2II5A

Crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), isobutyryl-coenzyme a-bound form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
234
structure length
234
Chain Sequence
b'GKDRTEPVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIATELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPRFNEKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENPAFMLLDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoamide acyltransferase component of branched-chain alpha-
publication title A synchronized substrate-gating mechanism revealed by cubic-core structure of the bovine branched-chain alpha-ketoacid dehydrogenase complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 65
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2ii5A01
1XL8A 3CLAA 4CLAA 5FALA 4JN3A 1DPBA 2XR7A 3L60A 2II4A 4KE4A 2RKTA 2CLAA 4KECA 3FOTA 4HVMA 1EABA 1Q23A 3U9FA 4JN5A 2E1UA 1L5AA 5DUAA 5KJTA 2E1VA 4N72A 1DPCA 1QCAA 5KJWA 5KJVA 5FANA 1XMCA 2VSQA 1XL7A 1CLAA 2ZBAA 3MAEA 4G0BA 1EAAA 4G22A 1DPDA 1EACA 1NOCB 2II5A 3B30A 1EAEA 2XHGA 5DU9A 1E2OA 1PD5A 1EADA 2RKVA 2I9DA 5KJUA 1CIAA 2BGHA 4G2MA 3B2SA 3U9BA 5KJSA 2E1TA 2JGPA 1EAFA 2II3A 1SCZA 1Q9JA 5T3EA 3FP0A 2IHWA 1XMDA 1C4TA
chains in the Genus database with same CATH superfamily
3CLAA 4JN3A 1DPBA 4KECA 2E1UA 1NDIA 2DEBA 5DUAA 1QCAA 2RCUA 2VSQA 1CLAA 4G22A 4EYWA 4G0BA 1DPDA 1NOCB 2XHGA 1E2OA 1NM8A 5KJUA 2I9DA 2FW3A 1S5OA 1Q9JA 3FP0A 1XMDA 5T3EA 1XL8A 2FYOA 2H4TA 2FY2A 4EP9A 2FY4A 2XR7A 2FY3A 2CLAA 4HVMA 1Q23A 4JN5A 1DPCA 5KJVA 1XMCA 3MAEA 2H3PA 1PD5A 2RKVA 2BGHA 3B2SA 3U9BA 1T7QA 2E1TA 2II5A 4CLAA 2II4A 2H3UA 2RKTA 4EPHA 1NDBA 1T7OA 1EABA 1L5AA 5KJTA 2E1VA 4N72A 5FANA 1Q6XA 2ZBAA 1XL7A 1EACA 3B30A 1CIAA 2FY5A 5KJSA 1EAFA 2II3A 1SCZA 2JGPA 2IHWA 1NDFA 1C4TA 1T1UA 5FALA 3L60A 2H3WA 4KE4A 3FOTA 3U9FA 5KJWA 1T7NA 1EAAA 1EAEA 5DU9A 1EADA 4G2MA
chains in the Genus database with same CATH topology
1XL8A 3CLAA 4CLAA 5FALA 4JN3A 1DPBA 2XR7A 3L60A 2II4A 4KE4A 2RKTA 2CLAA 4KECA 3FOTA 4HVMA 1EABA 1Q23A 3U9FA 4JN5A 2E1UA 1L5AA 5DUAA 5KJTA 2E1VA 4N72A 1DPCA 1QCAA 5KJWA 5KJVA 5FANA 1XMCA 2VSQA 1XL7A 1CLAA 2ZBAA 3MAEA 4G0BA 1EAAA 4G22A 1DPDA 1EACA 1NOCB 2II5A 3B30A 1EAEA 2XHGA 5DU9A 1E2OA 1PD5A 1EADA 2RKVA 2I9DA 5KJUA 1CIAA 2BGHA 4G2MA 3B2SA 3U9BA 5KJSA 2E1TA 2JGPA 1EAFA 2II3A 1SCZA 1Q9JA 5T3EA 3FP0A 2IHWA 1XMDA 1C4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XL8 A;  3CLA A;  4CLA A;  5FAL A;  4JN3 A;  1DPB A;  2XR7 A;  3L60 A;  2II4 A;  4KE4 A;  2RKT A;  2CLA A;  4KEC A;  3FOT A;  4HVM A;  1EAB A;  1Q23 A;  3U9F A;  4JN5 A;  2E1U A;  1L5A A;  5DUA A;  5KJT A;  2E1V A;  4N72 A;  1DPC A;  1QCA A;  5KJW A;  5KJV A;  5FAN A;  1XMC A;  2VSQ A;  1XL7 A;  1CLA A;  2ZBA A;  3MAE A;  4G0B A;  1EAA A;  4G22 A;  1DPD A;  1EAC A;  1NOC B;  2II5 A;  3B30 A;  1EAE A;  2XHG A;  5DU9 A;  1E2O A;  1PD5 A;  1EAD A;  2RKV A;  2I9D A;  5KJU A;  1CIA A;  2BGH A;  4G2M A;  3B2S A;  3U9B A;  5KJS A;  2E1T A;  2JGP A;  1EAF A;  2II3 A;  1SCZ A;  1Q9J A;  5T3E A;  3FP0 A;  2IHW A;  1XMD A;  1C4T A; 
#chains in the Genus database with same CATH topology
 3CLA A;  4JN3 A;  1DPB A;  4KEC A;  2E1U A;  1NDI A;  2DEB A;  5DUA A;  1QCA A;  2RCU A;  2VSQ A;  1CLA A;  4G22 A;  4EYW A;  4G0B A;  1DPD A;  1NOC B;  2XHG A;  1E2O A;  1NM8 A;  5KJU A;  2I9D A;  2FW3 A;  1S5O A;  1Q9J A;  3FP0 A;  1XMD A;  5T3E A;  1XL8 A;  2FYO A;  2H4T A;  2FY2 A;  4EP9 A;  2FY4 A;  2XR7 A;  2FY3 A;  2CLA A;  4HVM A;  1Q23 A;  4JN5 A;  1DPC A;  5KJV A;  1XMC A;  3MAE A;  2H3P A;  1PD5 A;  2RKV A;  2BGH A;  3B2S A;  3U9B A;  1T7Q A;  2E1T A;  2II5 A;  4CLA A;  2II4 A;  2H3U A;  2RKT A;  4EPH A;  1NDB A;  1T7O A;  1EAB A;  1L5A A;  5KJT A;  2E1V A;  4N72 A;  5FAN A;  1Q6X A;  2ZBA A;  1XL7 A;  1EAC A;  3B30 A;  1CIA A;  2FY5 A;  5KJS A;  1EAF A;  2II3 A;  1SCZ A;  2JGP A;  2IHW A;  1NDF A;  1C4T A;  1T1U A;  5FAL A;  3L60 A;  2H3W A;  4KE4 A;  3FOT A;  3U9F A;  5KJW A;  1T7N A;  1EAA A;  1EAE A;  5DU9 A;  1EAD A;  4G2M A; 
#chains in the Genus database with same CATH homology
 1XL8 A;  3CLA A;  4CLA A;  5FAL A;  4JN3 A;  1DPB A;  2XR7 A;  3L60 A;  2II4 A;  4KE4 A;  2RKT A;  2CLA A;  4KEC A;  3FOT A;  4HVM A;  1EAB A;  1Q23 A;  3U9F A;  4JN5 A;  2E1U A;  1L5A A;  5DUA A;  5KJT A;  2E1V A;  4N72 A;  1DPC A;  1QCA A;  5KJW A;  5KJV A;  5FAN A;  1XMC A;  2VSQ A;  1XL7 A;  1CLA A;  2ZBA A;  3MAE A;  4G0B A;  1EAA A;  4G22 A;  1DPD A;  1EAC A;  1NOC B;  2II5 A;  3B30 A;  1EAE A;  2XHG A;  5DU9 A;  1E2O A;  1PD5 A;  1EAD A;  2RKV A;  2I9D A;  5KJU A;  1CIA A;  2BGH A;  4G2M A;  3B2S A;  3U9B A;  5KJS A;  2E1T A;  2JGP A;  1EAF A;  2II3 A;  1SCZ A;  1Q9J A;  5T3E A;  3FP0 A;  2IHW A;  1XMD A;  1C4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...