 2C7UB 5LQBL 2CR3A 4M6AA 4NQDB 4AEHL 2A9NH 5FV1L 2JCCB 5GGRY 3KG5A 2HJKA 3CLEH 3MLZH 4JRXA 3EYSH 4PY7B 3UJTH 3JV6A 5TE4L 1JZ7A 2QADB 4LAQH 5TE6H 2EDYA 2ZKHH 4PJ8D 2ZG2A 3QUYC 1YNTA 4X5LA 4PJCA 2AJSH 4OFPA 5MEOA 3S88L 3TA3C 5EBWA 5EC1B 1D5BB 4ISVA 1MELA 3LRHA 3HI5H 4PJEF 2DLEA 2C4FU 3IFNL 1DL7H 4ZNEE 2DM3A 5DD3L 1MWAH 4XB7A 4P5KB 4OT1H 4FQPA 4YLQT 4D9LH 1UVQA 4KK6D 5GPRA 2DYPB 1CFTB 1M71B 1HINH 1FNLA 4RGNE 2AEQL 2GIYA 4M6MH 2ADGB 3Q5YA 5L88L 2HVJA 1QFHA 4FFYH 2Y07L 1NLBH 3KPRB 4YX2L 1CGVA 5DUBB 3E6HA 2C7UA 4NQDA 2XZQH 2JCCA 5DSCA 1NLDL 3LS4H 5E8EB 4YWGH 2AVGA 4MQXC 1YPZB 3MTRA 4TRPH 4YR6B 4PY7A 3MLVL 4JCMA 4I0PD 5I1AB 2B2XH 3NACH 5A1AA 4K3GA 3MXVL 4ERSL 5ITBH 4JVPA 1YA5A 4U31A 3CSGA 4HK0B 3S36H 5EC1A 1I1FB 3VDCA 1KSRA 1FG9C 4N8VG 4R2GB 4RISL 2A9ML 5DC0A 2KBGA 3UDWA 4XNXL 1I1CA 1PSKH 4G5ZL 1AXTH 5JW3L 2UZIL 3A6CL 3IDNB 4LEXH 4ZQKB 1TZIB 4HKXB 3ZHLA 2GK2A 4OB5L 3VXNA 5E5MB 4P5KA 5JXEA 4XZUB 1EV2E 3RIFF 3TBYB 3UJJL 2DYPA 1QFWM 4EOWL 1CFTA 1M71A 32C2B 2APTA 2ADGA 3TYGH 4IMKA 5FA3B 4HJGB 1OTUC 1WZMA 3KPRA 1CXLA 2VXSH 5DUBA 5KSUB 5EOQL 5F44A 1TLKA 3RJQB 5HY9A 1GC1H 3AU1B 2D7QA 2O61B 5E8EA 1JZ4A 1YPZA 4QHNB 4YR6A 2ZUWA 1A1MB 2AV7B 5IUSA 5IB4B 4UUJB 2J6EL 3PQYE 2ZCLH 3QCTL 5I1AA 4NGHL 4QHLB 4XVJL 4CDGC 1T4KB 4HK0A 1PG7X 3P0GB 2D3VA 1BZ7B 4JKPL 1I1FA 4NT6B 2IBZX 1KXVC 4WI5A 4L3CA 4K9EC 4GAJH 5IQ7H 5IB1B 2YHGA 4ZQKA 3WS6A 1U8OB 1TZIA 1F5WA 2VR5A 3MRKB 2QQQA 5E5MA 3UTTE 5GHWH 4XZUA 4B5EA 3TBYA 1NUNB 4Q9RH 4LVNC 4FQJL 32C2A 3JSSA 3ES6A 1ZLSH 4CMHC 3ALWA 3G6AB 1UZ6F 3P4OB 4Q6IB 5KSUA 3IS1X 1HH9A 5A2KH 3AU1A 2B8OT 4MX7A 5HI3C 4N0UE 4YBLB 4QHNA 4HDIB 4J4PC 2Z92B 4NFBA 2AV7A 2P47B 1MJ7H 5IB4A 5E6ID 4UUJA 1NL0L 2P5WB 1H5BB 1R24B 1FPTL 2PF6A 2X9YA 4QHLA 4R97B 1A6PA 2QLVB 1E6JL 3B6SB 1T4KA 3RX7A 3ARFD 1LK3L 1BZ7A 3QR2A 1VENA 4L4TE 4NT6A 2Y9RT 5F88B 1WFUA 1DQLH 5CAYB 2ATPB 3DPBA 2XQYG 1J87A 2UZYB 3QHFH 4UINH 5KS9E 3SKNB 2VN7A 2W92A 2R0WH 1MPAL 1U8OA 5IIEB 3K8MA 3MRKA 4M8QB 5JW5B 3KWWB 2RAMA 4HCRA 4XP5H 3DXAE 3G6AA 5GGVL 3GIVA 3EGSB 1QZ1A 5DD5L 1I75A 4D3CH 4Q6IA 3QIUC 4LMQI 1YNLH 4RX4D 3CX2A 1NFIB 3ULUH 4HDIA 5DT1L 2Z92A 1NCTA 1FFQA 3VWJB 4R8WH 2P5WA 1H5BA 1R24A 1ROWA 3FN9A 4MAYC 4ZYKB 3B6SA 4XMPL 1JMXA 1OAZL 1HQ4B 2NY4B 5F88A 3UTSD 4DVRL 2ATPA 5DJ6B 3V95A 3B9KA 4P9ML 1ZHBB 1K4CA 4UMGA 5IIEA 1YEGL 4M8QA 4XTRD 5JW5A 5J7CC 1N0XH 3KWWA 3WKMH 1S8DB 2VE6B 4X4ZA 4CUCA 5KANI 2R15A 4LRIC 1JV5B 4NM4H 3U9PL 1IC5L 1MCOH 3EGSA 2OXHA 3LPFA 3SGKA 1T0PB 1HZHL 3U36B 4I3SH 2IAMB 4KI1A 4KV5E 4OCYL 4FQQB 4W4OA 1NFIA 1D5ZA 4K8RD 1K2DB 5ECJE 4YHML 1YN7B 4LF3B 4M9OA 1I9RL 3QUMB 3ROOB 3SGJC 5D1QD 5FECB 1T0MA 3R1GL 4GQPH 4Y4KB 1QSEE 3NFSH 1M1SA 3VWJA 4OBRA 3RZCC 5BW7C 3IVKB 2EIZB 5D7IF 4M1DL 3BMWA 2V5TA 3ULVD 4ZYKA 5JPNA 1MRCH 1VFBB 5ICZB 1JNJA 4KVCH 1HQ4A 2VJXA 3KXFE 4PJHA 5JA8B 1D7FA 3UTQA 1BVZA 3RRQA 4WI7A 2W60B 5CGTA 1PGRB 5T1KD 5E6YA 2Q7NA 1S8DA 2VE6A 3PWNB 4G8IA 1NCWH 2PXYD 3WFDL 3MRDB 3RDTB 1IT9H 3VD9A 4PJIF 1JV5A 4MA7L 1QBLL 2CRMA 2IPUK 3CK0H 5TDOB 4FQCL 3LKRB 4Y4HD 1PVHA 2V7NB 2NZ9D 2IAMA 4FQQA 4M93B 1MIML 3NPZB 3VFRB 1I7UB 1K2DA 1YN7A 4NSKB 4LF3A 5CEZH 1AXIB 3QUMA 3ROOA 4UI2A 5BQ7B 4XGZB 5CEXB 5FECA 1RMFL 3IVKA 2EIZA 5E7FA 4NNPL 3ZE1F 4ZUUB 2EDDA 4TTDD 3EW3B 1VFBA 5ICZA 4NZUH 5T3XE 4WO4D 4G6JL 3MV7D 4DK3A 1AXSB 4HMEA 3V5KB 1FQ9C 1KB5L 2W60A 1JGDB 1RIHL 1NGZB 3CD4A 3V6OA 4XC1L 3W2DH 1OQXA 3GUTB 5IWLA 3MJ7B 5EZLB 4ZTPH 3PWNA 3VFMB 3DROB 3MRDA 3RDTA 3C2SA 3H3BC 5KZCD 5FFLA 3HB3D 5F1NB 5TDOA 1G9MH 3LKRA 1J1XL 5KW9L 3RPKA 1CLYL 1FL3B 4EN3B 1XGQA 3VFRA 1EZVY 3DO3A 1MHPH 5IVNA 1I7UA 1AIFB 1Q72L 4NSKA 1KOAA 2AEWA 5BQ7A 4XGZA 5CEXA 4Z9KB 1KXQE 4K23L 2HFGL 1CI5A 3ZKXC 4Y1AD 3BE1H 5HHNB 3U0TB 2O26U 3BKCH 5EU5B 4F8TA 4QY8A 1JPFB 2B1AH 5J3HC 1ULVA 3CMGA 4Q2ZA 1AXSA 1A22B 3UMTA 3V5KA 4RQQB 1A0QL 2BY1A 3R8BB 4JVUA 1JGDA 1NGZA 4IIQB 5D7KE 1HKFA 3KS0J 3QDMB 4WTXA 2AJUH 3CFKB 3MJ7A 3MCLH 1IKFL 2AK4E 3SOBH 5EZLA 3VFMA 3DROA 4YXKL 3JXAA 1G9NL 1MVUB 3O8XD 4PJDB 5HHME 5F1NA 2HWZL 4XAKE 5DJXB 3QPXL 3ROLB 5K9QI 1FNEB 4BK4A 1HQRB 1XEDA 2HTKC 2VZTA 4PS4L 1JUFB 4XWOD 3S5LA 2ORBH 3WD5H 1NSNL 4EN3A 3LRSB 1D9KB 3BPCB 1MCLA 4RWYL 1AIFA 1FNAA 4P4KB 5AWNH 2R56H 3KPMB 1CL7L 2A77L 3GJFB 2JJSC 4WGVB 5I1JH 3JV5A 5IMOB 4QLRA 5HHNA 3U0TA 2FSEB 3DJ9A 5DUPL 1PW3A 2OM5A 1JPFA 3F6LA 2AKRB 2XTLA 2KPNA 4XP9H 4I0KA 1WJ3A 1UJ3C 4RQQA 2FEEL 4IEFB 4FABL 3BPLC 3HE6C 3QDMA 4F57L 3CFKA 2VB5A 3RWJB 2VLKE 1JHLL 1QLFB 3CXHJ 2CK0H 1CIUA 2RB8A 2V17L 4PJDA 1BJ1H 1CIDA 5DJXA 1SEQL 4WUKH 1X5JA 3ZLQC 1FNEA 5DA4A 5FCUH 1HQRA 3KLHC 1E4XL 2V5MA 3TN0C 4ELMB 1JUFA 4YUEH 4ZXBC 1X5GA 3LRSA 1D9KA 2CH8A 2BVUA 2AEIT 1OTSD 4XCYB 3WCYA 4P4KA 4G8GD 3KPMA 3U6RB 3K3QA 3F7VB 5KTEH 3GJFA 3W9EB 1U3YA 4X99B 5IMOA 2FSEA 2OI9C 2Y5EA 2WUBH 1RVFH 4JN2B 4CBPA 2Q3ZA 2AKRA 5D1XD 4DGYL 5IJKC 2A38A 2VLJA 3BKML 2MQ0A 3LEVH 1RZKC 2R0KL 2DQEL 4HUKB 8FABB 3B9DA 4PJ8C 3VJ6B 3RWJA 1WEJH 4JRXD 4OM1H 3TVMB 1QLFA 1T89C 3VA6A 5DJ8B 4LQFH 4K07A 3BZ4B 3DVIA 5CIPH 3DRTB 4WFFE 1V7ML 1RUKH 4ELMA 2DQHL 1V3KA 3MOQA 2VLME 4N0CD 4K94L 4XCYA 4KK6C 5JQ6L 3U6RA 3QUXB 3F7VA 2XNAB 4JQXC 3W9EA 4X99A 2IPTH 1J10A 2R4RH 2ZNWA 2YD3A 4HUVB 2NXYB 4MNGA 4C4KT 3MUGB 4JN1L 5I1HL 4ZMAT 5A40E 1JZ6A 4JDZA 5MEPB 4N8VA 3S3PA 1YEHL 4NQDD 1PY4A 2HTLD 5FHBH 4G9DB 4IOFD 4M7KH 5C0AB 1M7IB 3VJ6A 5LGHH 5E9DB 1U8MB 2W0LA 1YJDC 4WCYH 3TVMA 25C8L 1D6VH 2DBLH 5ISZB 5DJ8A 5C08B 3VFOA 2QADD 3IB4A 1KLFA 3CH8A 1JRHH 2R2CA 2XV6B 3P9WB 1DLFL 3DRTA 4JPIB 3UO1L 1SY6L 5GGRB 4JFDA 3TWCH 1J8KA 2PYFB 4I3GA 5I1IL 3P11H 1EFQA 2P8LB 2XNAA 3OGCB 1OOAA 2HFTA 2IANB 1LEIB 3H9ZA 5DJ2B 4HUVA 5JXED 3CFDB 2DYPD 4LIQH 1SM3L 3KVQA 5ESQB 4CJ0A 2EZ0D 3KPRD 3JV4B 3UYOD 3RFZC 2JLLA 3O81A 2VDRL 1QA9B 3SCMC 3ET9F 3L5WB 1NAMB 4G9DA 3MV11 5C0AA 1X6LA 2ZUQB 1MREL 2HFEA 2E9WA 5E9DA 5DD1L 5EO9B 4JREB 5ISZA 5BV7C 4C57C 2FIRT 5FUCC 5C08A 3V6FB 2X4TB 3VMPA 3O0RH 2GJ6E 3QZWG 4JPIA 1NCBH 4K94C 4XRCB 5D2LF 5GGRA 4C59B 4O2FB 1A7RH 3UTOA 1EBAA 3MOBH 1ITBB 1DN2A 1FFOB 2ED7A 4R2GD 4UB0L 3SKOB 4YHKL 2WQ8A 1B3JA 2P8LA 2NY2C 1UA6H 3OGCA 3CUPB 2FGWL 2IANA 2QTEA 1FRGL 1LEIA 2DICA 5DJ2A 3P77B 2IQ9L 1CLOL 2QL1A 3CFDA 2E7CA 2IFFL 4Z7VB 5ILTH 3G6JF 4Z7OE 3MUHL 5ESQA 5E00B 4UNUA 4C83B 3JV4A 1KLUA 1T2QH 5E6IC 1J1XH 1QA9A 3BKYL 3L5WA 2EDLA 1NAMA 1CDUA 5DJCB 5L9DL 4KUZL 1CD8A 2NX5B 3H42H 3WUWG 4FQ1L 5EO9A 1GGIH 5IMKB 2XN9E 3NZHH 3V6FA 2X4TA 1R3KB 4WW2F 12E8L 3I9GL 5F7HA 4DKFL 4M5YH 4XRCA 4O2FA 1QNZL 1E6OL 3KHQA 3ZTNL 4B41A 3QWRA 1JPGB 4XBPA 4H88H 2JB5H 2FX8H 1OSPH 1BM3L 4YGAB 1FIGH 3SKOA 1X7QA 1H3VA 2LTQB 3CUPA 2MKWA 1IGJB 5L7XH 5GRWA 3P77A 4HXBL 4U6VH 3WN5B 4JY6B 4YIQB 3GSNH 2AJYH 4Z7VA 4KPHL 1MFAH 3DSFH 2W1NA 3MUJA 2EKSB 2WUCH 1GZPB 5F7YC 1QO3B 5E00A 4NQCE 5KAQF 1K5NB 1KPVA 4C83A 4F15B 3Q2CA 1XCQA 5D5ME 1BJ8A 5DJCA 1LO4H 3WFHB 2QEJA 5EOCH 3HS0B 5BZDB 1U36A 5AZ2L 4G6AD 1J18A 2P5WD 3D3VB 1KEML 3EZJB 2CIKB 2C1PB 2J1KA 4YAQB 3RVTD 3EO0B 5IFAL 2Y36H 4XCCL 1JPGA 3ZMRA 4X5XB 3BP7B 3V5HB 5C0NC 2X7LA 4Z95H 5HYEA 4G6ML 3ZE0E 1YEFL 2Z91B 4OZGA 4WTWA 5IQ9B 1IGJA 3SDCA 3WN5A 1BLNB 4JY6A 4YHYB 4YIQA 2JB6B 3MA7B 1RZ8B 1JL8A 2EKSA 4K8RC 1GZPA 3H9HB 9CGTA 1QO3A 4HZLB 2AEPH 2ZPKL 1OCWH 1TITA 4UILL 3ULVC 4O9HH 3WFHA 2IG2H 3AROA 4ONGH 4QXUH 1TVHB 2KZ1B 2F53B 5FYKH 3VWJD 2EDKA 1FLRL 4XPGL 2CIKA 2C1PA 3FQNB 5DRWB 1MFEL 3S34H 1KN2L 5ADOL 1RULH 4YAQA 2AJZB 4HKZB 3EO0A 1UWEL 3HMXL 3BP7A 4X5XA 4NKOB 3V5HA 3IDMB 2OQJB 2FATL 4IRSC 3CFCH 1OAQL 2DQGL 1OW0A 2PXYC 1IGML 1AY1H 2Z91A 4WENB 1L0QA 2IMNA 2NZ9C 4JE4B 5JR1H 5B39G 1BLNA 4I9WE 5DK2B 2JB6A 3KPOB 1S7RB 3MA7A 1RZ8A 1PG7W 1Q9OA 3E1F1 3H9HA 3SDAB 5KJRH 1OGTB 1KELL 4WY7L 4Y8DC 4ONFL 4RGMB 4HZLA 2IAMD 3MNZB 3A6BL 2BVTA 3FN3A 1PJ9A 2CO7B 5TPWH 4DGIH 4ZOEA 1TVHA 4PJEB 1CICC 2CGRL 2F53A 2YPLB 3OAZH 4Y4KD 4J3TA 4RSVA 2BFVL 2MSPA 3FQNA 3RWHB 2VN4A 4OF7A 1LD9B 3RWEB 2AJZA 4HKZA 2ICES 5I2IB 2MHAB 4WEBH 3NA9L 3ULUF 3RKDC 4M8VA 4NKOA 4D9QE 2AGJH 3SDXE 1S7TB 3IDMA 4APQA 2OQJA 3V8CA 3BRDA 5I19L 5EZIL 1P9MC 3VXMB 1DBKL 3KYAA 4KHTH 4N8CL 4YDKH 4J3WA 5DK2A 3BKJH 3KPOA 1S7RA 3EOTL 3X14B 2YZ8A 3EFDL 3RDTD 4UT9H 3SDAA 1OGTA 3K46A 4NC0B 4HSQA 3MNZA 3K81A 2ZG3A 4JRYA 2QHRH 3MREB 5DJZB 2GJZB 5J1TC 2HA1A 4PJEA 4NZDA 4P5TB 4GS7B 1UEMA 1F3DJ 1RJZB 3RWHA 3HAEH 1LD9A 3RWEA 4AEIL 5I2IA 3FO9A 5I17B 1I1YB 1MFBL 3JV0A 4G6FB 3O2VL 5D70L 5I1GL 2V2TB 1S7TA 4U1LB 1NFDE 3OKLA 1S9VB 4MLSA 1G1CA 4CN1A 1GAFH 5D8JH 3HNSH 4OCLC 1X5YA 1FE8H 2HH0H 3VXMA 3TIEA 1T7ZA 1PBYA 4Y5XC 4X9BA 4HMDA 1EJOH 1VFUA 4R4ND 3CXDH 1LP9F 2EH8L 3MLWL 2QSVA 3UBXI 4L29B 4MD4B 3BN9C 4JPWL 1NGQH 3FOMA 4MCZB 5KG9B 3BSZH 3VRLE 5JHLH 1DN0A 4HX1B 3MREA 4EN3D 5DJZA 1V3JA 2GJZA 5E6ZA 4LCIL 5MHSD 1DQDL 2OJZL 3MXWH 4HWZB 4OZFG 1LO0L 1P84K 4P5TA 6CGTA 1RJCA 3MJGX 4NCDA 4L9LC 3IFOA 2I9TB 3RWCA 2MPAH 3BEVB 4UIKL 5HYQB 4YJZL 1AC6A 1JNLL 5I17A 1I1YA 2V2TA 3U4BH 4HLJA 1I4FB 4U1LA 4G7YH 3UTSE 1S9VA 2XOTA 1A3LH 3OB8A 2PTTB 1ZLUH 1KC5L 2FJFB 1G1YA 5F3BB 3QDMD 4JAMB 4NCC2 3MJ6A 1LO3H 1YC7A 3I6GB 2V9QA 5K9OB 4CMMB 2X6MA 3PXJA 4L29A 4MD4A 1FFNB 1U8KB 5JLZB 1OTSC 3MLTB 5FUOH 1B0RB 3OJDB 1OWRM 4MCZA 2VYRE 2WMPA 1PKOA 4PJGB 1A6TB 4JHAH 2CMRL 1S7UA 1D9KD 1U6AH 4CVXB 4X4MA 4NHUB 1DQQB 1J8HE 4GT7A 4P4KD 4Y16B 4NWUH 5D1XC 4HWZA 1CD9B 2CLRB 2UVFA 2R29L 3VG9B 1AGFB 1KCSL 4FZEL 2P45B 2ILLA 2I9TA 2I5YL 3ULVE 3BEVA 4LGPB 4TUKL 3TH2T 1N3NB 1CLCA 1F4WL 5HYQA 4O58H 3AS1A 1M6OB 1Z0NA 3R8QA 1I4FA 4OV6F 3OKNB 2VXTH 5TDPB 2YUXA 2PTTA 3MJ9L 3O3AB 2FJFA 5F3BA 4LCYB 1H15B 4JAMA 5SWZE 1NQBA 2LVEA 1S7XB 3C8HA 3I6GA 5K9OA 3SDDB 1F6LL 4CMMA 1FNSH 1WAAF 1FFNA 1U8KA 5JLZA 3MLTA 1B0RA 1UC6A 3OJDA 1FAIH 2MQCA 5CKGA 5EFIB 4PJGA 3WIHL 5JW4Q 1A6TA 2J4WH 2ADFH 1RFDL 4EIZC 5ERWB 4NHUA 1DQQA 1LK2B 2CK2A 4JZJB 4NUGH 2JELL 3GSQB 4Y16A 5JMOC 5F97E 2CJUH 4KI5D 5KVFH 2CLRA 1JPSH 1A7QL 1AGFA 5J0BA 4RFNB 3QG6B 5DK3A 1N3NA 3VRIB 2AI0L 3L7FB 5GXBB 1N2RB 3G5XA 5DO2D 4M7JL 1M6OA 2HTLC 2OS7A 4IOFC 4XVSH 3QZWB 5KVGL 5EORH 2NY7H 5F8RC 1R0AL 1ZVHA 1OGAB 3HKFA 2E9JA 3OKNA 4Z7WE 5GJSH 3GBLA 5T5NG 2EDNA 4JHWL 4TSBL 3RWGB 3FMGL 3O3AA 4P2YA 4BUGA 4LCYA 3T1WA 2G60L 1S7XA 4M9PA 3T0WA 1JTTA 2A6IB 4K71C 3SDDA 1DFBH 3TVMD 3QEHB 1QP1A 3WE6B 3GIZH 3BPOC 2DLFL 3WNOA 2V7HA 1UKQA 4PFEA 1EUTA 3GNML 4XP1L 1VPOH 3UDWC 5IW3A 5EFIA 1SYVB 1A1OB 1T1WA 4KTDH 3VG0L 5ERWA 5BMFH 1NEUA 1RSFA 5JXEC 4LLVA 2CDEB 1UWXH 4JZJA 2XICA 3LQZB 4TN9A 3S4SG 3QUXD 3BP4B 2V5SA 2FX9H 1XGRA 3O6FC 3WUWB 2D9CA 4IMKC 5EWIH 4Y1AE 3QG6A 4WJ5B 3L3JB 3VRIA 3L7FA 3NN8B 1N2RA 1O7SA 1OAUL 2NXYD 3MA9L 3QXWA 3QZWA 3V79C 4POZC 4YEEA 1OGAA 2P7TB 4LSQH 5I6XB 2EC9T 3RWGA 3P30L 4ZO7A 3SJVB 1F11B 5JNYB 3K4ZA 4IBLT 5C0AD 4Y5VB 4GKZB 3PP4H 1MFCL 2A6IA 2OBGA 1QRNB 3SQOL 5DUML 3QEHA 3WE6A 5ISZD 4MDIA 1NCCH 5C08D 1TNMA 2ZZUT 4KK8D 4R2GC 4Z0XB 4NC1C 4I13B 3C9NB 1CXFA 4DKAA 1CR9L 5IT2L 2HYMA 3ZDYE 3WS6C 1A1OA 1JGLL 5C3LD 1QFWI 5CKAA 1IGTB 1HE7A 5DMGD 3ZT7A 2CDEA 5DHYB 3LQZA 3C60B 1UWXK 3BP4A 3WUWA 1A14L 2L7JA 4XPHL 1AJ7L 4O02L 2IAND 4QF1B 1EFXB 3L3JA 4WJ5A 3IDXL 3NN8A 4MB3A 4GSDH 3V4PH 3DHJA 4BFIB 4L5FL 4B53A 2PNDA 4FOMA 5CWSB 2P7TA 1TJIH 2BVQB 4KQ3H 3TT1H 1IC4H 5MERB 3E8UL 5GRUH 5T3ZH 3QB7C 1F11A 1VEPA 2DJ4A 2GYSA 5JNYA 2X4QB 1QRNA 5I1EH 3OKDB 3QG7H 1I7RB 1BOGB 4G6KL 4Z0XA 2RBLA 2AERT 3C9NA 1FAKT 1GZQB 1W72B 4GMSH 1HKLL 5T1DL 3QWRD 4CJ1A 4NN5B 1IGTA 1N4XH 1A7PL 3T3ME 4QTIL 3TP4A 5DHYA 3ME0A 3GBML 5F7WC 2WZPD 1GGYA 5K33A 4OFYA 4QF1A 1EFXA 4Q6IC 5HDQL 4HPYH 4HS3B 1CXEA 1GGBL 4BFIA 1K3IA 5IBUB 2A1WH 3VWKB 1A7NL 2BVQA 4KGJA 5I30H 3S35X 4G6AC 5MERA 5KVDL 1H5BC 3SN6N 1QSFE 3MYZA 4R97C 4NQUA 2VDKH 4HWBH 5BO1H 2NX5D 2X4QA 3RVTC 4JRXE 2EO1A 1G7QB 1WFOA 1UH2A 3FRPA 3NVQA 2VDML 3OKDA 1BIIB 1B0GA 1I7RA 1BOGA 5I8KL 3B9KC 1GZQA 1W72A 3IETA 5HDBE 2VUYA 4JDTL 4BQBA 4PJCE 3EJYC 2OL3B 3PF2A 5CGYC 4XVTL 3DSNA 3RAJL 4LCWB 2FLRT 1IJ9A 2WW8A 3OJMB 4MS8C 5ADPH 4MMXC 1IM9B 3B9EA 4M02A 5EN2B 3IFLL 4XHQA 3SGKC 4EJ1C 1RK1B 1KJ3H 4NN7B 2VDPH 1ADQH 4HS3A 3FZUC 4MAUH 5ELIA 1F4HA 3JWOL 4W4OC 2HRPH 4WUUE 5EU6B 3VWKA 5B38G 3OG6B 1KENL 2EE2A 2CIIB 3VWJC 5LBSL 2X40A 4ZS7H 1D5XB 4NQDE 4JFFB 3L3KA 4U0QB 1CZ8L 2VMFA 4NUJB 1IARB 4WI4A 4XAWL 3CJJA 4OKVB 1G7QA 3TPUB 2W65B 2NY4C 1F8TH 3D3VD 2VDNL 5EBLB 4OI7A 2FBJH 2OYPA 2P8MB 2D4DA 5B3NA 4LSRH 3UJIH 4DW2L 1MQ8A 5C6PB 2ATKB 2OL3A 3IJYB 3SGEI 4PREB 1AFVL 2ZWLT 3W5NA 3QFJB 4LCWA 4EI6B 3MUY1 4W6YB 5ID1B 4X98B 1IM9A 3H3PL 5EN2A 3VFTB 3O3EA 5TF1L 1WGOA 3SGDI 1Q0XH 1RK1A 4FMFA 3GSRB 2IAMC 5E7BA 1E27B 3L3HB 1WIUA 5T1LA 1BECA 3HCVA 3LKOB 5ITFB 5EU6A 1A6ZB 4DCQA 1RIVL 1CQYA 1RI8A 1YYLH 4MYWB 3ESVF 3KPRE 1T5WA 3CLFH 3ZKSD 1GSMA 5D9SB 2X4NA 1D5XA 2DLIA 4JFFA 4KXZI 3BGAA 4S1SH 3N1GC 4NUJA 1YPZE 1IGCL 4OKVA 2F53D 3TPUA 4H1LH 4LU5L 2W65A 4P2CG 1J0KA 1LE9B 3Q1SL 1W8NA 3OXSB 4FQIL 4LSTL 4ODSL 4UV7L 2P8MA 1OLZA 4UOW0 3Q3GB 3IDUA 3E2HB 2CUHA 3NFPB 5GGSY 2ATKA 2W9LA 3IJYA 4PREA 1AQKL 3F7QA 5E1HB 3M45A 3QFJA 4M6NL 3UZQA 1VB9A 2BY2A 5ID1A 4X98A 1G6RB 3GI8H 3VFTA 3WSQL 4OZFB 2DQTL 2A83B 3GSRA 1FVCB 5T3XH 4J2XA 1NMAH 3DWTA 1U3HB 4QHUB 3RUGA 1U8PB 3LKOA 1RURL 4DGVH 3UCRA 3SDAD 3FN0H 1A6ZA 3P0YH 2XZAH 3FFDA 1MF2H 5EZOH 4LLMB 5D9SA 5JHDB 1EAPB 2WV3A 4G8FA 4RZCB 4YBHA 1MCEA 4N1HB 1NMBL 1MJJB 4JEGB 1L7IH 1JNHB 5EUOF 1FO0L 4UDUB 2YPLD 6FABL 1LE9A 4K9EH 4PB9H 3OXSA 1QG3A 3HZKB 4HUWB 3CVIH 4KH2A 4TOYL 1KBGH 1N0LA 3Q3GA 5K93A 3SE9L 4KROB 4NM8L 3NIGE 4XT1C 4CVWA 4R4NC 4X7DC 3D6GA 3LIZH 1PEWA 4LARL 5CCKL 1C1EH 3T2NL 2OP4H 2CR6A 1G6RA 1A4JB 3VXMD 4S1DC 4F58H 4YHZL 3VW3L 4OZFA 2A83A 1BQLH 1FVCA 3OAUH 1J1PH 3U0WL 4QHUA 2E7HA 4AH2B 5B8CB 1U8PA 4EN3C 4JGMA 1T7XA 5F96H 5DMIH 4G3YH 4LLQB 2BHZA 3MLSH 3CFIC 2W9DH 5CP3H 4KKBD 4LLMA 5JHDA 4NO0B 5IB5B 4RZCA 1WWWX 4Z77B 2F5BL 3MRQB 1MJJA 5FO7B 3UZEA 4QGYA 4R96B 4DWHA 1JNHA 3BOVA 3EYOB 4HUMB 3SE4A 3VDBA 4UDUA 4P5TD 3TBWB 2P5WE 5GGTA 4RGNB 3HZKA 4OIIH 1VDGA 5JOEA 3G6JB 4PGDB 4E41B 1ES0B 1DBJH 3SKMB 2MCG1 1RZ7L 3NZ8B 1MWAB 2VRAA 4DQOH 4OGYH 4XVUD 1A4JA 4WWID 1FGNL 1IC1A 1K3ZA 2FJGB 2O5ZH 4QTHB 3ZYJA 5B3JE 4AH2A 5ANMB 3QEGH 5B8CA 2X1WL 1AE6H 4L1DA 2F8VA 1D9KC 4RFEB 1FG2A 1UKTA 3Q0HA 2GCYB 4JGJA 3BGMB 2IGFH 4WW2B 1TTGA 2ZCKH 3BMVA 4LLQA 4P4KC 5CD5D 1IL1B 3O2DH 1N8ZB 3RWDB 1E4WH 1L7TH 4NO0A 1WF5A 5IB5A 2HRLA 4Z77A 3MRQA 2WWKO 1RJYB 5FO7A 2XA3A 3JWDL 1RUML 4R96A 3EYOA 1CGWA 1GL4B 1N5AB 2GY5A 7FABH 3DX8B 1JGVL 4MXQD 4G7VL 3TBWA 1TVDA 1WWAX 3P0VL 3GZKA 4UT6H 3RU8L 2BDNL 1UCBH 4E0RB 3LEYL 4PGDA 4MA8H 4E41A 1ES0A 1BP3B 5AG9A 1GHFH 3SKMA 1FV1B 4K3EH 5E2VH 3NZ8A 1MWAA 3FKUS 5FYJU 5GRXG 3VXOB 4NIKB 3HMWH 2FJGA 3S4SB 4H8WL 4NWTH 4Q9QL 4QTHA 43C9B 3O6LL 5ANMA 4ZFOL 2EXWD 2VDMH 4RFEA 4D9RD 4YDIL 3BGMA 4WW2A 1AC0A 1YZZA 1IL1A 3FT4A 3BUYB 4KI5C 3RWDA 1N8ZA 3LS5L 3ULSB 1VFAB 4P9HL 4U1NA 2FX7H 2KDGA 1KJ2H 1F00I 3WO3B 1MRDL 1N5AA 4NBZB 3DX8A 4YQXH 4Y16D 5DO2C 3UTTB 5GIRB 1MY7A 4MQ7B 4IRJB 3G9AB 3VD5A 1V7NL 2MFNA 4E0RA 4KDTA 3NFNB 4S10A 4G80B 4E9LA 2FO4B 2BJML 1DUYB 1ZGLM 1C7SA 4GLRI 1FV1A 3TVMC 4ZD3H 4J6RH 1NAML 4PRNB 4PJ7B 4DN3L 1TJGL 3UYPA 3VXOA 3O3BB 5DC9B 4HJJH 3V6OE 3H0TB 5D4QA 4YHIB 1GOFA 3S4SA 1II4E 4NO2B 3BRGC 1MQKL 43C9A 3SDDD 1DQJB 2VDOL 4GO6B 1SMAA 3BN3B 3FO0L 4QRQB 4AIOA 4M7ZB 1Z3GH 1UWGL 3BUYA 3U7AA 3KDMB 4PG2A 3NH7L 3D9AL 3RI5K 3WLWD 3ULSA 5H37G 1VFAA 1AO7E 5C0JB 1B2WL 2Q3AA 4HLZH 1MUJB 1QPPA 2NXYC 3UTTA 4WTZA 4C55A 4DN4H 5GIRA 2ESVB 4YZFF 4MQ7A 3QNXB 4H0GA 1T5XB 4IRJA 4HH8A 3TBVB 2MOVA 1GXEA 2XY2A 3Q5TA 3HPLA 2AABL 4GXUM 4K2UL 1KEGH 4H26B 3NFNA 3MC0A 1VFOA 2YKLL 3F58H 4G80A 4QNPE 2FO4A 4S11A 3FFCB 1DUYA 2B0SL 3W9DB 1OGAD 5GS0D 3V2AR 4PRNA 4H8WC 4PJ7A 1AD9B 4GG6F 4KK8C 4IHOB 4LSVH 4YHIA 3ELAT 1MRFL 4NO2A 1KV3A 2PCPB 4OTXH 3WHE0 1DQJA 3MOAL 4F8QA 5AAMA 1A2YB 4QRQA 5IEHB 2VWEC 5FF6B 2GY7B 4BZ2H 3KDMA 2N7BA 4UOW1 5C0JA 5KS9A 4BSWB 3SHSA 5FO8B 5MHSE 1MUJA 1OP5H 1T83A 1DBML 3BDBA 1MAML 4ZO9A 2ESVA 2UYLA 5AYUL 3QNXA 1T5XA 3TBVA 2WWKT 1OSZB 5GRJH 4PUBH 2EYTB 2NNAB 4EIGB 4XP4H 1XF2B 2OK0L 1YQ2A 1U8NB 3GI9L 4H26A 5E1AB 4GAGH 3UPCA 2R8SL 1YEKL 3FFCA 4OKDA 2ZUQC 1HH6B 3W9DA 3LN4A 5J9PB 3TV3L 4CVUA 1IE5A 3RIAK 3O11A 1AD9A 4XX1E 2C9AA 2ZSVB 4IHOA 3SJVD 3QDME 3QRGL 3BEWB 2Q8BH 2ICWJ 1C7TA 4LGSB 5DQDH 1QRND 1ZT7B 1FL6B 2PCPA 1XR9B 2YD7A 4LPCA 4NZRH 4M1GL 2EE6A 3QFDB 4PJDE 5IEHA 1A2YA 4GAYB 4UTBL 4XP6H 5FF6A 3TBSA 3KXFB 5FM8A 4N90D 3T4YB 5F7KC 1J05A 5B38B 2ZCHH 3RWIB 2YUZA 2H1PH 1FORH 3QWOB 4JZNB 4QYOB 3DOSA 4BSWA 4TSAH 1MLCB 4Z7NE 1ZK9A 1R5WB 3HZMB 3HC3L 3C60D 3MLYL 1OP5K 1OSZA 4L8SB 1KJMA 1EFXD 2NY1B 2EYTA 4LOUD 2NNAA 1NH6A 1XF2A 1U8NA 1FZJB 4OLWH 4BH7B 4LSDA 5J9PA 1CN4A 1T03H 4ZO6A 5C0CE 3CCHB 1UYWL 3W5MA 2ZSVA 4S1RH 3V52L 3BEWA 4MZ3A 4KJPD 1HIMH 1MEXL 3GGWB 1JMZA 1ZT7A 1S7VB 1XR9A 3OXRB 4W70A 4HF5H 1B88A 4Z78B 3NCCB 4YXHL 3QFDA 1DEDA 1G0YR 4PGZA 1IAOB 4GAYA 5T5NF 3CX5K 3KXFA 2HT4C 3NCFB 1FZOB 2YUVA 1G7MB 4PRDB 5B38A 3RWIA 2AK1H 2N56A 3QWOA 3C2AL 3SDCC 4QYOA 1IFHH 3WN5C 1MLCA 5CILL 1KIPB 4L3AA 1R5WA 3HZMA 5HXMA 1RZKH 5EO0B 2ARJQ 5FM5M 5DDHB 2E27L 4KI5E 3GRWH 2EYSB 5I75B 4L8SA 1NCAH 1ONQB 1FGVL 3D1MC 3T1FB 3BIBX 1SBSH 1FZJA 2BC4A 5FHAL 4GJTB 4GRMA 5IP4A 2BNRD 4BH7A 4GG8A 3VWKD 3ARGB 1WCQA 1BD2E 2H9GB 1ZGLB 3CCHA 2Y72A 4JO1L 1DE4B 2K1MA 3ZDXF 4FNLL 4QKXB 2VH5H 4DFIA 4PTUB 4KK9D 4P49A 4K3JH 4RMVA 2EO9A 2FCBA 1FH5L 3GGWA 4NN6C 3MQIA 1S7VA 2DKUA 3I85A 2C3VB 3OXRA 4Z78A 1TQCB 5EA0L 1HN1A 2L4OA 1IAOA 3BXNB 1OW0C 5D71L 3DRQA 4EI5B 1FZOA 4PRDA 3VFGL 3L6FB 4ODUB 4JPKL 5GGQH 4FMKA 4JFZH 5BXFB 4YHYC 1KIPA 1EMTL 2GJJA 4LBEB 4LCWD 2GW5A 3INUL 2AK4B 1EK3A 5DDHA 4KTYA 3OKEB 2VO5A 1IM9D 1SJVA 1T80A 3QHZL 1IGFL 2QR0B 1ONQA 5HHMB 4GMTL 3T1FA 3MBXL 1YJDH 4GW5B 4FZ8L 3GK8H 5EU6D 2GTZB 3ARGA 2YMXH 1HHIB 2B39A 2H9GA 4N0YL 1PZ5B 4E42B 1ZGLA 3N9GL 1LEKB 1DE4A 3I50L 3P9MB 4JFFD 2AS5M 2ICWI 2UVEA 4GOSA 1PLGL 5I1CH 3QBTB 4YHOH 4Z18A 5C0AE 2NY3B 1CFVL 2DQJL 1MCCA 3TT3H 2QKIA 2C3VA 5ISZE 5C08E 1IRAY 1U93B 4APQC 2PW1B 1L9NA 3BXNA 5C0GB 3KYKH 4ZOAA 2VXVH 3MR9B 2QSQA 5F9OH 4PGJA 1I7TB 3L6FA 4ODUA 4JG0H 5JA9A 2VNCA 5BXFA 1SJEB 3QFJD 5JDJA 4LBEA 1JHKH 2AK4A 4AL8L 2VWEE 4EDWL 3T0AA 2G2RB 2OR9L 5I9QB 3SDAC 5I73C 3GBNH 2LFGA 4OZIF 4KZEL 4RGMC 5IR1B 2IANE 2NR6D 4LPXA 1DSFL 4XPFL 3Q6FB 2AJVH 3P4MB 4GW5A 5DRXB 1F4AA 5BV7H 1VERA 1RUQH 1RUAH 4FQ2H 1HHIA 3FO0H 4WHYH 4ENED 1I3RB 1PZ5A 1JI1A 1N64H 2ID5A 1LEKA 4E42A 3DUSB 3P9MA 4PLJC 3QYCA 1BAFL 3MGAA 3QIWA 3ZKMC 1XCTB 3X13B 5D1ZB 4JZOB 5L6YH 4NNXB 1U93A 2PW1A 5E03A 1QACA 5C0GA 4LCCB 2QQLH 3N85L 1QD0A 1I7TA 4HBCL 5D7LB 4LASL 3O3UN 1SJEA 3MV01 4GRWH 5CZVL 2G2RA 3GKWH 4DOHB 1KACB 1S3KH 2WM0A 3K0WA 5IR1A 5CD3B 4ZUVB 4PRPB 5F7NC 4KKBC 5GGSB 3Q6FA 1P84J 3KPQA 1U3HD 3P4MA 2Z0BA 1JYVA 4U1GB 5DRXA 2NLJB 4HFUH 5J4MA 1QYGL 4RDQF 3WFZA 1ZS8B 1FNGB 5E8DH 2XTJE 1I3RA 3OF6A 4P5TC 4GS7C 5JHDD 3DUSA 3BP6B 3ZYZA 4TUOB 1CS6A 3PHQB 3QH3B 1OF2B 3S6CA 4OI8A 2YOCA 4PJXB 1J0YA 3GB7B 2NX5E 3I84A 1XCTA 4Y5YC 3X13A 5D1ZA 5F21B 2DD8L 4NNXA 3OKYA 4JO3L 3HHRB 3BWUC 5DYOB 1TTFA 4LCCA 4FP8L 4M1CC 4FTVB 5E2UL 4XVUC 1OHQA 3CU1A 4KROD 3MBEB 4BH8B 3AXLB 4JR9L 5F7EH 2AV1B 1FNFA 5D7LA 5I8OL 1TDQA 4XNMA 5FEBA 5EC2B 1DR9A 1L0YA 3LPWA 3GMNB 3VI3E 3QQ9D 2FHCA 4AIXA 3O6MH 4PRHE 1IC7L 1JIBA 5K9JL 5CD5C 1G7JB 4DZBB 4ZUVA 5CD3A 3FL7A 4PRPA 5E08L 5E24E 5GGSA 2OZ4H 2APVA 4XBEL 5EUKB 3X3GH 1H3TA 3EO9H 3TIDB 2PYEB 1WZLA 3HFML 2VIRA 1I1RA 1ZS8A 2CPCA 1FNGA 4AQOA 4P2RB 4MXQC 2ZUXA 4NO0D 2Q6WB 5HGGS 5TQ2L 3PHQA 3QH3A 4B0MM 1OF2A 1T1YB 1UZ8B 2B4CH 3GB7A 4NJ9H 3BAEL 4PJXA 1KCUH 2J8OA 1IM3B 3F7RA 3HC3H 5I1DB 4X80H 3D3VE 1X5LA 4RGND 3S37H 4FTVA 4W4NA 5EIVA 3LY6A 4KJQD 3ARXA 2XZCH 3MBEA 4BH8A 3AXLA 1T7WA 1LDSA 4K8RH 4BK5A 4E41D 2AV1A 1WK0A 5EC2A 2VR4A 3MNWB 4KAQL 2EXWC 1QRKA 1T6VN 3MRJB 4ODHH 2CDGB 3FB7B 4YNYB 3UP1A 1G7JA 4DZBA 5AZEH 5DFWH 1B4JL 3QPQD 4R26H 1KIRB 4TSCL 5EUKA 3MGOB 3MYJB 3BDYH 5IF0B 3MGTB 2PYEA 3BX7C 2OJEB 4Y16C 5JUEH 1OM3L 3GKZA 4P2RA 2COQA 3HI6H 2DIAA 2Q6WA 4ALAL 2OXGA 3FRUA 1T1YA 1UZ8A 3M8OL 3MLRH 1UT9A 4HBQA 1IM3A 3IU3B 5ICXB 5I1DA 2VLRB 4MNHB 4OF8A 1BGXH 1UACL 2GITB 2IH3B 3LCYA 4MVBD 1CXHA 2DB8A 1UM4L 4PJBF 5E5RB 1CU4H 2M8XA 5BVJB 4KFZC 1S78D 1SVCP 5D6CB 3QQ3B 3MNWA 1VGEH 3MRJA 1VKXB 5TJWK 4YBQC 4YNYA 4OF0A 1KIRA 4DTGH 3LDBB 3U7WL 3WLWC 4CAGA 3MGOA 3MYJA 3MFFB 3KYMB 5IF0A 1D5MB 3MGTA 1N26A 4JZJC 3L5JA 1QBML 1IBGH 1B90A 4I77L 1CGSH 3L3DB 5DHVH 2C4FT 3F12B 3QXVA 3DYPA 4PJEE 2D03L 3FQTB 3QA3A 3UTTD 4RRPA 3IU3A 2I27N 5ICXA 2YPLE 5MP6H 3BZFB 4IRJD 2VLRA 4IRZL 4MNHA 2IC2A 5GS0C 5F9WC 1KFAL 4M6OH 2GITA 2IH3A 2NY5C 3MLXL 5DURD 3CMOL 3ARPA 3WDIA 5JPMB 2XPGB 5CJQL 1YEIH 5D6CA 4KQ4H 5GZOC 5E4EB 4KC3B 3OZ9H 1VKXA 2DQDL 1VCAA 3BH8B 4M43L 3QO1B 3VXME 1GGCH 3OMZA 4M7LL 4W6WB 4FFZL 3GO1L 5TQ0H 1AR1D 3MFFA 1KNOB 4Q58C 4F3FB 4PLKD 3KYMA 2D7MA 1D5MA 4K7FB 5MI0B 1W72L 4MXWH 2J3SA 1TENA 3DIFB 2Z8SA 1OAKH 1I1AB 1TETL 1W8OA 1KPRB 3L3DA 4IDLA 1T66D 3F12A 4IOSD 5GISH 1A7BA 5IG7B 3RTQC 4B50A 3HNTH 2ESVD 4E5XB 2R0ZL 3BZFA 4EUPH 5GGUB 3RI5F 5I6XC 1BQHG 1JZ5A 1CF8H 2CO6B 3RA7L 2NW3A 3MRBA 3TNNB 4NQCA 3V7MA 3RGHA 3D39B 5DGRA 3QIBB 4L3EB 5I18L 5JPMA 2BVYA 2F58L 3FFCD 2DN7A 5LAXB 1TVBB 3SY0B 4F9PC 3D18B 5C8JB 1BF2A 3BH8A 1UXSA 2VDLH 1YEEH 3LRGA 3LHPL 1PYWB 2ZNXA 4H20L 5F7LB 3H3KA 1EXUB 3DVGB 3GHEH 4CU6A 1W0YT 1KNOA 5L2KE 1T2XA 3CZFB 1RZJL 4K7FA 2DI7A 4LSUL 2BY0A 5GJTH 2C4XA 2R69H 1WITA 1NGXB 5IVXF 3DGCR 3SKUD 3D25B 3DIFA 1MJUH 3WJJC 1I1AA 3ULUD 1KPRA 2C1OB 5D2NC 4XWGH 3OPZH 4Q0XH 5DVOA 3U82B 2HT2D 5FCSH 4KKLD 3WFEL 1WZ1L 5C0FB 4HXAH 4F7MB 3O45B 4QRUB 1V5JA 2DQUL 1J0IA 5IV2B 5GGUA 1LDPL 2FECL 1CK0L 5IBTL 3LQAL 3TNNA 3ILPB 3ZO0A 3B3IB 4P59L 4OFDA 3A0OA 1CTNA 3QIBA 4OLVH 4L3EA 2EDTA 5JZ7D 2RCSL 5I0DA 1UZ6E 4KJPC 2UUDH 2R2EB 5DTFA 5IKCB 5LAXA 1TVBA 5EDXA 1TPXC 3HC4L 3SY0A 1X4ZA 3D18A 5C8JA 5C07B 2YEZB 4I0PA 4PV9B 2HKHH 1NFKA 2YXMA 5DRNB 1PYWA 4NPYA 2CDFB 1INDH 1EXUA 3DVGA 2ZJSL 4WVRA 5HBBA 1AKJB 3VGHA 2KH2B 3RIAF 3J8F7 3CZFA 5KSBF 2BHUA 3H2WA 3QEUB 1NGXA 5I8CB 3KXFD 4OFIA 2ED9A 3D25A 3O4OB 4PJGE 2C1OA 4QRSB 1IEAB 5I8OH 2YXFA 4LLUA 4LFHD 2VXUH 2APFA 4F7MA 4ZDHB 3O45A 4QRUA 3SDYH 3VWKC 2MKLC 5IV2A 3QJFB 5LVEA 1LO2L 1MAJA 2NY1D 4XMKH 1X5FA 2A6JB 4RFOH 3ILPA 3B3IA 4JB9L 2AJXL 4TTGA 1EO5A 1IGYB 4KK5C 4KK9C 2R2EA 5IKCA 3FQUB 2UUDK 3DECA 4BFGA 2BERA 4X6DF 1HXMB 3S9DB 5C07A 4AEFA 2YEZA 4PV9A 4X9GA 5DRNA 4AG4H 2CDFA 4N0FB 3WIFA 1A6UL 1R3IH 1AKJA 4XNUH 5C0RH 1DDHB 1P1ZB 3QEUA 5I8CA 4HT1H 1OAYH 1BFVH 2AJ3B 1ZANH 2J12B 4J3XA 2NCMA 1DVFB 4ZS6C 2VL5B 1J5OH 3ARWA 5GQBA 1TJHH 4NN7C 4QRSA 4V1DB 1G7PA 3NMEA 1IEAA 1G6RL 1N6QH 5IBLD 3LQAC 5FYKU 4ZDHA 4Y8AA 2EECA 5BZWB 3H7LA 3QJFA 2EDRA 2XKSA 4HIIB 5BRZB 5JOPD 3W39B 1IGYA 1AI1H 3ARGD 3FQUA 4JO4H 4KMTH 5TE7L 1OGAE 3AUVA 1KTRL 3IXAB 1K9TA 4X7SL 1UADC 1HXMA 4HWEH 3HG1B 3GHBL 3IRPX 1Q0YL 3WUZA 4N0FA 3ARFA 3QUZB 1DDHA 1P1ZA 4MCYB 3UAJD 3KYNB 3THML 5C1MB 3DI3B 4EI5D 2AJ3A 2FDBP 3UYRH 1DVFA 3MLUL 4WFED 2NR6C 2VL5A 4OCRH 4JFHE 3V7AE 4KDWA 4V1DA 3REVB 5DD0H 2HLAB 2AK4D 2X4UA 2YPKB 4P5MB 5IHUL 5HHMD 1MCFA 4HIIA 4ORZC 5D5MF 5BRZA 2YN3A 4ENEC 1EHLH 1RY7B 2A0LC 5F1SA 5SWSB 3W39A 3PGFH 2APWA 4F33B 2EDBA 4AJ0A 2A9NL 1QLEH 3BIKB 4RX4A 1AQDB 4HULB 2R1YB 3CLEL 3MZGB 4PB0H 4X4YB 3MLZL 1DP0A 3EYSL 1B0WA 1J8HB 2J88H 4Y19E 3IXAA 3UJTL 4OQTH 3WFCH 1U41A 3C09B 3HG1A 4LAQL 5TE6L 3SJVE 3FONB 1JGUH 2ZKHL 2NY3D 3TNMB 1QRNE 4IMLB 2AJSL 3QUZA 2DQIH 3R4DA 4H0HB 4MCYA 3ZE1E 2R0LH 1UM6H 3KYNA 1FSKB 5HJ3B 5CUSH 1BBJB 5ENWB 3HI5L 5C0EB 1IMHC 1F4YH 4WWKB 1DL7L 1YQVH 5SWZB 1MWAL 5FDYA 1CXKA 3REVA 2EXYD 5LWYH 1WBZA 1V05A 2HLAA 4GG6B 4HKJB 1PG7H 2YPKA 2WK2A 4OT1L 5E94A 4P5MA 4D9LL 2OR8A 2RHEA 4Z7QF 1HINL 2ERJB 1Q1JH 4M6ML 1JF1B 4FFYL 2NY0B 3JTTB 1NLBL 3HZVA 4ZAKC 4F33A 5HHQB 1IKNA 1KF9B 2XZQL 3LS4L 3BIKA 4YWGL 1AQDA 3GSOB 2R1YA 4X4YA 3FOLB 3SE4C 4TRPL 5GS1B 1J8HA 1ZLVH 3C6SB 5D1QA 5F7DB 2B2XL 3NACL 4HIEA 3VI4E 3FONA 4YFLI 4Y88A 3TNMA 1X4YA 1P5UA 5ITBL 5A2FA 3CVHH 4IMLA 2X41A 4KROC 3S36L 4UBDD 3EOBB 5D1ZD 4HCRH 1HNGA 1Q8MA 4HK3N 4GQ9H 5HJ3A 1BBJA 3SPVB 5ENWA 3QQ9C 5C0EA 1PSKL 1AXTL 2JTDA 3MCG1 4JY5H 1U8QB 4LEXL 4WWKA 4MJ4A 3CFJB 4NOFA 5SWZA 2YD1A 5D7LD 2DTSA 1NAKH 3VXUE 4X7EC 5B8CC 1P53A 4HKJA 5FUZH 3O41B 4XNQA 2VERN 3MRLB 3TYGL 4PRPD 3JTTA 5CMAB 2VXSL 1HEZB 5HHQA 2VZVA 1GC1L 4U7MA 2BNRE 3C5ZB 3GSOA 1G6VK 3FOLA 2EEAA 2VZ1A 4ZUTB 5GS1A 4ZTOH 1BPVA 4X6EB 5L2JB 3C6SA 3MJ8B 3AGVA 5F7DA 2ZCLL 4RGNC 1ZLVK 2XG4A 3IGAB 2C3HA 4NHCH 3FB6B 3P2TA 3EOBA 3VMNA 1XGPB 3ESUF 4Z7WA 5DJ0B 3SPVA 1OARH 4FTVD 4XI5D 1R3HB 5EIQA 4GAJL 5I15H 5IQ7L 3MBED 1U8QA 2J5LB 2E7BA 3CFJA 3EYUH 2VQUA 3HC0B 3QPQC 1F3DH 4LCWE 5JOFA 5GHWL 5HVHC 4Q9RL 3O41A 2FBOJ 2E6PA 2R9HC 1ZLSL 3MRLA 2CRIA 5CMAA 3HA0A 1AP2A 2PYED 4GRWF 5DFVD 1MCDA 5EU6E 4ZUTA 1KGCD 2EDEA 4P2RD 4NP4H 4X6EA 1MJ7L 4QHKJ 5L2JA 3MJ8A 4BZYA 3GMRB 4PYHA 1K8IA 2Q8AH 3D0VB 1A9BB 3VE0B 3IGAA 4MVBC 1BIHA 2H6PB 4KDTC 3FB6A 3GSUB 1NFDF 2I07B 1FDLH 1S78C 1CD0A 1XGPA 1DQLL 2GQHA 4OM0H 5DJ0A 4M62H 5BCAA 1CE1H 1P4IH 1R3HA 3KPTA 1QBBA 4X7TB 3QHFL 4UINL 1BREA 2HLFD 4S1QH 2EE9A 3VXPA 3HC0A 3KLAB 3QUMH 2ENSA 3QFJE 4Z7UF 5DVMA 3S3JA 3VRLF 4XP5L 2VISB 1SBBA 4PG2C 1N7MH 5AD0B 4LQ1A 4D3CL 5CJ8A 1YNLL 1EX0A 2BVEA 2EIBA 4RBPH 3ULUL 1F6AB 5H2BB 1ORQB 2R4SH 4IRJC 3EYFB 5T5FH 2D7PA 4R8WL 2XQBH 5I71B 3GMRA 2YPVH 1UXWB 3MACH 3D0VA 1A9BA 3VE0A 4CVZB 2DLTA 3MRRB 5HYJE 5IGXH 2H6PA 3GSUA 4KUCD 2Z9TA 4MA1C 2I07A 2V5YA 2WBWB 1FVDB 1XT5A 2VLRD 1CDGA 1ACYH 1QFWH 4K3DH 4TULH 2JKXA 4KY1H 2YA1A 1UFUA 2J8UF 3WFBH 2GKIA 4X7TA 1BEYH 5I16B 3K4DA 1QSFB 2WP3O 4KHXH 3KLAA 2XT1B 1RJLB 4WI6A 5HGDB 1AR1C 4TPRH 1N0XL 4PLKC 3WKML 5KN5B 4OD1H 2N1KA 5E95B 4AENA 2VISA 4NM4L 1MCOL 5AD0A 4JANB 4I3SL 4NZJA 5D72H 1KN4H 4XNZB 3CU7A 1ZKAA 3QCUH 2QBWA 4F7CB 1F6AA 1T83C 1ORQA 4JM2B 4XX1G 2XACC 2DRUA 3ULVF 4BZ1H 5FYJH 3EYFA 3MNVB 3NFSL 5JHDE 3U79A 1IZJA 2ZUTA 4CVZA 1CLZH 1BVLB 3MRRA 2NY6D 1MI5B 1MRCL 3V0WH 3KPLA 1J0ZA 3CAFA 1LGVA 4KVCL 4R0LC 1F02I 1FVDA 4OZIB 3N50A 4WUUB 3RNKB 3ZKNC 4U6YB 1NBVH 5IROA 4XPTH 1I3UA 5I16A 1U42A 3KJ6H 1QSFA 5CGMA 1PDKA 4YDVB 4KZDH 3IU4H 4CDHA 5HGDA 4OLYH 2E8YA 5DR5H 2GUOB 5KN5A 4HS8H 1NCWL 1ITCA 1IT9L 1F4XH 2B5IB 3CK0L 4JANA 2OLDA 1F2QA 3B2VH 2HT2C 4YDJB 4KKLC 4F7CA 5FV2A 5CEZL 4JM2A 3PWPB 4QHKI 4YFDB 2QQNH 1I1AD 1D6EA 3MNVA 4HWBA 4M4RA 3UZVB 3DX7B 4NQTA 2P5EB 3E0GA 4HUXB 1BVLA 3LB6C 3VMOA 1MI5A 3P3YA 4NZUL 4PLOB 5JZ7C 4OJFH 3T2PA 3PXHA 1A6VH 4UAOB 4PBXA 1N5YH 4R3SB 4WUUA 3RNKA 5F93C 2P46B 3D39D 4U6YA 3QIBD 5DF0A 3G6JE 4L3ED 2C26A 3W2DL 5D7SH 4JO2H 1NCNA 4YDVA 4E41E 3CX5J 1WIPA 4M3JA 4NOBA 3N1MC 4JFPB 4ZTPL 2GUOA 3GJFH 2Y6SC 4UTAH 5CJ5A 5J57B 1ADQA 2GEEA 1J12A 1G9ML 2DLHA 1YNKH 5ANME 1FIEA 4XH2B 5C2BH 1MHPL 5CJOH 1D5BA 2I60H 3QP3A 2CD0A 3PWPA 3M07A 4KGLA 4L8SC 1L9MA 1MCWM 3DX7A 5D6DA 4H1LB 2P5EA 3BE1L 3QNYB 4HUXA 4N9GB 3BKCL 2X1XR 1J9CT 4I9WD 2B1AL 5FYLH 3T2QA 1EJ6A 4OF5A 2EIEA 3BD3A 4TVSa 2IWGA 3Q5OA 5HHXH 4R3SA 3SGEH 5I8EB 3QI9B 1NUDA 4Y7MA 4FXGB 2AJUL 4GBXB 4P23B 3LH2H 1ZEAH 3EBAA 3MJ9A 3MCLL 3SGDH 3SOBL 3EJZD 4JFPA 5C6TH 4FQLH 1DUZB 2WP3T 5C07D 3ZDYF 3GJFK 3AC0A 2NQCA 4WFGE 4AYFA 3VFVB 1AKJD 2B20A 3GSVB 2ORBL 3WD5L 1TQBB 4XH2A 2DQCH 2NTSP 4RNRB 4LVOC 4D9QD 1UEYA 3WIHA 5IBLC 1CWVA 3QAZC 5AWNL 2R56L 2Q7YB 5I75C 5JIIA 4QXGH 1I9IH 1NGPH 3DBXB 3IDNA 1XR8B 3BZEB 5I1JL 4H1LA 4U6TA 5DMYA 3QNYA 4N9GA 4KU1A 4HKXA 3H9SB 3N0PB 4XP9L 3WIIH 1FL5B 1LEGB 4N8PA 5I8EA 3QI9A 1ZVSB 3L5XH 4L9DA 3SKJH 5FA3A 4HJGA 5JW4N 2VZ3A 3RX5A 4B7IA 1QEWB 4FXGA 5DGQA 4GBXA 4P23A 4BUHA 2O61A 1C12B 1G9MC 4PJ7E 1A1MA 2CK0L 5DS8B 4I4WB 1LE5B 1TQCC 1DUZA 4P4RB 3UAJC 1A4KB 4WUKL 1IVLA 1FCGA 2BNQE 5KVEH 3K2UH 3L1OH 5FCUL 3VFVA 3GSVA 4YUEL 5I76B 5FGRA 4RNRA 1YY9C 2V2WB 4K7PH 1JP5A 3CPLB 5HPOA 4PJBB 2Q7YA 4YGVB 5KTEL 1NBZB 3DBXA 1XR8A 1DVFD 3U2SB 3BZEA 5IB1A 1X44A 1W2KT 4V1DD 1EEZB 2WUBL 1RVFL 1QOKA 4GW4B 2ESVE 5DK0B 4NQXB 3LEVL 1FL5A 5F7FA 5BRZD 1ZVSA 1QFOA 1EEQA 1HHHB 3I6LD 1HSAB 1J1OH 3P4OA 1QEWA 2XKUA 2NY3C 3FFCE 2G9HB 5E2WH 1WEJL 3QIWC 1CCZA 4OM1L 3V6BR 5ESAB 5DS8A 1LE5A 4J4PA 4LQFL 3HG1D 4P4RA 4FFVD 1A4KA 4PJCF 1QKZH 1RQ5A 2E6JA 5DA0B 1F3JB 4URTB 1RUKL 3I6KB 4MAYB 5HHVH 1I3GH 5I76A 2H26B 3QUZD 5CP3A 4I1NB 1VGKB 2EXYC 2V2WA 4MJ6B 2MWCA 3CPLA 5AAWA 1GGTA 2F5AH 3LMJH 1B9ZA 3ULUE 4YGVA 3NCEB 1NBZA 2L0DA 2IPTL 2R4RL 3SKNA 4JM4H 1EEZA 3TJEH 4GW4A 5DK0A 4NQXA 2NPLX 3ZE2F 5J06A 2LE9A 2JCCF 1HHHA 5SWSD 3MV9B 1S9YB 4NKIH 1L0XA 3PWLB 4R7DB 5FHBL 5FGBA 4M7KL 2G9HA 2NYYD 5LGHL 1J8HD 4WCYL 3WXWH 5D1ZC 1GGUA 5ESAA 1D6VL 2DBLL 1SJHB 5CLWA 2CXKA 3CDGB 1JRHL 3QQ4B 3LKSB 4LCCC 4R90H 5C0DB 1CGUA 5HI4D 1F3JA 3TWCL 3I6KA 4XPAH 2H26A 3QXDB 1PY9A 1VGKA 4YO0B 5GS2D 3P11L 4MJ6A 4OAWB 1NCDH 4GXUN 1KJ2B 5DJ6A 4OD3H 4OCXH 4WWKD 4LLDB 5SWZD 5HDLA 5GSRB 2XQYK 1ZHBA 2UZXB 4RIRB 2XWJB 4U1GC 2VL4A 2RFXB 3W81A 4LIQL 1HWGB 2GSIB 2HKFH 5GRVK 1CL7I 3LD8C 4KMLB 1UQSB 3V0VB 2NY0D 4XNYH 2DLGA 4JFOB 3U36A 3MV9A 1S9YA 2P8PB 3PWLA 4R7DA 4U1KB 1YECH 3PV7A 5IVXB 1AO7B 1F58H 1PD6A 2FEDD 2FEEI 1LQSR 1QTYT 1SJHA 2OMBA 4Y4KA 1MHCB 4U3HA 3CDGA 3QQ4A 2PR4H 3LKSA 3O0RL 3VXSB 1KCLA 5C0DA 1NCBL 4F7TB 5KBNC 4KKCD 1A7RL 3MBEC 4GRLC 4PP1D 3VCLB 3MOBL 4YO0A 5D93B 2IBGA 4OAWA 3RL1B 5IW6B 2D7TH 4Z8FH 1ETZB 5GRYA 5IESH 4XCFH 1SYSB 1PKQB 1J0JA 2JJTA 4HEPG 5CEZE 2ZOLB 1UA6L 1C08B 1E4XI 3I2CH 3BD4A 4LLDA 3AB0C 5GSRA 4RIRA 2XWJA 3BH9B 2VKXA 2RFXA 5ILTL 2GSIA 1C5CH 5HD8D 1MIEH 3C8KB 4JJ5B 2X4OB 4XCEB 4PR5B 1UQSA 3V0VA 4NDMB 4GLRH 1T2QL 4F9LA 5JOPE 4JFOA 2V7NA 5KSBB 2P8PA 1MY5A 1RUPH 4U1KA 3C5ZD 4OGXH 5IVXA 1AO7A 4KJWD 5JMRA 3VD3A 5DWUH 4X6CB 3H42L 1GGIL 1IEHA 3F65A 3K2MC 3NZHL 1MHCA 4C4KO 2CXGA 1C16B 1WC7B 1XGYH 2BOBB 1D5IH 3NIGF 3VXSA 4ZUUA 4F7TA 4M5YL 4DZ8B 4QWWC 3VCLA 4H88L 1FJ1B 2JB5L 2FX8L 1OSPL 3F7PC 3RL1A 1FIGL 1ETZA 2JJUA 3FQXB 1PKQA 2ZOLA 1C08A 3RNQB 4WFEE 5L7XL 3GUTA 4U6VL 1L6XA 3GSNL 3BH9A 4N68A 4OD2B 2AJYL 3EDEA 4X6DB 1MFAL 3DSFL 1BMGA 3T8XB 3C8KA 4JJ5A 2WUCL 4Z0BH 2KQMA 2X4OA 4XCEA 4ZFGH 3MRIB 4NDMA 2E7LA 1OY3B 4FFWD 4MQSB 1JZ8A 2H32H 2Z8VC 3DURB 1PX3A 1DBAH 2P49B 4S2SB 1FL3A 1LO4L 4JCLA 4X6CA 5EOCL 4LNVA 3EOAB 3QDJB 1OPGH 2UWEB 1EGJH 5TFSH 3P73B 1FO0B 1C16A 1WC7A 2BOBA 4YK4B 5JXAH 5CBEB 4WGWB 4DZ8A 5EU5A 2Y36L 4MD0B 1IQWH 5E0QA 1IAKB 1FJ1A 4Z95L 4GKOA 3PE9A 1RV6X 5IM7B 4P3DB 2W59A 3D2UB 3V4UH 3E6FB 2BRRH 1VESA 3FQXA 1UJ3B 3SQBA 5C0CB 3RNQA 5CSBA 4IIQA 3HE6B 2CKBH 3LDBC 4EVNB 1T6WA 3V6ZB 3MV8E 5C0BB 4P2QB 1MVUA 3MRIA 3T77B 4QHMB 3ROLA 3DURA 4X8JB 1JWMB 2AEPL 1OCWL 4S2SA 1XH3B 4O9HL 5IOPB 2IG2L 3TN0B 3BPCA 1CDCA 4ONGL 5T3ZD 4QXUL 3EOAA 3QDJA 5A16B 5HVWA 5FYKL 2UWEA 4WIQA 3DLQR 3P73A 2YWYA 3LV3B 3RVXD 1FO0A 3S34L 1WBYB 2JJSA 1RULL 3K74B 4ZOCA 5CBEA 1JGEB 1YEDB 4MD0A 4PJHF 4LHUB 5CEYB 1EHNA 3F8UB 4J3UA 3EDDA 1IAIL 2EDJA 4HAGA 3CFCL 1BD2B 4CU7A 4P3DA 5IM7A 3D2UA 3S96B 4I3RH 3E6FA 5C0CA 1AY1L 1QSFD 3KPPB 1RK0B 1ZT1B 5D7LE 2FD6H 1YYMH 3SE8H 1G9NC 1HSBB 5LCVH 5JR1L 4EVNA 3IKCB 3AMKA 3BT2H 3V6ZA 3SE3A 3M17B 5MI0C 1JYXA 4DOHE 5KJRL 4P2QA 5C7XH 4HFWB 3T77A 4PRPE 4MD5B 2YSSB 5E8OB 1JWMA 1XH3A 5TPWL 4P48A 5IOPA 4RGOH 4DGIL 3TN0A 5EU4B 4JM2D 5GSVB 1ND0B 5A16A 4QRTB 5CBAB 1AR2A 5DXWA 1H3XA 3LV3A 3AS3A 1ZXQA 4PJXE 1WBYA 1MI5D 3N1PC 3QIBC 1JGEA 2LU4A 4JN2A 4WEBL 3MLPA 1YEDA 4JLRB 1JK8B 4LHUA 5CEYA 2AGJL 4WUUD 3OR7B 4OI9A 4BQ6A 5IJKA 3TFKD 1BD2A 4YDLB 3S96A 4FTVE 2QQKH 5E2TH 1T7VA 1MJ8H 2K3TA 4I0PC 4U2YA 2BVOB 3KPPA 1RK0A 3HE7B 3I3EA 4KHTL 8FABA 1ZT1A 4ZFFB 1OB1B 4YDKL 1HSBA 4OCWH 1G84A 3IKCA 3WO4B 3BKJL 4K7PX 4WU7B 2BMKB 2X44D 5T1MB 3V9FA 3M17A 2XA8H 4NQEB 4UT9L 5C71A 1UKSA 4HFWA 3BZ4A 3DX9B 3O2WH 4ZFOB 1WWBX 4MD5A 2YSSA 5E8OA 3F62A 2LU3A 2QHRL 4Q9BA 1D3CA 5C0IB 5FDWB 2PYEE 4L4JA 5EU4A 5GSVA 3O9WB 1KGCE 1ND0A 3PWPD 3LOWA 2EH7H 4P2RE 4QRTA 5E8PB 3QUXA 1WBXB 2P5ED 4CU8A 3NABH 4EZMA 3IJHB 1ZT4B 4TYUA 1S9WB 1JK8A 3MUGA 2IBZY 3OR7A 3PUCA 3A6OA 3EJZC 1GAFL 1JPTH 5MEPA 5D8JL 3HNSL 3ZL4H 2F19H 1FE8L 2HH0L 2BVOA 2I9LB 3HE7A 3N06B 3SCMB 4ZFFA 1OB1A 3NCJH 4NZTH 1M7IA 3U7YH 4J1UB 5IHZB 1EJOL 3O6KH 4WU7A 2MCPH 1U8MA 2BMKA 3CXDL 5T1MA 3WLBB 4EEEA 4YXLH 4NQEA 2AXJA 5BV7B 3IDIB 4LIQE 3DX9A 1NGQL 4C56E 4ZFOA 1QR1B 3BSZL 1S5IH 5JHLL 1JFQH 2PYFA 5C0IA 4JFXB 5FDWA 2FHBA 3O9WA 3MXWL 4P2OB 5E8PA 2OSLB 3FTGB 1WBXA 2MPAL 2NY2B 3IJHA 4M4PA 3NAAH 4CN6A 1OWWA 1ZT4A 3ALXA 4LVHB 1G7LB 2HJLB 1S9WA 1UENA 1WVZA 2O5YH 4UOJA 5B22A 2AXFB 3U4BL 2VLRE 1AD0B 1CD1B 4G7YL 3QI9D 4P3CH 1A3LL 3D5OF 2JE8A 2X1OA 5T33H 2XTJB 3P4NB 2CUMA 4RA0C 3WYRA 3V7AG 2I9LA 4OZHB 4GBXD 4P23D 3SCMA 4OV5B 1LO3L 2B1HH 1WTLA 4J1UA 4CADB 5IHZA 4LRNH 5FB8B 1FYTE 3WLBA 3ARFC 1PQZB 1YMHB 4Y89A 3IF1B 4YC2B 3NTCH 5FUOL 4RA3A 3IDIA 2VAAB 4YPJA 1CYGA 4M7LT 3EUUA 5BVPH 4JHAL 3CNKA 2V5RA 4JFXA 1U6AL 3LZFH 5GS0H 5ETUB 1FFOA 4EDXB 3GEWB 4NJAH 3F6IA 3UC0H 2NY5H 2EE3A 4NWUL 1U3JA 4P2OA 2OSLA 4PRHB 5H94B 4O58L 3H9SD 1JZ3A 1G7LA 2AXFA 1CD1A 1M7XA 3TO2B 2VXTL 5A43C 3P4NA 1KXTB 1NC2B 4OZHA 1B6DA 1Y6KR 5LXGH 1NEZG 2DI8A 2Y1VA 4ONHB 4DJMA 4CADA 4D0DB 5FB8A 2NX5A 1FNSL 3QUZC 4YHLH 5IMKA 1PQZA 4J4PD 3VFPB 4WNQB 1YMHA 3Q6GH 3ARDB 3IF1A 4MDJB 1R3KA 4ELMF 3ZDZF 3WMSA 5J1AB 2VAAA 1FAIL 4U1MB 2J4WL 2ADFL 4GXVH 4KI5F 2X10A 3VXRB 5ETUA 4EDXA 5J1SC 4XTRC 4NUGL 2J8UB 2ZUYA 2CJUL 3VD4A 3U4AA 3G9VA 5KVFL 1CFQB 2Y7QB 1JPSL 3F7YB 5C09E 1TZGH 3WNLA 2ED8A 4PRHA 3TJHD 3DX6B 3FRPG 5E99H 4HS6B 1EERB 2YD5A 5H94A 1IKNC 1N6UA 4XVSL 3I3BA 5EORL 2NY7L 2NYYC 1ED3B 4LCUB 2FIKB 5GJSL 3TO2A 1OVZA 3Q48A 1K5NA 3D39E 5D1QC 5IJVB 3C09C 4L3EE 1NC2A 2A6DB 1S9XB 3JBG7 3QIUD 1BFSA 1ZA6B 5ALCH 4ONHA 2H2PD 5HI4C 1EHXA 1ZAGA 4IDJH 1DFBL 3HS0A 4R4FH 3VGAC 5BZDA 3I3DA 2VZUA 3GIZL 3VFPA 4WNQA 2NTFB 3ARDA 2OZ4A 1FSKC 3D3VA 4MDJA 5J1AA 2IFGA 5J8OA 1VPOL 1W0WB 4OGZA 3MO1B 5IBUG 2P24B 4MAYD 4U1MA 4KTDL 4XC3H 5BMFL 3IAPA 3VXRA 1IGIH 1EO7A 4QXTB 5EB9A 2DI9A 1IAIH 4KTEH 4HPOH 2Y7QA 3F7YA 3GDBA 2FX9L 1C5BH 5J56B 3CDCA 3DX6A 3OV6A 2NY0C 5EWIL 5FYKE 5IQ9A 4HS6A 4O5LH 4Y4HC 4OLXH 1A6AB 1K8DB 2KKQA 5ACMA 4POUB 2XI9A 2XKNB 5GS1C 1ED3A 4LSQL 2FIKA 1DQMH 2FEDC 4LPUA 5IJVA 3EYVB 4HUNB 3MV9D 2A6DA 1S9XA