2II5A

Crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), isobutyryl-coenzyme a-bound form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
234
structure length
234
Chain Sequence
GKDRTEPVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIATELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPRFNEKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENPAFMLLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoamide acyltransferase component of branched-chain alpha-
publication title A synchronized substrate-gating mechanism revealed by cubic-core structure of the bovine branched-chain alpha-ketoacid dehydrogenase complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 65
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2ii5A01
1Q23A 5DUAA 1XL8A 5T3EA 3U9FA 3B30A 5KJUA 1CIAA 4KE4A 1XMDA 2I9DA 1DPBA 5FANA 2II3A 2II5A 5DU9A 1XMCA 2CLAA 2E1UA 1EAAA 1DPDA 4JN5A 4JN3A 5KJWA 4N72A 2VSQA 1Q9JA 2IHWA 1XL7A 1EADA 1PD5A 1CLAA 5KJVA 3U9BA 4G0BA 1EAFA 1L5AA 2RKTA 2RKVA 1SCZA 2ZBAA 1EABA 1EAEA 1QCAA 2E1VA 4KECA 1C4TA 3MAEA 3B2SA 5FALA 2XHGA 1EACA 2XR7A 2II4A 2E1TA 4G2MA 4CLAA 1E2OA 3L60A 2JGPA 5KJTA 5KJSA 2BGHA 3FOTA 1NOCB 4HVMA 3FP0A 3CLAA 1DPCA 4G22A
chains in the Genus database with same CATH superfamily
1T7QA 5DUAA 2DEBA 3U9FA 3B30A 5KJUA 1CIAA 2FYOA 1DPBA 4EPHA 2II5A 1XMCA 1NM8A 4JN3A 4EP9A 1EADA 1S5OA 4G0BA 2RKTA 1SCZA 2ZBAA 1EAEA 1QCAA 2E1VA 1EACA 2JGPA 5KJTA 1NDBA 2FY5A 3FP0A 3B2SA 1Q23A 2H4TA 1NDFA 1NDIA 2II3A 5DU9A 4JN5A 1Q9JA 1XL7A 5KJVA 1CLAA 1L5AA 1EABA 5FALA 2H3PA 1T1UA 4CLAA 1E2OA 3L60A 4EYWA 3FOTA 4G22A 1XL8A 2RCUA 1T7OA 2CLAA 2E1UA 1DPDA 2FY4A 4N72A 2VSQA 1EAFA 4KECA 3MAEA 2FW3A 2XR7A 2E1TA 1NOCB 3CLAA 5T3EA 4KE4A 1XMDA 2I9DA 2H3UA 5FANA 1Q6XA 1EAAA 5KJWA 2IHWA 1PD5A 1T7NA 2H3WA 3U9BA 2RKVA 1C4TA 2XHGA 2II4A 4G2MA 5KJSA 2BGHA 2FY2A 4HVMA 2FY3A 1DPCA
chains in the Genus database with same CATH topology
1Q23A 5DUAA 1XL8A 5T3EA 3U9FA 3B30A 5KJUA 1CIAA 4KE4A 1XMDA 2I9DA 1DPBA 5FANA 2II3A 2II5A 5DU9A 1XMCA 2CLAA 2E1UA 1EAAA 1DPDA 4JN5A 4JN3A 5KJWA 4N72A 2VSQA 1Q9JA 2IHWA 1XL7A 1EADA 1PD5A 1CLAA 5KJVA 3U9BA 4G0BA 1EAFA 1L5AA 2RKTA 2RKVA 1SCZA 2ZBAA 1EABA 1EAEA 1QCAA 2E1VA 4KECA 1C4TA 3MAEA 3B2SA 5FALA 2XHGA 1EACA 2XR7A 2II4A 2E1TA 4G2MA 4CLAA 1E2OA 3L60A 2JGPA 5KJTA 5KJSA 2BGHA 3FOTA 1NOCB 4HVMA 3FP0A 3CLAA 1DPCA 4G22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q23 A;  5DUA A;  1XL8 A;  5T3E A;  3U9F A;  3B30 A;  5KJU A;  1CIA A;  4KE4 A;  1XMD A;  2I9D A;  1DPB A;  5FAN A;  2II3 A;  2II5 A;  5DU9 A;  1XMC A;  2CLA A;  2E1U A;  1EAA A;  1DPD A;  4JN5 A;  4JN3 A;  5KJW A;  4N72 A;  2VSQ A;  1Q9J A;  2IHW A;  1XL7 A;  1EAD A;  1PD5 A;  1CLA A;  5KJV A;  3U9B A;  4G0B A;  1EAF A;  1L5A A;  2RKT A;  2RKV A;  1SCZ A;  2ZBA A;  1EAB A;  1EAE A;  1QCA A;  2E1V A;  4KEC A;  1C4T A;  3MAE A;  3B2S A;  5FAL A;  2XHG A;  1EAC A;  2XR7 A;  2II4 A;  2E1T A;  4G2M A;  4CLA A;  1E2O A;  3L60 A;  2JGP A;  5KJT A;  5KJS A;  2BGH A;  3FOT A;  1NOC B;  4HVM A;  3FP0 A;  3CLA A;  1DPC A;  4G22 A; 
#chains in the Genus database with same CATH topology
 1T7Q A;  5DUA A;  2DEB A;  3U9F A;  3B30 A;  5KJU A;  1CIA A;  2FYO A;  1DPB A;  4EPH A;  2II5 A;  1XMC A;  1NM8 A;  4JN3 A;  4EP9 A;  1EAD A;  1S5O A;  4G0B A;  2RKT A;  1SCZ A;  2ZBA A;  1EAE A;  1QCA A;  2E1V A;  1EAC A;  2JGP A;  5KJT A;  1NDB A;  2FY5 A;  3FP0 A;  3B2S A;  1Q23 A;  2H4T A;  1NDF A;  1NDI A;  2II3 A;  5DU9 A;  4JN5 A;  1Q9J A;  1XL7 A;  5KJV A;  1CLA A;  1L5A A;  1EAB A;  5FAL A;  2H3P A;  1T1U A;  4CLA A;  1E2O A;  3L60 A;  4EYW A;  3FOT A;  4G22 A;  1XL8 A;  2RCU A;  1T7O A;  2CLA A;  2E1U A;  1DPD A;  2FY4 A;  4N72 A;  2VSQ A;  1EAF A;  4KEC A;  3MAE A;  2FW3 A;  2XR7 A;  2E1T A;  1NOC B;  3CLA A;  5T3E A;  4KE4 A;  1XMD A;  2I9D A;  2H3U A;  5FAN A;  1Q6X A;  1EAA A;  5KJW A;  2IHW A;  1PD5 A;  1T7N A;  2H3W A;  3U9B A;  2RKV A;  1C4T A;  2XHG A;  2II4 A;  4G2M A;  5KJS A;  2BGH A;  2FY2 A;  4HVM A;  2FY3 A;  1DPC A; 
#chains in the Genus database with same CATH homology
 1Q23 A;  5DUA A;  1XL8 A;  5T3E A;  3U9F A;  3B30 A;  5KJU A;  1CIA A;  4KE4 A;  1XMD A;  2I9D A;  1DPB A;  5FAN A;  2II3 A;  2II5 A;  5DU9 A;  1XMC A;  2CLA A;  2E1U A;  1EAA A;  1DPD A;  4JN5 A;  4JN3 A;  5KJW A;  4N72 A;  2VSQ A;  1Q9J A;  2IHW A;  1XL7 A;  1EAD A;  1PD5 A;  1CLA A;  5KJV A;  3U9B A;  4G0B A;  1EAF A;  1L5A A;  2RKT A;  2RKV A;  1SCZ A;  2ZBA A;  1EAB A;  1EAE A;  1QCA A;  2E1V A;  4KEC A;  1C4T A;  3MAE A;  3B2S A;  5FAL A;  2XHG A;  1EAC A;  2XR7 A;  2II4 A;  2E1T A;  4G2M A;  4CLA A;  1E2O A;  3L60 A;  2JGP A;  5KJT A;  5KJS A;  2BGH A;  3FOT A;  1NOC B;  4HVM A;  3FP0 A;  3CLA A;  1DPC A;  4G22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...