2IJAA

Human n-acetyltransferase 1 f125s mutant
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
292
structure length
292
Chain Sequence
b'SGSDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGSGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylamine N-acetyltransferase 1
publication title The Crystal Structure of Human N-acetyltransferase 1 mutant, F125S
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 292
sequence length 292
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2140.20 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase fold 2ijaA00
4DMOA 2PFRA 2PQTA 2IJAA 3LNBA
chains in the Genus database with same CATH superfamily
1W4TA 2VFCA 4NV8A 4BGFA 2IJAA 4DMOA 1W5RA 2BSZA 2VFBA 4NV7A 3LTWA 1GX3A 4C5PA 2PFRA 2PQTA 4B55A 4GUZA 3LNBA 1W6FA 3D9WA
chains in the Genus database with same CATH topology
4DMOA 2PFRA 2PQTA 2IJAA 3LNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DMO A;  2PFR A;  2PQT A;  2IJA A;  3LNB A; 
#chains in the Genus database with same CATH topology
 1W4T A;  2VFC A;  4NV8 A;  4BGF A;  2IJA A;  4DMO A;  1W5R A;  2BSZ A;  2VFB A;  4NV7 A;  3LTW A;  1GX3 A;  4C5P A;  2PFR A;  2PQT A;  4B55 A;  4GUZ A;  3LNB A;  1W6F A;  3D9W A; 
#chains in the Genus database with same CATH homology
 4DMO A;  2PFR A;  2PQT A;  2IJA A;  3LNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...