2IJ0C

Structural basis of t cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
118
structure length
118
Chain Sequence
GAVVSQHPSMVIVKSGTSVKIECRSLDTNIHTMFWYRQFPKQSLMLMATSHQGFNAIYEQGVVKDKFLINHASPTLSTLTVTSAHPEDSGFYVCSALAGSGSSTDTQYFGPGTQLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxic shock syndrome toxin-1
publication title Structural basis of T-cell specificity and activation by the bacterial superantigen TSST-1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 21
structure length 118
sequence length 118
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ij0C00
3FQUB 2AV1A 1JHKL 3QJFB 2Y4SA 2QKIA 4ZNEE 2AXFA 1BMGA 3V6OE 1KBGH 2Z4QB 2YUVA 2F15A 4EN3D 5A3ID 4G3YL 4HPYH 2W9EL 3ZDZF 4UOW1 3NZ8A 1DE4A 3TVMA 1SJEA 2ADFL 3IDMA 1UZ8B 1T83C 2DWDA 1T1WA 4XVUD 1J1XH 4J8RA 4UDUB 4CN6A 2YPLB 1JGLH 3D2UD 4KUCF 4O9HH 2DTML 5F1KC 4YR6B 1J88A 4PJAF 3L1OH 4ZQKB 2JJTC 1DSFL 1S3KL 1QRNE 2ARJB 1FZOB 2RQ8A 4J1UB 4NQEA 4DUXA 2HRPH 3N1MC 3O6FD 5KVEH 3MRHB 2W60B 2R9HD 1EXUA 5H94B 2A9ML 4UV4H 4MX7A 4KJYA 5E00B 3NGBB 4PJCF 3KG5A 1BWMA 1NC4B 4JZNA 1P1ZA 3FOLA 3V7AE 3QUZB 4NP4H 1RJLA 4XTRD 4XP9H 1RMFL 4YFDB 2PR4L 5GPRA 4AG4H 1RJYA 1VEMA 1F3JB 1E4XI 2IH3B 2IQAB 2H1PH 2XA8H 4L4TD 4XPBH 1GGCL 3MA7B 2ESVA 5JPMB 4OQTA 4XP6H 3RVWC 5JOEA 5C0AD 3TZVD 2NY0D 1UWXH 2NY5H 2A74B 3ECBA 2VLJE 4Y16A 1RQ5A 3SDYL 4LLAA 1WWAX 5TE7H 4MB3A 4FFVC 5J06A 4ODVH 5D7KD 4UTAH 3QNZA 3EYOA 4ZPVA 4G80A 3ELAT 3LKPB 1F00I 2EYSB 5IEHA 2AKRA 1DBJH 4EN3B 4Z0XA 4L8SC 3O4OC 1JFQH 2YKLL 2HMIC 2DQCL 5FDWA 3DPBA 3S35H 3O81A 2BXZA 3IDIB 4O5LL 2VDQH 5M7QA 3RPIA 4KRLB 4LLDA 2HT4D 1S9XA 4NQDE 4NN7C 2JK5B 3GNML 3AGVA 3H0TB 4JKPH 4G6ML 2ERJC 4HMEA 1KIRA 4YK4C 5A2JH 4JZJB 5CJXC 4G6JH 4WHTB 5MEQB 3DVGA 1OTTD 1A4JA 1OSPL 3PL6A 2LU7A 5BVPH 5CEZH 1YEKH 2R2EA 1LNUA 3WKML 3T08A 5DLMH 1D5MA 4Q9CA 5E8NB 3RZCB 3JXAA 4ONHB 4ETQB 2UWEF 5SWSE 3L3DA 1JNJA 1FLTX 5C6TL 4JG1H 5C0ND 4PR5B 5DVLA 5D7IB 4L4TB 2HVJA 4YZFE 2OZ4H 1OQOA 5DT1H 1G7MB 3NTCL 1CG9B 3RI5F 3TZVB 2EDHA 2VLRE 1JGUH 4U1SA 5GGRB 1FC1A 1WCBA 3V6OC 3WSQL 2E7LA 4ODHH 4NOBA 1HYRC 5B3NA 1CE6A 3BW9B 1QVOB 1N0LA 1FFQA 2EDJA 1VA9A 2NW3A 4BZ1L 4JQIL 3CC5B 1N6QH 4QTIL 5IFHH 3RAJH 2YBRB 1N3NB 5K9OB 4M7ZB 4L3CB 1DEDA 3MLUH 3CFKB 1RZKH 4TUJB 4QRRA 4HUXA 3DXAE 4LVOB 5TDOA 4K7PX 1LE9B 1I8KA 3LCYA 5CSZA 4X4YA 3TVMD 1KBGL 1J11A 3IKCA 3OR6A 4HPYL 1R5WB 3B8SA 1WWWX 2JJSA 5JXED 2RB8A 2B5IB 2MOVA 1J1XL 4G6AC 2V7HB 2DKSA 1JGLL 2YD1A 4O9HL 3L3OB 3CH1B 4NQED 4QHNB 4HULB 1VFBA 4JHZA 1DBBH 3S8WA 3L1OL 3GO1H 3TPUB 2QR0A 2Z91A 3DVIA 2HRPL 1D5BA 4PYHA 5HPMA 4TNWF 3BWAB 5KVEL 1NBZA 4UV4L 1A22B 2RBLA 3FRPG 5AZ2H 2GUOA 1DBKH 2VXVH 1FJ1A 5IW1A 4IIQC 4NP4L 4Y4KA 4JM2B 5D5MB 4XP9L 4NNXB 2XKNA 2ESVD 4AG4L 3TA3C 1SJHB 2KBGA 5D1QB 2XA8L 2H1PL 4XPBL 4X7FC 1OQXA 2IADB 4CADB 3FRPA 3LRGA 4GXUM 4Y16D 1GAFH 4XP6L 1MHCB 2VL4A 4JN1H 3REVA 4ZFFB 4U1LB 4ZFZB 5DMIH 3TIDB 4XCYB 2NY5L 3FQWB 4U1NB 3TBVA 4PRHB 5TE7L 3KPMA 2QKIB 4K71C 3P9LB 4ODVL 2AXFB 3QO0B 3IDYC 4WHCA 1YEJH 1S9KC 4UTAL 2C4XA 4R26H 2BNQA 4CN4A 1CQYA 4N5EC 4GXVH 2R8SH 2BSTA 3LZFH 3TVMB 1SJEB 3IDMB 4JFFE 1DBJL 4RFEA 1JFQL 2IANE 1BBJA 2J8UF 1T1WB 4J8RB 4P23C 3V5HA 3S35L 1JZ5A 4NKDA 3WYRA 2WP3T 1TETH 1P4LA 2VDQL 4EDWH 4ZSOA 3E3QE 5FIEA 2VXTH 3NFPB 1NLDH 4MNGA 3O8XC 4S1QH 3MRDA 4UILH 2AGJH 4JKPL 3I3DA 5CINH 3PL6D 2VAJA 4KJYB 1H3WM 4U1JA 5F3HA 5FF6B 3NCEB 4G6JL 3SPVB 2AXGA 1U8PA 3SKMA 1P1ZB 1JV5A 4G8FA 3FOLB 5BVPL 3O3BA 5CEZL 1YEKL 1RJLB 4Q6IC 4MB5A 1JRHH 2ADIA 3ULSA 5DLML 3MREA 4Z7WA 3P4OA 1CLCA 1RJYB 5DJDB 1P5VA 2PKDA 4PJAA 2ESVB 4JG1L 3RNQA 5D7JB 3TYFB 4JFEA 1OT2A 2GCYA 1NSNH 1U92A 2P48B 2OZ4L 3ECBB 5DT1L 1QEWA 4Y16B 3SEPA 3P0YH 4BFBD 2GAZB 3DHMA 2BMKB 3SDXE 3PJSA 3J8F7 5HDBF 3ZKXB 1JGUL 4PBXA 5I15H 5KZCB 3H3BC 2YPKA 4LRIC 4N90D 2FZ3A 1QUNA 3EJZC 4ODHL 1JVKA 1G7IA 1KB9K 3QNZB 3EYOB 3FQXA 4N1HB 1ROWA 4LCUA 5IEHB 2YN5A 3TN0A 1AIFA 2AKRB 1N6QL 4QRRD 5IFHL 1W72H 1A6VH 4UQ2A 1OTUD 5FDWB 2DQEH 3MLUL 4QLRA 1RZKL 1T5XA 4PJDE 3CVIH 5IBLC 2R39A 1NDGA 4F57H 2P5WB 1ZGLA 5C07B 4MJ4A 4X99A 1S9XB 3IU4H 4QNPE 4KU1A 1LDSA 5IP4A 4LHJB 5I75B 4PG9B 2V2XB 2H2PD 4LLYB 1BF8A 2VDPH 4N9OB 5DEGB 5ICXB 1J1PH 1KIRB 2HWZH 1P9MA 1U8IB 3DVGB 2NNAB 2HG5B 1A4JB 3PL6B 4M61B 2OP4H 4UQ3B 4XXCA 3RX5A 3ZL4H 2R2EB 1LNUB 4HUWA 1DBBL 2ZUYA 3OXSA 4DAGH 3GO1L 1D5MB 4LK4A 4NNYA 2NY5C 1P7KA 8CGTA 5BV7C 2ZSVA 3SQBA 4FMKA 1NANH 1KEMH 5AZ2L 4X6BB 1U8JB 1DBKL 2VXVL 2D4DA 3KDMA 4Y4KD 5DQDH 3SQOH 2HVJB 2HFEA 2CJUH 2VN7A 1FV1A 2PO6C 4NC1E 3ZT5A 5HHOE 1K4CB 4EI5C 2MWCA 4U1SB 3T3PE 2B39A 1DUYA 2FWOA 1A1OA 1AO7B 3DIFB 4C56E 1WCBB 4MA1B 4ZMAT 1MCSA 4N0RA 1T83A 4LSQH 3QWRA 5IVXA 1UC6A 3HCVA 4X5XA 2NW3B 1GAFL 4JN1L 3BEVB 2BSRA 1AQKH 2BNRA 3HUJF 5DMIL 1HH6B 1TNNA 2JJTA 1SBBA 5GQBA 1VFAB 1GCFA 4PJXA 1XCQA 3GSOB 5C2UB 3L7EB 4HUXB 4QRRB 4ZOAA 5C0IB 1I3GH 5TDOB 4YX2H 2BNQD 3I75B 3H7BB 1CICA 2W07A 4LHUA 5CSZB 1YEJL 1FCGA 3E3QC 3QI9C 4R26L 1YPZF 3OR6B 4L3EE 5E5UB 4PD4K 4XBGA 4GXVL 2R8SL 3LZFL 5A2LH 4PJEF 2A73A 3G5XB 1TLKA 4IS6A 5EA0H 2CD0A 2BVEA 3CUPA 4YEEA 1UM5H 3C9NA 3EBAA 5D93C 1WITA 3V0WH 1TETL 1ONQA 3B6SA 4QOKE 5IHZA 2G2RA 2JJUA 3O2VH 4EDWL 3ARRA 2QR0B 4X80H 2Z91B 2VXTL 1NLDL 2GTWA 1KJMA 5KSVA 1D5BB 4S1QL 4UILL 2AGJL 1OD9A 3SJVE 5CINL 4NBYB 3FB6B 5A16A 2GUOB 4OKDA 2HKFH 4HZAA 4HGMA 1CGXA 1FJ1B 1MIMH 5C9JA 1FE8H 1PY4A 4TOYH 4Y4KB 5ICYA 4GG8A 4Y5YC 2AK1H 1JRHL 5DFTA 4K7PH 1PKQA 2XKNB 2FATH 1T5WA 5IB3B 4QGTA 1QFWH 5CCKH 4JDTH 4JFED 4L8SA 1YMHA 4R7DA 3QFJE 1HSBA 3X11A 2I24N 1MJ7H 5F9DC 4NC0B 1FC2D 1RZKC 1PBYA 3REVB 2F58H 2V2WA 1NSNL 1R24A 1MJUH 5TE6H 3P0YL 5FO9A 4XMKH 5DGRA 5E2VH 1KT2A 3BKYH 1QD0A 3KPMB 5I15L 1VFOA 3LMJH 5D2LB 5DHYA 5CJXA 3TN0D 2XICA 4Z7UA 3FB5A 1EBPA 4E0RB 1BX2B 2BSTB 2DIBA 1UENA 3FFCB 1U8OA 2UZYB 4RFEB 1W72L 4BZYA 1A6VL 5IUSA 3LEVH 3WE6A 2DQEL 4PRIB 2FO1A 1QSFA 2P47B 4BM7A 4NKDB 3CVHH 3CVIL 1P4LB 2ENYA 4F57L 3LDBB 4ISVA 2I9LA 2BJMH 1MCOH 1ZLWH 4ZSOB 3IU4L 3SY0B 1P7QD 2W65A 4Z18A 4I13B 2J4WH 5DRNB 2VDPL 3AXLA 1J1PL 5GRJH 2HWZL 2GJ6E 2E27H 4ZNEA 5CKAA 3V6OA 1CXKA 4NC1C 1JV5B 4LVHC 2OP4L 4RFNC 5JORB 1IAIM 3ZL4L 4X7SH 3QUMH 2ADIB 4U3CA 1ZT1A 5GGUA 3ULSB 1QFPA 3KPSE 3MREB 4C4KO 3P4OB 4DAGL 5MHSD 1I1AC 1X4XA 3TNNB 1FNSH 4ZTPH 2X4NA 3LN4B 3MBEC 1D5XA 4HIJA 5MI0B 4PJAB 3TM6A 3ALXA 3RWDB 3D87B 3TFKC 1KEML 1HDMA 4JFEB 2GCYB 5DQDL 3SQOL 4OBRA 1U92B 2CJUL 3GIVA 3OSKA 1CT8A 1QEWB 1T0PB 3CSGA 3GMPA 2FSEA 1CGUA 1SJVA 5DRZB 3PJSB 3CXHJ 3QWRD 1GC1H 5FYJH 4WI4A 4LLUA 1LVEA 2UV3A 2YPKB 1T1ZB 2FZ3B 4WFFE 1RK1A 2CDGA 4LSQL 5DA0B 5J57B 2BNRD 3MJ7A 1IC7H 3FQXB 5E08H 2WM0A 2FGZA 5ISZB 3SDDC 3GIZH 4TVPH 1AIFB 1AQKL 1PD6A 1Y6NR 5JZ7C 1AP2B 3QG7H 1CICD 4LHUD 2ZUQC 1NEZA 1T89C 4RGMC 3OZ9H 2WSKA 3GHBH 1T5XB 4QRUB 2Q86B 2HJLA 4AIOA 1ZK9A 1Q9LA 4F7TA 1I3GL 5DEFA 4YX2L 3V6BR 1NDGB 2AABH 2H45A 3INUH 5DS8A 2OL3H 1G6VK 4KH2A 4PJGE 1OAZH 3TIEB 1AQDA 5ILTH 4HWEH 4IIQA 4MA3B 4ACPA 2AQ3A 3V4PH 1P7QB 4U1IA 2DQHH 1T6VN 1P6FA 2P24A 5EA0L 1PW3A 4LCWE 3VRLF 1X6LA 4JO4H 1BQLH 3RVWD 1UM5L 2ZUWA 4DFIA 3V0WL 2VXQH 4HUWB 3C60C 2BRQA 2VLKE 2MKWA 4GW1A 3O2VL 1L9NA 4PJBE 4X80L 2ZOLA 4NNYB 3K8KA 4FFVD 2K9UA 3QCUH 5KVDH 1NDMA 3QIBC 3FT4A 1WEJH 1A1NA 4MQSB 5DTFB 1JUFA 2HKFL 3VMOA 1OSZB 1MIML 2R2HA 2X4UA 1FE8L 1FV1B 1YN6B 3AREC 2GYSA 1UA6H 3BGMB 4TOYL 4NQDA 4LDEB 4Y8DC 1LO0H 2NW2A 2AK1L 3QNXA 1CGTA 2FWOB 3FZUC 3TF7C 1WC7B 4K7PL 2HMID 2FATL 3DURB 5L88H 1QFWL 5CCKL 4JDTL 4LQ1A 3ZE1F 4P23A 4NO3A 5TF1H 3HCVB 1MJ7L 4X5XB 4OD1H 1KENH 2F58L 3VFSB 2UWEB 2BNRB 4F2MA 1MCBA 4V2CB 1MJUL 5TE6L 2DQJH 4PJXB 2V9TA 4XMKL 2DLFH 5E2VL 3O8XA 4XAWH 3BKYL 4GXUN 1CICB 2JB5H 4X8JA 1UG9A 3LMJL 2YA0A 3LQMA 3TNMB 3VDCA 4FQCH 3MJ9H 1FGVH 4XBGB 1G7LB 5DD1H 1JHTB 3IT8D 2EYTA 1KN2H 1ZHNA 4Q6IA 2OQJA 4CMHB 1QSFD 2A73B 2CDFA 3MNVB 4IS6B 3LEVL 1ZLUH 2ZWLT 2WW8A 3CUPB 3C9NB 1AD9B 3CVHL 5J6GA 1EAPB 5JO5B 1ONQB 3SE9H 3B6SB 2BJML 2QQKH 3MRKA 4KJQD 1MCOL 2G2RB 3P40A 1TVHA 4OFYA 4HWBH 4I5BB 5F9OH 2GTWB 5KSVB 1NGYB 2J4WL 2Q6WA 1ITBB 1BQSA 5MEPA 4WDIA 5GRJL 5A16B 4GG6F 2E27L 1AE6H 2WV3A 4K7FA 3H3KA 1FNGA 1GRWA 3BT2H 2E7CA 4LBEB 5ICYB 4PJEA 4GG8B 4RX4A 4X7SL 5I16B 3UZQA 2R1WA 3D0VB 3QUML 3FAWA 2Y6SC 1FNSL 4ZTPL 3O4OB 1YMHB 4R7DB 3GMLA 1A6AA 3RDTC 3X11B 3U2SA 3MMEA 1TENA 1PYWA 4WI9A 1R24B 4PRBA 3L3KA 3VA2C 1KT2B 4PTUA 1X5LA 1GC1L 5FYJL 4TVPE 4G6AD 4WRLA 4YK4B 3LKRA 3BIBX 3GM0A 3G9AB 4R2GB 2IG2H 5EBWA 3KPQA 2VDKH 1PAMA 1IC7L 5E08L 1TCRA 3T0DA 5DD5H 3GIZL 4MDIA 4TVPL 5HI3C 5CD3A 1BFTA 1U8OB 1N2RB 3DUHA 5I8CA 4FTVA 1S7WA 4ZYKA 3QG7L 3WE6B 5CGYC 2BVUA 5FUOH 3OZ9L 1RZIA 1QSFB 3GHBL 2HLAA 3Q3GA 1MCRA 2XQYK 1NAMH 2AABL 2I9LB 3INUL 4IMLA 4WHYH 2OL3L 4WGVB 1G1CA 1OAZL 2PO6A 1UQSA 5ILTL 1DQTA 4HWEL 2FIRT 1TXKA 2HN7A 4OKVA 1F45A 1QO3A 3AXLB 4OFIA 2PXYB 3V4PL 1CL7H 4EI5A 5T1MA 2DQHL 1CXIA 4L9LC 4YPGB 3PGCB 4JO4L 1BQLL 2VXQL 3T0XA 1MPAH 1DEEB 4PV8A 3KGRA 2J8UB 5GGUB 4P2OC 3TJEH 1DQMH 4JFFA 4YHNA 3E8UH 4BFIA 4HIJB 4I0CC 1UXWA 3O3DB 3QCUL 5KVDL 1HHHA 1WEJL 5DQJA 5J11C 2FBOJ 4NQDD 1HDMB 4H0GA 4JLRA 4LGPB 3GIVB 1CT8B 4TNVK 1B4JH 4N5ED 3EOBA 1UA6L 3B2VH 2Y36H 2FSEB 3T3MF 5L7XH 1LO0L 3DSFH 4YLQT 1HKFA 5HVWA 4P23D 3UXFA 4KV5F 5L88L 1FL5A 1RK1B 3LB6C 2CDGB 2E7BA 3MJ7B 4M93B 5TF1L 4X0KB 4XHJC 1ACZA 3LKSA 1AHWC 3NPSB 3W9EB 4OD1L 4Y2DC 1KENL 2C9AA 3O8XD 4FQIH 4IOIA 4X6CA 1FL6B 2DQJL 2E9JA 5IKCB 1BBDH 1IAII 2NYYC 1B0RA 2DLFL 3C5ZB 2OZ4A 2HJLB 4XAWL 4F7TB 4KDTA 2IBZY 5DEFB 1A6PA 4WNQA 5JA8B 3TV3H 3ARYA 3QEQA 2JB5L 3HG1B 5C0BB 1QSEE 5F7NC 4TSAH 4FQCL 3MJ9L 2Z8VC 1FGVL 1R5VB 3I85A 1AQDB 5DD1L 3U48A 4IIQB 1RULH 4DN3H 2EH8H 1KN2L 4MD5B 1XH3B 5IROC 4WGWB 3SDXA 4X7DC 4Y5YA 2P24B 4KKLC 4MAUH 2DJ4A 4JY4B 3THMH 3VMNA 2OCFD 3ARUA 4OFYD 1X3DA 3OKOA 3SE9L 2QQKL 1FFNA 2ZOLB 4HWBL 5F9OL 1IC5H 2MKLC 2GK0B 1JPFA 5H8DA 5GXBB 4GRWH 5DXWA 3EJZD 2R56H 4QWWC 4UZGA 4PJDA 1GC1C 4K71B 1JUFB 1Q94A 3OGCA 4HUNB 4RX4D 1AE6L 1F6AA 2R2HB 2X4UB 4XI5D 4ALAH 1EEZA 3BT2L 2A6DA 1HQ4B 3G6JF 2EIDA 2NW2B 3QNXB 2EC8A 3GK8H 4KK9C 3ZDYF 3LV3B 3QZWG 4L8BA 2R0WH 2DIJA 3G04A 5IBLD 4DVBA 5ESVA 3IXAB 3DI3B 4DN4H 1JPTH 4P23B 4F80A 1A9BA 4W6XB 4EQ2A 3LIZH 1G9MH 4OLUH 4Q9RH 3D18B 3CFCH 2P5EE 4BH7A 3CZFA 4F2MB 2XZCH 2D7QA 1I75A 5ID0A 5KS9E 5JMRA 3C6LC 3VWJC 2J2ZA 2YXMA 1Z6JT 5IGXH 5DMYA 2EE9A 1FVDB 5E6IC 5ACMA 4X8JB 4M3JA 1F5WA 4ZOBA 4J12A 2IG2L 2Y9RT 4NWUH 4HG4J 2VDKL 1MVUA 3CK0H 4P5KA 4FTVD 4Q6YA 1NFIA 5DD5L 2EYTB 4S0SD 1ZHNB 1E6OH 2ZP0T 4PRNA 4K8RC 3GKWH 4Q6IB 5HHOA 1U58A 4C56A 5ID1A 4U1GC 2BSSA 1I1AA 1IGMH 2QSTA 5FUOL 4N8VG 1IAOA 5J6GB 1KUMA 1KN4H 2ZG2A 2PO6D 1NCCH 5EU7E 1NAML 5HYJD 2WK2A 1HNFA 4H1LG 1P4BH 1TVHB 5DI8A 4EI5D 2EDWA 2FX8H 5MEOA 5DJXB 2Q6WB 3C8KB 4JPVH 4WDIB 1CL7L 2WMPA 4UNVA 1YPZB 2ZUXA 4K7FB 1VKXB 1AH1A 4N8VA 4JFFD 2HJFA 2NR6C 3TLRA 4PJEB 5LJYH 1YMMA 1MPAL 5GSRA 1WLHA 3SDDA 1CFTA 3TJEL 3MCKB 4XB8A 1DQML 3E8UL 4Z7NE 4F7EA 1A6AB 1E4XH 1E0OB 2RAMA 3IJHB 4RA3A 3U2SB 3MMEB 1MCKA 5E2TH 4ORGB 1B4JL 3PDGA 4PRBB 5CEZD 1C08A 3B2VL 2DS4A 3FB7A 4LDOB 2Y36L 4PB9H 4ONFH 5L7XL 3L3KB 3E6HB 3DSFL 1VEPA 1M1SA 4E42A 5E94B 2Q20A 1VFUA 1QBMH 1ZLSH 4HF5H 3P73A 5F7FA 1GZPB 3UJIH 3LKRB 4I18C 4NUGH 2Z92A 3NIDE 1A8JH 4TUOA 3KPQB 2PCPA 5EBWB 1YY9C 2OK0H 4WWID 3DBXA 3QR2A 1C12A 2JE8A 4P3CH 4MDIB 1I1YA 3C60A 4FQIL 1TTUA 4FTVB 1S7WB 4ZYKB 4FQJH 4I2XE 5GISH 3CGTA 3QEQD 1B0GA 1BBDL 3WIHH 1RZIB 1T2XA 3QFJA 3Q3GB 1KFAH 3QIBA 3TV3L 2Z35A 4IMLB 4J6RH 4TSAL 2K7PA 5IB4B 4O4YH 5HYJB 1OAQH 2PO6B 3NA9H 3AREA 1RULL 3NH7H 2EH8L 4OKVB 4ZUTA 1QO3B 4DN3L 2XKSA 3QRGH 4EI5B 5T1MB 2YD8A 3BN3B 1WT5C 2XWBA 3LSOA 4MAUL 3JWOC 3THML 1W72A 3OGOE 1J0ZA 1XGYH 1BOYA 4I77H 4TTDC 4EIGB 1Q9OA 3Q5OA 4ODUA 1N8ZA 4YHNB 5DSCA 4DFHA 4OJFH 4CDHA 4Y89A 1IC5L 4G43A 2FRGP 2XYCA 3DARA 4YHLH 3I6GA 2R56L 3L3HA 3MV9A 1TFHA 1XT5A 4AQOA 4JLRB 4WTWA 4HGWA 2KQNA 2CLZB 2Z31C 1NH6A 4ALAL 4EI6A 4JCMA 3EOBB 3BEWB 2VZ3A 5AG9A 3OHXA 3GK8L 3RWJA 4U1HB 3KWWA 2R0WL 3BZEB 5CBEB 3T0VA 1FL5B 2GJ6A 1AI1H 4DN4L 3G08B 1JPTL 3N1FC 3LIZL 1G9ML 3LKSB 4OLUL 5LGJB 4Q9RL 4XWOC 4JR9H 4K3EH 3CFCL 4IOIB 4X6CB 2XZCL 4RAVB 3KPSA 4Y4FC 5JW4N 3EDJA 4BKLA 2PF6A 1HXYB 4FHBD 4F33A 3VXPA 4POUB 3B9KA 4WNQB 5EU7C 5IGXL 5IMMB 1AR1C 2SEBB 4KJWC 2YA2A 3HRZB 2XFXA 4NWUL 3CK0L 4JDVA 4C56D 3VGGA 1I1AD 1E6OL 3PQYA 3GKWL 1S7VA 4Y5YB 3QDAA 4BQCA 3MRCB 5E70A 1IGML 4KK6D 3TFKD 1AJ7H 1FN4A 1VHPA 4L4VB 5DQ9A 2EE6A 1KYOK 1KN4L 3RDTA 1NCCL 5F89A 5EZJA 4FABH 1DQQA 1P4BL 3DETC 2OR9H 4GH7B 4KC3B 4LSDA 4U6VH 2FX8L 4JPVL 1FGNH 4PGBA 3C5SA 1Q94B 3OGCB 1TVBA 1F6AB 1YMMD 5JDJA 1CQKA 4WWKC 1EEZB 4FXGA 1S7XA 3QUYC 1GGIH 3KYAA 4U2YA 3VH8G 4L8BB 5FM4A 1OP3H 1Z9OA 4PJIE 3G04B 4DVBB 1E4XL 1A9BB 3WO4B 4R4BA 2VLKA 5CMAB 5E2TL 1JZ2A 4HWZB 4PB9L 3SKUD 4FS0A 3UZEA 4ONFL 4CU6A 5ID0B 5IV2B 1HHIA 2X4TB 2FYYA 4G5ZH 3CMOH 1QBML 3VH8A 3QZWB 1ZLSL 4HF5L 3UJIL 4CW1A 4NUGL 3C60D 3LD8C 4L9LA 4OGXH 2OK0L 1QFUH 4MLSA 5CKGA 1OP5H 3JUZA 5EO1A 3QXUA 3QXDA 4RFNB 3FONB 3T2OA 1NFIB 4P3CL 1S7SB 1JI2A 3QFJD 5C0CB 1QLEH 4P2OA 4Z7VA 5IJVB 2JF1A 3QIBD 4FQJL 1J8HB 5GISL 3U6RA 3BHBB 3WIHL 4CAGA 1IAOB 1KFAL 4HFWB 5D1XC 5INDA 3U4EB 1U3HB 3ARED 2VZSA 1AXIB 2UVFA 4J6RL 4NDMA 3DX9A 5DI8B 4O4YL 1OAQL 3NCYP 3NA9L 3WS6C 3FZUD 1CFSA 1MFEH 1B0WA 3EUUA 3DX6A 5GHWH 4I9WE 3NH7L 3W0WE 3QRGL 5E6YA 5J3HD 4Q7DA 2JIXA 3IAPA 3QQ3A 4N8VB 4Q9QH 5CLWA 1XGYL 5ALCH 1YMMB 5GSRB 4I77L 3TESA 4H1LB 1CFTB 3CVHA 1M6OA 4Y2DA 3MV9D 2X1XR 1GZQA 2XIDA 4OJFL 1YN7A 4PB0H 1G0DA 3U1SH 2D0HA 1UJTA 4HH9A 1JNHA 3SHSA 4YHLL 3U0PB 3H2WA 4Q74A 1LE5A 1JHLH 4KI5E 5BW7C 3U46A 3ZHDA 3FN9A 2E7HA 2N4IA 1C08B 4NM4H 3CSBA 1EO7A 1N5AB 4GG6B 1QLRA 2GJ6D 3IFPA 3VMPA 1G7HA 2AV7B 3P73B 5IROA 5D8JH 1A6UH 5C09D 3QUMA 1I7TA 4Y5VC 3RVXC 1AI1L 2PCPB 1TQCC 3DUUA 2UYLB 1YNTB 3KPSD 1UYWH 2MCPH 4NO0D 1C12B 4LPTA 4QO1A 4K3JH 1D9KC 2WBJA 3EOAA 4JVUA 2AAVA 3C60B 4JR9L 4K3EL 3K46A 3B9KD 2YK1H 7CGTA 1MCQA 4HKZA 5C08E 1B0GB 3S37X 5BZWA 4JVWA 1T0MA 3MZTA 1KPVA 4G6FD 3QIBB 3GUTA 2ILLA 2Z35B 4J3XA 3K1DA 2VZUA 2XN9E 3PQYD 4MA7H 2DI7A 4JKLA 2Y6SD 4ZUTB 1XZ0A 2R0KH 5L2KE 3BH8A 5EU3B 1N59A 3RDTD 1EVUA 1AJ7L 1W72B 2NXYC 3RWCB 2OTUB 3UTTE 1ZKAA 2CKNA 4WEUD 4FABL 1Q9OB 4QHKI 3LRHA 1VDGA 3GSUB 2GY5A 3GZKA 5DSCB 2OR9L 1F4AA 4GRWF 4U6VL 2OL3A 4G43B 2YRPA 3ESUF 1NCTA 1FGNL 3C6LA 3VWJA 4JRXB 3MV9B 3PP3H 4HGWB 4OCLC 5E6IA 1EEUA 1Z3GH 5HI3D 5AUMA 1S78C 1GGIL 5A43C 3OHXB 2E9BA 3CLFH 3MOBH 3MTRA 5CGYD 3KWWB 2J3SA 3PHOA 5JUEH 1LEIB 4Y19E 4NO2A 3MNZB 4KKNA 3IJSB 1KSRA 1KTKE 3KLHC 4YGVB 1ORSA 5C09B 2V2TB 1UKQA 3QULA 2X9YA 4BSVB 4NO0B 3CX2A 3WS3A 2X4PB 3UC0H 3VXPB 4G5ZL 3B9KB 4Z95H 3CMOL 4XCEA 1I1FA 1KCUH 4DEPB 2XFXB 4OGXL 1QFUL 4CVXB 4PJHE 3BP6B 4P2OD 3RKPA 1YDPB 4HWNA 4YHIA 1MEXH 1X6NA 1S7VB 5C0DB 5F8QC 1JZ8A 5EO0B 1IM9D 1QLEL 3BN9C 1VESA 5ACLA 4J3SA 1FN4B 2DJSA 5DQ9B 2D9QB 5HHME 3ULVH 3ESVF 1N26A 3WEXA 1E4WH 5MP6H 1DQQB 1U41A 3HAEH 1AGFA 1CXEA 5FA4B 1BJ1J 1MFEL 3MJ9A 2JIXD 5GHWL 1ZT4A 5EIIA 3WO3B 4F15C 3LB6D 3EDFA 1S7QA 4KI5C 1UKSA 3KHQA 5K9QG 1H5BA 4XHJD 2G75A 2LTQC 4FXGB 1IGJA 5B38G 4Q9QL 4Y2DD 2Z93B 4HS3A 4P2QA 1S7XB 5ALCL 4GKSA 4XBPA 4YZFF 3RIFF 3KNBA 3PV6A 3HLAA 5SX5H 2NYYD 3BMWA 5D6CB 5A40E 3CFDB 3CFJA 2BOBB 3QDJA 4WI8A 4PB0L 3U1SL 3HI5H 5DMJB 4P9MH 4HWBA 5A1AA 1JHLL 3CPLA 4JO2H 4R4BB 5DD0H 5HDOA 1KYOJ 4N0UE 4OZIE 4MQ7A 3MV8E 3QQ9C 1NMCC 5B38A 5FOBA 4NM4L 5CP7B 3DVFA 1HHIB 2F5BH 2FYYB 4KKLD 5JIHA 1SEBA 3VH8B 5KSBA 5D8JL 1A6UL 3M17A 3QA3B 3T1WA 5DRXB 3G6JB 2WBJD 2D9CA 3JV6A 3MRLB 1WT5A 4C54A 2J6EH 4G9FE 4LFHG 5EO1B 3QXDB 1UYWL 4POYA 2MCPL 3ZSTA 3UBXI 4K3JL 4ORZC 1MFDH 4P2YA 1G9NC 2XWJB 2YK1L 4P2OB 4Z7VB 5JNYA 3ZE2E 4QWWD 1BLNA 1N0XH 3IJYB 5FA3B 3T0WA 1IM9B 5E7BA 5INDB 5JW3H 5KANG 3B9VA 5FKPA 2Z31A 3O41B 4MA7L 4WHYG 4KK9D 1CFSB 4TVPD 3ZHLA 3DX6B 1HYSC 5KS9A 2AXHA 2R0KL 5T5FH 4YNYA 3RU8H 1ES0A 5D70H 1GVIA 2JIXB 2H41A 3LQZA 4NPYB 3KLAB 3QQ3B 2VL5A 4YO0A 4MAYC 3LN5B 3HTLX 4NFDA 2DQIH 2OJEA 3OJVC 1B9ZA 1RUMH 3CVHB 1NFDE 3C6LD 3VWJD 1FNEB 1JF1A 5J12C 1PZ5A 1GZQB 4LEXH 1YN7B 3KXFE 4Y4FA 5E6ID 4H25B 1ZA3B 2K7QA 1LE5B 3BD4A 5E0QA 4UI2A 3U46B 1MH5B 1Z3GL 3MODH 3S98A 3ARFC 2O5YH 1NKRA 4ELME 3QHZH 2BHUA 2CIIA 3BZFA 1G7HB 4JZOA 4UDTA 4D0BA 3CLFL 3MOBL 4ZOEA 2H3NA 4NQSA 2W0KA 1QR1A 4U1KA 1TQBB 2FB4H 1I7TB 5JUEL 3DRQA 1OM3H 4KXZI 2AK4E 5ANMA 1IAKA 4HXBH 4XZUB 5BJTA 2WBJB 1BJ1H 3O9WC 1SBSH 3VXUB 5I9QB 3UC0L 2E3VA 4Z95L 1BD2D 4XNMA 3DUSB 1KCUL 3GBMH 5DHVH 4WWKA 2QV2A 3LKNB 3MRRB 1MEXL 1CDGA 1CD1B 3QUYA 4KRPC 4GKZA 3VFTB 4I0KA 2G9HA 2V5RA 1PLGH 1J12A 3ULUE 1MJ8H 3H9SE 1S5IH 1ZXQA 2KQMA 1U42A 1XFPA 5EB9A 4RNRA 1QBLH 1UM6H 3MUY1 4AJ0A 3ULVL 1N4XH 1E4WL 5MP6L 1P53A 2FECI 1R5IB 3WHE1 4M8VA 3A0OA 1FNAA 4LQFH 2OL3B 1OGAB 3PNWA 2PW2A 4I2XA 1XF2A 3KPPA 1YY8B 2DWEA 3UTSE 1SYSA 2XXMB 4EZMA 1OF2B 4P2QD 4KPHH 4E41E 2OI9B 1YY9D 4Y5XC 1TPXC 3RGVC 4XNZC 3RWEA 3TBWA 3D69A 2QJDA 3OKYA 4XT1C 1K2DA 4L8CA 3NBNA 3S37H 5DDHA 3QDJD 1BOGB 5T3ZH 5EDXA 2CMRH 1FZJA 2AEPH 3D9AH 4NZJA 4CVZA 1CI5A 3TBSA 2XQBH 4XBEH 3PHOB 5HSFA 4NO2B 3HI5L 1X7QA 5DYOA 4F37F 4P9ML 5HJ3A 4U7SA 3R4DA 5D1XA 3QP3A 2OLDA 4JO2L 5DD0L 3QDGE 2C3VA 4GRMA 1LEKB 3P9MA 4J23A 5CJQH 5IM7B 2F5BL 3QUXB 3WS6A 3C87A 1A14H 3PWPE 3C09C 4TULH 4CJ1A 1I1FB 2ZCKH 4AY0A 1RHFA 4TTDD 2J6EL 4YHPA 1BD2B 2O61A 1RJZB 3F8UB 4YHIB 3T2QA 1MFDL 4EUPH 3G6AA 1A3RH 1LWRA 2AJVH 5FDYA 2AJXH 4P4KC 1N0XL 2Z31D 3HI6H 4LFHD 4XX1E 3UTPE 5JW3L 5BOZG 3KS0J 5EIVA 5C8JA 2Q76A 4KJPD 2P49B 3ME0A 3MNWB 5BW7A 4R4FH 4GW5A 5C6WH 5SV4A 1KLGB 4OLWH 2ICEA 4R9HA 1C5CH 1RU9H 5T5FL 2X1PA 1LP9A 3VRIA 4HK0A 4L29A 2NX5A 4Z7QE 1S7QB 3RU8L 1TJIH 5D70L 3X3FH 4MCZB 1H5BB 2G75B 4NKMA 4Y5VA 1MI5A 4XWOD 4P2QB 4HS3B 2DQIL 1RUML 5JOFA 4XBPB 4Y4FD 4FMFA 2VIRB 4GLRI 3KNBB 5HY9A 3PV6B 3HLAB 1D9KA 2IBBA 1WAAE 4BH8A 1JYVA 1U8LB 4AEEA 1VEOA 3QDJB 4LEXL 5E4EB 3ARPA 4P2RE 4O51B 4KJWD 1KTDA 2FBJH 1Q1JH 1RZ8A 3S9DB 4EEEA 2NZIA 3MODL 5B38B 3JWNC 5FOBB 3DYPA 1HXMB 4RMWA 4EVNA 2O5YL 3QHZL 1TZGH 5F3BA 2OJZH 5IMLB 4OF6A 5FUCE 5KSBB 3H3PH 2FB4L 3ROOA 3O4LA 1FVEA 3MLPA 3DETD 4HXBL 2P44B 3D3VE 2D7PA 3KPLA 2A9NH 2XY1A 2DMKA 1MCWM 4X6FB 3ULUC 1SBSL 1BLNB 1YYMH 4HBCH 4PJIA 4WWKD 4ZFOL 3MGOA 3GBML 4NQCE 4GBXC 5FKPB 3WNMA 2Z31B 3QUYD 5E5RB 5I2IA 1W0VA 1H3UA 1FHGA 1I8MA 1JK8B 4GSDH 4ONOA 3K4AA 1OPGH 4KKBC 1PLGL 1ODAA 1MJ8L 1S5IL 1UKTA 4LLVB 4YO0B 4KHTH 1QBLL 2DYPD 2FDBP 3TO4C 3V5DA 1UM6L 2OJEB 1FIGH 2VISA 3WIHA 4APQC 4YXHH 4MD0B 1N4XL 3VFVB 5I30H 2H2SD 5FCSH 5HHQB 1NAMB 1JF1B 1U8QA 1CD0A 4LQFL 4Y4FB 1KGCE 5F9WC 5I1LA 1RZ7H 1H0DB 4QXWA 4RFOH 3SCMC 4PG2C 1L0XA 3CCHA 4KPHL 5T3ZE 5BS0E 1BPVA 1CS6A 1KG0A 2PN5A 4I0PC 5E8OA 3S37L 1Q38A 2CIIB 1KJVA 5T3ZL 4AMKH 2CMRL 2AEPL 3D9AL 4NQSB 2XQBL 4JAMA 4X6EB 4XBEL 5D1XD 3DRQB 2Q8BH 4FG6C 3EDKA 3KS0H 5ANMB 5BJTB 3OBAA 5DHXB 3TO2A 3G5VB 1A64A 3FJTA 1DVFC 4H20H 3RVUC 5CJQL 5I71C 1MHHA 2YPLE 1FG9C 1IAIH 2DD8H 1A14L 2G60H 4R7NB 1SVCP 4LPYA 1U8HA 4TULL 5DFVC 3H7LA 4WI5A 2ZCKL 1T22A 3KPRD 2BC4B 4PJ8C 4WWKB 3F7YB 3MLYH 5EBLB 4B50A 4O2CB 3MV7B 5BVJB 4TSCH 3QUYB 4QCIB 3KYNA 4GKZB 5FGSA 1A3RL 2G9HB 2AJVL 2AJXL 1C1EH 3ULVF 1G7JB 4ZUVA 3HI6L 1CGVA 1HE7A 3TH2T 1BQUA 1SM3H 4NRYA 4AIZB 1MSPA 3PWUA 3ARVA 4R4FL 2DYPB 2NX5D 4U0RC 2NCMA 1UVQB 1JWSB 4LEOA 1B6UA 2EDQA 2PW2B 4OLWL 1C5CL 1RU9L 5C08A 1VGKA 5D7LA 3KPPB 3OB0H 2DWEB 3FB8A 3RL2A 1MI5D 2NY2D 2WQRA 5EOTA 1XGQA 1TJIL 5HHNA 3X3FL 4HKJA 3TBWB 3D69B 5F1NB 1D9KD 5KBNC 3IDJB 3LD8B 5DDHB 2WWMC 1FZJB 4RZCA 4XH2A 4CVZB 3HI1B 5FUCC 1GOFA 5L2KA 4HKXA 3OAZK 4S10A 3W11C 4WEMB 5EULV 1A7NH 3SKOB 1X7QB 2QBWA 5EZLA 2J12B 1BECA 3VWKC 5D1XB 1RZGA 1Q1JL 2FBJL 2Y7QB 1N7MH 3K8MA 4GRMB 4GRWB 2AJ3B 4RRPA 1OB1A 3C8DA 1IKNC 1A6ZA 1D3CA 4NCDA 4MJIA 4O2EA 1WBZA 3ES6A 3OWEA 4N1EA 5F71A 1TZGL 3O4LD 1FO0H 2OJZL 3C2SA 2D31A 3KJ4B 3H3PL 4W70A 2VDNH 1QG3A 3QIUB 5J9PA 5C0FA 2QSVA 4NZRH 4UIMA 5A2FA 3CFBB 4MAYA 5C0JA 3V4UH 3KPRB 5GIRA 5CWSA 3SDCD 3TEUA 1JWUA 4PJGF 4W4OC 2A9NL 2HFGH 1FIEA 1G7QB 5IQ7H 1H8NA 4PP2A 1YYML 5C1MB 3DROA 4HBCL 4Y19A 2HLFC 1EJOH 3ZTJH 5I73C 1YQVH 2EXYD 5I6XC 3VFUB 3DV6A 3N9GH 1Q9KA 4XNXH 3QBTB 1A7BA 4ZXBB 4GW5B 4MQXC 4CJ0A 5J89A 4JO1H 3JTTA 4F8TA 2CR6A 3ARFA 3JBG7 1BP3B 1JI1A 4HK0B 1IZJA 4L29B 2NX5B 3K3QA 4GSDL 4OFPA 4HCRH 4B53A 3E2HC 3VD4A 5HGDA 4G8IA 1OPGL 5D7IE 4L4TE 4PJ7A 3MOQA 3KLHD 3GJFH 3V8OA 4QHLA 1MI5B 2NY2B 4KHTL 3VFMB 1KOAA 1FIGL 2LQRA 5JOFB 4YXHL 3G6DH 5I30L 1W0WB 4TNWK 4BH8B 5FGCB 3O9WA 3P11H 1KTDB 5D7KE 3QG6B 1RZ7L 4HX1B 4RFOL 4D3CH 3CLEH 1ZSDB 1RZ8B 1JRHI 4OLVH 4I48A 3BRFA 4EVNB 3I84A 3RL1B 3IETA 4P5TC 3U0WH 3BN9D 5F3BB 4AMKL 2OSLB 4AK1A 2VITA 3ABZA 3Q2CA 4L1DA 2ITCA 2COQA 2IFFH 1B3JA 2Q8BL 2X9WA 3ROOB 3O4LB 1N64H 1FVEB 4N0FB 4NYLB 5CSBA 5FYKE 5HI4C 3WJJC 1RAMA 3EDDA 5DD3H 4H20L 3NGBC 1XEDA 2YRZA 3SDCB 3SKJH 1IAIL 2DD8L 2G60L 3QUZC 2X4SA 3ARSA 2DDQH 4DZBB 1MWAH 2BNUA 4P59H 4Y5XA 1LMKA 3UROR 3RGVA 3MLYL 5C0GA 4OZIA 1FNHA 1W0VB 1Q8MA 3ZYJA 2JCCF 1IRAY 1YNKH 5DF0A 4TSCL 1K8IA 3GRWH 1KV3A 1YECH 4WW1A 4MHHI 3OKEA 2BVPA 4YPJA 1X5YA 3NIFE 4M02A 1C1EL 3QWOA 1L0YA 5SX4H 3FO1B 3V5DB 2RFXA 2QLVB 4LLMA 3QQ9D 4OV5B 5D5ME 5C08D 1SM3L 3ZYIA 1PZUB 5D7LD 3R0MA 4MQTB 1MELA 5ESAA 43C9B 1CBVH 1U8QB 2UUDK 1PKOA 2LABA 3FQRA 3SDAC 32C2A 4LOUC 3S97C 2KPNA 3BPOB 3BGFB 4ETYA 3CCHB 3ZKMC 4ODSH 1JYWA 1KG0B 1U2CA 2CXGA 2F53B 5L2KD 5E8OB 1WIOA 3FTGB 4CUCA 3OL2A 2Y1VA 5BQ7A 5B3JF 2FLBT 2MPAH 3MRPA 3R0NA 3IS0X 5EH1A 1A7NL 4P4KA 3EFDH 5IR1A 1AKJD 1A1MA 4MJID 4N0YH 1N7ML 3TO2B 4JZJC 1HYSD 1DN0A 1JIBA 1LGVA 3Q6FA 5AAMA 1MHHB 3KXFA 5CUSH 3S88H 2GT9A 4Q58C 1FO0L 3J7HA 4GAJH 2VDNL 4MAYD 4XP5H 3RZCC 3STZA 1F3DJ 3RVVC 4NZRL 4XTRC 1UWGH 4JFPB 3V4UL 4Y19D 3VI3E 4WU7B 3KYNB 2HFGL 3L3JA 35C8H 3F12B 1YYLH 5IQ7L 3N1GC 1WIPA 4H5SB 4WENB 1E28B 4ZUVB 1EJOL 1YQVL 3L7FA 1MHEA 3N9GL 5GS2H 4XNXL 3ARFD 1MCWW 1DTUA 4N9GA 5I1DA 4LEOB 3HE7C 4JO1L 1MCFA 1NMCB 2VZTA 2CIKA 3HZKA 3HAEG 1KELH 1CFVH 1OARH 2ESVE 3FB8B 3RL2B 4HCRL 1GJIA 1JN6B 5GZNC 5DMKB 3SGDH 4QF1B 3KYOA 2MSPA 1E27B 4HQQH 4M7ZC 5K9JH 1FYTB 3I6LD 3WFDH 4HV8A 3G6DL 4LVOC 4XH2B 4J3OC 3VRJA 2PTVA 4HKXB 3D0LB 4LLQA 4NOFA 3ISWA 3P11L 1QR4A 1DZBA 5CJBA 3HAEA 4XHQA 4LVNB 1WTGT 4LPCA 2F74A 3ZE0E 2EDYA 2YSSB 5AD0A 2EYRA 4D3CL 5KVGH 3CLEL 3K74B 2B7DT 3STBA 1T66C 4LIQH 5HGHA 2XXCB 2YUWA 2APXA 1AKJB 4OLVL 4QHKJ 4MJIB 4OI9A 4KRPD 3WL9A 3ES6B 1JTTA 3MXWH 5F88A 4LMQI 3U0WL 5ELIA 3BVNA 2D31B 1DQDH 4JQVC 3WFBH 3IGAB 2IFFL 3S6CA 2XWTA 4E41A 1EFQA 1N64L 4ZS7H 4HIHA 5KSAD 5C0FB 5JTWA 1XR8B 5J1AA 4C57C 5EPMA 4PIRF 4U3HA 4F3FA 4M43H 3GDBA 3TO4A 3WIFB 5D1ZC 1URLA 4APQA 3IU3A 3FOMA 4RAHA 5DD3L 3P3YA 4PP2B 3DROB 3SKJL 3GBNH 3FRUA 3QXWA 3RGVD 4JM2C 4DK6A 1NGPH 5GGVY 3V0VB 1Q9KB 1KLFA 2DDQL 4OZHF 3SCMA 4PG2A 1MWAL 3QDGA 4P59L 1ORQA 5JR1H 1VACA 2FH8A 3JTTB 4UUJA 5D1QC 4MS8C 1YNKL 4MD4A 4I0PA 3V79C 2BFVH 2J6EA 3MSPA 1NCDH 2ED8A 4GMSH 3GRWL 1YECL 5LQBH 4G8IB 1L7TH 4KTDH 2VQTA 4PJ7B 2I5YH 2D7NA 2P43B 4HC1H 2DN7A 3DO7B 4OI7A 1AO7E 5GRYA 2VQ1A 1CBVL 4OZ4B 1DVFA 4BQ8A 2YD6A 1A7RH 1BFOA 3GB7A 2WLYA 3EOTH 3TVMC 1HHKB 4OQ1A 1IVLA 2A83A 4P0DA 3UYPA 1RZJC 1F3DH 4ODSL 1T7YA 5L8KB 4I48B 1QP1A 3K7UA 4PJ8A 3QCTH 4PGJA 1IC4H 3UTZA 5JXEC 4QRRE 4P4KD 2VITB 2ITCB 4Y0GA 2MPAL 4KRPB 4I3RH 3MRBA 1ERNA 1UWXK 3EFDL 43CAA 1XIWC 2A0LC 2DBJA 3FQTA 3K1KC 4N0YL 5JW4Q 1I7ZA 4MZ3A 3KXFD 5KSAB 4OI8A 3PHQA 3BQUC 2A6IA 2EXWC 5IW6A 4FQ1H 4P2RA 5CUSL 5T1KB 4CVUA 3S88L 3VFNA 3TWCH 2X4SB 4GAJL 2BNUB 5D71H 5DC0A 4Y5XB 1TPXB 4XP5L 3O2WH 1U36A 3RGVB 2QL1A 4X7EC 3KVQA 4XNZB 1UWGL 1HCFX 3O45A 1RUKH 3C8HA 1K8IB 5D7JC 3ARDC 3BO8A 5F7YC 35C8L 1CE1H 1YYLL 5DJAB 2YUZA 5FUZH 5JIPA 4L3EB 3DYOA 1G6RB 3MLWH 3UAJD 3VWKA 1YEGH 4XCCH 5C0EA 3ZKXC 2ZJSH 4OCXH 2B4CC 3P0GB 1IKNA 3FQRB 32C2B 4NUJA 1KELL 5DHVA 1CFVL 1OARL 1HWHB 3C09B 4QXGH 3GJEA 4QTHA 5EU5A 3MLXH 4HQQL 4ZDHA 1BZQK 4JFQA 5K9JL 4H88H 2VR9A 2BOCB 2P7TB 2RCSH 1IE5A 3WFDL 1PDKA 4M7LT 3WBDA 5K9KB 4JCLA 5BQ7B 2IH1A 1BAFH 2VDLH 4W4OA 4XPTH 1D5ZA 2WQ8A 3MRPB 4LIQE 3RJQB 5D2LE 2I9TA 3FHQA 3PWNA 5I18H 4P4KB 5F44A 2IMMA 4JFXB 4YXKH 1UZ6E 5F9JA 2IALA 1A1MB 1T1XA 2Q8AH 5KVGL 4QRQA 2VXUH 3FFCE 4FXKA 4LIQL 1F42A 3FAXA 4YJZL 3VFWA 3Q6FB 4GKNA 4PRIE 3MXWL 4W68A 4E41D 2DM3A 3BZ4B 2IMNA 1R3HA 3HNSH 1DQDL 3WFBL 3QYCA 2K1MA 5BS0A 3TO4D 1WV7T 4APQD 4ZSOE 4ZS7L 1MY5A 3AFLA 3BUYA 3STZB 5HXMA 1MAMH 1EUTA 2BVTA 3FQUA 3FFDA 4M43L 4V2BA 4WFGD 3QJFA 3QXTA 4MYWB 1CTNA 3L3JB 4N68A 5IIEB 1FH5H 4EUPG 3SCMD 1CK0H 4OIIH 5CEXA 3GBNL 3ET9F 3QDGD 3ZDZE 4DCQB 2RGSA 3A6BH 3L7FB 3QUKA 1XF1A 1R3KB 1NGPL 3T65B 4ELKA 3IS1X 3RWFB 4I0PD 5GRWA 1JMXA 5DJZB 2APFA 4KVNH 4N9GB 4MA1C 5JR1L 4HPOH 5I1DB 3S3JA 2CIKB 3LOWA 4PJAE 2BFVL 4UDUA 1NCDL 2YPLA 4GMSL 3O0RH 4P5TA 5LQBL 1L7TL 1G1YA 4JFEE 4KTDL 2I5YL 4EUPA 3KYOB 4KRNA 4ZQKA 5HYSG 4HC1L 1DVFD 3IRZA 3WJJA 4HUUA 4TYUA 3RVUD 5K9QI 5H94A 2V5YA 4PV9A 5IB1B 5E00A 3UTPD 2HT3C 2VO5A 5E5MB 3RUGF 5ABDE 3HAEB 5DFVD 1A7RL 3SO5A 2F74B 5K33A 5ISZE 5AD0B 3RWHB 3K2UH 4PJ8D 4YAQB 3EOTL 5ITFA 3QUZA 5E1HB 5DR5H 1UXSB 1GYAA 4YDKH 4I1NB 1B2WH 2YC1B 4YC2C 1X5JA 4NNPH 4NQVB 5HYSA 3QCTL 2DKMA 1F3JA 1MIEH 4MMZC 5F88B 1I9JH 2C3XA 1IC4L 2IH3A 2IQAA 1CDJA 4OSUH 1I7UA 5F7DB 5C3LD 5JPMA 4J3UA 4ZAKC 1IGCH 4I3RL 3DVNB 1OLZA 2ITDA 4HIHB 3UO1H 1EMTH 2XNAA 2A74A 4M03A 2XTJB 4NM8H 4APQB 3IDNA 4P2RD 3M45A 5FGBA 4H8WH 3QEUA 4P9HH 1YJDH 2C4FU 4FQ1L 4OM0H 5KSUA 3SDAA 4Y4KC 3TWCL 3BE1H 5F9WB 2DL9A 1I1RA 3QNYA 3GSVA 5D71L 3LKPA 1JNLH 3O2WL 5IK3A 4UUJB 3B5HA 2VH5H 3O3AA 2GITB 4I0PB 1RUKL 5IB5B 3W11D 3VA6A 3JTSA 1S7RB 4AEHH 2O5ZH 2HVKB 3IDIA 1A3QA 1CE1L 3NPZB 3VWKD 3T2NH 2IPKB 5FUZL 3RP1A 3MLWL 4CVWA 1YEGL 4XCCL 2ZJSL 3JUYA 4OCXL 2VQ1B 4JZJA 1DVFB 2UUDH 3K2MC 4WHTA 5ICZA 2PTUA 5I71B 4OFDA 1QHPA 4QXGL 4JJ5B 2D4FA 2BNRE 2UWEE 3MLXL 4OCYH 1EDQA 5E8NA 4PJXE 3RZCA 4FNLH 1QSVA 2W0PA 4PJ8B 4H88L 2RCSL 3JV0A 1F2XK 2M1KA 4QRPB 1BAFL 2VDLL 1QHOA 4XPTL 4RCAA 2HLFD 2B0SH 5I18L 3L6FA 4YXKL 1DN2A 1IILE 1L6XA 1XCTB 4PBWD 3KYKH 4KXZH 2Q8AL 4MQXD 2VXUL 2W92A 5DZOA 1MQ8A 4NJAH 5FB8A 1MF2H 3LY6A 5IW6B 4U0RB 5JA9A 5T3ZD 3FN3A 2A6JB 5BS0D 2ICWB 1YNLH 3HE7A 4EXPX 3IXTA 4AEFA 3VFNB 1QVOA 1M7XA 3HNSL 2G5RA 4FN0A 3DGGB 3TBTA 3QEGH 3VXSA 1GOHA 1LO5B 3VXRA 3CC5A 1MAML 3QH3A 5MI0C 5K9OA 2PTTA 4L3CA 1IGTA 4NFCA 2OMBA 4V1DA 3BO8B 2ZSWA 1FH5L 4K3HA 1BIIA 1CK0L 2EDFA 4OIIL 2HYMA 1YEHH 5BRZA 3A6BL 4LSVH 3F65A 1U6AH 1R5WA 5C0EB 4P3DB 4KWUA 4R6UA 5E95B 4ZFOB 1X5IA 4KVNL 5EOQH 4P5TD 4HPOL 4Q2ZB 5M95B 5TDNA 2V7HA 3CFIC 3O0RL 4Z0BH 4DGVH 3L3OA 4Z78B 5HI4D 1YC8A 3K4ZA 4JQVA 5F1IA 2JCCB 2DAVA 3W82A 3TPUA 2MJWA 3VXNB 4TTGA 3EDEA 2IAMC 2APBA 3BWAA 1IC1A 2IH1B 3QCVH 2UZIH 2J5LB 5D1ZA 5C0RH 2Q3ZA 3QUZD 1LEGB 1KACB 5EORH 2ZPKH 2IALB 1T1XB 1AY1H 3K2UL 5I6XB 4JM2A 5DR5L 1JWMB 2AXJA 4YDKL 2F5AH 5D5MA 1LK2B 3VFWB 2JTDA 4F7PB 2OMNA 1B2WL 2X1OA 3S3PA 4NNPL 1MIEL 4ZS6C 1I9JL 1SJHA 4W81A 1QSFE 5D1QA 3C08H 2RJMA 4M8QA 4OSUL 5J13B 4JVPA 4EDXB 2IADA 2ID5A 3VJ6B 2Y06H 3HMXA 1IGCL 4U1LA 3UO1L 1EMTL 4FXLA 4XC1H 1CDYA 1D6EA 3FQWA 1ZHLB 3FFDB 2CK0H 4NM8L 4U1NA 3RA7H 4PRHA 3SDAD 4KZEH 4H8WL 5EUKB 3P9LA 4P9HL 4LOUD 1YJDL 1FNLA 1NC2A 3AU1B 3QO0A 5CEXB 3GBLA 4OM0L 3RNKA 3ZKMD 8FABA 1EEQA 3QUKB 1AGBA 2H6PA 1DANU 3BE1L 3HPJA 3PG2A 3WNNA 3ZMRA 4ELKB 3BP5B 1FO0A 3ZTJG 2J8UE 1AC6A 1JNLL 1PFCA 5B39G 4YDIH 3VGAB 4ZO9A 4CNIA 4XGZA 2VH5L 2ZUTA 4LARH 1AD0B 5E8DH 3HB3D 4P5TB 4IHOB 5JXEA 5MENB 4AEHL 2O5ZL 4NZTH 5I1JH 4EUPB 3T2NL 1BJ8A 4LAQH 5J6HB 1V7NH 4ZO8A 4XB7A 2XPGB 4OT1H 3NFPA 4LSPH 1XIWA 1P2CB 1JGDB 4HUUB 5IQ9A 4GLRH 4PV9B 5EU6A 1EPFA 1CICC 5C2BH 3K80A 1DANT 5FF6A 3SPVA 2CUMA 3BQUA 4HUKB 3S96B 4UT9H 3QXAA 1DQLH 5ITFB 3RZCD 3RVVD 2Y5TB 4CMHC 3C6SB 4Y1AB 3DSNA 4HCRA 4OCYL 3WNOA 4X6DF 1A7OH 2VR4A 4GRLC 3D25B 5HYSB 4FNLL 4GAYB 4HIEA 4JEGB 1OD7A 4JFDA 5DJDA 2YD9A 1I7UB 2EDKA 3X14B 3HG1E 5C0BE 5D7JA 3TYFA 3ARDA 4HIIA 1LK3H 2ITDB 2B0SL 1EZVX 4OCRH 4HJJH 2XNAB 1HCVA 3KYKL 3RX8A 3IDNB 1LO3H 2GAZA 3HE7D 2BMKA 3LQAH 3QEUB 4HK3J 4PJHF 4N0CC 4NJAL 4ODWB 1JTOA 1MF2L 4PGEB 3VXSD 4W4NA 2D3VA 5GZND 1YNLL 2BHYA 4YH6A 3SDAB 3GSNH 5KSUB 3VXRD 2OR7A 4WW2C 1KCRH 4MWFB 3QEGL 3QNYB 3GSVB 4PY7A 3T4AA 3IDGB 3ROLB 1IARB 1RV6X 4V1DD 5IK3B 3O3AB 3VFPA 1ZVSB 2AP2A 3JTSB 5BRZD 5JW5A 5FYKD 2P5WA 1ZLWK 5C07A 4GUPB 5F6IB 5ACZB 1YEHL 2ATKA 1T66D 3CDCA 1E4JA 4LSVL 1U6AL 4U6YB 4PG9A 2NY1D 2V2XA 3OB8A 4LLYA 2FECL 4I3GA 5DEGA 5EOQL 5ICXA 3MFFB 1MWAA 4R2GC 5ICZB 4Z5RB 1U8IA 2HA1A 4OZHB 2NNAA 2HG5A 4M61A 3S34H 5BXFA 3T4YA 1GH7A 4Z0BL 4DGVL 4UQ3A 2O26U 3OAYH 2H32H 1CLYH 2J8OA 1DP0A 3GRWA 2NY3C 3MGAA 5D1ZD 1K8DB 1QA9B 3CJJA 3FQNA 4M6AA 3EZ8A 3WLBB 4YBQC 2CUIA 3QCVL 2UZIL 5T3XH 5C0RL 3QEHA 5GGSB 4X6BA 1U8JA 4PJ9D 4JM2D 3OXRA 4P9HC 1NKOA 1VENA 1YJDC 3L6FB 4S1DC 4NN5B 5EORL 2ZPKL 4KJQC 1AY1L 1J8KA 3Q1SH 1BZ9A 2PXYC 4FQXA 4PJFF 5D1QD 1K4CA 2F5AL 3P4NA 4MS8D 1JZ7A 4JG0H 3QHFH 1Q9WA 1AO7A 1CLZH 3DIFA 5FB8B 1LO4H 3HE7B 4BFGA 3IXTB 3C08L 3GI9H 3TBTB 3TBYB 3VXSB 2Y06L 2EZ0C 4PRHD 3BEVA 3VXRB 3ZKQD 1IEBB 1HH6A 3BZDA 3QH3B 4XC1L 3WFHB 1NC2D 1VFAA 2PTTB 2CK0L 3GSOA 1IGTB 3RA7L 4KZEL 3L7EA 4V1DB 2ZSWB 5C0IA 1YPZE 3I75A 3H7BA 1TNMA 2MFNA 1BIIB 3EZJB 4KKCC 4IJ3C 5CS7A 5BRZB 4G8GD 4PJEE 1G7PB 4X4XB 2QQQA 4O2FB 5SWQB 3U30B 4D9QE 1CXHA 1H3VA 5D96C 1HH9B 1L7IH 4WW2F 4YDIL 3G5XA 1UB6B 4NRZA 2VDMH 4NGHH 2NY1B 1NFDF 4LARL 1O7VA 5TDNB 4YEFA 2F19H 4M93C 5E8DL 4JRYA 1WVZA 4PLJC 1L0QA 3NPSC 4NZTL 1XIWD 2A0LD 2ED9A 5I1JL 5F1IB 4G7YH 4D0CB 4ZAKA 5EU6D 4LAQL 1V7NL 4Q97A 4OT1L 4LSPL 1C7SA 4HEME 3C5ZC 5CJOH 5DMGC 3P9WB 3BQUD 2EXWD 2B1HH 5D1ZB 5IF0A 5C2BL 1HKLH 3VD7A 3FB6A 4LKXA 4OF3A 1T03H 4UBDC 1ZHBA 2C26A 4UT9L 1DQLL 2CUHA 4ONGH 4PJ9B 4BJLA 5F8RC 4JFDD 4FTVE 1A7OL 5B8CB 5D7JD 4ERSH 5IB3A 3ARDD 4M8QB 3IRPX 1ZANH 3R8QA 1Q0YH 1QFHA 1LK3L 1WFNA 4OCRL 1FCCA 4HJJL 5HYJE 1KULA 1D6EB 5KZCD 4XRCA 3O2DH 1LO3L 3W9DA 3QSKB 2DL2A 3LQAL 2D7MA 2QTEA 1NC2B 2EDDA 4OZGF 1UH2A 5D2LA 2ZG1A 3RNKB 4YQXL 3GSNL 3MYJB 8FABB 2W59A 4LSUH 4OFKA 3VE0A 1VERA 3L5WA 1AGBB 2H6PB 3HPJB 1KCRL 2FJFA 4E0RA 1FO0B 1KCVH 1BX2A 1FSKB 3FFCA 4AM0B 4G8GB 3HZYA 1TCMA 3OJDB 3MUJA 4R96B 3RKDC 4CNIB 5E4IA 4XGZB 1ZLUK 2P5WD 4PRIA 5C07D 1X44A 2EDTA 4H1LH 4LSRH 5BZDA 4K7PY 3BGAA 3VXMB 1X5XA 3V7MA 4U6TA 4LKCB 3SY0A 3FMGH 4HFUH 3NZHH 1XIWB 3CXHK 5IQ9B 3UX9B 4RDQF 5CEZE 5EU6B 5DRNA 5B39B 2BVQA 2PYFB 5IFJA 1I85C 3BQUB 5EG6C 3D85A 2IJ0C 3V6FB 2FNBA 3S34L 2VQUA 3QXAB 3X12B 5JORA 3U4AA 2E6PA 4JY5H 5T3XE 1CLYL 3QFDB 3TIDA 4X6CE 1RI8A 3TNNA 3GJFB 3LN4A 4HIEB 3DO3A 1FL3B 4M4PA 3LS5H 4JFDB 4J7RA 4HC1A 5T3XL 5E2JA 3RWDA 3QEQE 1QACA 5HDLA 3ARDB 4HIIB 3UYOD 4BK4A 4FQXD 2VKWA 1I9IH 1TTGA 1AO7D 2JJVA 1KNOB 3Q1SL 1S5HB 5DRZA 3RUGB 4Z8FH 4PJCA 4JG0L 3QHFL 1CLZL 1LO4L 1T1ZA 1P84J 4L4VE 3GI9L 2YA1A 3TPKA 2EE2A 5JMOC 4XI5C 5ISZA 1MLCA 4X6DA 5T5NF 4PY7B 3T4AB 4DKEH 3BPLB 2Z8WC 1T20B 4IDJH 3MCG1 4HEPG 1AP2A 3VFPB 1F4HA 2HT3D 2Q86A 4QRUA 2IAMA 5JW5B 1NUDA 1S9YB 1H3GA 1TDQA 2E9IA 1IQDA 2ZCLH 4L5FH 2ATKB 2WWKO 4XPFH 1EH9A 3L5JA 3TIEA 4B0MM 4MA3A 1L7IL 1TMCB 4PGDA 1P7QA 4JRYD 1ULVA 2GY7B 2VDML 1MWAB 2FHFA 4NGHL 3VXTA 3CH8A 2F19L 5BXFB 4ZAKD 1WAAF 3T4YB 1WBYA 4WIQA 1V3LA 2X4QA 4IMKC 2DM7A 5EIQA 4G7YL 2C7UB 3FQNB 5GS2D 1K85A 5CJOL 5F9AC 3K81A 2ARJQ 3VI4F 2B1HL 5CP3A 3G5ZB 1HKLL 4MDJA 3QEHB 5CZKA 5DTFA 3OXRB 1A47A 1OSZA 4FFZH 1T03L 1YN6A 3VG0H 5FM5M 4DGIH 3BGMA 2E9WA 3RPKA 1XAUA 4ONGL 2D2OA 5GRXG 1BZ9B 4HLZH 4NC2B 4TQEH 4FQXB 4Q0XH 3P4NB 5C0CE 1Q9WB 4ZUUB 3IDXH 1VCAA 1WC7A 1J8HE 4DKAA 3DURA 4PRPA 2QADD 4ERSL 4C83B 3VW3H 3QB7C 4JDZB 2VDOH 1EFXA 1NGXA 1ZANL 1F58H 1Q0YL 3FT3B 4OCSH 3LEXA 4FFWC 3VFSA 2UWEA 1RY7B 1W2KT 1EBAA 3KYMB 3O2DL 2VXSH 2GTZA 3BD3A 1RK0B 1FZMA 4LRNH 2VLME 3IFLH 3TNMA 3FFCD 5FOJA 3B9EA 4LSUL 2W9DH 5CILH 4MMXC 1YMME 1G7LA 1JHTA 1KCVL 4PRID 5DURD 3MNVA 4NRZB 1SMOA 4MNQB 4YC2B 5E9DA 4GRLA 4L9DA 1AGCA 2ZUSA 4JRYB 3UDWC 3MUGB 1AD9A 4LSRL 1EAPA 5JO5A 4ZAKB 3LRSA 1KF9B 4AL8H 3FMGL 4HFUL 4I5BA 3NZHL 4HS8H 4GG6E 1NGYA 4KDTC 4U1MA 3D85D 5LAXB 1A3LH 5IF0B 1T4KA 4LKXB 3HZMB 5D7SH 2Q87A 1ZHBB 3DRTA 3NOIA 4LBEA 4ODXB 2QEJA 4KUCD 5LVEA 4WW2A 1RUQH 4JY5L 2A1WH 3B43A 5I16A 3EJYC 4WY7H 3D0VA 2GJZB 4ZUSA 4DW2H 3DJ9A 2HJKA 4RGNC 2PYEB 2APWA 3LS5L 2W91A 3R1GH 5CGMA 3KR3H 3GSQB 3MOAH 3AAZB 2C1PA 2QADB 1EERB 4ESKA 4HJGB 1I9IL 1U8NB 3BP4B 5LGKA 3BUTA 4XRCB 4CU8A 5E8EA 3W9DB 1LDPH 4Z8FL 4ENEC 1VB9A 3UBXG 5DZLA 5ISZD 3VG9C 2VZVA 1W8OA 3ZHKA 1G9EA 3VE0B 2OX5A 3L5WB 1LHZA 4KQ3H 4M1GH 2FJFB 3EYSH 2D03H 5EU4A 1ZLVH 4LASH 4LF3A 4DKEL 4IDJL 5DJ0A 3HZYB 3HC0B 1XF4A 2IAMD 1N2RA 5FYLH 5DURB 4FRWA 4JRXE 3MV9E 1MHPH 3BMVA 5BZDB 2YMXH 3WO4C 3UBXA 3QISA 2ZCLL 3PWLA 4L5FL 3U7WH 5HVGB 4XPFL 5DGQA 4PP1D 2BVQB 4ZS6D 2PXYA 5IFJB 3CDFA 2NLJB 5EUOF 3D85B 4YPGA 3PGCA 4B41A 4RDQG 4BFEA 3NMEA 5C09E 1C7TA 1EO8H 1QNZH 4PTTA 1DEEA 2J8UA 4XNQA 5IWLC 5GRVL 5I17A 3O3DA 3HE6B 1U3HC 3QIWB 4KK6C 1BFVH 4FFZL 5I66A 2ICWI 4RWYH 4A6YH 3VG0L 4DGIL 1FAIH 2X2YA 5CSGA 4PRPD 4HJ0D 4NN6B 3PQYE 4TQEL 2XV6B 4Q0XL 4PJCB 1EFXD 4LNRA 5F72S 3SE4C 5SWZB 3IDXL 5LWYH 1EHLH 3QPXH 3VW3L 4RQQB 3WNPA 3DWTA 2VDOL 3WDIA 5FK9B 1F58L 1GHFH 3BYYA 1MLCB 4X0KA 4X6DB 3U9PH 4OCSL 4XVSH 1HHGA 3W9EA 4RA0C 1AGEA 1I4FB 3L95B 1FL6A 1FZKA 5IKCA 1AFVH 2FH6A 3BDXA 3QPQC 5T5NG 3C5ZA 4M6MH 2BDNH 4LU5H 2IAMB 2VXSL 3NIGF 4LRNL 3HG1A 5C0BA 3IFLL 3WLWC 1IQDB 5I1HH 5D7IF 1RFDH 3EOYG 4LDLB 2W9DL 1R5VA 4U05A 5CILL 2DLEA 5E9DD 5DK2B 4GRLD 2H8PB 3RIAF 3REWA 4MD5A 1XH3A 4PGDB 1HSAB 5IHBA 3IDUA 2FL5B 4LCYB 3VXTB 4EJ1C 2EEAA 3NCMA 4JY4A 5JQ6H 4WU5B 1WBYB 3EO1B 2X4QB 3WKNA 1MUJA 3PUCA 2FO4A 4AL8L 1RSFA 5BOPA 2ZZUT 1IL1A 1KC5H 4S11A 4HS8L 4NQUA 4N0CD 2GK0A 1A3LL 4MDJB 4U7KA 1OAXH 1Z2KA 3G6JE 5D7SL 4HG4K 2YXFA 2P8LB 1HQ4A 2P8PA 1RUQL 3CDYA 1J5OH 2A1WL 1II4E 1XGRB 4WY7L 1IGYA 4H0HB 4Z7VE 4DW2L 5T1LB 3LV3A 4PRPB 2YHGA 2RR3A 5JW4M 2A6KB 5J3HC 2X10A 1EFXB 3IXAA 1NGXB 3R1GL 3KR3L 3MOAL 3LEXB 3D18A 5ESQB 3GSXA 1WZKA 4M7KH 1LDPL 1BQHG 2GTZB 4R2GD 1ETZB 1FZMB 1FVDA 4C4KT 4B5EA 3QDMB 3ARTA 1GXEA 1I85A 4PJFB 4KQ3L 2NY3D 4M1GL 4NRXA 3T2PA 3EYSL 2D03L 2DB8A 4LASL 4YBQD 5E9DB 2Y25A 4GRLB 1AGCB 1Y0LB 5FYLL 2UY7A 4RBPK 1FVCA 2X5PA 3ARGC 1MHPL 1VSCA 4MGXA 2YMXL 1CFQA 4S1DD 3HUJA 1I8IB 1SQ2N 3DX8A 3LRSB 1J10A 3W39A 3U7WL 3AMKA 2PXYD 1OTSC 3UP1A 4U1MB 3B9KC 5DJXA 5GRUH 1BM3H 3C8KA 3W5NA 1T4KB 1U0QA 4DEPC 2GIYA 4N8CH 1YPZA 5JOPE 4JFZH 1VKXA 5DVNA 3DRTB 2EZ0D 3WV0A 4U4BA 5IHLB 4WW2B 1EO8L 2NY6C 1QNZL 2AEIT 1JL8A 4ZUSB 3MCKA 1OP3K 3F62A 3R06A 2HJKB 3VXUE 2WBWB 1RZFH 2RIKA 5IFAH 4NIKB 5F6HI 3IJHA 3ZYZA 2C1PB 4KKCD 5FYJE 1BFVL 4M5YH 2O93L 3BDYH 5J1TC 2AERT 4LPVA 1H15A 4ORGA 4A6YL 4RWYL 1FAIL 3BD5A 1NPUA 4HMDA 5E8EB 3E6HA 5E94A 2CLRA 5I1AB 5LWYL 1EHLL 3HZVB 3AS0A 1GZPA 3Q0HA 3QPXL 1PG7W 1R0AH 1YEFH 4PLJD 2LVEA 4HDIB 5FECA 1OP5K 5I1GH 3H42H 3B5TA 1GHFL 1OLLA 5IBUG 3U9PL 3NFNB 4NCC1 5EU4B 4XVSL 3WD5H 4LF3B 4E5XB 5JLZB 5DJ0B 3IFOB 3C5ZD 4IMKA 2KDGA 1XF4B 5DMGD 4MSWB 2NY3B 2VRAA 15C8H 1MRDH 1OGAE 3IF1A 1AFVL 1V05A 3HG1D 5C0BD 4M6ML 2BDNL 2D0GA 4LU5L 4UBDD 3UBXB 1BZ7B 2GFBB 4BSWA 5C9KA 3EYUH 1UB5B 5IB4A 3PWLB 5I1HL 1RFDL 5HYJA 1T7ZA 4TUKH 1FQ9C 4OZGB 3H9YA 2AJSH 3OKDA 3MCLH 3V8CA 4QT5B 5MERA 3LH2H 3TCXA 5F7LB 2H9GA 5JQ6L 1FPTH 2A77H 3ARBC 4PTTB 3OKLB 1OL0A 1KC5L 4XNQB 5FCUH 5I17B 1CD8A 1OAXL 3RY6C 3HR5A 2CLZA 3P4LA 5ALBH 5I66B 3HKFA 1BD2E 3BEWA 4IJ3B 4OTXH 3RKDD 1J5OL 5D96B 5DK0A 4LNRB 4U1HA 2Y23A 3QQ4B 1H8OA 3BZEA 3MRJB 5CBEA 2HFFA 3ZSSA 3T77B 4Z7OE 3G08A 4YDJA 4GOSA 3DX7B 3UDWA 1HHGB 5LGJA 2NTSP 3D39B 1AGEB 5T1DH 3RVTD 4LSTH 4RAVA 5H37H 3PV7A 1KIPB 1FZKB 5GSVB 4M7KL 1NGWA 1HXYA 2V7NA 4HWUA 4AENB 3UJJH 1DDHA 1WF5A 2DKUA 1Y6MR 5IMMA 3MC0A 3IAQA 2SEBA 3HRZA 1WIUA 4NO5B 3AROA 4P2QE 1UEMA 4NCC2 4R0LB 3REWB 5IG7B 5IT2H 3FHAA 1TQBC 3QDJE 3MRCA 5EO9A 2DRUA 2E6JA 3MRQB 4X9IA 5I8EA 5IW3A 1OP9A 4L4VA 2YWZA 5DO2D 5ETUB 3RJDA 2WBJC 1MUJB 3VGHA 3PGDB 3MLTA 3C5JA 5HVFB 2FO4B 2FX9H 3BXNB 1IL1B 2X4OB 2LE9A 5I9QC 3M1BA 3MXVH 5FEBA 5GRUL 1BM3L 4FFYH 4PREA 5KSBE 4OM1H 3HFMH 3PP3K 4XP1H 5CHNB 3W5MA 3UEZA 4N8CL 4ODBD 4G6KH 3I02A 1WFTA 2CDEB 4IRSD 4JFZL 1A5FH 4D9QD 4WUUA 1U3JA 3VFOA 4LP5A 1WZMA 5HYFA 4ZD3H 2F54A 2P8PB 1HK6A 4OBSA 2CRZA 2R4RH 1IGYB 4MA8H 1WGOA 4GKOA 3BRDA 2EDOA 4KROD 3I3BA 1RZFL 1YUHA 3SGKC 5IFAL 2CO7B 4LCCC 4Y4HB 2L7JA 1T04B 3MACH 1V3MA 2QSQA 4M5YL 3BDYL 1MAJA 5CMAA 3GSXB 3SE8H 4HWZA 5TF0A 3PDOA 5IV2A 2X4TA 4CL7A 1UEYA 4RAUA 2OI9C 1TZHA 3QZWA 1CVSC 5CEYA 1R0AL 4D8PA 1YEFL 4XVTH 4PLKC 3NABH 1MFBH 5I1GL 3H42L 4NRXB 1K5NB 3FONA 3RHWF 3WD5L 1S7SA 4L8DA 1DJSA 4PRAA 3DMMB 5C0CA 4YE4H 2BRRH 3F7VB 1FLRH 15C8L 1MRDL 3N85H 5IJVA 1J8HA 3BHBA 1FVCB 1L4IA 3VXQB 5IWLA 1BQHB 2OYPA 1CFQB 3O3UN 4HFWA 3HUJB 3U4EA 1U3HA 1EIBA 3DX8B 5EFIA 3EYUL 3PHSA 3W39B 4U31A 1QRKA 3QUXC 1I9EA 2ZKHH 1HHJA 4TUKL 4YIQB 2X41A 5IVNA 4KK5D 5CD5C 1S8DB 2AJSL 3MCLL 1HWGB 2N1KA 3PP4H 3LH2L 3SE4A 4OLEA 4M7LH 4HBQA 4H0IA 4FFWD 5ANME 1FPTL 2A77L 5F1SA 4MJ2A 1QLFB 2UVEA 4IRSB 4OLYH 5ADPH 1HN1A 1UZ6F 1ZV5A 2B8OT 4H1LA 5SX5K 4OLZH 1T1YB 3R06B 3T0EC 2PUQT 1PEWA 5FCUL 1XGPB 2FHBA 1B6DA 5TH2B 3U0PA 4KROB 5ALBL 4AZ8A 1FORH 1H15B 3LKQB 3LKOB 3MV7E 1NCBH 1ACYH 3OKMA 1N5AA 3OPZH 4GG6A 3H8NA 4OTXL 3VXOA 2AV7A 2CLRB 4M00A 1H5BC 1H3PH 2HTKD 5FECB 3B2UC 5T3XD 1INEH 5E99H 2UYLA 2JLLA 1YNTA 4D0DB 1CR9H 2Z9TA 5C71A 3RRQA 4KI1A 2V9RA 5T1DL 4LSTL 5E4EC 3IF1B 2XTLA 4S1RH 5HYQA 4Z7WF 3UJJL 3U9UA 1KXVC 2AJZA 1X5HA 3T04D 2VZ1A 2FR4B 3GMQB 4BSWB 1JE6A 1G84A 4HUVB 4NHUB 4MHHG 4F8QA 1S7UA 3X13B 3EJYD 3RGHA 5IBUB 2X89A 3GSNB 5IOPB 3OKDB 4RGND 4L4VD 5IT2L 5D2NB 5EU3A 4JGMA 5MERB 2X6MA 3WFEL 4JFHD 4R4ND 3ZDXF 2C1OA 5SX4I 4PBVC 2H9GB 5HGAB 3RWCA 2OTUA 1JGEA 4OB5H 2V9QA 4GRWE 4WHDA 2W0LA 2FX9L 3U0TB 4CMMB 3STLB 4HHAA 3GSUA 2HT2C 4ENED 4BSJA 3MXVL 4FFYL 4WUUD 3QRFM 4OM1L 3HFML 3OG6B 4XP1L 4JRXA 3UPRB 2F54D 3HR5B 4G6KL 1A5FL 4UOW0 2XZQH 3TH4T 4KJPC 1OGTA 1R3LA 3OKNA 3KPRE 5EBMA 4ZD3L 1ZTXH 5BV7H 1LD9A 2R4RL 5EUOB 4AH2B 5DK0B 4MA8L 4JPIB 2I26N 5CFHA 4HLZG 1EK3A 2H32B 5ERWA 5I19H 2HFFB 3CDGA 1K4DB 1LEIA 1DUZB 3MNZA 3I6KB 3IJSA 3EIFA 4YDJB 1CVRA 1MOEA 3MACL 3ARGA 2VLLB 2DQTH 4YGVA 5C09A 2V2TA 4L1HA 1Z9LA 4WCYH 2R23B 3SE8L 4BSVA 4Z77A 2X4RB 1XMWA 4NO0A 1NGWB 3NCYS 2V7NB 1LP9E 2X4PA 2NX5E 1DDHB 3ZKND 5EN2A 1DCLA 2R29H 1W8NA 4XVTL 2YEZA 3OR7B 3D2UB 4JPKH 3NABL 1MI5E 3WJLC 3S5LG 1MFBL 5C0CD 3CXDH 2EKSA 4CVXA 2ENSA 3BP6A 1YDPA 1J8HD 4HLJA 3DI2B 2ZCHH 1I3RB 5C0DA 4YE4L 2BRRL 5EO0A 1FLRL 5EO9B 5FGCE 3N85L 1U3HD 3O6FB 5I8EB 4RBPH 4RGNB 3EYVA 1T3FA 5DJYB 3S7GA 1F4WH 4YBLB 3WMSA 4X9GA 3MLTB 5IVXF 3C5JB 3WUWG 1FFOB 3ZLQC 3S5LA 4K3DH 1FRGH 5FA4A 1VADA 2ZKHL 3M1BB 2ICES 2VLMD 4PREB 4PJXF 4MXWH 5FFLA 3SGDI 2VB5A 3PP4L 3I02B 3O4LE 3FO9A 4M7LL 3VG9B 3E1F1 4DUWA 4WUUB 1U8MA 4WVRA 3VFOB 3DGCR 2Z93A 2F54B 4JE4B 2GSGA 5C0AB 4OLYL 3WUWA 5ADPL 2WP3O 2NY0B 1TJGH 2C3HA 3QPQD 4AYFA 2WLZA 5DRWB 4H26B 5D6CA 2YD7A 4OLZL 2FHCA 3CFDA 2BOBA 3HPLA 1YUHB 3NCJH 1Z9SA 3P2TA 4OAWA 3WLWD 1GPOH 1F6FB 4YBHA 1S9VA 4P2CG 1YZZA 1FORL 5IMKB 3PDOB 3MRMA 5CP7A 2H2SC 3PGFH 1NCBL 1ACYL 3OPZL 1P5UA 5CZXC 4RAUB 1TZHB 4UT6H 3PDDA 5D72H 5CEYB 4D8PB 1H3PL 5HI5C 3QA3A 4OZFH 5DRXA 3A67H 3G6JA 4DKFH 3MRLA 1ZVYA 1IMHC 1INEL 5E99L 1CR9L 3BYTA 1YQ2A 5BO1H 3ARBA 4L8DB 4PRAB 4I3SH 1SMAA 2M2DA 1ZA6A 2XWJA 3V6ZB 4S1RL 5LGHH 3MUZ1 2ADJA 1HEZB 3IJYA 5FA3A 3MPCA 1IM9A 2X89D 5EFIB 3RY6A 4X5WA 1Y18B 2F53E 3U36B 3O41A 3Q48A 4KDVA 2XKUA 3DV4B 1HHJB 5L8LB 2DMBA 4WV1C 3BESR 1A7QH 3KJ4C 4JM4H 3QIUC 4KKAC 4YHZH 3B9DA 4F9PC 3DLQR 1EEYB 3KLAA 4NPYA 3LN5A 4OB5L 1QBBA 4Z7UF 3GFUA 2Q1EA 1G9MC 1CGWA 5CBAB 2R15A 4W6WB 1FNEA 2A38A 4JRXD 1N6UA 4RMVA 3T0BA 4XCNB 4H25A 3H9HA 1JGVH 1ZA3A 3GKZA 5FM5O 5KN5B 3F6IA 5LG1A 1WUNT 4ZXBC 4MJ6B 4DGYH 1MH5A 1OT1A 2XZQL 5H2BA 2IGFH 5TQ2H 2AV1B 5J56B 2UZXB 3OKMB 5BV7L 1ZTXL 2QQLH 3VXOB 1KXQE 5JHDA 5I19L 3ARGD 1NUNB 2NY2C 2R1XA 4JGUA 2YWYA 5LBSH 2DQTL 4XZUA 1EUUA 2G5BA 1DE4B 3NZ8B 1OTSD 4WCYL 4FQQA 1JF6A 3E0GA 2DWDB 5HYQB 1ADQH 1G6RH 3VXUA 1M7IA 1QYGH 3Q5YA 5D7LE 4A6YA 3U9UB 2AJZB 5HGBA 4RGOH 2R29L 3DUSA 4FQLH 2VMFA 2NY6D 4JPKL 1S7UB 4NQEB 2WUCH 3CXDL 3L5XH 4OGYH 1FYTE 3LKNA 3MRRA 1AC0A 1EXUB 4PJ5A 4A2LA 2ZCHL 4MX7B 1CD1A 3VFTA 2D0FA 1FP5A 3B83A 5TQ0H 2C1OB 4JZNB 3VD9A 1NQBA 1DL7H 3N0PB 3PWJA 1JGEB 3B9AA 1F4WL 3SGKA 4LCCA 1KIQA 3NFSH 4FZEH 2GI7A 5F93C 1EVTC 3UTQA 4HHAB 1R5IA 4MJIE 4K3DL 1FRGL 3SDCC 4EIZC 2GKIA 1OGAA 1V8HA 1Z0MA 3HRPA 5GJTH 4MXWL 5I0DA 1YY8A 3ARQA 4U3XA 1OF2A 4NFBA 2EXYC 1PG7X 5GZOC 4NJ9H 1NCAH 1OGTB 1R3LB 1Y6KR 3OKNB 5EBMB 4IOSD 1BOGA 1EA9C 1LD9B 1INDH 2V6HA 4LPWA 1TJGL 5ERWB 3CDGB 4LNVA 3NCJL 1BVKA 4NQXA 4EKXA 3V4VH 5KVFH 5GS0H 5KOVC 4WTXA 1GPOL 3ARGB 4ZPVB 4G80B 2IQ9H 3QAZC 1LEKA 4Z77B 4Z0XB 3RAJL 3F58H 3PGFL 4K23H 5IM7A 3QUXA 3BPOC 3AUVA 3BGFC 2DLGA 4UT6L 1WZLA 3EFFA 4PJ7E 5EN2B 4JKKA 5D72L 3RPIB 4LLDB 2YEZB 3ARBD 3A67L 4DKFL 2CSPA 3GM8A 2EKSB 2ICWJ 1BD2A 2H26A 1RJZA 3ZT6A 1L6ZA 5BO1L 5J8OA 2NY6B 4I3SL 4GQPH 2PNDA 2V5SA 3I6LE 5LGHL 3T0EA 1CF8H 3EYVB 1T3FB 3WHXA 2E5EA 4OCMC 3MNWA 3S5LB 1MRCH 2VUYA 1HIMH 1VADB 1KLGA 3SN6N 3L3DB 1MCDA 3OB0K 3P77A 1A7QL 1RUAH 4PGCA 4JM4L 3MUHL 3SE3C 5FYLD 4MCZA 3FO9B 4YHZL 4YFLF 1T7WA 1U8MB 1F02I 4RWHA 3AM8C 2GSGB 3WUWB 3VFRA 2VIRA 1QTYT 1CTOA