2IJIA

Structure of f14h mutant of cole1 rom protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
56
structure length
56
Chain Sequence
GTKQEKTALNMARHIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 27
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijiA00
2IJHA 2IJIA 4DO2A 3K79A 2IJKA 1ROPA 1B6QA 1PD3A 2GHYA 1F4MA 2IJJA 1RPOA 1GTOA 1NKDA 1RPRA 1F4NA 1GMGA
chains in the Genus database with same CATH superfamily
1KUQA 5A2QN 4FZ0A 4PDRA 1N0JA 1M5IA 1YDXA 2Y0IA 4ZOLB 3SGIA 1QLEB 3Q4HA 5H5NA 4H0LB 3HKBB 3LSUA 5LA6A 3AG7A 4H13B 2YS8A 3D3IA 1XHZA 2JJ2G 1HWYA 3N2KA 2ZNIA 2V1DA 3H9VA 3HKEB 3M7MX 3WG7B 4B7KA 3L75H 4CS2A 3ABMC 3ZBHA 2A0LA 5GONB 3SYAA 3SYCA 1FJGB 4QGPA 2YXYA 1JFFA 5KHHA 1PP9H 4X1YA 1FJGO 1AB3A 3U11A 1DGSA 3F5WC 2A3QA 4IGGA 3RYFA 4YXWG 2Z3YA 3K79A 2F93B 4E2LA 3AK3A 1GAXA 3O9OA 3DC5A 1VQ9V 3N2GB 3FAVA 4MS2A 4O4IA 4UV8A 4I7ZB 1R1BA 2E3CA 2EULA 1D5NA 3G6BA 1AJQA 3H1HH 3JCZA 3T1CA 4UB8Z 3CJHB 4OGQB 3G6EV 4I0XB 4X8AA 3WB0A 1SZXA 1KKDA 1I08A 3JD3A 1F4MA 1X4TA 4LBEC 4UCUA 1HP8A 2Q0AA 1SETA 2Y69C 4WFAV 1YTFB 1PL0A 1I5YA 1V55C 2M7WA 2IH1C 5C8YA 3CC7V 1M90W 5IJ9B 3TCUA 4TQFA 4NB5A 2ETNA 1U96A 2JVDA 3D36A 4ICGA 5H6QA 3E35A 3ABTA 3O65A 4LR3A 4DK1A 1Q90D 1TVKA 2QTSA 1NJIW 1R3LC 3OW2U 2F95B 1Y6XA 4QE9A 2NLJC 3QO5A 1IBKB 2P06A 1E1QG 4R8CA 4OPHA 3IGAC 2ATKC 2MW2B 2EIKB 2HJFC 4KHPB 2RCVA 5KUMA 3CB2A 1AVMA 1MA1A 4FFBB 4KHPO 5JCOA 5BMVB 2QDOA 4ZHQB 2UXDB 2GDSA 1BE3H 1OV9A 1N34B 3E22B 4DR5B 1ZX3A 2CH7B 2QM4A 1EZVH 4DR6B 1N34O 1MMMA 5D5PA 1I94B 4DR5O 4KL1A 2IJJA 1RSOA 3T1HB 3OUSA 2EINC 3OFNG 4BIOA 1GN2A 3MAQA 1I94O 4LCUC 1HW7A 3ZHUA 3T1HO 1VP7A 4K0KB 4QE7A 4GZRB 4I50B 2XAJA 4TWKA 3JALA 2KG7A 4K0KO 4K3AA 2KQXA 1K8AW 1OCCC 5FPOA 1W0JG 2LO1A 1GO3F 3B4SA 4OXSA 1BHBA 1VQ4V 2DYRB 2B9ZA 1SQPH 4J11A 4UUJC 4FM0A 5IYCO 1S76D 2ZR2A 1PD3A 3ZRWA 1WA8B 1LUVA 3G67A 4BIUA 4X66B 4IL6Z 5EZYA 4UB6Z 1J95A 3JAKB 1Y66A 1NTZH 1NR7A 3RYIA 2IH3C 4FLUA 4N21A 3RYHA 4X66O 1N32B 4I55A 3B2EE 3JASA 4X1KB 3KZIZ 5EC1C 4LFAB 1NU1H 2ILMA 1DF4A 3ZJZA 2ZIOA 5DM6V 1N32O 4Q6GA 3AG3B 1W0KG 2ZD9A 4LFAO 4MVZA 3FX7A 4DV6B 3H1JH 4JASA 1BCCH 2HVJC 1VEWA 1L1FA 4YJ2B 5DEDA 4FLWA 1URFA 4XDLA 5IYZB 4DV6O 2WSSG 3BAAA 3HKDB 1US6A 4RQEA 2WLHA 4RWUA 4CH3A 4LFBB 5E1AC 5H6RA 2ZE7A 1Q6HA 4JYAB 5GTHZ 1FKAO 1GN6A 3CYOA 3UT5A 4LFBO 3KCXA 1YZBA 4JYAO 2R70A 1SQVH 3OGIB 2DN9A 5CN0A 1YHQV 3RVZA 1HNXB 1RM1C 4JZ2A 1NH2D 2ADQB 5CA1A 2DMXA 3FB6C 1HNXO 1M9NA 4UXNA 2FMLA 5KX5A 2PF4E 3AG4C 2QR4A 2BCCH 5IJ0B 1O9HA 5LP6B 2HVKC 1QLEC 3LNNA 3ABLB 1S77D 5EC2C 4P9OA 3K5OA 3DC6A 4GKJB 3FB8C 3OAAG 1Q81W 2FL4A 4O2BB 3LNMB 4GKJO 1VQOV 4X65B 4IHJB 2GTAA 4UVAA 2XAFA 3L74H 3RYCB 1P7BA 1Q86W 2Q69A 4LNUA 2Y69B 4J7ZA 2QWNB 4IYIA 4LFCB 4O4JB 4X65O 1NS1A 2E5LB 1R73A 1YVWA 2GTSA 4PD4F 3DSQA 5KHIA 1AJNA 4CH4A 1GRJA 1VARA 4JAVA 3ZHTA 4LP8A 4LFCO 3B8MA 2E5LO 2KB1A 5IE9A 4J9YB 4X20B 4UFZA 4J10A 1NVPD 1M57C 3R65A 3F7YC 2X6AA 1ZSPA 2VWKA 2JS5A 3JATB 1K97A 4EKWA 1GKFA 1S0VA 5LOVB 2W6JG 4DK0A 1VQNV 2WLKA 2JGDA 4WFGA 5JH7A 2RQ6A 1B04A 3T1YB 3OR7C 5KUKA 4XDKA 5LMNB 5JWPA 1BQZA 1KC8W 3T1YO 3ETQA 3S3XA 1N0NA 4PELA 5KAFZ 5LMNO 4DUYB 1JA8A 3CCUV 3CC4V 2V7QG 5EYPA 1OJHA 3E86A 1DTOA 1M93A 4KP4A 4DUYO 3ZHVA 1QLNA 5B1OA 2KSDA 4UVCA 1NTKH 3JAWB 1YIJV 5CA0B 2EINB 1R3KC 3K58A 3U0ZA 2YC0A 4EFBA 4D6TH 3X2QC 1F7YA 4PA7A 4PV1B 5GTIZ 2EIKC 2UUAB 3RN4A 2ITCC 3B40A 4O4HB 1XOUA 2PYJA 4I5SA 4KXRA 4DV4B 5LXTA 2PI4A 1XHXA 2UUAO 3K0GA 1Q43A 4CH6A 1VIBA 2CUGA 5CBFA 1J5EB 1Y76B 2LJ2A 3TXQA 3CX5F 5LGTA 1Q82W 2PZSA 4DV4O 1JQ0A 4BR6A 4R7CA 2OTJV 1FXKC 1J5EO 3FB7C 3SPCA 2YIAA 5KHKA 1UPGA 1P4RA 4LF7B 2GSMB 2EIJB 3UM7A 1EBOA 4CC5A 4UCOA 2X6CA 4LWSB 1K4DC 4LF7O 2F1MA 3JAMN 1E79G 2X7RB 4W4KA 3RFRA 1NR1A 4X1IB 1XMOB 3CCVV 4NTWA 5J2UA 2YI8A 1ZWIC 1F23A 3WU2Z 2QM7A 1GK9A 2BTQB 2K1EA 1PL4A 4MVOA 1XMOO 2BOBC 4PDVA 3S3WA 3LUTB 2AZ0A 2DYRC 1ZL8B 3WB2A 3OT7A 3CPWU 2OIEA 1QR8A 2N74A 1EFRG 1NZ6A 2B1GA 1YTFD 1B06A 3BCCH 2PGGA 4NXMB 2WA4A 4JGSA 1CXZB 1JJ2U 1YCIA 3ZMTA 1FFXA 4BW9A 1GN4A 3MDSA 2CTPA 4D7SA 2ZDIA 1PNMA 5HFMA 4NXMO 3DXRB 4MW3A 3P3PA 5LA6B 4TUYA 4WBNA 5JJEB 2JDIG 3N2KB 3P3NA 2W6IG 3TETA 3ZEDA 3BPZA 2M6YA 4J41A 3SPGA 1Y74A 4Z2WA 1BSMA 1MG1A 4NTYA 1IXMA 3CCEV 4X1YB 2EBOA 2D3OW 1I7FA 3L73H 3K59A 4FM1A 1JJOA 3AG4B 4H44B 3FFQA 3PJSK 2EJ7A 1MABG 4HZ3A 1MOFA 3E8GA 1AROP 1VQ5V 1SQGA 4O4IB 2P6JA 1SA0A 4DW0A 2R9AA 4WFEA 2Q5ZA 2CDYA 1CEZA 2HG5C 4TV8A 4DRXA 5EK0A 5BR8B 1EZJA 2DOSA 2ZXWB 3JYCA 5JQGB 4BW5A 1Z5WA 3TXSA 2NR5A 5BR8O 3T2MA 1PKXA 4IYHA 5B1BC 2R9IA 2LGWA 1V9PA 1PNLA 5LP6C 5LGUA 3ABLC 1WPXA 4EFEA 1M57B 2IJIA 3CXHF 2Q0OC 1VF6A 4FFKA 2Q67A 2NNUA 4HNAA 1CP9A 2ZINA 5D5QA 2P67A 2XUMA 3OE7G 1TA8A 3BFRA 1U97A 4TV9B 2QWRB 4X62B 2B5UA 2EJRA 3K03A 2Q4PA 3VQWA 3ML0A 2QWQB 1H2KA 3M99B 1K92A 1KP3A 4X62O 4ZI7B 1YEWA 1MSWD 5GONA 4FLXA 2XHBA 2LP7A 5IT9N 4I4TB 2R9RB 5BXZA 3BHPA 3UKMA 2ZQMA 2VQEB 2EZOA 3E89A 3OEEG 2QE7G 3G71V 1HR0B 4R6ZA 3J81N 3ASNB 4GT1A 3GWKC 2VQEO 2QKCA 1VQ6V 4PHZA 2X6BA 1HR0O 1WPBA 2VRZA 2WLMA 4U7OA 5DN6G 4PA4A 2OWOA 3X2QB 4PA3A 4CC6A 3N2GA 1PV0A 3BA9A 1H8EG 3W7SA 1XL6A 3ZN1A 2BSKB 1IBKO 3C90A 2H3OA 3CJHA 2VS0A 5EIBC 2DQ3A 1KU9A 2LW1A 4GX0A 4I0XA 5LYJB 1NBMG 4PDMA 4DR2B 2KG7B 3K04A 2DYSC 3SYOA 1M56C 4DR2O 3BY6A 4UCRA 3ZS8C 4JI7B 2BTOA 2UXDO 1FXKB 2QM8A 5ITZA 1LR1A 1D5AA 1GM7A 1SC5B 3ZRWB 4JI7O 4GX5A 2P22C 4DR6O 1M1KW 4U3JA 3LDEA 4JF3A 4O4LA 2JIZG 3FKSG 4GX1A 3CSXA 1G6UA 2Y0PA 2ZKOA 1VQ7V 1S5LZ 1VMGA 3JD4A 3SYPA 1MZEA 4JI4B 4P2ZA 2QA4V 2FYUH 1AJPA 1PM9A 2Q6AA 4D7TA 5L3CA 2HP8A 1L8DA 3JARB 4JI4O 1SF9A 2WLLA 3B09A 3ABKB 3OMNB 3K9SA 5EBLC 1K7DA 4YY3B 1VQKV 1MSDA 3L70H 4ZIBA 5BMVA 4YY3O 4ZHQA 2EIJC 2DQ0A 4E4EA 1XI1A 1RP3B 3E22A 1TGOA 1BT8A 2HLDG 1OCRC 2QKAA 4H37A 3RWRD 1V54C 5C93A 2XTAA 3ASOB 4X89A 2YDEA 3TJTA 2ZM6B 4Q20A 1BL8A 4U3FH 1SQXH 3WFVA 3CD6V 2ZM6O 2JRIA 1JX9A 3SJBC 4JYYA 4AQYB 4FZ1A 4IIJA 4O2AB 2OCCC 5H2FZ 5FPRA 4I50A 2VWJA 1AP6A 4J42A 4AQYO 2LQTA 5EIBD 1IURA 4Z1VA 4DV3B 5KHGA 3QO8A 4QPJA 2WWWA 1IX9A 4JAAA 4YHHB 2PI5A 3SPHA 4J80A 2P7TC 1UJWB 1OZ0A 4B3MB 4DV3O 4TSFG 1L0NH 3MHSC 3W7TA 4YHHO 5LHGA 1WA8A 4L87A 4B3MO 1K73W 3CP1A 3JAKA 5IY5B 1NT2B 5L3DA 2E76B 4JTDB 2G38A 5GW7A 2A79B 1G8MA 2WLIB 4X1KA 2YXLA 3UQ8A 1H2LA 2XASA 1FPOA 3VQVA 5B1BB 5LL6Y 5CBHA 2W0XA 3ZMSA 3EHBB 4JYCA 2IJKA 2IU0A 1YSCA 3HB3B 4YJ2A 4UV9A 2YIDA 5IYZA 3LDDA 2YEVA 5K1XA 2ZR3A 4EB6B 2L6LA 4H33A 4FK5C 2PUSA 5KA6A 1YJWV 4G2KA 2JGDB 3CHXA 3FYEB 2QEXV 5JH7B 1GM8A 1FS0G 2ZXWC 4DUZB 1IZ3A 1Y67A 3U10A 3CC2V 3I5DA 4GYCB 2XAQA 4DUZO 2V4DA 4J7KA 1H2SB 2Q73A 4KFMA 1VQPV 1TAEA 1XBLA 3JD1A 5KAIZ 4ZKIA 1XNRB 1GMGA 1RFYA 4P9PA 3D36C 4B3SB 2XAHA 2GBOA 2WPDG 5LBQA 1XNRO 2XAGA 1X59A 2Q7GA 5CB4B 1KQSU 1CPYA 1K4CC 4B3SO 3ETEA 1QHTA 5KA5A 1W2BU 5JJJB 4RUEA 1BQ0A 4RQFA 1YITV 1VQMV 4I9WA 3F5TA 4NTXA 2X0LA 5B5EZ 1Q6UA 2DYSB 4JAUA 1WJZA 4W4LA 1M56B 5JCOC 3LDCA 3CRCA 1QVGU 4XBFA 3E8HA 3AG2C 3RT3C 2AHYA 2YXHA 1HNZB 4JTAB 1GM9A 1WP8A 3E8FA 3GB7C 3ASNC 2E74B 3E2EA 4MSWC 4YIPA 4MT8A 4QIWF 2CTRA 1AI4A 1KP2A 3ZHSA 1F51A 2OT5A 3NXSA 5JVDB 1HNZO 4X20A 3CRMA 4B08A 3ZMZA 2Y48A 1Q8IA 4OX9B 4I9QA 4JI1B 4TOIA 1ZUQA 3JATA 3P32A 1RPOA 3A2FA 4OX9O 2W0FC 2BOCC 4MW8A 4JI1O 2VQFB 2F4VB 2IBZH 5J2UB 1NH2B 1E1RG 2Z0AA 3C3TA 5B66Z 3K9AA 3BEHA 2LFSA 3R66A 4TT3G 2VQFO 5L3BA 1IBLB 2F4VO 2YICA 3OTFA 4DYLA 3HKCB 2GUZB 2H8PC 3J7AU 3CRQA 3STLC 3FYIB 1AR5A 3CCMV 3QVNA 5J2TB 1A32A 4MVRA 4PA6A 2DWDC 3IC7A 2Y4TA 3VOUA 1H2NA 1OCRB 1Q5OA 3SYQA 5K1PA 1V54B 2F66C 2HJDA 1AI5A 3M8AA 3SJCC 4MTOA 2LFRA 4WBNB 2ZE6A 4MTXA 1DLBA 1S5HC 4F6RB 3CMEV 4JI5B 5CBGA 4L8JA 2OCCB 2EILB 1Y74B 3ABKC 1AR1B 3CS5A 4C7UA 2XNDG 3LSQA 1TUBB 4JI5O 4LF6B 2YSUB 4O4HA 4HYOA 5IYBO 2UU9B 4YJ3B 5DECA 1ZTEA 1WP7A 2QJ1A 1ROPA 3L71H 3P30A 1KECA 1WAZA 3MHHC 1KD1W 4LF6O 2XOKG 1FAFA 2UU9O 1Y76A 1B6QA 5LMUB 3Q4HB 4WF9V 3AG1C 5HFLA 3SPJA 2P90A 3ASOC 4K35A 5H9CA 4LF4B 1SQBH 5LMUO 1JOYA 4DXWA 4ZBMA 2IU3A 3AEIA 2D2CB 1KBHA 4DV7B 4LF4O 1IVSA 2CK3G 1JFFB 3EVKA 4DV7O 1BS3A 4X1IA 1P84F 3A0RA 1JR9A 1XILA 3MD0A 4WFHA 4NVPA 2BTQA 3RW0A 2PY5A 3RYFB 1HNWB 3SPIA 3KCYA 3KG2A 1EN6A 2GV9A 3FAVB 3FB5C 1HNWO 3N27A 4HAMA 3OTOB 4PDLA 4HNAB 1H8HG 3KKYA 5KMGA 2Z5UA 1SKVA 2ZCEA 1KMIZ 1MNGA 3DXRA 5IY5C 1Z2GA 3IJ4A 3UO3A 5KLVH 3OTOO 1QNMA 1XNQB 4CS3A 2KKWA 2CTQA 1QQCA 5IWAB 1VF7A 4BAYA 2OYQA 3ZN0A 5BY1A 1XNQO 5C8YB 5FNVA 5BZBA 2DJVA 5IWAO 1FXHA 1R6TA 2FKXA 2WLNA 5B3SB 1VQLV 1K34A 3UO2A 4AILC 3ZRVA 3G80A 4PJ0Z 5F2VO 3J80N 4RO2A 4BIZA 2DE0X 4ZOLA 2Q68A 1TVKB 3HKBA 1PNKA 1IXBA 4WFFA 1K5SA 1XUQA 1K5QA 1JMKC 4UVBA 3D8CA 3QNEA 4GCZA 3HKEA 2QTOA 4UCSA 5L3GA 1M4UA 3CWBH 4WFBV 1K3EA 2L35A 2ZE5A 3BA8A 5JQGA 3ETGA 3OEHG 3VQXA 3ZMUA 4DR1B 2PTMA 3AG2B 2E75B 3HR0A 1NQTA 4DR1O 3GVMA 3PN1A 5ITZB 4PI2A 1RSOB 4IT5A 2F23A 3L72H 3OD4A 1OHHG 2ZE8A 4U3JB 5FLXN 2JS3A 3ZRSA 4O4LB 3APOA 4JI3B 1ENVA 3JD2A 3VBBA 2IM9A 2Q9LA 3K06A 2CAZC 3JALB 4QPKA 2HFEC 4G28B 1VF5B 4JI3O 4TV9A 3I55V 4F6EA 1TUEB 3THOA 2WLLB 3QTCA 1N4CA 4MVQA 5B1AB 1VQ8V 3CCJV 4X9QA 1EN5A 1JPXA 4X64B 4ZI7A 3K0DA 3CCSV 2A06H 1B3QA 3K5LA 5IJ9A 2EIMB 4GLXA 1DK1A 2EZPA 1DF5A 4I4TA 2FTKA 1BZKA 4X64O 5EZYB 1AI6A 2UXXA 3RYIB 4AHCA 2JJ1G 3RYHB 5E79Z 4I55B 3JASB 3ZHQA 1QBZA 4RUFA 1N36B 3JD0A 1EN4A 1K33A 1EM1A 4A5UB 1KYOF 3RGBA 3CCRV 1N36O 2LW7A 3ZX6A 3B8NA 4IIJB 2BSKA 4RAIA 4FM2A 1WB7A 1SESA 5LYJA 5AG2A 3B77A 2CGNA 2YUAA 1RPRA 3IC9A 4MVMA 4FFBA 1R6NA 1PPJH 1SS3A 5L3EA 2LGQA 4YIOA 3AG1B 2JK5C 3TK1A 2CH7A 1H2MA 2JGUA 4K8ZA 2ZDIC 3CCQV 1FXKA 3G4SV 1S5JA 2QKSA 3HPLC 2AHZA 4TQDA 3UT5B 1BMFG 1WNSA 1OCZC 3ZCCA 3T4DA 4CBCA 2BE3A 1WN7A 2IJHA 1FD9A 4U7NA 4N23A 3I56V 2N05A 1AR4A 2EILC 3DTUB 5CA1B 1OCOB 2OIGA 2P5OA 3AK1A 3K3WA 3STZC 4UCTA 5JJNB 2EX3A 1R6KA 3JSLA 3JARA 5CMUA 5KX5B 3TGUH 3K5MA 1COWG 2ZIMA 4GX2A 1S3JA 3UCSC 3QF7A 4BWAA 2GHYA 2K9PA 3OR6C 2YEVB 4FJCC 4MTGA 3W7XA 4LH6A 3EXAA 5IDJA 3H1KH 4DV5B 1BGYH 2YIBD 2ZT9B 2UXNA 3CE2A 1AILA 3CXCU 4DV5O 4LNUB 3AK2A 4LH7A 3BVOA 4DV2B 1NKDA 1ZAUA 2HR3A 3H1LH 1Q7YW 3ABMB 2F43G 4O2AA 4DV2O 1N33B 1K9MW 3F7VC 5CA3A 1ZLZA 1G4YB 3A0BZ 2OTLV 1N33O 1XDCA 1NI8A 4NYKA 3HKDA 4GUNA 3L9DA 1VF6C 5B1NA 1XREA 4QNHB 2WLJA 1GTOA 4DR7B 3QO7A 2Q7HA 3NR7A 1WLEA 4FLYA 2UUCB 4JYBA 5KHJA 5EBMC 1SQFA 4DR7O 4J7JA 2UUBB 2DWEC 1SQQH 2RMKB 2UUCO 1D2DA 1FFTB 4P30A 1YJNV 1Q6IA 4JI6B 1P49A 1XL4A 2UUBO 3WG7C 1ORQC 4DW1A 3K5NA 4LC1A 1F4NA 3W7WA 4FMTA 3D3QA 1H38A 4JI6O 5EYPB 5B3SC 4DR4B 2HHHB 2WLIA 2JEXA 1FXVA 3ZMVA 3E8BA 3JCUZ 3ZHRA 2Y4UA 1V55B 3JSNA 3VQYA 2ARHA 3CRRA 1KKCA 3A8TA 4FPPA 4DR4O 4WCEV 2HHHO 1N8RW 2B1IA 4XDJA 5IJ0A 5LP6A 1YJ9V 4LF9B 1L0LH 1IBMB 4FLVA 4FLTA 2ZNJA 3SJAC 1W59A 2P4VA 1Y4MA 2UXCB 4LF9O 3CEIA 3K08A 1XEQA 1XMQB 2C2AA 4EB6A 1IBMO 4O2BA 2AZ2A 4PI0A 4F4LA 2WA3A 1R3IC 3IFXA 3ZIAG 2UXCO 3RBZA 1QR9A 3EFFK 4IHJA 5EBWC 5LXTB 3QG5A 5LHIA 1XMQO 1I5XA 3BRCA 2OCHA 3ETDA 3RYCA 2QWOB 4JV5B 2P4KA 4O4JA 2A7WA 2AW9A 1I0HA 2DW4A 4MTFA 4OPAA 3ZRXA 4JI2B 3H1IH 2Q8VA 1GN3A 4NKGB 1P7GA 3OM3B 3OUFA 4JV5O 4UCVA 2UXBB 1R3JC 2O57A 1GH6A 4JI2O 1AP5A 2RDCA 3CRAA 2QSAA 2UXBO 3C3SA 3DGEA 1S72V 5LOVA 3LSSA 4MVSA 4FVMA 1YF2A 4LF5B 5CB4A 1G1XB 4FLZA 4AI8A 4DV0B 4MVUA 3OMIB 2RNBA 2QGNA 1UFIA 4LF5O 4LF8B 2XT9A 1T5EA 2HKOA 4DV0O 1SZTA 5B1AC 4KUMA 1WB8A 2IW5A 1HDJA 1Z5VA 4LF8O 4B3TB 1IBLO 4CH5A 4JI8B 1OCCB 2EIMC 2ITDC 2WAMA 2Q7EA 5J9PC 1FFXB 4R50A 5A9GA 4B3TO 1KB9F 3WB1A 2N04A 4JI8O 1YXBA 4K8XA 1AI7A 1SERA 1LNQA 4TUYB 3JAWA 1OCZB 5CA0A 1QVFU 2YIBA 4ASUG 1H2GA 5JVDA 3CMAV 4ABMA 1SRYA 4X88A 5L3FA 5LGNA 4NR1A 5TISZ 3E83A 1Q3EA 3APQA 2HEPA 4Z1MG 2PYLA 1O9GA 2RJZA 3FD9A 5IYDO 4B7EA 4JZGA 3OMAB 1IDSA 3ICXA 4JTCB 4QJFB 5LHHA 2NN4A 3GWOA 4GKKB 2H94A 4NXNB 1NVPB 2RN9A 2ADPA 1NTMH 1YI2V 3RVYA 2CTWA 1XQ8A 2JEUA 3HKCA 4CZZA 2GUZA 2QWPB 4PA9A 3SR2C 4GKKO 2MK3A 4G27B 4NXNO 3ABUA 3CCLV 4JI0B 5J2TA 3W7UA 1LUWA 4EEQA 2FB5A 4B3RB 1SA0B 1JVMA 4FIPC 5KMGB 1THZA 4JI0O 4DO2A 4LWSA 2YI9A 4TV8B 4DRXB 3SDLA 1JCHA 2R72A 4B3RO 2AGAA 4DR3B 1OCOC 3IAYA 2A9HA 4F6RA 1FYJA 3H01A 3T4ZA 4CS4A 3BABA 3SJQC 4J9ZB 4DR3O 5FNVB 3AG3C 2CGOA 1MZFA 1QU7A 1RM1B 3OGCC 4HBNA 2CE4A 1BHAA 3K57A 3A0HZ 4JPRA 4DV1B 1TUBA 2ODMA 1QCEA 1ZL8A 4YJ3A 5FL7G 2AXTZ 4DV1O
chains in the Genus database with same CATH topology
4JTDB 1JPXA 4PDRA 5GW7A 2A79B 1G8MA 3K0DA 3CCSV 3X2QC 2WLIB 1R3KC 2XASA 2EIMB 4PA7A 1QLEB 2EZPA 1DF5A 2EIKC 2FTKA 5B1BB 2ITCC 5CBHA 3D3IA 1AI6A 3ZMSA 2JJ2G 1HWYA 2UXXA 3EHBB 4I5SA 2V1DA 2PI4A 4JYCA 2IJKA 2JJ1G 3K0GA 3WG7B 2IU0A 1YSCA 3HB3B 5CBFA 4UV9A 1Q82W 1QBZA 3ABMC 4RUFA 5LGTA 2A0LA 3SYAA 3LDDA 3JD0A 3SYCA 1JQ0A 2YEVA 4R7CA 2ZR3A 1K33A 2OTJV 1FXKC 3FB7C 4H33A 3SPCA 4FK5C 3CCRV 5KA6A 1YJWV 4G2KA 1P4RA 3B8NA 3FYEB 2QEXV 3F5WC 4RAIA 2GSMB 2EIJB 3UM7A 1EBOA 1SESA 1GM8A 3B77A 1FS0G 2ZXWC 2X6CA 1RPRA 1K4DC 4MVMA 4YXWG 1R6NA 2Z3YA 3K79A 5L3EA 3CC2V 4E2LA 2XAQA 1E79G 2X7RB 1VQ9V 1NR1A 4MS2A 3AG1B 4UV8A 2JK5C 3TK1A 3CCVV 4KFMA 1VQPV 1AJQA 3JCZA 1ZWIC 2ZDIC 1FXKA 3T1CA 3JD1A 4ZKIA 3G4SV 3CCQV 1F23A 2QKSA 3G6EV 2QM7A 1GK9A 3HPLC 2AHZA 2K1EA 1GMGA 4X8AA 1BMFG 4MVOA 1KKDA 4P9PA 1OCZC 2BOBC 3ZCCA 4PDVA 3JD3A 1F4MA 2XAHA 3T4DA 4CBCA 3LUTB 2IJHA 2WPDG 5LBQA 2DYRC 4U7NA 2XAGA 4N23A 3CPWU 4LBEC 1QR8A 3I56V 1EFRG 1SETA 1KQSU 1CPYA 2Y69C 1K4CC 2B1GA 1YTFD 4WFAV 2EILC 1PL0A 1YTFB 1I5YA 4JGSA 1V55C 3ETEA 2M7WA 1JJ2U 2IH1C 3DTUB 5KA5A 1W2BU 3ZMTA 1OCOB 3CC7V 1M90W 3K3WA 4RUEA 2ZDIA 3TCUA 1PNMA 3STZC 5HFMA 4RQFA 1YITV 1VQMV 4MW3A 4I9WA 1R6KA 5CMUA 3D36A 5H6QA 2X0LA 2JDIG 3E35A 2DYSB 4JAUA 2W6IG 3TETA 3ABTA 1COWG 1M56B 3LDCA 4GX2A 1QVGU 1S3JA 4XBFA 1NJIW 3E8HA 3SPGA 1R3LC 3OW2U 2GHYA 3AG2C 3OR6C 4QE9A 2NLJC 2YEVB 2AHYA 3QO5A 4JTAB 4FJCC 1MG1A 4MTGA 1E1QG 1GM9A 3E8FA 1IXMA 3GB7C 3ASNC 4R8CA 3W7XA 3E2EA 4MSWC 5IDJA 3IGAC 2ATKC 4MT8A 4QIWF 3CCEV 2EBOA 2EIKB 1AI4A 2D3OW 1KP2A 2HJFC 1F51A 5KUMA 2OT5A 3NXSA 2UXNA 3ZMZA 3AG4B 3CXCU 2Y48A 3PJSK 1MABG 1NKDA 2HR3A 4HZ3A 1MOFA 3E8GA 1Q7YW 3ABMB 3P32A 1RPOA 1AROP 2F43G 2W0FC 1VQ5V 2BOCC 4MW8A 2P6JA 1K9MW 3F7VC 5CA3A 1NH2B 1E1RG 4WFEA 1CEZA 1G4YB 2HG5C 3K9AA 3BEHA 2LFSA 2IJJA 2OTLV 4TT3G 5EK0A 5L3BA 1EZJA 3OUSA 2EINC 2H8PC 2ZXWB 3JYCA 5B1NA 4QNHB 2WLJA 3OFNG 1GTOA 3QO7A 3STLC 3FYIB 4BW5A 3CCMV 1WLEA 4LCUC 4MVRA 4PA6A 2DWDC 4JYBA 3IC7A 4QE7A 5EBMC 3T2MA 1PKXA 5B1BC 2XAJA 4TWKA 2R9IA 3VOUA 2DWEC 1OCRB 3SYQA 1V54B 1FFTB 4P30A 1PNLA 1K8AW 1OCCC 5LGUA 1YJNV 1AI5A 1W0JG 3ABLC 1WPXA 1GO3F 2IJIA 1M57B 1XL4A 4MTOA 2LFRA 4OXSA 3WG7C 1ORQC 1BHBA 4LC1A 1DLBA 1F4NA 1S5HC 4MTXA 3W7WA 1VQ4V 4FMTA 3CMEV 2DYRB 2Q67A 1H38A 2NNUA 1CP9A 5B3SC 4UUJC 5CBGA 2WLIA 2P67A 2JEXA 1FXVA 3ZMVA 2OCCB 3E8BA 5IYCO 2ZR2A 1PD3A 2EILB 3ZRWA 1S76D 3ABKC 1AR1B 1V55B 3OE7G 2XNDG 3LSQA 4BIUA 4FPPA 4WCEV 2YSUB 4HYOA 2B5UA 5IYBO 1N8RW 2B1IA 2EJRA 3K03A 1J95A 4XDJA 1Y66A 1NR7A 2IH3C 3ML0A 1YJ9V 1ROPA 3P30A 1KECA 1KD1W 3M99B 3MHHC 4N21A 1K92A 1KP3A 2XOKG 1MSWD 1B6QA 5EC1C 1Y4MA 1DF4A 2LP7A 3ZJZA 5DM6V 4WF9V 3AG1C 2R9RB 3K08A 2C2AA 5HFLA 3UKMA 2ZQMA 3AG3B 3SPJA 1W0KG 2P90A 3ASOC 2ZD9A 4F4LA 1R3IC 2EZOA 3IFXA 4MVZA 5H9CA 3ZIAG 3E89A 3OEEG 2QE7G 1QR9A 3EFFK 4R6ZA 5EBWC 3RBZA 3G71V 1JOYA 5LHIA 1I5XA 3ASNB 4DXWA 4ZBMA 4GT1A 2IU3A 3ETDA 2HVJC 4JASA 3AEIA 1L1FA 1VQ6V 4XDLA 2X6BA 2DW4A 4MTFA 2WLMA 4U7OA 3ZRXA 2WSSG 5DN6G 2CK3G 4PA4A 3X2QB 3OM3B 4RQEA 3OUFA 2WLHA 4PA3A 5E1AC 5H6RA 1R3JC 1H8EG 3W7SA 1XL6A 3ZN1A 3A0RA 3MD0A 4WFHA 2DQ3A 3CYOA 4GX0A 1NBMG 3RW0A 4PDMA 3K04A 2DYSC 3SPIA 3DGEA 3SYOA 1S72V 3KG2A 1M56C 3LSSA 4MVSA 3BY6A 5CN0A 1YHQV 3RVZA 1RM1C 3FB5C 1NH2D 4MVUA 4HAMA 1FXKB 3OMIB 4PDLA 2QM8A 1H8HG 2Z5UA 3FB6C 1GM7A 3ZRWB 5IY5C 2HKOA 1M9NA 4GX5A 1SZTA 5B1AC 4KUMA 2IW5A 4UXNA 1M1KW 3AG4C 3LDEA 4JF3A 2JIZG 3FKSG 4GX1A 1OCCB 2EIMC 4BAYA 1VQ7V 2HVKC 1QLEC 2ITDC 3ABLB 3ZN0A 1S77D 5EC2C 2WAMA 3JD4A 3SYPA 5BZBA 4P9OA 4P2ZA 5J9PC 2QA4V 4R50A 1AJPA 1FXHA 2WLNA 2Q6AA 3FB8C 3OAAG 5L3CA 1Q81W 5B3SB 1AI7A 1SERA 1VQLV 1K34A 1LNQA 2WLLA 1OCZB 3ABKB 3OMNB 3LNMB 5EBLC 1VQOV 1QVFU 4ASUG 1K7DA 1H2GA 4UVAA 3ZRVA 3CMAV 2XAFA 1SRYA 4RO2A 4X88A 1VQKV 4BIZA 1P7BA 5L3FA 1Q86W 5LGNA 2Q69A 2Q68A 2Y69B 3E83A 1R73A 1PNKA 4WFFA 1K5SA 1AJNA 2EIJC 2DQ0A 1K5QA 4Z1MG 4UVBA 4JAVA 4LP8A 2HLDG 5IYDO 3B8MA 1OCRC 3QNEA 4GCZA 3OMAB 4H37A 2KB1A 1V54C 2QTOA 5C93A 4J9YB 3ASOB 4X89A 4JTCB 4QJFB 5LHHA 3GWOA 1NVPD 2H94A 1NVPB 1M57C 3R65A 3F7YC 4Q20A 5L3GA 1BL8A 1YI2V 3RVYA 2JEUA 4WFBV 4CZZA 2X6AA 1K3EA 4PA9A 3WFVA 3CD6V 3ETGA 1K97A 3OEHG 3ZMUA 4EKWA 1GKFA 2MK3A 4G27B 1S0VA 2W6JG 3ABUA 1VQNV 3CCLV 3AG2B 2WLKA 1JX9A 4WFGA 3W7UA 2OCCC 1JVMA 1NQTA 3OR7C 4FIPC 5KUKA 1THZA 4XDKA 4DO2A 1JCHA 1KC8W 1OHHG 4PELA 1OCOC 3ZRSA 3QO8A 2A9HA 4QPJA 2WWWA 3H01A 3T4ZA 2PI5A 3CCUV 3SPHA 3CC4V 1ENVA 2V7QG 3SJQC 3JD2A 3VBBA 4J9ZB 3E86A 2P7TC 1DTOA 1UJWB 3AG3C 1OZ0A 3K06A 4KP4A 4TSFG 1RM1B 3MHSC 1QLNA 3OGCC 4QPKA 1BHAA 3W7TA 2HFEC 5LHGA 4G28B 4JPRA 4L87A 1QCEA 5B1OA 3I55V 4UVCA 1K73W 1TUEB 3CP1A 2WLLB 5FL7G 5IY5B 4MVQA 1YIJV 5B1AB 5L3DA 2EINB 1VQ8V 3CCJV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJH A;  2IJI A;  4DO2 A;  3K79 A;  2IJK A;  1ROP A;  1B6Q A;  1PD3 A;  2GHY A;  1F4M A;  2IJJ A;  1RPO A;  1GTO A;  1NKD A;  1RPR A;  1F4N A;  1GMG A; 
#chains in the Genus database with same CATH topology
 1KUQ A;  5A2Q N;  4FZ0 A;  4PDR A;  1N0J A;  1M5I A;  1YDX A;  2Y0I A;  4ZOL B;  3SGI A;  1QLE B;  3Q4H A;  5H5N A;  4H0L B;  3HKB B;  3LSU A;  5LA6 A;  3AG7 A;  4H13 B;  2YS8 A;  3D3I A;  1XHZ A;  2JJ2 G;  1HWY A;  3N2K A;  2ZNI A;  2V1D A;  3H9V A;  3HKE B;  3M7M X;  3WG7 B;  4B7K A;  3L75 H;  4CS2 A;  3ABM C;  3ZBH A;  2A0L A;  5GON B;  3SYA A;  3SYC A;  1FJG B;  4QGP A;  2YXY A;  1JFF A;  5KHH A;  1PP9 H;  4X1Y A;  1FJG O;  1AB3 A;  3U11 A;  1DGS A;  3F5W C;  2A3Q A;  4IGG A;  3RYF A;  4YXW G;  2Z3Y A;  3K79 A;  2F93 B;  4E2L A;  3AK3 A;  1GAX A;  3O9O A;  3DC5 A;  1VQ9 V;  3N2G B;  3FAV A;  4MS2 A;  4O4I A;  4UV8 A;  4I7Z B;  1R1B A;  2E3C A;  2EUL A;  1D5N A;  3G6B A;  1AJQ A;  3H1H H;  3JCZ A;  3T1C A;  4UB8 Z;  3CJH B;  4OGQ B;  3G6E V;  4I0X B;  4X8A A;  3WB0 A;  1SZX A;  1KKD A;  1I08 A;  3JD3 A;  1F4M A;  1X4T A;  4LBE C;  4UCU A;  1HP8 A;  2Q0A A;  1SET A;  2Y69 C;  4WFA V;  1YTF B;  1PL0 A;  1I5Y A;  1V55 C;  2M7W A;  2IH1 C;  5C8Y A;  3CC7 V;  1M90 W;  5IJ9 B;  3TCU A;  4TQF A;  4NB5 A;  2ETN A;  1U96 A;  2JVD A;  3D36 A;  4ICG A;  5H6Q A;  3E35 A;  3ABT A;  3O65 A;  4LR3 A;  4DK1 A;  1Q90 D;  1TVK A;  2QTS A;  1NJI W;  1R3L C;  3OW2 U;  2F95 B;  1Y6X A;  4QE9 A;  2NLJ C;  3QO5 A;  1IBK B;  2P06 A;  1E1Q G;  4R8C A;  4OPH A;  3IGA C;  2ATK C;  2MW2 B;  2EIK B;  2HJF C;  4KHP B;  2RCV A;  5KUM A;  3CB2 A;  1AVM A;  1MA1 A;  4FFB B;  4KHP O;  5JCO A;  5BMV B;  2QDO A;  4ZHQ B;  2UXD B;  2GDS A;  1BE3 H;  1OV9 A;  1N34 B;  3E22 B;  4DR5 B;  1ZX3 A;  2CH7 B;  2QM4 A;  1EZV H;  4DR6 B;  1N34 O;  1MMM A;  5D5P A;  1I94 B;  4DR5 O;  4KL1 A;  2IJJ A;  1RSO A;  3T1H B;  3OUS A;  2EIN C;  3OFN G;  4BIO A;  1GN2 A;  3MAQ A;  1I94 O;  4LCU C;  1HW7 A;  3ZHU A;  3T1H O;  1VP7 A;  4K0K B;  4QE7 A;  4GZR B;  4I50 B;  2XAJ A;  4TWK A;  3JAL A;  2KG7 A;  4K0K O;  4K3A A;  2KQX A;  1K8A W;  1OCC C;  5FPO A;  1W0J G;  2LO1 A;  1GO3 F;  3B4S A;  4OXS A;  1BHB A;  1VQ4 V;  2DYR B;  2B9Z A;  1SQP H;  4J11 A;  4UUJ C;  4FM0 A;  5IYC O;  1S76 D;  2ZR2 A;  1PD3 A;  3ZRW A;  1WA8 B;  1LUV A;  3G67 A;  4BIU A;  4X66 B;  4IL6 Z;  5EZY A;  4UB6 Z;  1J95 A;  3JAK B;  1Y66 A;  1NTZ H;  1NR7 A;  3RYI A;  2IH3 C;  4FLU A;  4N21 A;  3RYH A;  4X66 O;  1N32 B;  4I55 A;  3B2E E;  3JAS A;  4X1K B;  3KZI Z;  5EC1 C;  4LFA B;  1NU1 H;  2ILM A;  1DF4 A;  3ZJZ A;  2ZIO A;  5DM6 V;  1N32 O;  4Q6G A;  3AG3 B;  1W0K G;  2ZD9 A;  4LFA O;  4MVZ A;  3FX7 A;  4DV6 B;  3H1J H;  4JAS A;  1BCC H;  2HVJ C;  1VEW A;  1L1F A;  4YJ2 B;  5DED A;  4FLW A;  1URF A;  4XDL A;  5IYZ B;  4DV6 O;  2WSS G;  3BAA A;  3HKD B;  1US6 A;  4RQE A;  2WLH A;  4RWU A;  4CH3 A;  4LFB B;  5E1A C;  5H6R A;  2ZE7 A;  1Q6H A;  4JYA B;  5GTH Z;  1FKA O;  1GN6 A;  3CYO A;  3UT5 A;  4LFB O;  3KCX A;  1YZB A;  4JYA O;  2R70 A;  1SQV H;  3OGI B;  2DN9 A;  5CN0 A;  1YHQ V;  3RVZ A;  1HNX B;  1RM1 C;  4JZ2 A;  1NH2 D;  2ADQ B;  5CA1 A;  2DMX A;  3FB6 C;  1HNX O;  1M9N A;  4UXN A;  2FML A;  5KX5 A;  2PF4 E;  3AG4 C;  2QR4 A;  2BCC H;  5IJ0 B;  1O9H A;  5LP6 B;  2HVK C;  1QLE C;  3LNN A;  3ABL B;  1S77 D;  5EC2 C;  4P9O A;  3K5O A;  3DC6 A;  4GKJ B;  3FB8 C;  3OAA G;  1Q81 W;  2FL4 A;  4O2B B;  3LNM B;  4GKJ O;  1VQO V;  4X65 B;  4IHJ B;  2GTA A;  4UVA A;  2XAF A;  3L74 H;  3RYC B;  1P7B A;  1Q86 W;  2Q69 A;  4LNU A;  2Y69 B;  4J7Z A;  2QWN B;  4IYI A;  4LFC B;  4O4J B;  4X65 O;  1NS1 A;  2E5L B;  1R73 A;  1YVW A;  2GTS A;  4PD4 F;  3DSQ A;  5KHI A;  1AJN A;  4CH4 A;  1GRJ A;  1VAR A;  4JAV A;  3ZHT A;  4LP8 A;  4LFC O;  3B8M A;  2E5L O;  2KB1 A;  5IE9 A;  4J9Y B;  4X20 B;  4UFZ A;  4J10 A;  1NVP D;  1M57 C;  3R65 A;  3F7Y C;  2X6A A;  1ZSP A;  2VWK A;  2JS5 A;  3JAT B;  1K97 A;  4EKW A;  1GKF A;  1S0V A;  5LOV B;  2W6J G;  4DK0 A;  1VQN V;  2WLK A;  2JGD A;  4WFG A;  5JH7 A;  2RQ6 A;  1B04 A;  3T1Y B;  3OR7 C;  5KUK A;  4XDK A;  5LMN B;  5JWP A;  1BQZ A;  1KC8 W;  3T1Y O;  3ETQ A;  3S3X A;  1N0N A;  4PEL A;  5KAF Z;  5LMN O;  4DUY B;  1JA8 A;  3CCU V;  3CC4 V;  2V7Q G;  5EYP A;  1OJH A;  3E86 A;  1DTO A;  1M93 A;  4KP4 A;  4DUY O;  3ZHV A;  1QLN A;  5B1O A;  2KSD A;  4UVC A;  1NTK H;  3JAW B;  1YIJ V;  5CA0 B;  2EIN B;  1R3K C;  3K58 A;  3U0Z A;  2YC0 A;  4EFB A;  4D6T H;  3X2Q C;  1F7Y A;  4PA7 A;  4PV1 B;  5GTI Z;  2EIK C;  2UUA B;  3RN4 A;  2ITC C;  3B40 A;  4O4H B;  1XOU A;  2PYJ A;  4I5S A;  4KXR A;  4DV4 B;  5LXT A;  2PI4 A;  1XHX A;  2UUA O;  3K0G A;  1Q43 A;  4CH6 A;  1VIB A;  2CUG A;  5CBF A;  1J5E B;  1Y76 B;  2LJ2 A;  3TXQ A;  3CX5 F;  5LGT A;  1Q82 W;  2PZS A;  4DV4 O;  1JQ0 A;  4BR6 A;  4R7C A;  2OTJ V;  1FXK C;  1J5E O;  3FB7 C;  3SPC A;  2YIA A;  5KHK A;  1UPG A;  1P4R A;  4LF7 B;  2GSM B;  2EIJ B;  3UM7 A;  1EBO A;  4CC5 A;  4UCO A;  2X6C A;  4LWS B;  1K4D C;  4LF7 O;  2F1M A;  3JAM N;  1E79 G;  2X7R B;  4W4K A;  3RFR A;  1NR1 A;  4X1I B;  1XMO B;  3CCV V;  4NTW A;  5J2U A;  2YI8 A;  1ZWI C;  1F23 A;  3WU2 Z;  2QM7 A;  1GK9 A;  2BTQ B;  2K1E A;  1PL4 A;  4MVO A;  1XMO O;  2BOB C;  4PDV A;  3S3W A;  3LUT B;  2AZ0 A;  2DYR C;  1ZL8 B;  3WB2 A;  3OT7 A;  3CPW U;  2OIE A;  1QR8 A;  2N74 A;  1EFR G;  1NZ6 A;  2B1G A;  1YTF D;  1B06 A;  3BCC H;  2PGG A;  4NXM B;  2WA4 A;  4JGS A;  1CXZ B;  1JJ2 U;  1YCI A;  3ZMT A;  1FFX A;  4BW9 A;  1GN4 A;  3MDS A;  2CTP A;  4D7S A;  2ZDI A;  1PNM A;  5HFM A;  4NXM O;  3DXR B;  4MW3 A;  3P3P A;  5LA6 B;  4TUY A;  4WBN A;  5JJE B;  2JDI G;  3N2K B;  3P3N A;  2W6I G;  3TET A;  3ZED A;  3BPZ A;  2M6Y A;  4J41 A;  3SPG A;  1Y74 A;  4Z2W A;  1BSM A;  1MG1 A;  4NTY A;  1IXM A;  3CCE V;  4X1Y B;  2EBO A;  2D3O W;  1I7F A;  3L73 H;  3K59 A;  4FM1 A;  1JJO A;  3AG4 B;  4H44 B;  3FFQ A;  3PJS K;  2EJ7 A;  1MAB G;  4HZ3 A;  1MOF A;  3E8G A;  1ARO P;  1VQ5 V;  1SQG A;  4O4I B;  2P6J A;  1SA0 A;  4DW0 A;  2R9A A;  4WFE A;  2Q5Z A;  2CDY A;  1CEZ A;  2HG5 C;  4TV8 A;  4DRX A;  5EK0 A;  5BR8 B;  1EZJ A;  2DOS A;  2ZXW B;  3JYC A;  5JQG B;  4BW5 A;  1Z5W A;  3TXS A;  2NR5 A;  5BR8 O;  3T2M A;  1PKX A;  4IYH A;  5B1B C;  2R9I A;  2LGW A;  1V9P A;  1PNL A;  5LP6 C;  5LGU A;  3ABL C;  1WPX A;  4EFE A;  1M57 B;  2IJI A;  3CXH F;  2Q0O C;  1VF6 A;  4FFK A;  2Q67 A;  2NNU A;  4HNA A;  1CP9 A;  2ZIN A;  5D5Q A;  2P67 A;  2XUM A;  3OE7 G;  1TA8 A;  3BFR A;  1U97 A;  4TV9 B;  2QWR B;  4X62 B;  2B5U A;  2EJR A;  3K03 A;  2Q4P A;  3VQW A;  3ML0 A;  2QWQ B;  1H2K A;  3M99 B;  1K92 A;  1KP3 A;  4X62 O;  4ZI7 B;  1YEW A;  1MSW D;  5GON A;  4FLX A;  2XHB A;  2LP7 A;  5IT9 N;  4I4T B;  2R9R B;  5BXZ A;  3BHP A;  3UKM A;  2ZQM A;  2VQE B;  2EZO A;  3E89 A;  3OEE G;  2QE7 G;  3G71 V;  1HR0 B;  4R6Z A;  3J81 N;  3ASN B;  4GT1 A;  3GWK C;  2VQE O;  2QKC A;  1VQ6 V;  4PHZ A;  2X6B A;  1HR0 O;  1WPB A;  2VRZ A;  2WLM A;  4U7O A;  5DN6 G;  4PA4 A;  2OWO A;  3X2Q B;  4PA3 A;  4CC6 A;  3N2G A;  1PV0 A;  3BA9 A;  1H8E G;  3W7S A;  1XL6 A;  3ZN1 A;  2BSK B;  1IBK O;  3C90 A;  2H3O A;  3CJH A;  2VS0 A;  5EIB C;  2DQ3 A;  1KU9 A;  2LW1 A;  4GX0 A;  4I0X A;  5LYJ B;  1NBM G;  4PDM A;  4DR2 B;  2KG7 B;  3K04 A;  2DYS C;  3SYO A;  1M56 C;  4DR2 O;  3BY6 A;  4UCR A;  3ZS8 C;  4JI7 B;  2BTO A;  2UXD O;  1FXK B;  2QM8 A;  5ITZ A;  1LR1 A;  1D5A A;  1GM7 A;  1SC5 B;  3ZRW B;  4JI7 O;  4GX5 A;  2P22 C;  4DR6 O;  1M1K W;  4U3J A;  3LDE A;  4JF3 A;  4O4L A;  2JIZ G;  3FKS G;  4GX1 A;  3CSX A;  1G6U A;  2Y0P A;  2ZKO A;  1VQ7 V;  1S5L Z;  1VMG A;  3JD4 A;  3SYP A;  1MZE A;  4JI4 B;  4P2Z A;  2QA4 V;  2FYU H;  1AJP A;  1PM9 A;  2Q6A A;  4D7T A;  5L3C A;  2HP8 A;  1L8D A;  3JAR B;  4JI4 O;  1SF9 A;  2WLL A;  3B09 A;  3ABK B;  3OMN B;  3K9S A;  5EBL C;  1K7D A;  4YY3 B;  1VQK V;  1MSD A;  3L70 H;  4ZIB A;  5BMV A;  4YY3 O;  4ZHQ A;  2EIJ C;  2DQ0 A;  4E4E A;  1XI1 A;  1RP3 B;  3E22 A;  1TGO A;  1BT8 A;  2HLD G;  1OCR C;  2QKA A;  4H37 A;  3RWR D;  1V54 C;  5C93 A;  2XTA A;  3ASO B;  4X89 A;  2YDE A;  3TJT A;  2ZM6 B;  4Q20 A;  1BL8 A;  4U3F H;  1SQX H;  3WFV A;  3CD6 V;  2ZM6 O;  2JRI A;  1JX9 A;  3SJB C;  4JYY A;  4AQY B;  4FZ1 A;  4IIJ A;  4O2A B;  2OCC C;  5H2F Z;  5FPR A;  4I50 A;  2VWJ A;  1AP6 A;  4J42 A;  4AQY O;  2LQT A;  5EIB D;  1IUR A;  4Z1V A;  4DV3 B;  5KHG A;  3QO8 A;  4QPJ A;  2WWW A;  1IX9 A;  4JAA A;  4YHH B;  2PI5 A;  3SPH A;  4J80 A;  2P7T C;  1UJW B;  1OZ0 A;  4B3M B;  4DV3 O;  4TSF G;  1L0N H;  3MHS C;  3W7T A;  4YHH O;  5LHG A;  1WA8 A;  4L87 A;  4B3M O;  1K73 W;  3CP1 A;  3JAK A;  5IY5 B;  1NT2 B;  5L3D A;  2E76 B;  4JTD B;  2G38 A;  5GW7 A;  2A79 B;  1G8M A;  2WLI B;  4X1K A;  2YXL A;  3UQ8 A;  1H2L A;  2XAS A;  1FPO A;  3VQV A;  5B1B B;  5LL6 Y;  5CBH A;  2W0X A;  3ZMS A;  3EHB B;  4JYC A;  2IJK A;  2IU0 A;  1YSC A;  3HB3 B;  4YJ2 A;  4UV9 A;  2YID A;  5IYZ A;  3LDD A;  2YEV A;  5K1X A;  2ZR3 A;  4EB6 B;  2L6L A;  4H33 A;  4FK5 C;  2PUS A;  5KA6 A;  1YJW V;  4G2K A;  2JGD B;  3CHX A;  3FYE B;  2QEX V;  5JH7 B;  1GM8 A;  1FS0 G;  2ZXW C;  4DUZ B;  1IZ3 A;  1Y67 A;  3U10 A;  3CC2 V;  3I5D A;  4GYC B;  2XAQ A;  4DUZ O;  2V4D A;  4J7K A;  1H2S B;  2Q73 A;  4KFM A;  1VQP V;  1TAE A;  1XBL A;  3JD1 A;  5KAI Z;  4ZKI A;  1XNR B;  1GMG A;  1RFY A;  4P9P A;  3D36 C;  4B3S B;  2XAH A;  2GBO A;  2WPD G;  5LBQ A;  1XNR O;  2XAG A;  1X59 A;  2Q7G A;  5CB4 B;  1KQS U;  1CPY A;  1K4C C;  4B3S O;  3ETE A;  1QHT A;  5KA5 A;  1W2B U;  5JJJ B;  4RUE A;  1BQ0 A;  4RQF A;  1YIT V;  1VQM V;  4I9W A;  3F5T A;  4NTX A;  2X0L A;  5B5E Z;  1Q6U A;  2DYS B;  4JAU A;  1WJZ A;  4W4L A;  1M56 B;  5JCO C;  3LDC A;  3CRC A;  1QVG U;  4XBF A;  3E8H A;  3AG2 C;  3RT3 C;  2AHY A;  2YXH A;  1HNZ B;  4JTA B;  1GM9 A;  1WP8 A;  3E8F A;  3GB7 C;  3ASN C;  2E74 B;  3E2E A;  4MSW C;  4YIP A;  4MT8 A;  4QIW F;  2CTR A;  1AI4 A;  1KP2 A;  3ZHS A;  1F51 A;  2OT5 A;  3NXS A;  5JVD B;  1HNZ O;  4X20 A;  3CRM A;  4B08 A;  3ZMZ A;  2Y48 A;  1Q8I A;  4OX9 B;  4I9Q A;  4JI1 B;  4TOI A;  1ZUQ A;  3JAT A;  3P32 A;  1RPO A;  3A2F A;  4OX9 O;  2W0F C;  2BOC C;  4MW8 A;  4JI1 O;  2VQF B;  2F4V B;  2IBZ H;  5J2U B;  1NH2 B;  1E1R G;  2Z0A A;  3C3T A;  5B66 Z;  3K9A A;  3BEH A;  2LFS A;  3R66 A;  4TT3 G;  2VQF O;  5L3B A;  1IBL B;  2F4V O;  2YIC A;  3OTF A;  4DYL A;  3HKC B;  2GUZ B;  2H8P C;  3J7A U;  3CRQ A;  3STL C;  3FYI B;  1AR5 A;  3CCM V;  3QVN A;  5J2T B;  1A32 A;  4MVR A;  4PA6 A;  2DWD C;  3IC7 A;  2Y4T A;  3VOU A;  1H2N A;  1OCR B;  1Q5O A;  3SYQ A;  5K1P A;  1V54 B;  2F66 C;  2HJD A;  1AI5 A;  3M8A A;  3SJC C;  4MTO A;  2LFR A;  4WBN B;  2ZE6 A;  4MTX A;  1DLB A;  1S5H C;  4F6R B;  3CME V;  4JI5 B;  5CBG A;  4L8J A;  2OCC B;  2EIL B;  1Y74 B;  3ABK C;  1AR1 B;  3CS5 A;  4C7U A;  2XND G;  3LSQ A;  1TUB B;  4JI5 O;  4LF6 B;  2YSU B;  4O4H A;  4HYO A;  5IYB O;  2UU9 B;  4YJ3 B;  5DEC A;  1ZTE A;  1WP7 A;  2QJ1 A;  1ROP A;  3L71 H;  3P30 A;  1KEC A;  1WAZ A;  3MHH C;  1KD1 W;  4LF6 O;  2XOK G;  1FAF A;  2UU9 O;  1Y76 A;  1B6Q A;  5LMU B;  3Q4H B;  4WF9 V;  3AG1 C;  5HFL A;  3SPJ A;  2P90 A;  3ASO C;  4K35 A;  5H9C A;  4LF4 B;  1SQB H;  5LMU O;  1JOY A;  4DXW A;  4ZBM A;  2IU3 A;  3AEI A;  2D2C B;  1KBH A;  4DV7 B;  4LF4 O;  1IVS A;  2CK3 G;  1JFF B;  3EVK A;  4DV7 O;  1BS3 A;  4X1I A;  1P84 F;  3A0R A;  1JR9 A;  1XIL A;  3MD0 A;  4WFH A;  4NVP A;  2BTQ A;  3RW0 A;  2PY5 A;  3RYF B;  1HNW B;  3SPI A;  3KCY A;  3KG2 A;  1EN6 A;  2GV9 A;  3FAV B;  3FB5 C;  1HNW O;  3N27 A;  4HAM A;  3OTO B;  4PDL A;  4HNA B;  1H8H G;  3KKY A;  5KMG A;  2Z5U A;  1SKV A;  2ZCE A;  1KMI Z;  1MNG A;  3DXR A;  5IY5 C;  1Z2G A;  3IJ4 A;  3UO3 A;  5KLV H;  3OTO O;  1QNM A;  1XNQ B;  4CS3 A;  2KKW A;  2CTQ A;  1QQC A;  5IWA B;  1VF7 A;  4BAY A;  2OYQ A;  3ZN0 A;  5BY1 A;  1XNQ O;  5C8Y B;  5FNV A;  5BZB A;  2DJV A;  5IWA O;  1FXH A;  1R6T A;  2FKX A;  2WLN A;  5B3S B;  1VQL V;  1K34 A;  3UO2 A;  4AIL C;  3ZRV A;  3G80 A;  4PJ0 Z;  5F2V O;  3J80 N;  4RO2 A;  4BIZ A;  2DE0 X;  4ZOL A;  2Q68 A;  1TVK B;  3HKB A;  1PNK A;  1IXB A;  4WFF A;  1K5S A;  1XUQ A;  1K5Q A;  1JMK C;  4UVB A;  3D8C A;  3QNE A;  4GCZ A;  3HKE A;  2QTO A;  4UCS A;  5L3G A;  1M4U A;  3CWB H;  4WFB V;  1K3E A;  2L35 A;  2ZE5 A;  3BA8 A;  5JQG A;  3ETG A;  3OEH G;  3VQX A;  3ZMU A;  4DR1 B;  2PTM A;  3AG2 B;  2E75 B;  3HR0 A;  1NQT A;  4DR1 O;  3GVM A;  3PN1 A;  5ITZ B;  4PI2 A;  1RSO B;  4IT5 A;  2F23 A;  3L72 H;  3OD4 A;  1OHH G;  2ZE8 A;  4U3J B;  5FLX N;  2JS3 A;  3ZRS A;  4O4L B;  3APO A;  4JI3 B;  1ENV A;  3JD2 A;  3VBB A;  2IM9 A;  2Q9L A;  3K06 A;  2CAZ C;  3JAL B;  4QPK A;  2HFE C;  4G28 B;  1VF5 B;  4JI3 O;  4TV9 A;  3I55 V;  4F6E A;  1TUE B;  3THO A;  2WLL B;  3QTC A;  1N4C A;  4MVQ A;  5B1A B;  1VQ8 V;  3CCJ V;  4X9Q A;  1EN5 A;  1JPX A;  4X64 B;  4ZI7 A;  3K0D A;  3CCS V;  2A06 H;  1B3Q A;  3K5L A;  5IJ9 A;  2EIM B;  4GLX A;  1DK1 A;  2EZP A;  1DF5 A;  4I4T A;  2FTK A;  1BZK A;  4X64 O;  5EZY B;  1AI6 A;  2UXX A;  3RYI B;  4AHC A;  2JJ1 G;  3RYH B;  5E79 Z;  4I55 B;  3JAS B;  3ZHQ A;  1QBZ A;  4RUF A;  1N36 B;  3JD0 A;  1EN4 A;  1K33 A;  1EM1 A;  4A5U B;  1KYO F;  3RGB A;  3CCR V;  1N36 O;  2LW7 A;  3ZX6 A;  3B8N A;  4IIJ B;  2BSK A;  4RAI A;  4FM2 A;  1WB7 A;  1SES A;  5LYJ A;  5AG2 A;  3B77 A;  2CGN A;  2YUA A;  1RPR A;  3IC9 A;  4MVM A;  4FFB A;  1R6N A;  1PPJ H;  1SS3 A;  5L3E A;  2LGQ A;  4YIO A;  3AG1 B;  2JK5 C;  3TK1 A;  2CH7 A;  1H2M A;  2JGU A;  4K8Z A;  2ZDI C;  3CCQ V;  1FXK A;  3G4S V;  1S5J A;  2QKS A;  3HPL C;  2AHZ A;  4TQD A;  3UT5 B;  1BMF G;  1WNS A;  1OCZ C;  3ZCC A;  3T4D A;  4CBC A;  2BE3 A;  1WN7 A;  2IJH A;  1FD9 A;  4U7N A;  4N23 A;  3I56 V;  2N05 A;  1AR4 A;  2EIL C;  3DTU B;  5CA1 B;  1OCO B;  2OIG A;  2P5O A;  3AK1 A;  3K3W A;  3STZ C;  4UCT A;  5JJN B;  2EX3 A;  1R6K A;  3JSL A;  3JAR A;  5CMU A;  5KX5 B;  3TGU H;  3K5M A;  1COW G;  2ZIM A;  4GX2 A;  1S3J A;  3UCS C;  3QF7 A;  4BWA A;  2GHY A;  2K9P A;  3OR6 C;  2YEV B;  4FJC C;  4MTG A;  3W7X A;  4LH6 A;  3EXA A;  5IDJ A;  3H1K H;  4DV5 B;  1BGY H;  2YIB D;  2ZT9 B;  2UXN A;  3CE2 A;  1AIL A;  3CXC U;  4DV5 O;  4LNU B;  3AK2 A;  4LH7 A;  3BVO A;  4DV2 B;  1NKD A;  1ZAU A;  2HR3 A;  3H1L H;  1Q7Y W;  3ABM B;  2F43 G;  4O2A A;  4DV2 O;  1N33 B;  1K9M W;  3F7V C;  5CA3 A;  1ZLZ A;  1G4Y B;  3A0B Z;  2OTL V;  1N33 O;  1XDC A;  1NI8 A;  4NYK A;  3HKD A;  4GUN A;  3L9D A;  1VF6 C;  5B1N A;  1XRE A;  4QNH B;  2WLJ A;  1GTO A;  4DR7 B;  3QO7 A;  2Q7H A;  3NR7 A;  1WLE A;  4FLY A;  2UUC B;  4JYB A;  5KHJ A;  5EBM C;  1SQF A;  4DR7 O;  4J7J A;  2UUB B;  2DWE C;  1SQQ H;  2RMK B;  2UUC O;  1D2D A;  1FFT B;  4P30 A;  1YJN V;  1Q6I A;  4JI6 B;  1P49 A;  1XL4 A;  2UUB O;  3WG7 C;  1ORQ C;  4DW1 A;  3K5N A;  4LC1 A;  1F4N A;  3W7W A;  4FMT A;  3D3Q A;  1H38 A;  4JI6 O;  5EYP B;  5B3S C;  4DR4 B;  2HHH B;  2WLI A;  2JEX A;  1FXV A;  3ZMV A;  3E8B A;  3JCU Z;  3ZHR A;  2Y4U A;  1V55 B;  3JSN A;  3VQY A;  2ARH A;  3CRR A;  1KKC A;  3A8T A;  4FPP A;  4DR4 O;  4WCE V;  2HHH O;  1N8R W;  2B1I A;  4XDJ A;  5IJ0 A;  5LP6 A;  1YJ9 V;  4LF9 B;  1L0L H;  1IBM B;  4FLV A;  4FLT A;  2ZNJ A;  3SJA C;  1W59 A;  2P4V A;  1Y4M A;  2UXC B;  4LF9 O;  3CEI A;  3K08 A;  1XEQ A;  1XMQ B;  2C2A A;  4EB6 A;  1IBM O;  4O2B A;  2AZ2 A;  4PI0 A;  4F4L A;  2WA3 A;  1R3I C;  3IFX A;  3ZIA G;  2UXC O;  3RBZ A;  1QR9 A;  3EFF K;  4IHJ A;  5EBW C;  5LXT B;  3QG5 A;  5LHI A;  1XMQ O;  1I5X A;  3BRC A;  2OCH A;  3ETD A;  3RYC A;  2QWO B;  4JV5 B;  2P4K A;  4O4J A;  2A7W A;  2AW9 A;  1I0H A;  2DW4 A;  4MTF A;  4OPA A;  3ZRX A;  4JI2 B;  3H1I H;  2Q8V A;  1GN3 A;  4NKG B;  1P7G A;  3OM3 B;  3OUF A;  4JV5 O;  4UCV A;  2UXB B;  1R3J C;  2O57 A;  1GH6 A;  4JI2 O;  1AP5 A;  2RDC A;  3CRA A;  2QSA A;  2UXB O;  3C3S A;  3DGE A;  1S72 V;  5LOV A;  3LSS A;  4MVS A;  4FVM A;  1YF2 A;  4LF5 B;  5CB4 A;  1G1X B;  4FLZ A;  4AI8 A;  4DV0 B;  4MVU A;  3OMI B;  2RNB A;  2QGN A;  1UFI A;  4LF5 O;  4LF8 B;  2XT9 A;  1T5E A;  2HKO A;  4DV0 O;  1SZT A;  5B1A C;  4KUM A;  1WB8 A;  2IW5 A;  1HDJ A;  1Z5V A;  4LF8 O;  4B3T B;  1IBL O;  4CH5 A;  4JI8 B;  1OCC B;  2EIM C;  2ITD C;  2WAM A;  2Q7E A;  5J9P C;  1FFX B;  4R50 A;  5A9G A;  4B3T O;  1KB9 F;  3WB1 A;  2N04 A;  4JI8 O;  1YXB A;  4K8X A;  1AI7 A;  1SER A;  1LNQ A;  4TUY B;  3JAW A;  1OCZ B;  5CA0 A;  1QVF U;  2YIB A;  4ASU G;  1H2G A;  5JVD A;  3CMA V;  4ABM A;  1SRY A;  4X88 A;  5L3F A;  5LGN A;  4NR1 A;  5TIS Z;  3E83 A;  1Q3E A;  3APQ A;  2HEP A;  4Z1M G;  2PYL A;  1O9G A;  2RJZ A;  3FD9 A;  5IYD O;  4B7E A;  4JZG A;  3OMA B;  1IDS A;  3ICX A;  4JTC B;  4QJF B;  5LHH A;  2NN4 A;  3GWO A;  4GKK B;  2H94 A;  4NXN B;  1NVP B;  2RN9 A;  2ADP A;  1NTM H;  1YI2 V;  3RVY A;  2CTW A;  1XQ8 A;  2JEU A;  3HKC A;  4CZZ A;  2GUZ A;  2QWP B;  4PA9 A;  3SR2 C;  4GKK O;  2MK3 A;  4G27 B;  4NXN O;  3ABU A;  3CCL V;  4JI0 B;  5J2T A;  3W7U A;  1LUW A;  4EEQ A;  2FB5 A;  4B3R B;  1SA0 B;  1JVM A;  4FIP C;  5KMG B;  1THZ A;  4JI0 O;  4DO2 A;  4LWS A;  2YI9 A;  4TV8 B;  4DRX B;  3SDL A;  1JCH A;  2R72 A;  4B3R O;  2AGA A;  4DR3 B;  1OCO C;  3IAY A;  2A9H A;  4F6R A;  1FYJ A;  3H01 A;  3T4Z A;  4CS4 A;  3BAB A;  3SJQ C;  4J9Z B;  4DR3 O;  5FNV B;  3AG3 C;  2CGO A;  1MZF A;  1QU7 A;  1RM1 B;  3OGC C;  4HBN A;  2CE4 A;  1BHA A;  3K57 A;  3A0H Z;  4JPR A;  4DV1 B;  1TUB A;  2ODM A;  1QCE A;  1ZL8 A;  4YJ3 A;  5FL7 G;  2AXT Z;  4DV1 O; 
#chains in the Genus database with same CATH homology
 4JTD B;  1JPX A;  4PDR A;  5GW7 A;  2A79 B;  1G8M A;  3K0D A;  3CCS V;  3X2Q C;  2WLI B;  1R3K C;  2XAS A;  2EIM B;  4PA7 A;  1QLE B;  2EZP A;  1DF5 A;  2EIK C;  2FTK A;  5B1B B;  2ITC C;  5CBH A;  3D3I A;  1AI6 A;  3ZMS A;  2JJ2 G;  1HWY A;  2UXX A;  3EHB B;  4I5S A;  2V1D A;  2PI4 A;  4JYC A;  2IJK A;  2JJ1 G;  3K0G A;  3WG7 B;  2IU0 A;  1YSC A;  3HB3 B;  5CBF A;  4UV9 A;  1Q82 W;  1QBZ A;  3ABM C;  4RUF A;  5LGT A;  2A0L A;  3SYA A;  3LDD A;  3JD0 A;  3SYC A;  1JQ0 A;  2YEV A;  4R7C A;  2ZR3 A;  1K33 A;  2OTJ V;  1FXK C;  3FB7 C;  4H33 A;  3SPC A;  4FK5 C;  3CCR V;  5KA6 A;  1YJW V;  4G2K A;  1P4R A;  3B8N A;  3FYE B;  2QEX V;  3F5W C;  4RAI A;  2GSM B;  2EIJ B;  3UM7 A;  1EBO A;  1SES A;  1GM8 A;  3B77 A;  1FS0 G;  2ZXW C;  2X6C A;  1RPR A;  1K4D C;  4MVM A;  4YXW G;  1R6N A;  2Z3Y A;  3K79 A;  5L3E A;  3CC2 V;  4E2L A;  2XAQ A;  1E79 G;  2X7R B;  1VQ9 V;  1NR1 A;  4MS2 A;  3AG1 B;  4UV8 A;  2JK5 C;  3TK1 A;  3CCV V;  4KFM A;  1VQP V;  1AJQ A;  3JCZ A;  1ZWI C;  2ZDI C;  1FXK A;  3T1C A;  3JD1 A;  4ZKI A;  3G4S V;  3CCQ V;  1F23 A;  2QKS A;  3G6E V;  2QM7 A;  1GK9 A;  3HPL C;  2AHZ A;  2K1E A;  1GMG A;  4X8A A;  1BMF G;  4MVO A;  1KKD A;  4P9P A;  1OCZ C;  2BOB C;  3ZCC A;  4PDV A;  3JD3 A;  1F4M A;  2XAH A;  3T4D A;  4CBC A;  3LUT B;  2IJH A;  2WPD G;  5LBQ A;  2DYR C;  4U7N A;  2XAG A;  4N23 A;  3CPW U;  4LBE C;  1QR8 A;  3I56 V;  1EFR G;  1SET A;  1KQS U;  1CPY A;  2Y69 C;  1K4C C;  2B1G A;  1YTF D;  4WFA V;  2EIL C;  1PL0 A;  1YTF B;  1I5Y A;  4JGS A;  1V55 C;  3ETE A;  2M7W A;  1JJ2 U;  2IH1 C;  3DTU B;  5KA5 A;  1W2B U;  3ZMT A;  1OCO B;  3CC7 V;  1M90 W;  3K3W A;  4RUE A;  2ZDI A;  3TCU A;  1PNM A;  3STZ C;  5HFM A;  4RQF A;  1YIT V;  1VQM V;  4MW3 A;  4I9W A;  1R6K A;  5CMU A;  3D36 A;  5H6Q A;  2X0L A;  2JDI G;  3E35 A;  2DYS B;  4JAU A;  2W6I G;  3TET A;  3ABT A;  1COW G;  1M56 B;  3LDC A;  4GX2 A;  1QVG U;  1S3J A;  4XBF A;  1NJI W;  3E8H A;  3SPG A;  1R3L C;  3OW2 U;  2GHY A;  3AG2 C;  3OR6 C;  4QE9 A;  2NLJ C;  2YEV B;  2AHY A;  3QO5 A;  4JTA B;  4FJC C;  1MG1 A;  4MTG A;  1E1Q G;  1GM9 A;  3E8F A;  1IXM A;  3GB7 C;  3ASN C;  4R8C A;  3W7X A;  3E2E A;  4MSW C;  5IDJ A;  3IGA C;  2ATK C;  4MT8 A;  4QIW F;  3CCE V;  2EBO A;  2EIK B;  1AI4 A;  2D3O W;  1KP2 A;  2HJF C;  1F51 A;  5KUM A;  2OT5 A;  3NXS A;  2UXN A;  3ZMZ A;  3AG4 B;  3CXC U;  2Y48 A;  3PJS K;  1MAB G;  1NKD A;  2HR3 A;  4HZ3 A;  1MOF A;  3E8G A;  1Q7Y W;  3ABM B;  3P32 A;  1RPO A;  1ARO P;  2F43 G;  2W0F C;  1VQ5 V;  2BOC C;  4MW8 A;  2P6J A;  1K9M W;  3F7V C;  5CA3 A;  1NH2 B;  1E1R G;  4WFE A;  1CEZ A;  1G4Y B;  2HG5 C;  3K9A A;  3BEH A;  2LFS A;  2IJJ A;  2OTL V;  4TT3 G;  5EK0 A;  5L3B A;  1EZJ A;  3OUS A;  2EIN C;  2H8P C;  2ZXW B;  3JYC A;  5B1N A;  4QNH B;  2WLJ A;  3OFN G;  1GTO A;  3QO7 A;  3STL C;  3FYI B;  4BW5 A;  3CCM V;  1WLE A;  4LCU C;  4MVR A;  4PA6 A;  2DWD C;  4JYB A;  3IC7 A;  4QE7 A;  5EBM C;  3T2M A;  1PKX A;  5B1B C;  2XAJ A;  4TWK A;  2R9I A;  3VOU A;  2DWE C;  1OCR B;  3SYQ A;  1V54 B;  1FFT B;  4P30 A;  1PNL A;  1K8A W;  1OCC C;  5LGU A;  1YJN V;  1AI5 A;  1W0J G;  3ABL C;  1WPX A;  1GO3 F;  2IJI A;  1M57 B;  1XL4 A;  4MTO A;  2LFR A;  4OXS A;  3WG7 C;  1ORQ C;  1BHB A;  4LC1 A;  1DLB A;  1F4N A;  1S5H C;  4MTX A;  3W7W A;  1VQ4 V;  4FMT A;  3CME V;  2DYR B;  2Q67 A;  1H38 A;  2NNU A;  1CP9 A;  5B3S C;  4UUJ C;  5CBG A;  2WLI A;  2P67 A;  2JEX A;  1FXV A;  3ZMV A;  2OCC B;  3E8B A;  5IYC O;  2ZR2 A;  1PD3 A;  2EIL B;  3ZRW A;  1S76 D;  3ABK C;  1AR1 B;  1V55 B;  3OE7 G;  2XND G;  3LSQ A;  4BIU A;  4FPP A;  4WCE V;  2YSU B;  4HYO A;  2B5U A;  5IYB O;  1N8R W;  2B1I A;  2EJR A;  3K03 A;  1J95 A;  4XDJ A;  1Y66 A;  1NR7 A;  2IH3 C;  3ML0 A;  1YJ9 V;  1ROP A;  3P30 A;  1KEC A;  1KD1 W;  3M99 B;  3MHH C;  4N21 A;  1K92 A;  1KP3 A;  2XOK G;  1MSW D;  1B6Q A;  5EC1 C;  1Y4M A;  1DF4 A;  2LP7 A;  3ZJZ A;  5DM6 V;  4WF9 V;  3AG1 C;  2R9R B;  3K08 A;  2C2A A;  5HFL A;  3UKM A;  2ZQM A;  3AG3 B;  3SPJ A;  1W0K G;  2P90 A;  3ASO C;  2ZD9 A;  4F4L A;  1R3I C;  2EZO A;  3IFX A;  4MVZ A;  5H9C A;  3ZIA G;  3E89 A;  3OEE G;  2QE7 G;  1QR9 A;  3EFF K;  4R6Z A;  5EBW C;  3RBZ A;  3G71 V;  1JOY A;  5LHI A;  1I5X A;  3ASN B;  4DXW A;  4ZBM A;  4GT1 A;  2IU3 A;  3ETD A;  2HVJ C;  4JAS A;  3AEI A;  1L1F A;  1VQ6 V;  4XDL A;  2X6B A;  2DW4 A;  4MTF A;  2WLM A;  4U7O A;  3ZRX A;  2WSS G;  5DN6 G;  2CK3 G;  4PA4 A;  3X2Q B;  3OM3 B;  4RQE A;  3OUF A;  2WLH A;  4PA3 A;  5E1A C;  5H6R A;  1R3J C;  1H8E G;  3W7S A;  1XL6 A;  3ZN1 A;  3A0R A;  3MD0 A;  4WFH A;  2DQ3 A;  3CYO A;  4GX0 A;  1NBM G;  3RW0 A;  4PDM A;  3K04 A;  2DYS C;  3SPI A;  3DGE A;  3SYO A;  1S72 V;  3KG2 A;  1M56 C;  3LSS A;  4MVS A;  3BY6 A;  5CN0 A;  1YHQ V;  3RVZ A;  1RM1 C;  3FB5 C;  1NH2 D;  4MVU A;  4HAM A;  1FXK B;  3OMI B;  4PDL A;  2QM8 A;  1H8H G;  2Z5U A;  3FB6 C;  1GM7 A;  3ZRW B;  5IY5 C;  2HKO A;  1M9N A;  4GX5 A;  1SZT A;  5B1A C;  4KUM A;  2IW5 A;  4UXN A;  1M1K W;  3AG4 C;  3LDE A;  4JF3 A;  2JIZ G;  3FKS G;  4GX1 A;  1OCC B;  2EIM C;  4BAY A;  1VQ7 V;  2HVK C;  1QLE C;  2ITD C;  3ABL B;  3ZN0 A;  1S77 D;  5EC2 C;  2WAM A;  3JD4 A;  3SYP A;  5BZB A;  4P9O A;  4P2Z A;  5J9P C;  2QA4 V;  4R50 A;  1AJP A;  1FXH A;  2WLN A;  2Q6A A;  3FB8 C;  3OAA G;  5L3C A;  1Q81 W;  5B3S B;  1AI7 A;  1SER A;  1VQL V;  1K34 A;  1LNQ A;  2WLL A;  1OCZ B;  3ABK B;  3OMN B;  3LNM B;  5EBL C;  1VQO V;  1QVF U;  4ASU G;  1K7D A;  1H2G A;  4UVA A;  3ZRV A;  3CMA V;  2XAF A;  1SRY A;  4RO2 A;  4X88 A;  1VQK V;  4BIZ A;  1P7B A;  5L3F A;  1Q86 W;  5LGN A;  2Q69 A;  2Q68 A;  2Y69 B;  3E83 A;  1R73 A;  1PNK A;  4WFF A;  1K5S A;  1AJN A;  2EIJ C;  2DQ0 A;  1K5Q A;  4Z1M G;  4UVB A;  4JAV A;  4LP8 A;  2HLD G;  5IYD O;  3B8M A;  1OCR C;  3QNE A;  4GCZ A;  3OMA B;  4H37 A;  2KB1 A;  1V54 C;  2QTO A;  5C93 A;  4J9Y B;  3ASO B;  4X89 A;  4JTC B;  4QJF B;  5LHH A;  3GWO A;  1NVP D;  2H94 A;  1NVP B;  1M57 C;  3R65 A;  3F7Y C;  4Q20 A;  5L3G A;  1BL8 A;  1YI2 V;  3RVY A;  2JEU A;  4WFB V;  4CZZ A;  2X6A A;  1K3E A;  4PA9 A;  3WFV A;  3CD6 V;  3ETG A;  1K97 A;  3OEH G;  3ZMU A;  4EKW A;  1GKF A;  2MK3 A;  4G27 B;  1S0V A;  2W6J G;  3ABU A;  1VQN V;  3CCL V;  3AG2 B;  2WLK A;  1JX9 A;  4WFG A;  3W7U A;  2OCC C;  1JVM A;  1NQT A;  3OR7 C;  4FIP C;  5KUK A;  1THZ A;  4XDK A;  4DO2 A;  1JCH A;  1KC8 W;  1OHH G;  4PEL A;  1OCO C;  3ZRS A;  3QO8 A;  2A9H A;  4QPJ A;  2WWW A;  3H01 A;  3T4Z A;  2PI5 A;  3CCU V;  3SPH A;  3CC4 V;  1ENV A;  2V7Q G;  3SJQ C;  3JD2 A;  3VBB A;  4J9Z B;  3E86 A;  2P7T C;  1DTO A;  1UJW B;  3AG3 C;  1OZ0 A;  3K06 A;  4KP4 A;  4TSF G;  1RM1 B;  3MHS C;  1QLN A;  3OGC C;  4QPK A;  1BHA A;  3W7T A;  2HFE C;  5LHG A;  4G28 B;  4JPR A;  4L87 A;  1QCE A;  5B1O A;  3I55 V;  4UVC A;  1K73 W;  1TUE B;  3CP1 A;  2WLL B;  5FL7 G;  5IY5 B;  4MVQ A;  1YIJ V;  5B1A B;  5L3D A;  2EIN B;  1VQ8 V;  3CCJ V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...