2IJ0C

Structural basis of t cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
118
structure length
118
Chain Sequence
GAVVSQHPSMVIVKSGTSVKIECRSLDTNIHTMFWYRQFPKQSLMLMATSHQGFNAIYEQGVVKDKFLINHASPTLSTLTVTSAHPEDSGFYVCSALAGSGSSTDTQYFGPGTQLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of T-cell specificity and activation by the bacterial superantigen TSST-1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Toxic shock syndrome toxin-1
total genus 21
structure length 118
sequence length 118
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ij0C00
2R0LL 3T65B 3GSNH 2DJSA 5DURB 3UTTA 5C0EB 1F8TH 4HMDA 5C0DB 5IFJB 1J9CT 1T0PB 3U7WL 5CP3A 4ELKA 3VFMB 4QRRB 3LZFH 3FQUA 4X4YA 1WVZA 3MRDB 5KN5A 3GMLB 3UX9B 4PJEA 4AIZB 3P4LA 3HS0B 2ZPKH 3D2UD 4UB0L 4X8JB 1F3JA 3ARDC 5E6IA 5KSBE 3N50A 4L4VB 1CYGA 3CSYB 2ZSWA 1IC5H 1DN0B 4QLRA 5I1AB 4BZ1L 3VG0H 2X41A 3HZYB 2XQBL 3F7VB 3A6BL 1U8LB 4WY7L 2OLDA 3TYGH 1N3NB 3UTPD 3L5WB 1XCTA 1SMAA 4DOHB 1XIWB 2FNBA 4NQXA 1I9IH 3AU1A 1HIMH 4LMQE 3BJLA 4PJCA 4RDQF 4NNYA 4Z7NF 4UNTA 2W0KA 3IJSA 5E6ZA 3GSRB 3WIHA 3S36H 4JZNA 1XFPA 4UIMB 3IJYB 2X4RA 5T5FL 4NQCD 1Q9KA 2NY0B 3BZFB 3X14A 3BEVB 4I0PA 1OT2A 2YUZA 4YAQB 1VFOA 3L5XH 1K8DA 1FNSH 3BKCL 4G9FB 4FFWD 4NWTH 4P49A 5DR5L 4DZ8A 3B3IB 2VLLB 4FQJL 1G0XA 4CNIB 5GGRY 1TVBB 3DLQR 5CFHA 1PYWB 1AIFB 4HV8A 1BQHG 3MRPA 4ELME 5DA4A 5KN5B 3BX7C 1X5KA 1KPRB 3H9SD 4PLJD 3QHFH 3BP5A 3GBNL 2C4FU 2JJTC 3KPPB 3MV7D 5HPMA 2EDEA 2NXYD 1FNHA 2HRPH 5KVMC 3ULVC 4PJ8C 2ZSWB 5DMIL 3VWKA 3HNTL 1KIQB 4K71B 1BWMA 3DETD 3BRFA 5IF0B 3H8NA 1BREA 3QI9D 4D3CH 2CIKB 1FAIH 1B0RA 4IRZH 1O0VA 3HNSL 4HH8A 4QHKJ 2FO4B 2W0PA 2UYLB 4PV8B 3ZKSD 4GKNA 1AGBA 3BI9X 1NCWH 1GJIA 4JY4A 1YJDH 4P4RA 4ZAKC 2X70B 3GKWL 5EPMB 3W9DB 5HHQA 5E5RB 1KCVH 1MCHA 2AJZB 4HKJA 4NNYB 4D2NA 4FQXB 3PDOA 5TFSH 4QHUA 4N1EA 1FYTE 5SV3A 1MAKA 2HMID 4NKOB 4QRTB 2HT2C 4KV5E 3CDGB 2BXYA 4PTUB 1NBVL 1JTOA 1IEAA 2HFTA 4H88L 5I30L 2EDNA 1HH9B 5HVFB 4FTVB 5F7FA 4HHAA 4N0UA 2R4RH 2ZCHL 4MNQD 3SY0B 5J6HA 4U6TA 3ZMRA 1BX2A 1CFSB 4KU1A 3KPNA 4AH2A 5BZWA 3TO2A 5B4MC 3R4DA 4X6CA 2UVFA 1WJ3A 3QA3B 4PRPB 4Y5YB 5FOJA 2CR3A 2XA8H 2KDGA 1AO7A 4U49A 4O4YL 3VE0B 1F97A 5HHMD 3WKMH 3NIDE 1QA9A 1QYGL 4NRYB 2J6EH 1T2JA 2BRQA 4X9FA 3A0OA 4UQ3A 2Q86B 1JNNH 2Y5TA 1MWAH 4Q2ZA 1RVFH 4GLRI 4OQTA 4V1DA 1IAOA 1MIML 1I1CA 3A67L 4HIJA 5FF6B 5J4MA 3HC0B 3QCTH 3UPRA 4NHUA 4QWWC 5CEYA 3GNMH 2W9DL 5I8CB 2R2EA 2BJMH 1FE8L 3R1GH 1IGTB 5D9SA 2O5XH 2G9HA 4ZTPH 4XVUC 2XZAH 4X7SL 3BW9A 3ESUF 5GS0C 2DMCA 4OFYA 4K3EH 4WFGE 3VXME 1UB5B 1CGTA 3RUGA 4M1GL 4JDTL 4JQVC 4HFWA 5H35A 1MCKA 1OTUC 1RJYA 5L2KE 2DKUA 3QXDA 4O58L 4MAYB 3PP3K 1EO8L 4LSQH 1ZAGA 2VXUL 1YN6A 4I5BB 4K71C 3V5HA 4MJID 2N1KA 4JPKL 4G6JH 3U6RB 2BVPA 4YXHL 5LGJA 4PJGB 2FBOJ 4FTVD 2W0FB 4OLUL 1D6VH 1I3GH 3IXTA 4X5XA 2WBJB 5D96C 2EKJA 1WGOA 5TPWL 3IDNA 5B38G 6FABH 3KHOA 4TVPD 4ELMF 1EDQA 1KCKA 1U8KA 1RHHA 5FHBH 4HPYL 1F4HA 1EH9A 4YEEA 1FO0B 1KEMH 4MXVF 3U0TB 3VFNA 2O26U 5JO5B 4M61A 4AENA 4ISVB 2VQ1B 1MCNA 1LE5B 1MCLA 5DWUH 5FKAA 4FP8L 4YWGL 2AS5M 1FCGA 4F7TB 4NT6A 1G1CA 4QHLB 2PW2A 4APQA 1NFIB 4WV1B 1A0QH 1A5FH 2C26A 3O6FB 1KJ3H 2DM7A 4LCYA 2AV1B 3WIFA 3TP4A 1VFUA 3C6LA 2G5BB 5EA0L 3MBED 5HD8D 3T2NL 3RU8L 4ZPTA 3T3PE 3QDAA 4CN4A 2DOCA 3OKMA 5GGVY 5IB4B 3NFNB 3MLPA 4G9FD 1KIUA 1NAMH 1FYHB 4HWZA 4XXCA 4JKLA 4F7MA 1U8OA 5CD3A 4PJFB 3GGWA 2VDKH 2ZOLB 4L5FH 1DBKH 1P1ZA 2P4AB 2P5ED 4CADA 4XHJD 3QEHB 2J8OA 1SQ2N 1PG7H 4WU5A 5EO0B 4WUUA 5ADPL 4CBPA 2R1YA 4H5SA 2AQ2A 1KEML 1T1ZA 3PDOB 1CDUA 5EO1A 3MRDA 5EOCL 5FKAB 5C09A 2VDOH 1H9VA 1FFPA 1WBXB 4F9LA 1HH9A 1TENA 3MV8E 4F15C 1UM6L 1T66D 5D7IE 5D2NA 5HHOB 2HLAA 4KK9D 4OLUH 1H3PH 2B4CH 1PD6A 4PRPA 3IETB 2NY6C 2NZIA 5F9JB 1HNGA 5JNYB 3EZ8A 3OR7B 5HI4D 3K4ZA 1REIA 3RGHA 2EDBA 4OZFB 5IEKA 2CRYA 3CDYA 3S4SB 4ZMAT 4G6FD 3RBSA 1MJJB 4FQIL 5DHVA 4L29A 2KUTA 4X6BA 3LMJL 5J13B 1Q9KB 3VXMB 1TLKA 2WW8A 3MLWH 2VLJA 4HD9A 3AREA 4U1NA 4J12A 4MB5A 3TCLB 4HGMA 4U0RB 4PRHA 5CEYB 3RTQB 4UIKL 4HGWB 5B8CA 2XZAL 4X7SH 1I9RH 2E9WA 4RMQA 1WTLA 1EVTC 1NLBL 2E9BA 3NPSB 2AXGA 3QCTL 3WNKA 4MCYB 3MRPB 1MWAL 5ENWB 5GS0D 1FNEA 3PL6C 3HZVB 5E5MB 4AEHL 1QYGH 4G8GB 4CU6A 3SDXA 3O6LH 1LDPH 1J05A 1E4XI 4FNLL 4OF6A 4YHYB 5A2FA 1JRHH 5DT1L 1L6XA 3ZKMC 5CKGA 2VDNL 3HE7D 5D7SH 3ZE1E 1VHPA 5T33H 3RAJH 3AS3A 2BNQB 1QFWM 4P46C 1YNTA 4YFLF 3SGKC 3RZCB 7CGTA 3JWOH 1Q9LB 1FZOB 3LY6A 5IQ9A 3PF2A 4NRZB 4PGZA 1FV1A 1JZ6A 2Q7YB 43C9B 4FQXA 4KRMB 4MS8D 4QHUB 3B6SB 4TUKH 5ERWB 1MJJA 5DHVB 2FBJH 4X7FC 1W72L 2J8UF 2X9XA 4GG8A 1T04A 5FUZH 1A6TA 4YGVB 4U1NB 5GJTH 1F58L 4F37K 5FGBA 1V8HA 1V3MA 4WTZG 1KCVL 1KTDA 1NC4D 3C08L 1EAPB 5F7DA 1T03H 1EEQA 5J3HD 2NMSA 4QRPB 2FDBP 1SJHB 3QULB 1RK1A 5I19H 3NIGF 4U3CA 1S7TB 1YDPA 3VH8A 5EWIL 3W82A 1AR1C 1CT8A 2BNUB 3BT2H 1J87A 4WFFD 5CZVH 2VXTH 2F53A 4XPAH 3X17A 2O5YL 4XMLH 1U8LA 5J1AB 5JQ6H 3UJJL 4OZFG 1L9MA 5KG9A 1UFUA 2PNDA 1JJUA 2QQLH 1U8HB 2P5EA 3NCYP 4QXTA 4PJ8D 1MUJB 2R29L 2DQIL 1OQOA 4IRJC 4PJIF 5IVXE 5IVZA 3SGEI 1NLDL 2KBGA 4WW2F 3UYRL 4FQJH 5INCB 3DX6A 5CZVL 1XF5B 1E4KA 1FNSL 4Y5VA 4OGXL 5TJWK 4NO0A 1B0WA 2ZKHL 1UB5A 2ZUYA 2GIYA 4M8QB 5EWIH 2B7DT 3VXSA 1Q8MA 4CADB 3ZKMD 2ESVE 3MV9D 4JFFD 4WO4D 3QISA 4XI5C 2Q87A 5DJXA 5I18L 4LCUB 4CVUA 2W9EH 5FYLL 3GB7A 1WLHA 3V5HB 4PLNC 2EYTA 5DZLA 3DTXA 4GKOA 2Z91A 1NMBH 1DSFH 2EDRA 5E8PA 1CDCA 2R0ZH 4HGKC 4K55A 1GSMA 1LD9B 3QRGL 1N5YL 4Y1AB 4JO3L 1SHMA 3VG0L 5KSBB 3FN3A 3OF6D 3KJ6H 5TDOB 1AO7E 2JIXB 1C8PA 1A8JH 3JWOL 1HHJB 3SE8L 4GRWH 5EN2B 2CIKA 4MA1C 5JW4M 3BH8A 3LN9A 4FQHA 4P4KC 2NX5D 3CMOL 4LP4A 1G0YR 3R0NA 2BSTB 2AV7B 5E4EC 5DYOA 3KPRA 3PJSA 1Q94A 3CFJA 3O8XB 3MGOA 1H3UA 2DTMH 3VXMA 1UH4A 1OARH 4AZ8A 3T0DA 3QIUA 2DMBA 4NKQB 3TN0D 2VZSA 4PGDB 4XHQA 1NLBH 2EDDA 1YEHL 2FWOA 3MMEB 4LLVA 1KTLB 2HG5A 4DGVH 4W70A 3AMKA 1KLGA 4Z0BL 1JMXA 3TIDA 4OKVA 1VACA 3FQWA 5C0RH 3HMWL 4KVCL 3LN5B 2VQTA 3QIWD 1KG0A 2VDML 3IVKA 1J8HA 4ODSL 2AK4E 4FQIH 3QG7L 4S2SA 3HNVL 4HWZB 2X4UB 2X2YA 3FQRA 4OF0A 5TDOA 4OZIE 1DVFD 1OGTA 4LPYA 1CQYA 1Z3GL 4KJQC 4OIBA 3S88L 1G7IA 1U92B 4HIEB 4NWUL 5D7LB 1N7ML 4N0CC 1UG9A 4FXLA 1W0WB 5HYJD 5EU3B 5EC1B 2XWBA 4JG0H 2P5WA 3KPSB 3MACL 1Q9LA 4ZFFA 2BSED 3KPRB 1A1MA 1UM6H 3PJSB 4N9GA 1T1ZB 2KQMA 3S3SA 3GM8A 3LS5L 2PO6B 3B5GA 3QEGL 2R9HC 4M43L 3PE9A 4ZUUA 3GJFK 3TV3H 5C0AA 3S5LB 3WNLA 3SDAD 1I8LA 2H1PH 3O9WD 3AM8A 2FX9L 4Z5RA 1ZTXH 4XB8A 3HC3H 4FQ1H 1ZLWH 4NN6B 1CGXA 1RU9H 3W2DL 1T3FA 3GMMA 5AZ2L 1AFVL 4HIIA 2NZ9C 1KNOA 4LVOC 5I8KH 5L6YL 3PV6B 1YZZA 3OR7A 1OAQH 1M1SA 5T1MB 4K3HA 4KPHH 1QRND 1SVCP 4A6YA 3OAZH 3VXUA 1V7NL 1T5WA 4CMMA 2I5YL 2IPKA 5ISZE 3AGVA 1KIRA 4IMLA 1QFWI 2ZCKH 4CL7A 3SDXF 2C4FT 4ZFZB 1R3LA 1A9BA 4LLYA 2AXFA 2XWBB 4LIQE 1RK0A 3QR2A 3DX6B 3I2CH 1EFQA 1FFOB 1HSAA 2Y4SA 4KTYA 3TBSA 5LWYH 5FFLA 4LARH 5BCAA 3OZ9L 3VXPA 4HC1A 5DJZB 1VGKB 4JKWA 5JLZB 3B5TA 5FGCE 4YAQA 5EIIA 4DZ8B 3MV8A 3T04D 1Q9OB 4QOKE 5DJ0B 3SKJL 4E42B 5IJKA 2UWEB 1KPRA 2AK4D 2UY6A 1FSKC 1RMFH 4OF8A 4N90D 3OKOB 1QR1B 1G6RA 4NDMB 1OP5H 1DQMH 4M03A 3QBTB 4I77H 1JFQL 1ZT1A 5D2NC 5F7EH 3C6SA 2IADB 5C0CD 3DOSA 4XBEH 3CVHB 3P2TA 3H0TB 4J1UA 1KLUA 4J3WA 3S37L 4BFGA 1T04B 1EJ6A 4G6JL 1A6TB 4MX7A 2Q1EA 5IGXH 2BVEA 2R2BA 1QRNB 1BQLL 3MO1B 3ZDYE 5TDPA 3T1FB 1B4JL 3MRGA 5B3JF 5J7CC 2WINA 2XZQL 3BO8B 4ZFOL 1A6WL 2YUXA 1KF9B 2P8LA 3TZVC 3WUWB 3QIBB 1B0GB 1EEZA 1YEIL 4JDTH 5K33A 3BXNB 3JWDC 3BVNB 4UQ2A 5GRJL 3PL6B 3V0VA 1KCRH 2ZZUT 4JFFB 5HHNA 1A1NA 2O5XL 5IB5B 4MCZB 2FL5A 3P40A 4PJIB 4WDIA 3GNML 4EBQL 2I9TB 3EOYG 4OKVB 2MTPA 4EQ3A 2EC9T 1BD2B 1JNNL 1PSKH 5E8OB 4MGXA 3L3GB 1QLEL 1MJ8L 4L3EE 3DV4A 3WKML 4AL8H 2X4UA 3NABL 4F7EA 1P4BH 1DL7L 2PTVA 4PJ7E 3QNZB 1OVZA 1T80A 1JN6A 2XA8L 3WHE1 3IFLL 3QUKB 5F6IC 2R56H 3RZCD 2AI0H 5J9PB 3MLXH 5FA4B 4WWKB 5DK0A 5F1NA 1ZEAH 2ADFL 4P5TD 2ZCHH 3V4VH 4LIQL 4XH2A 4UILL 5I30H 4HUXB 4MNHA 1NL0H 4MQTB 4AG4H 2VISB 5C9KA 4HFWB 5H35B 1YQ2A 4NQEE 1OD7A 1U93A 2E7LC 2Y5EA 3DURA 4FQLL 32C2A 1RUPL 3QAZB 4R2GB 4MQXD 1JGLL 3CJJA 1QBBA 1AO7D 1UWXK 4KK6C 2CO7B 3EOBB 3G6JB 1K9TA 4X7CC 2DBLL 5TE6H 3KPMA 4KQ3L 4HWBL 1DUYA 4PJ9C 5GS0H 3PGDB 4PJIA 4WDIB 2OL3A 2NY4D 2VLJD 3GIZH 5B38A 4X7TB 3RDTA 1FAIL 1BD2A 1FO0H 4MA1B 2ATKA 4GRLD 3BMVA 4OUUB 5DJYA 4FQQA 3KWWA 3L3GA 4O02L 1CCZA 4HUKB 3ZT6A 4NZTH 2HAZA 1DBBH 1RZJL 3QEQD 1JN6B 3OJMB 1GGBH 2X10A 4NN7C 5GS2D 3LIZH 3INUH 5IHBA 2AKRA 1A21A 3MV8D 3MFFA 1JI1A 3U9PL 2OS7A 2YD7A 2I60L 4ELKB 4NRXB 1IGIH 1IM3B 4LLVB 5ACZA 2VZOA 3IGAB 5BV7C 4N0YH 4HBCH 5DRZA 4N8PA 1UA6L 1VGKA 4Z76A 1IEBA 1S9XB 1F3JB 2WQ8A 3GBMH 2PO6D 1FP5A 5JOPD 3DRQA 1I7TA 3P4OB 4NIKB 5I1EH 5CEZL 4OZHB 1ONQA 3NAAH 3QUXB 3GSNA 1AJ7H 3NOIA 4U2YA 4WTWA 1CFTB 3OAUL 2AJUH 3AC0A 3ZHLA 5F9OH 4NBXB 3GJEB 1QHPA 1U6AL 5DS8A 1FFRA 3TYFA 1Q0YH 1H3XA 4C58B 5KS9B 5I8EA 5I1KH 3LDBB 3PGDA 1S7RA 1MHCB 2D9QB 5LBSH 5FM5M 4PJCB 3G9AB 4X7EC 4N5UA 5GGTH 5DURD 1T1XB 2GSIA 1CLOL 4FQCH 1M71A 1MWAB 2AJSH 1T4KB 2DQCH 2V5MA 1BVKB 3GFUA 3C6SB 4E41E 4S1SH 5TQ2H 2JB6B 3BPOB 3X14B 2CKBH 3IU4H 4UB0H 5HYQB 5HHOD 2BCKA 4UV7L 1M7DA 4KJQD 4WUUE 3T77A 5JW3L 4JY6B 1A7RL 5D72H 3RIAF 1HINL 4I3SL 2J8UE 2VNCA 4EIZC 2SEBB 4L1DA 4UTAL 5BW7C 2YKLH 1I1FA 4NO3B 4QO1A 1ZVSA 1LO2L 4PR5B 4N8VB 2ARJQ 5ICYA 4HK0B 3HC4H 5BMFH 3FQTA 3UBXG 1HSBA 3GMOB 2P48B 2AK4A 1YC8A 4DEPC 4OGYH 5CJQL 3Q3GA 1CQKA 2GITA 2C3GA 2BOBA 2AJ3B 5CIPH 4ZS6D 4IDLA 1U3JA 4FFZH 4KMQA 3E1F1 3I9GL 4B5EA 5DYOB 1JPSL 3DUSB 3VFOA 4YBQC 3U0WL 3LKOA 1JPST 1HN1A 3BKJL 2R69L 2BNRD 4KHXH 3MJ6A 4L4TB 1M71B 1MWAA 5AG9A 1DBAL 4JY5L 5F72S 2J2ZA 4H1LA 4BUHA 1J5OH 3OAZK 1L0XA 4LEXH 3CDGA 5KVDL 5DMYA 2LU4A 5EU7E 1QVOA 2FATL 3UAJC 3OSKA 1SEBA 3LQMA 3MMEA 4EZMA 3AS0A 1IAII 2JJWA 2VR5A 5JHLL 3HTLX 2YS4A 5IBUG 1LVEA 4YPGB 1LP9A 4KXZI 1FLRL 1RUQH 2R1XA 1EFXD 3O2DA 4H20L 1U8MA 2UZIL 3QIWB 4Z7UA 2EH8H 5CSGA 4PLKC 3MR9A 5D93B 4HK0A 1M7XA 3W81A 2OX5A 4PP1D 3E2HC 1N64L 3P77B 5HVWA 1JWSA 3PDGA 3EAKA 3P4MB 4GW5A 4F8QA 4DTGH 3G5VA 4CMHC 2Y5TB 2MQ3A 3E6FA 1PDKA 1C1EL 1RUAH 5E5UB 3VXRA 4X99A 3LN4B 5C8JA 4GW4A 1Z5LB 2YA0A 4ZFFB 3MJ8B 5L8LB 2JJUA 1A1MB 3LKOB 1TETH 4YHML 1OWWA 3MGAA 3FCTA 2ERJC 3MXWL 5D1QB 3VFSA 4G9DB 5JIKA 4BZ2H 4G6FB 3H9SA 4Z8FH 4FQ2L 1GRWA 2J6EA 5DDHA 3LRSB 4J8RB 1A3LH 4JKMA 3F7QA 2MCPL 1BM3H 2F58L 3SBWA 4LU5L 2VDQL 5HDQL 1T83A 2FGWH 1QO3B 4E5XB 4MA8H 1D5MA 4X9HA 4PFEA 4LLDA 5EBWA 3N85L 1NBZB 5BJTB 1MCPH 3QDGA 1TJHL 4QRPA 4N0UE 3WV0A 5IHZB 4O51A 4FHBD 4QRRE 3VXNB 4UV4H 5DUPL 2PTTB 3P9WB 1J1OL 2Z9TA 2B8OT 4KVNH 4Z78B 4WCYH 4ODTH 4N5ED 4LASH 2YUVA 4PP2B 2EECA 3TFKC 3GHEH 1CFTA 2CUHA 1VERA 1C5CL 4P5MA 5DHVH 5E7BA 2DWDB 3MOBL 4L8CB 2AJVH 2X4OB 2ZG3A 3CLEL 5E8NA 3QUKA 2EIDA 5SWQA 1LEGB 2CUMA 4FZ8L 3QQ3B 5D2LE 1HHIB 2E9IA 4OLYL 2YRZA 1W2KT 4JHAH 2V2XA 1JMZA 4OF3A 4IDJH 3VD5A 4NQDA 3B9DA 2Z93B 3HG1B 1YYMH 3FT2A 4NO0B 4M5ZL 4H0IA 2PCPB 4OCYL 2NY4C 1ULVA 5AEAA 1WCBA 1KIPB 3LRSA 4JY6A 1T22A 2YBRB 3HI1A 5D5MB 3O8XC 4XPHL 3O11A 4PRAB 2G5BA 3EHBC 5GPRA 3TO2B 2NX5A 4ONHA 4F9PC 2DM3A 3WHE0 3PL6D 5CGYD 5INDA 1GOGA 1IGCH 2GJ6D 2XACC 3GMOA 1V3KA 2Q3AA 2ICWB 3Q5OA 3H9YA 3ARTA 1YMHB 4XPFL 1ZGLB 4RX4D 1D6EB 2F19L 3BDBA 1HHJA 2Q86A 4UQ3B 4BYHA 1TVHB 1NUFA 5DD0L 3S35H 5FK9A 5MERA 4HJ0C 2JB5L 4OZFH 2HT4C 5ALBH 5JORB 1CZ8L 3OAYH 3QWQB 4BSVA 3B9EA 2IH1B 5FGBC 1HXMA 3TA3B 5AD0B 1I9EA 5FYJH 3O4LE 4H5SB 1KXTB 4M7LH 5EUKA 3UO1H 2XV6B 4GSDL 3HKFA 2VL4A 7FABH 4RAHA 3VMNA 1DQDL 1RJYB 1CICD 1Z9SA 3HLAB 3HI6L 3PL6A 4OLZH 4YXLH 2APBA 5HVHC 3NZHH 4XCFH 2V17L 5IB1A 3EYUH 1I7UB 1R3KA 1OTUD 3TYFB 4DCQA 3O0RH 4JN2B 1M6OB 4Z7UB 1L7IH 1G9NL 4WEBL 4CDGC 3FO2B 4DGIL 5BRZB 1TZGL 5K9KB 4FXGA 4IJ3B 1FQ9C 4HS3B 4R4BB 3IDNB 1A6VH 5T3ZD 5KTEH 4L3CB 2A6JB 4PGCB 4YR6A 3K81A 3F62A 1S9YB 1DQLL 4PGBA 1GGCH 1BGXL 3SGDI 1T0NB 4X99B 3P3YA 1CD1B 4MD4B 4HGWA 3OX8B 3O3EA 1ZOXA 4AENB 5BVJA 5HHQB 1F90L 3EGSB 3HZKA 5GGUA 2PXYC 2P1YA 1SJEA 4L9LC 4NHCH 4X83A 2ZNWA 2VISA 1RZ7L 3L95A 5IEHB 2PF6A 1HWGB 1DBML 4WUUD 1MI5B 5E5MA 3PWLA 3N0PB 5JDSB 1NUNB 4IRSB 4ONGL 1CE1H 1JPTH 1NCAH 1S3KL 4Z5RB 2A6DB 5D71L 5D2LF 5FO7A 4M3KB 1TMCB 1QFHA 5D1XA 5DFVC 3U7AA 4Y5XC 1U42A 4O51B 3RWHA 3DMMA 1MFBH 2P8PA 4N5EC 4XXCC 2ZUVA 4NZJA 5LG1A 1T2QL 4JDVA 5CSZA 2Y07H 5E08L 1W0VA 2JK5B 1O7SA 1M05B 5SWSD 4HW6A 4HAGA 1QTYT 1KB9K 5J11B 1DLFL 4GMTL 2DQGH 4EOWL 2A6IA 3HZMB 4I2XA 2HLFC 1BLNA 1EHXA 1R3LB 4Y4HA 1NAKL 3BJ91 4U31A 1RK0B 1A7NH 5DRZB 1TQBB 5SWSE 5HJ3A 3MLRL 3P4NA 2PCPA 4PIRF 1IEBB 1YEKL 4HXAL 1XGUA 2BY2A 3EOTL 4RZCB 3L9RA 2Y6SD 1WV7T 1TXKA 1OWRM 2IFFH 5GRVK 3SQBA 4X4MA 5E1HB 4Z6AT 4C4KT 2JJVA 1JWSB 4PB9H 1HKFA 3P4MA 2VLRB 3C8KB 4PUBH 1P2CA 2XWJA 3KNBA 4QXTB 3ORJA 4PB9L 2X4QA 4EN3C 3O6FD 1X3DA 3FHAA 1U41A 4WW2C 1ZT4B 4M7KL 3S4SA 4ODHL 5HI3D 5GS1A 1WICA 4MJ2A 5TGBB 8CGTA 3VD4A 1WZLA 4DKEL 2OK0H 4O9HL 3MLRH 1S7SB 1YEJH 4PJ8A 1KEGL 4HXBL 1NCBH 2FHFA 4XP4H 4Z77B 1A7QH 3RHWF 3D0LB 3GM0A 1OSPL 5FGCB 5JOFB 5EUKB 1KB5L 1OCWH 3MO1A 4M61B 1OHQA 3JWOC 4EOWH 4UI2A 5CBEA 4X0KB 2IEPA 2VB5A 3NCEB 2Z91B 1E6OL 4NBZB 1KENL 1RAMA 3D85B 4XT1C 5D7KD 4XPTH 4PY8I 1E28A 3UYOD 4RMUA 5EZOH 1EK3A 4Z7UE 3S5LG 4L4VA 3GMPA 3MRNB 1F00I 5GJSL 5E08H 3TA3D 4P59H 2AV1A 1NPUA 2GITB 3RBGA 1RURH 3CC5A 3BZDA 2JJTA 2YN3A 2F15A 2APTA 3H42H 2F53E 2EO9A 5IW1A 2BOCA 5ID0A 2GW5A 4XVJL 3H3KA 1MPAL 5AWNH 1NEZG 2VITB 3ULUH 3QXAB 5F71A 4Z7UF 2KH2B 1JHKH 5CCKL 4HEPG 4K8RD 1N5AB 1MFNA 3CVIL 5IWLA 1VESA 1XGTB 3K1KC 4G6KL 1RZ7H 1PZUB 2ERJB 1HZHH 4OV5B 2OP4L 3MROB 2OTUB 2WLZA 4RAVB 1L6ZA 1K8DB 4R26L 4P23D 1UXWB 2OJZL 3VXSE 1X5LA 3R06B 5EORH 1LP9B 3NFPB 1FPTL 2NY4B 2WAHA 5DD6B 5I76A 4ZPVB 4XZUA 4P57B 1E4KC 4YDVA 3QULA 1YPZA 4HKZA 2FJHA 3I50L 5JIPA 2K9UA 1EEYA 1H0DB 3W9EA 2OZ4A 2ITDB 3O2VH 3PWLB 2A2QT 1XIWC 2AGJH 5T1LB 5GRUH 1NCDL 3MRNA 4DGIH 3FB7A 3X3GL 1G9NH 2J5LC 1IAMA 1WAAF 4XWGH 3G5VB 1QEWB 3QQ4B 1JPFA 1B0RB 1CGUA 3OGCB 5I9QC 3QDGD 1BJ8A 4PPTA 4GKNB 2FX7L 1Z5LA 4JM2F 5JNYA 3MA7A 3GRWH 2NY5L 3BPNB 5DLML 4ACPA 2WM0A 3VXOA 3FTGA 5FO8A 2XICA 3PXHA 4EKXA 2IH3B 4UINH 2FZ3B 2I26N 4J8RA 2FGZA 4OV5A 4GSDH 3K46A 4LHJB 1X5JA 1RPQA 4PRHB 4XNXL 1KELH 4PJHB 1R5IA 1VFAA 4HC1H 4JO1L 3KYKL 2K7QA 2J3SA 4LHUB 1CZ8H 2D0GA 4P2YA 3BEWB 4QXUH 5ACZB 1BHGA 1CFSA 2LAAA 4AH2B 3CXDL 4G8FA 3S35L 4OZGE 3QA3A 5DD0H 4RGMC 4M5YH 2W07A 3SGKA 2ED8A 1KNOB 2JELL 2PTTA 4Z7QE 4AT6B 2EXYD 2WUBH 4KK8C 1I3UA 4Q6IC 4TVPL 3FHQA 4Z0XB 5ILTL 3FO0H 1I1AC 2HFFB 2P42B 1FH5H 5T1LA 3DWTA 1FZMA 1VPOL 4FMFA 3U4AA 5AZEL 1QZ1A 3D2UB 4KI5C 4M7JL 1DQJB 1NFDB 4NQXB 2NQCA 4NHUB 4XWOC 1RY7B 4UT9L 1FH5L 2ZCLL 5A2JH 2DDQL 2HRLA 4NQDB 5TDNB 2EIZB 2VE6A 1HSAB 3QJHB 4KJPD 4GKSB 5A1AA 2RGSA 3LPWA 5GRXG 3K3QA 1I7ZA 4PJDB 3QQ9C 4QEGA 5B3JE 1YYML 4F3FB 3DVFA 3EDFA 4XAKE 4P3WA 1JZ5A 2XG5A 2OXHA 4IRSD 4MXVE 4JO1H 4WVRA 5BV7H 4FZEL 1K4DA 2J8UA 1KELL 4QNPF 1ADQH 5C0AE 1KTKE 3IDGB 2A6DA 1TTGA 3P11H 4LPCA 3PNWA 2DIBA 3MRJA 3WLWD 4IRJA 1KG0B 1SJHA 4HT1L 4ONOA 1S5IL 2VUYA 3C60B 3LCYA 4PRIB 4L8SC 1C5CH 2GFBA 3BPNC 2RCSH 5MENE 2ICWI 3QP3A 2CK0H 5GSVA 2FH8A 1HQRB 2DIAA 1XCQB 3DIFA 5IW1B 3V8CA 2YRLA 3T0EC 2VAAB 1Z9MA 4LF3B 1RIHL 1DN2A 2R2BB 1RZJC 1BM3L 4ENED 1H3WM 3V7MA 4Q9BA 4L4TA 3MRGB 1OB1B 1UGNA 1R3HB 4POUB 2PYEA 4Z8FL 3PP4L 4K94H 4MNGA 1A9EB 1B0GA 1EEZB 1F2QA 1PY9A 5I17B 3DBXB 3OJVC 4PJXA 3V7AE 4ZS7L 5SWZE 3PABB 5D1QC 1HCFX 3WSQH 1N0XH 2R2HA 3GMMB 4FN0A 3UDWC 1C1EH 3ULVL 2DD8H 2VLRA 1S9VA 3C8KA 1SYSA 5IV2B 2MHAB 1ZHBA 2PETA 3ZL4H 4P9HH 1YUHB 5DD3L 1ORQA 1PEWA 2R0KH 5AYUL 3CFIC 4DGYL 1CR9H 2APXA 3OKKB 1FC2D 3FOMB 5MP6H 4OB5L 1JUFA 2DN7A 5DJDB 1MREL 5JXAL 2E5EA 3P73A 4PJ9B 5F3HA 1K85A 4FQHB 1BJ1J 1RURL 1U2HA 5ANMB 2X4NB 1IGTA 5FUCC 2HTKD 1N2RB 2HVKA 3L1OH 5C0CB 5IMLA 4BQBA 4EUPH 3L95B 5SWSA 1TZIA 3QEUA 2XKNA 4RIRB 4P3DB 4CN6A 2H45A 4BJLA 4KTDL 3WS3A 4Y4FB 4S0SD 2DF3A 2R69H 3MLVH 2PTUA 3KLSA 4LBEA 2HJLA 3QIBD 4GW1B 3RWHB 3O4OB 3RWFB 1FGVL 4ZSOA 4X7TA 5IMMA 5E95B 5E6IB 1QUNA 1G6RB 1ORQB 4DVBA 1UXSA 3CSYA 2P46B 4M7KH 5CD5C 1VEMA 3QIBC 2CH8A 2QTEA 3E2HB 1IQDB 5FOBA 5T3XE 3GMRB 3X12A 1OGTB 5HHXH 2XWTA 3KYOA 3QG6B 4BQCA 5IHLB 4KKCD 3P73B 3IKCA 4PJ9A 5F3HB 2A6IB 3HZMA 3T1WA 3WNPA 4MXWL 2ARWA 1UWGH 1DLHA 4Z7VA 2QLVB 2D4FA 1I9JL 5B8CB 5JO5A 4XXDA 4ISVA 4R6UA 3D48R 2B1HL 4P2QB 1UACH 2GJZB 4H1LH 5DQJA 4HH9A 1N2RA 4R4NC 2AVGA 4N9GB 3EOTH 3PWNB 1YEKH 1A6UH 3WBDA 3BPOC 4EI6A 3BEVA 4WHTB 5CLWA 3F7PC 3RWDA 3BVNA 4GG6A 4U7SA 2AJSL 5JMRA 3DHMA 2DLHA 1NAKH 4M1DH 4ZPTB 2VABA 3MCKA 1T1WB 1INEH 4EUPA 4C56B 4OD1H 5HYSA 3ROOA 3KNBB 3G6JE 2DQGL 1EZVX 3QPXH 4GMTH 2VMFA 1J11A 4JFHE 4KI1A 1JNLL 4Y4FD 1W8OA 5F9OL 2J88L 4PRIA 4JVWA 5HPMB 4GAYA 2MJWA 3HN3A 5KSUA 4B50A 1AJ7L 3UCRA 1UXSB 4LLUB 5ID1B 5CEZH 3PHOB 2K3TA 1FN4A 3LSOA 3GBML 1K8IB 3TWCL 2NY1C 3ARDD 3WN5A 3V8OA 3DIFB 2DJUA 4OGAD 3GMNB 1BVLB 2Q8BL 4PV8A 4HBCL 3LQAL 1AGBB 2FB4H 4LK4A 3D5OF 5D7JC 4MHHI 2EIEA 5FYLE 4EDXB 4XXDB 5LXGL 3E3QE 3BDXA 4HH9B 4X6DE 1JBJA 5HY9A 3BIBX 3SO3B 1ETZA 1U58A 2VXVL 3CH1A 1DBBL 1RZJH 4FTVE 1S7TA 1YDPB 3ROLB 4PTUA 2NXYB 3VXTB 4UMGA 1IL1B 2CJUH 4Z7NE 3LD8C 4JN1L 2ATPA 2JCCA 4NHCL 3HHRB 3MLTA 2H26B 5C7XH 2IAMD 2VWEE 5IVXF 5CILL 5IB2B 4HUMB 4K8RH 3CC5B 5E2UL 3WFBL 4BKLA 4V2BA 5FUCE 3X11A 1CS6A 3O9WC 1XH3A 2X6MA 3BDYH 3MBEB 3F8UB 4JM2A 5CMAA 5AUMB 1CTOA 1KUMA 4HCRA 1X7QB 4U6YB 4XWOD 4DKAA 2XKSA 3WKNA 1C16A 1YJDC 4PLKD 5FDWA 4BFEA 2RIKA 3QO1A 4UUJA 3VRJA 4OGZA 5IEKB 1XF2A 1A6VL 5SV4A 2PKDA 1WK0A 3BD4A 4NO0D 5F89B 1N5AA 5D1ZC 4FQLH 2O5ZH 1UKSA 3C5JB 4JQXA 4PV9A 1MAMH 5C0IA 1E6JH 3OKLA 4AG4L 3G5YA 4J3TA 4HWUA 4NJ9H 3VMOA 3HC0A 4LIQH 1CVRA 4OLWL 1IM3A 1G7JB 1ZEAL 4JVPA 1AQDA 4W4OA 4XZUB 5IW3A 4EDXA 4KUCF 2IGFH 1ZWIA 4CVZA 2AI0L 3PUCA 1KJ2B 3IFLH 3O45B 4QXGH 3DRQB 2P8LB 3TA3C 4J6RL 4HF5H 5F88A 4XBGA 4D9QD 4H25A 1MI5A 5MEOA 1R3JB 3P9MB 4HDIB 2XPGB 4QHNA 4GO6B 1A1NB 2CDEB 3HPJA 12E8H 3IAQA 5ESQA 4EI5C 4BZYA 1KXQE 1VKXA 4KAQH 5JUEH 3RL2A 2QQNL 3RZCA 1MQKL 4F80A 4PJ5D 1WAAE 4DOHE 3SDDB 1IAIH 2XXCB 1F4XH 3O3DB 5DMGC 1MVUA 5FA3B 1X5YA 3DI3B 3O8XA 1FHGA 1IZKA 2GY5A 5EU6E 3D39A 1C7SA 4I2XE 1I3RA 4OTXL 3OKLB 4UOW1 1B4JH 25C8L 2LFGA 1U8IA 5I17A 5J9PA 1BLNB 4WFEE 3BKMH 2L4OA 2GJZA 3DETC 3FONA 5DQJB 5C6WH 5C6TH 3DVNA 2DJ4A 3ZTNH 1LE5A 3B5HA 4ZXBC 4B53A 1VCAA 4F7TA 2IANA 4AT6A 1I8LC 3T0VA 5KANI 1P4IH 3BP6A 3TJEL 4XBGB 3QCUL 1C12B 3OB0H 4YHIB 2F54A 5E00B 3T4AA 4QF1B 5IFAH 3Q3GB 1EFXB 4HDIA 5E94A 4K8RC 3VWKC 1EHLH 4OV6F 1G6RL 4N1HB 1DQJA 4X6EA 1MUJA 4JEGB 3O2DL 4NKIL 3GIVB 1KV3A 5JOEA 5EC1A 4P23A 3Q6GH 4FQPA 4XNMA 4BSWB 3WDIA 4JJHA 2CGRL 3FZUD 3GSRA 1DVFB 4RFEB 3TM6A 3R8QA 1EGJA 3JV6B 3C8DA 4EN3B 4UV4L 3FQNB 3LOWA 4YQXH 1VFBB 1QVOB 1LEKA 3QEUB 2UV3A 4HPOH 1MCPL 4Y2OA 1Q9WA 4LCUA 2BNRA 2OCFD 3WS3B 3QEHA 4JGUA 2KZWA 2EYSB 3HRZB 2VLLA 3KPRD 3MTRA 4ZTOH 3WHXB 2VDQH 5HDQH 3LPFA 4LU5H 4PRAA 3QNXA 3DTXB 4M6OL 1CICA 5D5ME 2QQQA 3TO4D 4D9RD 4Z76B 2ID5A 5DD1L 4U1KA 1TQBC 3BQUA 5IVNA 4D9RE 4ELMA 4HJGA 2RBLA 4OM0L 2ICWA 3EYOA 5T1MA 4OF7A 5D2NB 5EN2A 3S96A 5I1DB 2HLAB 5I8KL 1JYXA 5F8QC 3MV7B 4Q9CA 3HRPA 3X12B 1INQB 4XVUD 5BVPH 1H8NA 3VXQA 2B20A 4DTGL 2ZUXA 1ZTXL 2AXFB 1UKTA 5HBBA 5AD0A 1P7KB 1EJOL 4BFIA 2HTLC 3MLZL 3TBSB 4P9ML 1XGTA 5DJZA 1Y18B 2UZIH 2ORBL 3FQNA 1ZMYA 1U9KA 3BRGC 2VDLH 5JXEC 3W0WE 1IEAB 4NO2B 4H8WL 1Q9WB 3CU7A 1KTLA 4N0UB 4L8DB 2L7UA 3MA9H 3R06A 1ZKAA 5KAQG 3MRHB 4HUVB 2X1WL 5EB9A 2X1PA 4WEMB 2E6PA 4KJYA 4WJ5B 3IF1A 3T08A 4Q9QL 1V05A 1I8IB 4YDVB 3O6ML 2Q6WA 1GHFL 3GSOA 3OV6A 4LEXL 2AJYH 1XT5A 2FLBT 1AP2A 2E9JA 1D5XB 4M4RA 2D9CA 2DL2A 1FIGH 3LS4L 3FO2A 4FXGB 1MCCA 3T0EA 3VE0A 4HJJL 3EYOB 4OBSA 3OG4B 4K23H 4TN9A 4Q9RH 3C5ZC 2XN9B 1OGAA 3DECA 3FFCA 1LO0H 4KDTA 5CUSH 4JFDB 4P2RD 2NCMA 4V1DB 2PN5A 4FFZL 3UPRB 1NAMA 3VXQB 2VZ3A 5I8CA 1AI1H 1FVEA 4P5TB 3DUSA 5L2KD 1QRNA 1C5BL 2DLIA 1B6UA 5GGUB 4C55A 1BJMA 2VDRH 3RNKA 3VFRB 3O41A 1AQKH 3FT2B 2W92A 4S1DC 1U8JB 2X1XR 4XNUH 3QYCA 3NTCL 3D39B 2P47B 3Q5YA 2YKLL 4PG9A 4PJXF 4M6MH 5GIRB 1IT9H 1JWMB 1AKJD 1T22B 1IFHH 3L3IA 2I07A 5D72L 5CJOL 4LCWB 1PKOA 5JDSA 5HHNB 3SDDC 1CU4L 1R5IB 4AM0A 2NX5B 2B0SL 4LBEB 4OIIH 3GSUA 3MRBB 4UV7H 1J0IA 1OSZA 4WUKH 1T7WA 3HE7A 5F96L 2NY1D 2XN9D 5ITBH 5E6IC 1CFBA 3JTSB 1CT8B 5CGTA 3O9WB 4FQCL 1MSPA 5F6IB 5FXCH 4PJBF 1KIRB 2R0ZL 3CPLA 4GW5B 4NZDA 1OGAB 3FFCB 2YD8A 4JDZB 1U8HA 1JGDA 2P5EB 5I1KL 4IOFC 3WIHH 2A0LC 3GIVA 4E41D 2I27N 4Q0XL 3WE6B 4XMKH 2BRRH 2DB8A 3OAUH 1IKNC 1G7JA 2CDFB 3SQOL 3MJ8A 5I18H 1EUTA 3LRGA 1VEOA 4O2CA 1U3ZA 2L0DA 3RFZC 2V9RA 4F58H 4Y19D 2MPAH 1U8JA 4PJHE 2BP3A 4XP6H 2Y25A 1NFIA 3HLAA 1UA6H 2VXSH 3HE6B 5KSVB 2B5IB 3JTTA 32C2B 2FHBA 1BAFH 4YUEL 4XCCH 4JRXB 3SBWC 3U48A 1OL0A 1MHPH 3OPZH 2Y06H 2J8UB 4Y8AA 3C5ZB 5DEZA 3INUL 3IU3B 3QFJB 4PJEB 2OJEA 2AERT 1IC4L 1ZA3B 5IESH 1BEYH 3TC9A 4YFEA 5GGQL 3UJJH 4M00A 4PBVC 3X3FL 3DVIA 1MELA 2IPTL 1QR1A 1LO4L 5DMKB 4Z78A 3KWWB 3PHOA 3V4UH 2VAJA 5F6HI 5BW7A 3MOQA 4PGCA 3DX9B 4D9LL 3RY6A 4XX1G 1GC1H 3GHBH 3UZVB 1QACA 4JCLA 3BH8B 1INQA 2BZDA 4IHOB 4OD2A 1BQUA 1R0AL 2VLMD 4P99A 1XMWA 2H9GB 5GS0L 1RZFH 1XIWA 3STLA 3GSWA 3HUJA 4JKKA 5TE6L 2QHRH 4OQTL 5B8CC 1NKRA 1F58H 4K9EH 4EDWH 4X98B 1OLLA 4ORGA 1U3YA 2M8XA 4R4FH 2X4RB 1W72H 4KI5D 3WFEL 1S9XA 1NSNH 1QSVA 4N0FA 3ILQC 1YN7A 2BVUA 2WBJD 4OLVL 2C3WA 1ODAA 4PJXE 4Y1AD 4ZNEE 1G9MH 1WCBB 2H26A 2PR4L 1J1XH 4MCZA 5C09E 3IDXL 4HJ0D 4Y89A 5E00A 4HUVA 3IDMB 4RNRA 4EI5A 3MLXL 4I48B 3IF1B 5DS8B 3MNVA 3VMPA 1I8IA 3ZYZA 1FSKB 3TIDB 2R56L 3RPKA 1VACB 5I8OL 1JRHL 4JFPB 1RZKH 4OLXH 3QUXD 1YUHA 3V7AG 2CKNA 3QO1B 3VRJB 2CLZB 1EVUA 3LEVL 1JZ2A 1LDPL 1HILB 3CGTA 4OZFA 1U3HC 4JPIB 2AXJA 2C3VA 2VO5A 1INDH 5CIPB 4YO0A 4AEHH 1QLEH 1KIQA 3H7LA 1D5ZB 5I1GL 1AD0B 3GK8L 5K9QG 1QSED 2JB6A 1G7IB 1U92A 4HIEA 2QR0B 2BCKB 4WHDA 4G42B 2D0HA 2EXWD 3TBVA 5F8RC 4DUWA 1CTNA 3KXFE 3O41B 1RZIB 3A6CL 5GRJH 2IG2L 4XTRC 5BXFA 3MNWA 4K7PL 4WTZA 2FJFB 1URLA 2PO6A 3NACH 4HKZB 5IWLC 3L9RB 1JI2A 3BHBB 4Y2DB 3NGBC 3TN0C 3AY4A 2XZQH 1CK0H 3FT3A 4N0FB 3L3IB 3OKNA 2AEPH 1S5HB 2FD6H 4P2OC 5EU4A 2OMBA 5C07A 2F54E 5HHPA 1J8KA 3NN8A 5H8DA 1IBGH 3RWIA 3VG9B 3THML 4XBEL 3DXAE 5MEQA 3KGRA 2D2OA 5D6CB 5F7EL 4BH8A 5JW5A 5F9WB 3REVA 2J12B 3WDHA 5IQ9B 1YYLH 5GHWL 1NEUA 3O2WL 4NRYA 1KACB 1UM4H 2VDOL 1PEZA 2XWTB 3KYOB 3QG6A 4KKBD 5H2BB 2MQCA 2HKFH 3MFFB 5KOVC 4DKFH 3RWGB 5HI3C 4FG6D 1A3QA 2EDYA 2J5LB 4D0DA 1IILE 4LCIH 1PG7L 4QNPE 3NCCB 3CCHB 4MJIB 4Q74A 2D0FA 1BPVA 2DYPD 1FLTX 2F9BT 2VERN 1QNZH 2ARJA 1ZSDA 3FO9A 3C87A 1AP2B 4GQ9L 3DYMA 3QDMA 1YPZE 3FT3B 3FMGL 2F53B 3H7BB 3U1SH 3C2SA 3WNNA 5LVEA 1NH6A 3MLSH 2DYPA 5I8EB 3MCKB 3ZE1F 2XN9A 4X6EB 5KJRL 1RUMH 4HWBA 4JFDA 3MLSL 3MQIA 3T8XA 2BNQE 3WFCL 1H3VA 1YEEH 5IROC 1U0QA 4JAMB 5EA0H 5MEQB 1ZS8B 2UZXB 1ZLUK 4GXUM 4WI7A 5EU6B 3LKNA 3MRKA 3TCXA 1OAQL 1KJ2L 3AS2A 1CXHA 4E0RB 1R5VB 5D1QA 1LEKB 4PJDA 4Z7QF 3NIGE 3W2DH 3LPGA 5C6PB 3ULSA 5IQ7H 2WUCH 4QTIH 5GZND 2EZ0C 2EZ0D 3UPCA 1ZHLA 5DD6A 5I76B 4P9HC 5IOPA 1K4DB 2YPVL 3FQUB 5A16A 2AABH 1N4XH 1QRKA 4X4YB 2KL6A 4DKFL 1CICB 2WINB 3TPUB 3TV3L 1UZ8B 1FZKA 2V5RA 1R3IH 4UBDD 4LAJH 4PG2C 2QSVA 1QFPA 3K2UL 1MIEL 3C60A 2VR4A 4HIXL 1RZKC 1SBBA 1UYWL 4G7VL 3V0VB 3ALWA 1SY6H 3OR6B 4G3YL 2FL5B 3ARPA 3BE1H 1OAZH 3MV7A 3PQYE 4S1RH 4EXPX 3D85D 2ZSVB 1WCQA 1X6LA 4XNYL 4YDLC 3S88H 2WBWB 5FHAL 1TFHA 3QQ9D 1NFDE 2BVOA 2E3VA 5DJ8A 1JIBA 4LSQL 4JPIA 3QI9B 3OGOE 1Q94B 3ZT5A 4HG4J 4F7MB 4FRWA 5CD3B 2Z93A 3HG1A 3TVMD 3QNZA 2BX5A 4H1LB 3MJ9L 4R3SB 1OP3H 3F6LA 4NC2B 5C0RL 4K7PH 1F6FB 2IG2H 2EDTA 1KN4H 4PGDA 4PLOB 2X40A 2EIBA 1NUGA 4TYUA 5L2KA 4LHUA 5J89A 5JOFA 3C6LD 3HI1B 3T2QA 4GXVH 2R1YB 4F15B 1ZWIB 1PKQE 1RVFL 3MOAH 3ARVA 4Y16A 4OCXL 2X4TA 4J4PC 3TPUA 2OJEB 2BSSA 1GGIL 4F7PA 3D85A 3LN5A 5T3ZL 3EYSH 3IAGC 5T1KD 3DURB 1H5BA 1PG7W 3CSGA 3GSQB 3FKUS 4NZRH 5MEOB 1JUFB 5I1LA 4XPGH 1D3CA 2GT9B 3DX9A 1G7HA 5HHVL 5I8OH 4ZODA 4RGNE 1VB9A 3T3MF 5E9DB 3CMOH 1NGQL 1NAMB 5EU3A 4Z7WB 5DC4B 5TDNA 5D7LE 1XF3B 4OUUA 1N26A 5DJYB 2IH1A 3RNKB 2HVKB 3VFRA 4GKSA 2VTFA 4CW1A 3QRGH 4I0PD 4L3ED 4RFOL 1T66C 2BFVL 3NH7L 5C0BB 3WO3B 4P46D 4TTDD 4R4FL 2HN7B 4YHPA 1CGSL 4EDWL 4K9EL 2D7QA 3FO1A 2XY2A 2V5SA 5E99H 3V6OA 1D5MB 4MNGE 5CAYB 3NFPA 3WS6C 1A1OB 1FAKT 1R0AH 1HQ4B 3ELAT 5BZWB 4KI5E 4R97B 3VH8G 4OZHE 5LJYH 3L3JA 1FORL 4U7KA 4D9LH 3MV9B 4WO4B 2MOVA 3PWJA 5MHSD 1D5BB 3NCMA 1QBAA 4PJ7F 4YHIA 2C3VB 4CGTA 3VXUB 4MLSA 4RRPA 3BZ4A 5GGQH 1GIGL 2R29H 1LQSR 3NA9L 3VWJC 1K4CA 2QQLL 5EH1A 2E7BA 1IAOB 4HIJB 5FF6A 2FIKB 1GIGH 4KZDH 1QKZH 5JQ6L 5LGKA 2Y1VA 3OX8A 1UH2A 1T6WA 2VXTL 4XPAL 1FZOA 1R3HA 1T7ZA 3SJVD 2QBWA 4XP6L 2COQA 3VXPB 1G9NC 1L7TH 5DXWA 4WI5A 3DBXA 5T5FH 3VFTA 3TBWA 1MCIA 5EU6D 3MX0A 1SBSH 4I0PC 2Z31A 1VA9A 3STZB 1GAFH 4KK9C 5CLTA 2PYFB 1F11A 5GJTL 3OKDB 3QFJA 1CGSH 5E24E 4WW2B 2SEBA 4WI8A 2P8PB 4KY1L 4PR5A 2XQBH 3GUTB 4ZQKA 1GZQA 3I6KA 3FOMA 5TQ0H 5CSZB 1IC5L 5D7KE 3L5HA 1FVDB 4L8BB 5ITBL 1WBZA 4EVNA 1K8IA 5F96H 1KCUL 9CGTA 5I16A 5T33L 3H0TA 4J1UB 3P30L 2P5WE 1R5WA 4ODUA 2VL5A 5D7SL 4WI9A 2R9HD 4TRPL 4BSVB 3LZFL 2XFXB 4XPGL 4Y4HB 2BY3A 4HCRH 4NZRL 4CRPA 3QI9A 3AAZB 1PBYA 1V5JA 4TNVF 3TESA 4WRLA 4Y5VB 4LSVH 3T2OA 4OCXH 1XGUB 1EV2E 3MOAL 4OCSH 1TJIH 4TSCL 2VDRL 4F3FA 3TBWB 4GXVL 4JFEA 3QNYB 1KC5H 4PLJC 2CXGA 1IARB 1KN4L 3CSBA 5C07E 3HCVA 1ZGLM 2BVQB 1P2CB 2XWJB 4YFDB 3MJ9H 4J23A 4K23L 4NNXA 5GS3A 4JZOB 2EKSA 4HS3A 1CFVH 2VDPH 2YRPA 2XYCA 4FQXD 3KLDA 3GUTA 1CLZL 2EDOA 4CMHB 2ZP0T 2IAMA 5ISZA 5JW4N 4XNZB 4M8VA 4QT5A 4MB4A 1SJXA 4TUJB 1GHFH 1T0NA 5L2JA 1UWEH 5H94A 3C2AH 3QDJB 1OAZL 4G42A 4S1RL 2UZYB 3TBVB 1ES0B 1OTSC 1XF3A 1FVEB 3MJGX 1F3DJ 4YDKL 1OD9A 1QSEA 3ILQD 1MIEH 5EO1B 4Z7OF 3MRMA 3VFSB 4EI6B 2VUOA 3WUZA 1LEIB 3IDUA 3QIUB 2D7NA 4JQXC 3GI8H 4LQFL 5HHMB 2KZ1B 1N4XL 3SCMB 4UDUA 1Z2KA 5ADPH 1J0ZA 4FABL 4YHZL 4U1MA 4QTIL 3IB4A 3RDTC 4J2XA 3C5SB 5ESQB 3QDGB 1YEDB 1CF8L 1X5FA 1AR2A 2ZSVA 3N1GC 5ID0B 1CDYA 4NO5B 4GAYB 1ZHBB 4JFDE 1D5BA 2V5YA 3IVKB 3REVB 5KANG 5LCVH 4IRSC 3PV7A 3SE4A 1NAML 3IRZA 1BF8A 3KDMB 3SN6N 4X6BB 3VGEA 2GTWA 3CPLB 4A6YH 5KJRH 3ILPB 4JRYE 1FL5A 1LEGA 3SHSA 3Q0HA 3TT1H 4LMQI 2DM4A 4ZTOL 2APWA 2GK0A 1D9KB 4R7NB 3TZVB 3VXUD 3P4NB 4Q6IB 2CLRA 4U2ZA 5A43C 1U58B 2WWMC 1YPZB 3EO9H 1LO5A 3I6GA 5L7XL 4F8TA 1QNZL 4P3CL 3VXTA 4KV5F 4NC1E 4OFPA 4W4OC 4FP8H 4TUOA 1J8HD 5A3ID 2VKXA 3GSNB 4AEIH 1ZLUH 2V2TB 5B4MD 1A64A 1CL7H 1P5VA 4LEOB 3RJDA 4NP4L 1XH3B 3D3VD 1G7HB 3V6FB 2ADIB 1JPFB 4HPYH 3SDAA 1G6RH 3TO4C 4MZ2A 1EHLL 1CFNB 3MUHL 1UM4L 2O61A 3PWUA 5J3HC 1LK3L 1YYLL 5GHWH 3SCMD 1YQVL 3TFKD 2VLKA 5EZJA 1QSFD 3DVGB 5K9JH 2IF7A 1YMHA 1ZGLA 4MSWA 3KLHC 43C9A 4EXKA 1FJ1A 3KPRE 4K3JL 4P46B 4CMMB 1IM9D 5FOBB 4PJ8B 3GMRA 4R8WL 1TNNA 4ODUB 4JPKH 1IBGL 2EDWA 3ZE2E 1NANH 4BELD 2C9AA 2H9GA 3T77B 2BSRA 5C0BE 4JQVA 1Z9OA 2FD6L 4E41A 5ECJE 4AYFA 1AGCA 2AEPL 3EDDA 2FLRT 4JGMA 5HI5D 1K6QL 1N6QL 2V7NB 4PJ9D 3NACL 5DGRA 1G6VK 1SJVA 3G5ZA 3I6GB 3V9FA 4JVUA 3VWKD 4K3EL 2GAZB 3CFEA 4DN4H 4ZTPL 2B2XL 4R8WH 1BMGA 4WU7B 2QQNH 2HFFA 4LGPB 4B0MM 2W9DH 4K3JH 5DJCA 1P6FA 1MIMH 2ZUTA 3NFSL 4MNQA 4PJGF 2VLRD 2AJXH 3UTSB 12E8L 4GOSA 4WFGD 3VXMD 2IAMB 2VLME 3VWJB 4X9GA 4NDMA 3AB0B 4U7MA 1DEEB 4R96B 5F21B 3FB5B 1OM3L 4HF5L 4L3CA 2J1KA 2KPNA 1RZKL 2QADD 4QXGL 3UTQB 5C0NC 3QJFA 5FB8A 4GT7A 1XGPA 5JR1H 1RFDL 3QDJA 2CDGB 3OKYA 3TF7C 4GG6F 1CD1A 3VFVB 2V9TA 3KLHD 2R4RL 4P3CH 5BVJB 3TNNA 1I75A 3EGSA 3HZKB 4ZFGH 3SJVE 5DRNA 3BWAB 1G9ML 3ES6B 4OT1H 1F11B 5FKPA 1QFUL 4UNVA 2X4TB 5LQBL 2R4SH 1MAML 3GI9L 4Q7DA 1IQWL 2O5ZL 4HUUA 2BVTA 1E27A 3ZYIA 3QUZC 1FCCA 1S5HA 4OQTH 5FM4A 4LRIC 2HKHH 2DL9A 2VSDA 2QHRL 1IAKA 3V5DB 3PDDA 5F1KC 1NCWL 1NFDF 5I6XC 3X11B 1RJZB 4Q97A 3T09A 3OXSA 4LHQB 1MFCL 4NN7B 3HNSH 4TNWF 2GYSA 4JFXA 3MA7B 4GW4B 4X8XA 5EUOB 1C16B 5DUBA 4LF3A 3D9AH 2A1WL 3PG2A 2XZZA 3OKEA 3JV6A 2CJUL 4K94C 5JHDD 2HRPL 2JKXA 5C0CE 1ZK9A 3FB5A 2R23A 3T65A 2H32H 4YHZH 3GBNH 1IC4H 2YEZB 5IESL 3QXTA 1G84A 1QQDB 5FB8B 2YK1H 4NM8H 2RHEA 3RZWA 5F1IA 2EYSA 4LQFH 5BS0D 2Y06L 3KS0J 4KQ4H 3RWGA 1AD9B 3QNYA 3QNXB 5DQDH 4MYWB 4AMKL 1NGZB 1A7PL 1FC1A 3LKSB 2Q8BH 5EO9B 1XR8A 2WSKA 4MS8C 4U6HB 5GSRA 4ONFH 43CAB 4K3DH 3BAEL 3QO0B 1WUNT 3WNOA 1OAXH 3EFDH 3K8LA 3SGDH 3BQUB 5I1HH 1PFCA 3VD7A 3S36L 1BVZA 3S96B 1PKQB 3T0WA 1MY5A 4QRPE 4RGOL 5ISZB 3BZ4B 2GTZA 3TO4A 2QEJA 2QSTA 2X4OA 3MREB 3L5WA 3FB8B 4NPYA 4ZD3H 4JFYB 1JGDB 5T1KB 5JIHA 1GH7A 3TYGL 1CLZH 4KKLD 5H94B 5KAQF 3CK0H 1QFOA 3A6BH 4WY7H 1DFBH 1OGAE 3FFCE 1ZS8A 4JREC 4PRDA 1P7KA 3ARDB 4ZUWB 4OCWL 2BHUA 3U9UB 4G6AC 5GS1B 4JZNB 4L9LA 3SDDA 3BP4A 1I3VA 3DXAD 2ZPKL 4GQPH 4LNRA 4ZXBD 4OCNC 1SM3L 1MJUH 1Q72L 3JTTB 4NKMB 4L8DA 1CU4H 4DN3H 1CVSC 4I3RH 4JRXA 4FMKA 1NGXB 5GZNC 4HLZH 4H26B 4GBXC 3BIKB 2N56A 1F8TL 5D1XD 3MUZ1 4MA3A 4M6ML 1T3FB 5I0ZA 3GSNL 4A2MA 3U7YH 1AQKL 4LSRL 3MODL 1ONQB 4PJBB 3E6HA 2F54B 2EICA 4RCAA 3PQYD 4OZIB 4L3EA 3VW3H 1FGVH 2GTZB 4ODBD 3UJIL 2DLGA 5FK9B 1ZHNB 1UC6A 4CN1A 1LO0L 1A7OL 4PJCE 2FECI 2RQ8A 4ZFZA 3N9GL 2VAAA 3OMZA 2DKMA 4P5TA 5TQ0L 4G80B 4X9IA 3T3PF 4KY1H 3MLVL 3LH2L 4TVSa 4GMSL 3VGFA 3O3UN 3N06B 4KTDH 3U9UA 1FIGL 3IAPA 1X5HA 3DRTA 2AJYL 1GAFL 3NCJH 4I4WB 5CP3H 3IDYB 4GG6B 4JFEB 1VGEL 3FRPA 4X6DF 1T2XA 4X9BA 3MA9L 3HRZA 3IRPX 4CJ0A 4D0BA 4H8WH 1L7TL 1BX2B 3BWAA 5DD5H 2VABB 2OSLB 4OI9A 4E42A 2VDLL 3RJQB 5LKNA 3E8UH 2YR3A 4CUCA 4YXKH 1CIUA 5FECB 2EEAA 1CFNA 3WO4C 3V95A 4P9MH 1QKZL 1JL8A 3AXLA 4N8VA 3BFOA 5F7YC 1EJOH 5F93C 4R4BA 4NJAH 3EOAA 1CR9L 2KQNA 5KSAD 4TOYH 1QA9B 3VA6A 3AUVA 1NDGA 5E8EB 4JANB 2ICEB 3EDEA 5ITFB 2BOBB 2VC2H 5D2LA 1J1PL 4GAGL 4IM8A 5E9DA 5LAXB 4Y4KB 3UTSE 1BVLA 1ES0A 4PBXA 1VADB 5HGAA 1ZVYA 4P2OD 1EO7A 1FYTA 4RISH 5TDPB 3T1FA 1G7QA 1PZ5B 5DI8B 4P3DA 5EULV 4RA3A 3BHBA 3RGVA 1CGWA 3QI9C 1OF2A 4M6OH 2EH7L 4UQ2B 1HE7A 3O3AA 4JO4H 4UDUB 1LWRA 1UB6B 3P0YL 4LVEA 1AXTL 4X6CE 3BUYA 4LFHG 4JM2D 1A4JB 5DZNA 2MSPA 5D1XB 1AY1L 3QWRD 4OGAC 4KJWD 1JCKA 2Q6WB 4G8FB 4NO5A 1OOAA 1S7WA 2GJJA 4LPUA 2CK0L 5BS0B 3QEQA 1UENA 4KZEL 1Y6NR 5EFIA 2DIJA 1W0VB 1NGQH 1QLRB 1X4XA 3EOAB 3TH2T 1YNLH 4WV1C 3DPBA 4NKIH 4OCRL 3IKCB 3QUYD 3U46A 1M4KA 3UTQA 1FL5B 4QRQB 2HTLD 3D2UA 5D2LB 3K8MA 4JHWH 1DLHB 1UKQA 4Z7VB 2LV4A 2CMRL 2ZOKA 1WFTA 4FFVC 3BD3A 3EYSL 2P24A 3IDJB 3UYPA 1MCEA 2NY7H 2VE6B 5DRWA 4HUXA 4MNHB 5DC9B 2IQ9L 5FM5O 1YN7B 3PP3H 5TE7H 3FN0L 2OR9H 4N1CA 4PJHF 3RGVB 3OG6B 1UM5H 3IDMA 3HUJF 4EI5B 4YC2B 3EDJA 3KPLB 5IW6B 5HYSB 4HIHB 1T7XA 2YXFA 4OTXH 4M93C 1EBPA 3MJ9A 3HE7B 3DI2B 5EZLB 3OKMB 5IB4A 4MNQE 4PY7A 4I0KA 3CAFA 2ZJSL 4MAYD 5FYKL 2ATKB 3SKUD 1ZT4A 5EZJB 4YHNA 4PP2A 3V6BR 4XNYH 1FN4B 3ARSA 1JWUA 4OFYD 2ZG2A 3F58L 3U82B 1MVUB 5FA3A 2HFEA 4KC3B 4BQ8A 3SDCA 2VKWA 3CXDH 3GMNA 2ZNXA 2YEZA 1QG3A 3WXVH 3U2SA 5JIIA 1XZ0B 1MCOL 2Z8RA 4Y4KD 3FZUC 5IBLC 1RJCA 2PW1A 3I6LD 2NXZB 4P2OB 1R3IL 4I1NB 5DK2A 5FCUL 3AAZA 4YHKL 4P2QD 5DRWB 1XR8B 3HB3D 5IFHL 5BQ7B 4FG6C 1WFUA 1WQVT 3KYAA 4JFOB 5F7MC 4PJEE 1S78D 4M62H 3W39A 3G08A 1ACZA 4UT7H 4U6XB 5IB2A 4LKXA 2C1OA 4OLWH 1EFXA 5E94B 4KHTH 5IMKB 4UOJA 3MREA 2J4WH 4MNQB 5IV2A 1L9NA 1MCJA 4PP1C 5EZLA 3X3GH 4YDJA 1NC2B 3CIQA 1MVFA 2BVOB 5DJ8B 3CZFA 3WFCH 2AGJL 1T1XA 5F89A 4JGJA 4MMXC 4UAOC 2HVJA 4RFEA 1KJMA 3QIUD 4L9LB 4QT5B 3I50H 3KAAA 1KGCE 3U30B 3DO7B 5JZ7C 2VLJB 2FYYB 5LAXA 3BDYL 5HYQA 1KJVB 4DK6A 2JCCF 5T3XL 3RI5K 1VADA 4M1CC 2BNRB 1FPTH 5ANMA 1MNUH 2DQDL 3H9SE 3C60C 4XNQB 2OJZH 4JR9H 2CRIA 1HXMB 5HYEA 5JA8B 2W65A 3MLUH 2X89A 3O4LD 1U3HB 2AK1L 1KYOK 2VH5H 2D31A 4YHOH 4M1CD 1ZVSB 2H2PC 4X4ME 2K7PA 2HH0H 1GOFA 2APFA 2XPGA 2GUOA 1EUUA 4P0DA 3BIAX 3ULUL 2CDEA 5AWNL 3E6HB 2HFGL 3ULVF 1T89C 4ERSH 2FB4L 1RJZA 3QPQC 3P9LB 3MNVB 3RPIA 5BS0E 2F5AH 3H42L 3SCMC 4KUZH 4OSUL 4G8GE 1D9KD 5JW4Q 3RWFA 1S7WB 2PUQT 4Y16D 5IMMB 3HFMH 3DARA 2DQHH 5DRXB 1FGNL 5HGGS 4XPBH 1MAJA 2QADC 5C0ND 4DVBB 4NQCA 3Q1SH 2BY1A 4WI2A 1HILA 3MUJA 4ALAH 5I75B 2E7CA 2R0WH 2PYED 4NC1C 5C0BD 5TF1H 2IH3A 5KSBF 1E6OH 1RIUH 3QPXL 4G6MH 2HN7A 4YHPB 3C6LC 4PGBB 2CPCA 2VN4A 1B9ZA 3UMTA 1FG2A 4MD4A 4YHYC 3VDAA 1KTDB 4XP1H 1QR4A 2GK0B 3MRLA 1FYTD 4APQC 4F2MB 3MRHA 2NW3B 3ZSTA 3LKSA 1HNFA 5C0EA 5GSRB 1W0YT 4O2FA 5GGSY 1RZIA 4DVRL 4O9HH 2IWGA 3A6CH 4GBXB 3GSOB 4L4VE 2YD3A 4Y2DA 3QPQD 3RWDB 4IBLT 1PKQA 3W5MA 4AIZA 3CLFH 4QF1A 2X5PA 2Z0BA 4LSTL 1CXLA 4X8JA 4GJTB 4YBQD 5DJAA 4IRJD 4LSSL 4M7ZB 4HQQL 5C9JA 2P5WD 3BISA 4TQEL 5HGBA 4LSUL 3ROOB 3EYFA 3QUZA 5I6XB 1K4CB 1EHAA 4P23B 4PB0H 4Y4KA 3U36A 5HGAB 4CDHA 2IMMA 1SMOA 2CD0A 3CFDA 5B39G 3BZEA 5D8JL 4MDJB 4QRUA 5EBGA 3NCBB 3S9DB 3WN5B 2H6PA 4LRNH 4R90H 4DVRH 4GFTB 1J1XL 1SEQH 1T7YA 2XT1B 4WWID 1U36A 1A7NL 4I2XB 5L2KB 4NQDD 1ORSA 4F57L 4XP1L 3CVHH 3BZFA 2P44B 2BSRB 1UADC 3WFEH 5KVEL 2VXQH 3HPLB 2FO1A 3IFPA 5GZOC 4HS8L 1DLFH 4HK3J 4F7PB 5TF1L 3QCVL 4IRJB 1LO3L 1OTSD 2JF1A 3SPVB 4NUJA 4U1KB 1WEJL 1AKJA 3JTSA 3UBXI 2Y07L 2QJDA 4P4KA 1FGNH 2F74A 5L9DL 5GSVB 4E9LA 2Y9RT 2GSGA 4KUZL 4OSUH 5E8NB 1XCQA 4QRPD 5AUMA 3QQ3A 3WFHA 2HFGH 3JWNC 1CE1L 3AFLA 5E9DE 3UTSA 2IPTH 3UTOA 1MOEA 4KJWC 5CZXC 1BEYL 3CFDB 3LDBC 2L7JA 2Z31C 1OGAD 3FFCD 5DD3H 4QTHA 1Y18A 2PYEB 3ZL4L 2C1PA 4JM2C 3QZWA 2FYYA 3QDJE 3MLUL 3WEXB 1TCRB 3HE6A 1AGEB 4KROC 1N0XL 5C3LD 5KSVA 1F90H 1Q0XH 1V7MH 2IPUK 1MNUL 1WWBX 2DQDH 3VFVA 5CD5D 5HPOA 3SJVA 2VIRA 2MNUA 1FBIL 2MPAL 3DHJA 3W5NA 5T3XH 4ZUVA 1JF1B 2FJGA 5M94B 3IFPB 3MPCA 4PRBB 5IBTH 1MQ8A 2BVQA 4X0KA 3F65A 2NY1B 4WFFE 3MV9A 1F4YH 1FZKB 4WO4A 1GGUA 2XOTA 4NNXB 5EC2A 2VSCA 2NY2B 3ZDXE 5HVGB 3MUGB 2R8SL 4IS6A 5FYKE 3QEQE 3VWKB 3T0XA 3TJHD 5DSCB 1I85C 1KXVC 3JV4A 5IMOB 3RY6C 3T2PA 3WDJA 3JVGC 3WN5C 3PGCA 3MRIA 5CJXC 5C08B 3UTZA 4U0QB 2ITCB 1DJSA 4ZUSB 5ICXB 5K93A 4PGEB 3KVQA 5C0CA 3VGDA 1S5IH 4OIIL 3GRWA 4PG9B 3G04B 2VR9A 4UT6H 5BQ7A 3RTQC 1LEIA 2HJFA 3BW9B 3P11L 4U1HA 4J3OC 4JM4L 2WWMD 4M7LL 1WF5A 5FCUH 1AH1A 1RJLA 3IS1X 1X5IA 5CEZE 5BV7L 3ARWA 3MRLB 1JGVH 2W59A 3NTCH 5I75C 4FQXC 3MZTA 4M9PA 2J7LA 3DVNB 3WXVL 1AXSB 5DGQA 3C09C 2HJLB 1R3KB 4U6HA 4DCQB 4KDVA 1RHFA 3I75A 4LCCC 1J10A 4ZQKB 1AI1L 4NM4H 4MVBD 3R8BB 5A40E 3VU2A 4PREA 4PRPE 1ND0B 2FEDC 1C12A 3E0GA 4WI3A 4JRYD 5D1QD 1IGCL 3VI4F 5ACMA 5FUOL 5CIPA 3DV6A 4YO0B 2W0FA 3ZTJH 2A6JA 1RZGA 2GT9A 3M45A 4Q9RL 1QPPA 3DO7A 1Y6MR 3LB6C 5T1KA 2MMXA 3KJ4B 4JFDD 2LABA 5C08A 1IZJA 3UTZB 3EO0B 2R2EB 3FO0L 5FYJE 3OWEA 5DVOA 3Q2CA 1GL4B 2G9HB 3ARDA 5ILTH 5IHUH 3OTTA 2LAGB 4W6WB 4CW1B 3QDJD 1HKLH 3EO1B 4TNVK 4MZ3A 3FB6B 1OW0A 4G7YH 1FDLH 3KYKH 2RFXA 4HC1L 1RJLB 5E4IA 5KSAC 3WHXA 4LEOA 5D1ZB 1VFAB 3V6OC 4GRWB 2R15A 4H26A 4DQOL 3MLZH 3MYZA 3WFZA 1YNKH 1MRCH 3P9LA 3RPIB 4MA3B 4RGNC 2NY3D 4HK3N 4RRPG 2WBKA 4QYOA 5JA9A 4CU8A 2YSSB 2WV3A 5KSUB 3BQUC 3VFWA 4ELMB 5BVPL 1LHZA 1J1OH 4NOFA 1M05A 4ODVH 4WFHD 1FJ1B 4P46A 4M9OA 4IHOA 4R0LA 3U2SB 4KJPC 1XZ0A 1BBJA 1S7VA 4XHJC 2BERA 5D70H 4NQED 2FGWL 1XAUA 4JFQB 5MEPA 4E41B 2EH7H 2MCPH 5J06A 4F2MA 3QXWA 3QUYB 3QZWG 4Y2DD 4DZBB 5SX5H 4YBHA 1UZ6F 4YDIH 3U4BH 4LDEB 1AGEA 3W39B 4GRMA 2GAZA 3RGVC 3I84A 5EORL 5HD8C 1CXIA 4ODVL 2PYFA 1RUAL 1HZHL 4JM2B 5CMAB 2VC2L 1J88A 5IG7B 4JFPA 5EZIL 5FDYA 2CKBA 3NFNA 2A9ML 3BYYA 5DJ6B 1JYVA 5K59F 4IS6B 5D4QA 3O2DH 1MRCL 2GTWB 4XVJH 4KUCD 5JPMB 4YXKL 2CR6A 4RQQA 2NY0D 2VLKE 4NZUH 5I16B 5IFAL 4W4NA 3MRIB 4G7YL 3QRFM 2HJKB 3QCUH 2EE3A 2ITCA 1P4IL 3M07A 1HKLL 5C70A 5GJSH 5DVNA 3TNNB 3ABZA 3MNWB 3Q6FB 3RVWC 1MHEB 2EE6A 1S7QB 4F9LC 4RAUB 4XPTL 4GG6E 3QUYA 5DI8A 3FRUA 4TUOB 1GPOH 3ZE0F 3J8F7 5GIRA 4L1HA 4ZO7A 4OM1H 1E27B 2OTWA 4KHXL 4GMSH 3LH2H 1CD0A 1G9MC 3T0ED 3PQYB 3TT3L 1OAKL 3SO5A 1MCSA 4GBXD 2F74B 2BNQD 4NCDA 1NCBL 1P53A 3I75B 4G5ZL 4PRIE 1KULA 2C7UB 4BK4A 3O6FC 5F9JA 1XGRB 3VRLE 5D6CA 1IGYB 1I1AB 2OXGA 3ARGD 5JUEL 4P23C 4J3VA 3OKKA 1A7BA 1LGVA 5D93C 4K7FB 3SKMB 3IKKA 4L4TD 1IVLA 4XP5H 3CNKA 1LO2H 3VXSD 1JGVL 1HEZB 1BBDL 2VOTA 5JPMA 1M7IA 5C86A 3OJDA 3MJ7B 4D8PA 2NPLX 5F1SA 4RAVA 4K07A 1U8IB 3PGFH 3CDCA 1ZGLP 3DSFL 2CDFA 4Q6YA 2NTFA 3ZKXB 3ZKND 3IGAA 3H9HA 1SM3H 3NCYS 5ADOH 4GBXA 5ENWA 3WCYA 2CKBL 3IU4L 1AGFA 4S1SL 5TQ2L 5BOPA 3ZE2F 3FB6A 4X6FA 3V0AC 2E8YA 4LHUG 3ME0A 3QXUA 2YOCA 5GISH 4WU7A 2YHGA 3MUGA 4Y19A 3ULUC 1RK1B 1DFBL 3T4AB 5DJAB 5ISZD 3VH8B 4PJIE 2DYPB 3CK0L 4JQIH 4MWFA 1QEWA 3MYJA 5KS9A 3AVEA 5I66B 3AREC 3T8XB 4JRWA 3PGCB 2EYRB 3JVGA 2D03L 4ZSOB 2WNGA 4PY7B 4XCYB 3BGFC 3BZEB 2HMIC 4NRZA 5I1HL 1HWHB 3ARED 5IVZB 4EN3A 3WFBH 5E2UH 1GOHA 3HE6D 4OD2B 1S9WA 2NY3B 4N0YL 1A7PH 4JN1H 2PYEE 1NBYA 1ZHLB 5DQDL 4M8QA 4NQUA 3PHQB 2I60H 5HYFA 4KQ4L 2YZ8A 3TZVA 3BEWA 1DBMH 1Q1JH 2NTFB 1Q1JL 4WO4C 2IC2A 4X98A 3RWEA 1F2XK 3OXRB 2A74A 4G8GD 2EDQA 1MI5E 4NZTL 3L3JB 4QKXB 2XQYK 5ICYB 4XNZC 1JYNA 4P4KB 2A1WH 3EYVA 2V2TA 2HWZH 1FO0L 3TH4T 4HS6B 4I3GA 1RI8A 4MJ5A 1WC7B 1MFCH 4HMEA 2HP4A 5EUOE 1BGXH 2F8OA 3MYJB 2NY5C 3QFDB 3WFHB 5CSBA 1V3JA 3UC0H 4P2RB 1WEJH 2R2CA 5MHSE 5CINL 2IFGA 1WWAX 2HKHL 1L0YA 2D03H 4HLJA 1OAYH 5DC0A 3QCVH 3UJTL 2PO6C 4XCYA 1ZLWK 1XF5A 1AR1D 2Y7QB 4MD0B 1IQWH 1INEL 2QSQA 5C0AD 2LU7A 3B9AA 3VXSB 4D94A 1QFUH 3CVHL 2VZ1A 3EYQD 4XAKD 3VFTB 2QR0A 4ZFGL 3MGOB 1I7RB 1NCNA 1G9EA 5DJXB 2V17H 5GZOD 2ADFH 3IXAA 1NJ9A 4R90L 3ALXA 3SJVB 4AIXA 1A6UL 4NGHH 4WGVB 3PHQA 3HI6H 1WT5C 1G7PB 1RFDH 2X44D 3IDGA 4LVNC 4WJ5A 3JV0A 3MLYL 5D8JH 5HYIA 5DVMA 3PNWB 1KT2B 3DSFH 3RVWD 2V7NA 3NZ8B 2B1HH 3CH1B 3PGFL 1I9JH 1PYWA 4HV8B 3GSQA 4I18B 3HA0A 2DLFL 1VFMA 3BPCA 2JE8A 1P4LB 6CGTA 4TQEH 3STBA 3VI3F 1SY6A 5GGSA 4LSSH 5ALBL 2AEQH 5DA0B 2WP3T 1P84J 3NFSH 2WQRA 4R0LB 3T0EE 3VCLB 2FEDD 4Y1AE 1R5WB 5TH2A 4URTB 2FH6A 4OF5A 2PXYD 1ZT7B 3IT8D 3ZLQC 2F19H 4NQCE 1J86A 5D7IF 5I71B 5IP4A 4UU9A 1HI6A 1U8PB 2D7PA 2EXWC 3FCTB 2WIMA 4PJFE 1IEHA 1KFAL 3C5JA 4LNRB 1PZ5A 1U8QA 4YHLH 2GJ6B 1UZ6E 3SO3C 2AJZA 3LRHA 2X42A 3TT3H 1PLGL 4NFCA 4KRPB 2ESVD 3X13A 2DICA 2BDNH 2X4PA 2FWOB 1GPOL 2NNAA 3PABA 3VD9A 4AM0B 4ETQA 1NCCL 3RUGF 1QPXA 3T0BA 2YPKA 1LDSA 3Q1SL 1LK2A 4LKCB 4I77L 4PREB 2XTLA 3KPNB 5K9JL 1OLZA 4U4BA 4Y19B 1YQVH 2F5AL 4JHAL 4Y5YA 1ADQA 4LVHC 4NZUL 1RMFL 5DO2D 1P7QB 3V5DA 2YA1A 4TUJA 2FIKA 3EYFB 5MP6L 1ACYL 3CLEH 5JPNA 1G7LB 4NP4H 2HH0L 2A9MH 2AEWA 2LE9A 5F3BB 4TTGA 4JFXB 3VFGL 3QWOB 5EZIH 5IK3B 5DUPH 1R5VA 3EO1A 3PIQA 4JR9L 4I4WA 2R23B 2NYYD 3OZ9H 3FRUB 4MD5A 4AEFA 3QB7C 4W6XB 1NBYB 2G60L 2HT3C 3WXWL 4YDIL 3X13B 4RFNC 5IOPB 4K94L 3S7GA 2F58H 5M95B 2IBGA 1TCMA 1FRGH 4HIHA 4PRID 4JFZH 3C5SA 4GAFB 2MCG1 1JGUH 43CAA 1Z9LA 4AK1A 4ZOEA 1RIHH 1V7NH 4NQSB 1U95A 5DMKA 3ARFC 3QUMB 3ZT7A 4YHNB 2J4WL 3O8XD 3LKPA 1CDIA 5E8EA 3ZYOA 1YY8B 3GMQB 4KHTL 5B22A 2N7AA 3D0VB 1DQQB 1BBJB 4M62L 3CXHJ 1X4YA 3WO4B 4HT1H 3WYRA 3BYTA 3ZDZE 2IBZX 5T3ZE 4P2QA 1EERB 4OQ1A 4H0HB 4S11A 1DVFA 1CBVH 2IALA 1IC7L 1ZANH 4X4XA 3W11C 3U0TA 3VFNB 3QEGH 1NCTA 1YEFL 3LS5H 4FZEH 4F33B 5CJ5A 1QP1A 3IXAB 2DMKA 1B3JA 3SE3A 2PW2B 4APQB 4BQ9A 3CFBA 3LD8B 3C2AL 3F58H 1UWEL 3MC0A 5IG7A 3QSKB 4KKNA 1UT9A 3MV01 2YUWA 2ZCLH 2XTJC 1DBAH 3NIDF 1P7HL 4YDJB 3RVTD 4DKDC 3WIIH 1EIBA 15C8L 1VSCA 1IKNA 3HNVH 5D6DC 5M7QA 2VZVA 3GZKA 4OKDA 4PYHA 4M7JH 1E0OB 4TVPE 2DQJL 5I1LB 2VDMH 1VPOH 4UTBH 3GMQA 1EXUA 2Q3ZA 4Z0BH 2BXZA 2AP2A 5TH2B 2HJKA 3MCG1 4MX7B 4DGVL 4NM4L 2WUBL 1KC5L 1JK8A 2HYMA 5TE7L 4G80A 1ED3A 2JELH 4F37F 1TTUA 2JJSC 2IQ9H 1TJIL 4Y5XB 1IGJB 5IBUB 5I73C 2B5IC 2D7OA 5BXFB 4RAUA 1II4E 3DO3A 4APQD 4ZG1A 4B7IA 5IEHA 1OARL 4PRHE 2W38A 3DX8B 1ETZB 3ARBB 4GUPA 5I74B 1IL1A 1CWVA 3OKNB 4JHWL 4NO2A 3ULUF 2GUOB 2IANE 1DANT 2HT4D 1A7RH 1EA9C 4U1MB 4UT6L 5IW6A 4G8IB 4J7RA 1FFPB 4Y19E 1O7VA 4LSPL 4MQSB 4PJ5A 4ZO6A 3PHSA 1OPGH 1KCUH 5C0GA 4KZEH 5DLMH 3SE8H 3BPLB 4KRPD 3PWJB 2DQCL 4UOW0 2P8MA 4K7PY 4HBQA 3SE9L 1AY1H 3UTTD 4JO3H 4PD4J 3HG1D 3RDTB 1FL6B 1A14L 5A2LH 5IR1B 5A2IH 3DNKA 5C0IB 1NMBL 1KLFA 2VJXA 2Z35B 5GRUL 3G5YB 2GJ6E 5JPNB 1JRHI 1GGYA 1EZVY 1U6AH 1MJ7L 1SBSL 1FG2B 5FYLH 1D9KA 4R7NA 3E3QC 3EO0A 3EBAA 3S35X 1NJ9B 3V4PL 4U1LB 2DLTA 1CLYH 5GGVH 4RFNB 3QUMH 2AKRB 4XH2B 3WD5H 1RZ8B 1HDMB 1BOGA 3G5XB 3RX8A 4WNQB 4ZNEA 5B39A 4RISL 4ZS6C 3BD5A 4HFUH 2ZKHH 4JFOA 3C60D 3CX2A 3FO9B 3CFKA 1Q0XL 5K9OA 3FFDB 4HAFA 1JWMA 1JE6A 1ZE3C 4GRWE 1BQSA 2OP4H 1IGIL 3H7BA 1FNEB 2NR6D 4S0TD 4KZDL 1BQHA 2X89D 5D1ZA 1H15A 4U1GC 3FJTA 3CVIH 5I66A 3I02B 3LIZL 3OKDA 4LLMB 4NJAL 1AGDA 1GGBL 2O61B 1B6DA 4HULB 3VCLA 5B38B 4PJGE 3GJEA 3ALPA 2D4DA 1VDGA 4N9OB 5CEZD 4QRSB 4JFED 5DUBB 4O02H 4OZIF 3O9WA 3E8UL 1QLRA 1NMAL 4U3HA 3SE3C 2BNQA 3VRIB 1FL6A 3D0VA 1KJVA 4YJZL 3U46B 3K4AA 4HKXA 3UTPE 1QQDA 4K9EC 2VL5B 1DZBA 1T03L 3EHBD 2XTJE 4KQ3H 5E99L 1AD9A 2NNAB 5A16B 4PG2A 1F6LL 4XCEB 3RRQA 1KCLA 3BH9A 4KRPC 4O2CB 5JXED 1OCWL 3G5ZB 1UZ8A 2BFVH 3NH7H 2FX8L 1CL7I 3HMXA 4NUJB 3UEZA 4TUKL 1HK6A 4EIGB 4LKCA 4UILH 1OSPH 1YMME 1QHOA 3QDGE 4RWYH 4DUVA 2GI7A 5HDBF 3S97C 5K9OB 1SEQL 2R1WA 3EYVB 3H9ZA 4XP9L 3V4VL 4P5KB 1KOAA 4HS6A 1HHGA 3TO4B 4C4KO 3RWCB 2Q8AH 3ARZA 5HHME 5F7NC 4P2RA 1MCWM 3MODH 5HHVH 4KDTC 4LSRH 1FFQA 3D3VE 1G7LA 2D7MA 4FNLH 2AJ3A 4RGNB 4NN5B 5A2KH 2VITA 5DJ6A 3O6LL 3QWOA 4N68A 1EPFA 5KVFH 4PUBL 4U05A 3EJZC 4TPRL 3TN0A 3QJFB 4PJEF 5CZKA 4I3RL 4LSTH 1MEXL 1UCBH 5IJVA 1I7RA 3FT4B 4M48L 3UBXA 5I2IB 2IQAB 2ZG1A 5IKCB 2ZUUA 1E4XH 4W6YB 4L3AA 3PWPA 3MRMB 1KT2A 4PRBA 3MLWL 3QUZD 1WIPA 1B90A 4I18A 4KK6D 1MRDH 5C2UB 4NQSA 1Z0MA 1A47A 5FYKU 4PJAB 1RIUL 4U6XA 4OBRA 5FHAH