2IJIA

Structure of f14h mutant of cole1 rom protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
56
structure length
56
Chain Sequence
b'GTKQEKTALNMARHIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 27
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijiA00
2GHYA 1GMGA 2IJIA 1F4MA 1B6QA 1RPOA 1F4NA 1GTOA 1ROPA 1PD3A 1RPRA 3K79A 4DO2A 1NKDA 2IJKA 2IJJA 2IJHA
chains in the Genus database with same CATH superfamily
4UCUA 4LNUB 1NVPD 1JJ2U 1VQ8V 4O4HB 4JI5O 2JJ2G 4X9QA 1Y74A 4ZHQB 3RN4A 3CCSV 5BR8B 3CWBH 5IYZB 1VF6A 5KHGA 2UUAB 4XBFA 1S5HC 2QGNA 1JQ0A 4FK5C 4Z1MG 4I0XB 3JD1A 2ZM6B 4PELA 2A9HA 2UXBO 2HJFC 3S3XA 1BSMA 2IW5A 3BRCA 5IJ9B 3VQXA 5FPRA 2DYSB 1R3JC 2DYSC 3ZMSA 3NR7A 3GVMA 5IDJA 4CH4A 1XREA 5LYJB 2GUZA 2NR5A 3N2GA 4PI0A 1UJWB 2G38A 4BIUA 2WLIA 3AG3C 3E22A 4XDLA 4TUYB 2RJZA 2PYJA 4FPPA 4JYCA 4H44B 1IBMB 3SDLA 1GM8A 1KU9A 4DR4O 4NR1A 2VWJA 1AJQA 1L0NH 4YJ3A 5IE9A 2OIEA 1AVMA 2UXNA 4DUZB 2E75B 1A32A 2W0FC 1N34B 5LMNB 1COWG 3TETA 4G28B 4DV0B 4LF9O 4PA7A 1OCCB 5FNVB 1I7FA 4NB5A 1F7YA 4G2KA 2K1EA 3LSSA 1WB7A 1VQKV 3QO7A 1NVPB 1D5AA 4D7TA 3ETGA 5EK0A 3MD0A 5LXTA 4WBNA 1URFA 3JALA 3ASNB 1NR7A 3CP1A 3E8FA 1VQNV 1Q90D 4HAMA 4JTAB 3DGEA 4P30A 3EHBB 4B3SB 2H3OA 4PHZA 3ABUA 4DR3B 1KKDA 5JJNB 1WB8A 2PYLA 5JVDB 1JFFA 4JI4O 4W4KA 3OR7C 2VQFB 1KD1W 1BHBA 1K5QA 4JASA 4I7ZB 4DYLA 2C2AA 3GWOA 4GUNA 2Q8VA 3FAVB 1EN6A 3ZMVA 1YDXA 3CMEV 1GN3A 4YJ2A 2YXHA 3T2MA 1SA0A 1NH2D 3A8TA 2XASA 2EIJC 4I55A 5LHIA 4X64B 2Q0OC 1JMKC 4O2AB 3AG7A 1SC5B 2YIBA 4LP8A 3OM3B 3U0ZA 2ITCC 5J9PC 1XEQA 4ASUG 1XNRO 3ZRWA 2VWKA 3HPLC 1WNSA 1O9GA 1KC8W 3RYFB 5IYBO 3CJHB 3R66A 3R65A 5IJ0A 3AG2C 3C90A 1ZL8A 2FB5A 3CD6V 4PDMA 3CB2A 2AGAA 5IWAO 2JDIG 2HG5C 4R50A 1E1RG 3AEIA 5GONB 3QG5A 4H13B 2DYRB 2F43G 1XDCA 5D5QA 4JYAB 3H1KH 1K4DC 1WPXA 3N27A 2UUBB 3K04A 3ZHVA 3EFFK 1WAZA 2ZINA 5LGNA 4JI5B 2JEXA 4RAIA 3D8CA 2A7WA 4I9QA 5KHIA 4L87A 4TV9A 2A3QA 4NXMO 3ASOC 4QPKA 4HYOA 1N8RW 2YEVB 4JV5B 1QLEB 2XAFA 1QLEC 3RYHA 5FPOA 1NH2B 3ML0A 3E86A 1QVFU 5H6RA 1G1XB 4IIJA 4DV7O 2CH7B 4K3AA 5J2UB 4DV6B 1L0LH 2AW9A 2IJHA 1QR8A 5H9CA 1QNMA 4JI2O 2QWRB 3OMNB 1OHHG 4MTGA 2GHYA 4JYYA 4B7EA 1OCRB 1RP3B 2QR4A 2A06H 4CC5A 5EC1C 1K5SA 4KP4A 3OMAB 2CDYA 4PD4F 1LNQA 4JI8O 4DR6O 2VQEB 2H8PC 2WLKA 3ZX6A 2WLLA 2D3OW 2CGNA 3F7YC 3SYAA 2Y4TA 3UO3A 2AZ2A 4UB8Z 1YJNV 1HP8A 2GTSA 3L75H 5DEDA 4FLVA 1BT8A 1N36O 1PNMA 3ABKB 3RYIB 1XI1A 1KQSU 4TQFA 2HEPA 2Q73A 3A0RA 3OT7A 3ABTA 1CXZB 2EBOA 1HNXB 1W2BU 5EZYA 3F5WC 3VQYA 1RFYA 3K08A 3A2FA 3W7SA 4TV8A 5BY1A 4CH3A 3K3WA 1IBKO 3E8GA 1XNQB 1NZ6A 5EBWC 3ICXA 1SQBH 1SS3A 1Y74B 4DR7B 4Z2WA 2M6YA 1FJGO 1OCZB 3H1JH 5DM6V 5KUKA 5FNVA 2LP7A 4LF4O 1QQCA 3SYPA 2B1GA 4OGQB 2N05A 3UT5A 2Q4PA 1ZWIC 4CZZA 3L71H 4J11A 4X66O 3AK2A 3ZMZA 3VQVA 4MVUA 2WSSG 4DR5O 2LO1A 2M7WA 3FX7A 1YEWA 5BXZA 1FYJA 1AI6A 2GUZB 4KFMA 2F23A 2Y48A 2WLIB 3AG1B 1BS3A 1NTZH 3RWRD 3AG1C 3E22B 4QJFB 1MZEA 1FFTB 4J7ZA 1SRYA 1K92A 1Q3EA 1XNRB 1QHTA 2YIBD 3JASA 1AP6A 5CB4A 1FS0G 2OCHA 4PDVA 1EN4A 1GAXA 4LF6B 4DK1A 5GW7A 2QSAA 3MHSC 4YIOA 4RUFA 5IWAB 2DQ0A 1AP5A 4I9WA 1CP9A 1GN4A 3K9AA 1HNZO 5JCOC 1SZXA 1LR1A 2O57A 4WBNB 4B3TB 3JALB 2LGWA 2UXCO 1PKXA 5KUMA 2V1DA 2BTQA 4WFEA 1NS1A 4JI0O 2ZD9A 2H94A 2JGDA 5IT9N 5BZBA 4LFAO 1AR5A 3ZS8C 1MZFA 2JK5C 1JFFB 4KHPO 3B2EE 2W6IG 3BA9A 3LSUA 5CA3A 4TQDA 4E2LA 1GN2A 4DV2O 3ZRVA 1MA1A 2EINB 2ZIMA 4DV7B 3MAQA 4YJ2B 4MVOA 2YIAA 1Y76B 4JTDB 4JI2B 3ZRSA 4U7NA 4I55B 2IM9A 2Z5UA 2JS3A 4LFCO 1SQPH 2YEVA 2EIMB 5CA0A 1EM1A 1U96A 4DV5O 4R8CA 3T1YO 4EB6A 2A0LA 3WU2Z 2DQ3A 3JAKA 2R9IA 3ZRWB 2GDSA 2CH7A 5J2UA 4X8AA 3A0HZ 4X65B 2OWOA 1MNGA 3GWKC 3DSQA 5IJ0B 4IYHA 4P9OA 1ZL8B 3FB5C 4DR2O 4UVCA 1XUQA 3IC7A 1ROPA 5C8YA 3K59A 4TOIA 3H1IH 2HP8A 5KX5A 3THOA 1ZX3A 2KQXA 4YHHO 1PPJH 4X1IB 2PI5A 2ZXWB 1Q7YW 4CS4A 1K33A 3FFQA 1JPXA 2QKAA 5EBMC 1NU1H 3B77A 1GRJA 5B5EZ 2R72A 1MSDA 1N32O 3CRAA 3B8MA 3FD9A 3CCJV 3W7XA 3RYIA 5E79Z 1GTOA 4I5SA 4CH6A 4TV9B 1SQFA 4OPHA 5A9GA 1ZLZA 4LF4B 1MOFA 3RYHB 2P06A 1H2KA 2QM8A 4QE9A 2QTOA 1G4YB 2W6JG 5JWPA 1G8MA 2F4VO 3QO8A 4IIJB 4EFBA 4B3MB 1T5EA 4GZRB 4J41A 4K0KO 4JAAA 2UU9O 4DR5B 4NTWA 4WFHA 1D2DA 1FAFA 4UCVA 2XT9A 2JEUA 4F4LA 4FZ1A 5LGUA 1WA8A 1Q6IA 3G80A 1NQTA 4X62B 4WFGA 2Q68A 3K57A 2WLLB 5DN6G 2HKOA 1F4MA 2ZNIA 4ICGA 1J5EO 2IU3A 1E79G 2JIZG 1SKVA 3BA8A 1D5NA 1VF5B 4YXWG 3KZIZ 2AZ0A 3CHXA 4J80A 4H33A 3D36C 1S3JA 1X4TA 1JJOA 2X0LA 4J7JA 1BZKA 4FMTA 1AROP 5JJJB 3E89A 4FIPC 1ENVA 3AG3B 1GO3F 4NXNB 4AI8A 5LHGA 5B66Z 1BE3H 1HNZB 4BAYA 1CEZA 5EZYB 4LR3A 2B5UA 1AI7A 3E83A 1ZTEA 4I4TA 4TV8B 4OX9O 5CA1A 2QWOB 4LFBB 4JI0B 3RT3C 1KUQA 4PJ0Z 2A79B 3F5TA 1I94O 2RMKB 4NKGB 3SJQC 5AG2A 3LNNA 3S3WA 1KECA 3TJTA 1L1FA 5JCOA 3CCUV 1VQ7V 3JCZA 1VEWA 3UT5B 3SJCC 4Q20A 2K9PA 1JX9A 2Q7GA 1YITV 3UKMA 5JH7A 4UV8A 4H0LB 1AI5A 1M9NA 4UVBA 4B3RO 3HB3B 4YY3O 3ABMB 1RSOA 3ABMC 2IJKA 2EX3A 1RPRA 1Q8IA 4DV5B 2ZT9B 3J80N 5CBFA 1DK1A 1L8DA 2WLMA 3JASB 2EJ7A 1Y76A 5CB4B 2CUGA 1K3EA 3CCEV 2R9RB 3K03A 4AQYO 2EIJB 2CTWA 1H2GA 3ETEA 5L3CA 4DO2A 4UCTA 3RYCA 1YF2A 4U3FH 1AR4A 3STZC 1S72V 2R70A 4LF7O 2DJVA 2L35A 1YI2V 3CMAV 3OMIB 2ZQMA 3IFXA 4X1YA 3K5NA 1P84F 4FZ0A 1DF4A 2PZSA 2LQTA 2WLJA 3HKBA 2AXTZ 4RUEA 1NTKH 2ZE7A 1W0KG 3BPZA 1FXVA 2ETNA 2Y69C 2BTQB 1XHXA 2LFRA 3AG2B 1LUWA 4JGSA 3WB1A 2JJ1G 1JA8A 3K9SA 3TGUH 2RN9A 2Z3YA 2JGDB 3BAAA 1EN5A 1Q82W 4JI1B 2XOKG 1EZJA 1MMMA 2QM7A 1EBOA 3W7TA 4LF5B 5B1BB 2FYUH 2Q69A 5B1BC 2EJRA 3P32A 2ZIOA 4X1IA 4NVPA 4JPRA 2UXXA 2F4VB 2GSMB 4ZOLB 4K8ZA 3UQ8A 2V4DA 4GLXA 5EBLC 2BE3A 3AK1A 2ILMA 2UU9B 4ZIBA 1XMQO 1R3IC 4R6ZA 4U3JB 4EKWA 2Q5ZA 4IT5A 1NI8A 4IL6Z 3W7WA 3ASOB 1XQ8A 4KXRA 1N33O 4AHCA 5CA0B 3G6EV 5GTIZ 5EYPB 3OGIB 1ZSPA 3TXSA 2E5LO 4EB6B 4UCSA 1BCCH 3H9VA 4TWKA 2MW2B 3JAKB 3BVOA 2IBZH 5KHHA 3I56V 2UXBB 1F51A 5KAFZ 2RQ6A 2FKXA 4J9YB 4HNAB 4ZKIA 3FYEB 1J5EB 1I08A 4CBCA 2ADQB 2Q7HA 3HKCA 1HDJA 5L3GA 4MTOA 3QVNA 2P67A 4EFEA 1OV9A 4DUYO 1SF9A 5C8YB 2LW1A 1XL4A 2ZE8A 5KX5B 4FLZA 5CMUA 4GKKO 1XMOO 1IURA 2ZDIC 3ZHQA 2LFSA 4JI7O 1XBLA 1XOUA 1US6A 2DW4A 1PV0A 3IC9A 4LH7A 5KA5A 4DR4B 1BQ0A 2LGQA 1I5XA 3SPGA 4RQFA 2ARHA 3D36A 2E3CA 4I50A 1MSWD 4CC6A 4EEQA 2PUSA 3KG2A 3JCUZ 4LF9B 3J81N 4QPJA 1RM1B 5LMUO 1RM1C 2DWDC 2W0XA 3ZHTA 3FB7C 4FFKA 3VOUA 3BCCH 1Q6HA 4NTXA 3HKDA 3RBZA 4IHJA 2E74B 3CYOA 1E1QG 1HNWO 3ZMUA 2YUAA 3C3SA 4PI2A 2KSDA 3OEEG 1KBHA 4B3RB 4XDKA 4YY3B 2XHBA 1NBMG 3KCXA 4MTXA 3F7VC 1Q5OA 4ZI7B 5LHHA 1H38A 3ZN0A 4FLYA 1FFXA 1WA8B 5J2TA 4DV1O 4JI4B 1P4RA 4MSWC 3OAAG 3D3QA 5F2VO 4K8XA 4GKJO 3OW2U 3G71V 3JSNA 3CCVV 3E8BA 4KL1A 3C3TA 2XTAA 3I5DA 1HR0O 1BGYH 3QF7A 3U11A 2CTPA 5KHJA 2EIKB 3SPJA 3OUFA 2EIKC 4F6RA 1R6TA 1BHAA 5EC2C 5B3SB 2QKCA 2QE7G 5B3SC 4JZGA 2ZCEA 2HVJC 2BOCC 1BL8A 2KG7B 2OCCC 4LF7B 1PL0A 3LUTB 3CPWU 1H2SB 1IDSA 2ADPA 3G67A 4DV4O 3G4SV 1YTFD 3WB0A 4C7UA 5B1AB 5KA6A 1PP9H 5B1AC 2Z0AA 3BY6A 4FM0A 4I4TB 2F66C 3P30A 5CA1B 1V54C 2B9ZA 2WAMA 1GN6A 2IH1C 2QDOA 1UFIA 5LA6B 3ZBHA 3QO5A 5DECA 1Q81W 2EULA 4BIOA 1P49A 4JI6O 5L3BA 1TGOA 5BMVA 2X6CA 3DC5A 2EILC 1VP7A 2NLJC 2F1MA 2JGUA 5JH7B 1AB3A 3H1LH 3CRCA 2Q67A 1XMQB 4D6TH 2L6LA 4WCEV 1RSOB 1PNKA 5CBGA 4NXMB 5EIBC 1IBMO 3Q4HA 3STLC 3LDDA 3UCSC 5KMGA 2YSUB 2OTJV 5H5NA 4QGPA 2RNBA 1XHZA 4ZOLA 1N34O 5LMNO 4NTYA 3ZIAG 2UXDO 1VMGA 1SERA 3K5LA 4U3JA 3GB7C 3RYCB 1G6UA 1PD3A 1K4CC 3L70H 4B08A 4DV3O 3CC7V 4UCOA 5EYPA 1NJIW 1YVWA 1AJPA 2MK3A 4JI8B 1XMOB 4GKKB 4X1YB 4DR6B 3RVYA 1DLBA 1M57C 4HZ3A 4B3SO 3M99B 1MABG 1TUBA 3O65A 4UCRA 5K1PA 3HKBB 3G6BA 1TUEB 4HNAA 5LP6B 4MW3A 5LP6C 3DC6A 1N36B 2VQFO 1K73W 2RCVA 3SJBC 2QJ1A 1FD9A 4LF8O 4PDLA 2DE0X 1RPOA 1DGSA 2ZR2A 5B1OA 5LMUB 4UXNA 3WFVA 4JYBA 4GT1A 2JS5A 4X20A 2EZPA 3CS5A 1YZBA 3N2KA 2Q0AA 2ZDIA 5C93A 1R6KA 1IZ3A 2HR3A 3ZHRA 1NR1A 4X64O 2ODMA 3LNMB 2Y0IA 3H1HH 1HNWB 1OZ0A 2XNDG 1IBKB 4DXWA 1CPYA 2OT5A 1VIBA 1QLNA 4L8JA 4WFBV 3BFRA 1FJGB 3CXCU 1FXKB 5LGTA 1FXKC 3X2QB 1PM9A 2OIGA 1KP3A 4MW8A 5IY5C 4AILC 3X2QC 3FYIB 2X7RB 3PJSK 1VQOV 4QIWF 2PTMA 4U7OA 4X66B 1B3QA 2ZNJA 4Z1VA 3JAWA 3DXRA 4WFAV 2CE4A 3HKCB 3SYOA 1B06A 3K0DA 4JYAO 1R73A 3E8HA 1M90W 3K06A 4ZI7A 2NNUA 1H2LA 1PL4A 1P7BA 4QNHB 4GYCB 2BCCH 2CAZC 4DV4B 2UUCO 2V7QG 4O2BB 1VARA 1BMFG 1I0HA 2GV9A 2OTLV 1VQ6V 1H2NA 1B6QA 4JV5O 3LDEA 2YICA 4JI3O 2P7TC 4CH5A 4JAUA 4I50B 3JARB 2Q9LA 4PA9A 3ABLB 2KG7A 3ABLC 4MT8A 4WF9V 1YXBA 3A0BZ 3ZN1A 4DV6O 3SR2C 4DR1O 2QTSA 1TAEA 3I55V 2YI9A 3HKDB 4JTCB 1K7DA 1WJZA 4JI6B 4IHJB 5JQGA 4FM1A 3UM7A 4PA6A 2HVKC 2UXCB 3AK3A 1Q6UA 4GX1A 4DK0A 2QKSA 4LFAB 5ITZA 3SYCA 2VQEO 1P7GA 2CTRA 4A5UB 1FFXB 5LA6A 2IU0A 5J2TB 2XAJA 4KHPB 3OR6C 2DN9A 4TT3G 2E76B 1V9PA 4PV1B 1S5JA 4DV2B 1S76D 4J9ZB 2Y0PA 4O4IA 4F6EA 1R3LC 1SQQH 5KAIZ 3W7UA 4OPAA 2UXDB 3JAMN 2D2CB 2P22C 3JD4A 2Q7EA 4F6RB 1F23A 2R9AA 1OCCC 3RW0A 1HNXO 4GCZA 3KCYA 3CCRV 4DV3B 2WA4A 4LFCB 3ASNC 1R3KC 2WLNA 1NTMH 4GX2A 4MVRA 5KHKA 3T1YB 4FLWA 1IXMA 1IVSA 2QWNB 5CBHA 1XNQO 1K9MW 2YXYA 1OJHA 4LH6A 4DR7O 1GH6A 4JAVA 2YC0A 4IYIA 4PA3A 1W0JG 2P6JA 4O4LA 1F4NA 4NYKA 3H01A 4DR2B 2PI4A 4LF8B 3TXQA 2N74A 4X1KA 5LOVA 2VRZA 4BW9A 1EFRG 4R7CA 5HFLA 3K5OA 4RO2A 1QVGU 4YHHB 2HHHO 1V55B 1FPOA 1V55C 3B40A 3CCMV 5BMVB 1VQ9V 1ZAUA 4ABMA 2QA4V 1M1KW 3JSLA 3M7MX 3TCUA 2Y69B 5LP6A 2QWPB 1LUVA 1N32B 1FKAO 3K79A 2OYQA 4LWSA 1K97A 3VBBA 4FFBA 5H6QA 3E35A 1TVKA 2QEXV 4OXSA 1VQ4V 2CTQA 3E2EA 1S0VA 3ZEDA 5A2QN 4GX0A 1GM9A 3Q4HB 3SJAC 1YJ9V 4RWUA 2FMLA 3LSQA 5KMGB 2YIDA 4LF6O 1SETA 4WFFA 3OUSA 3JATA 2VS0A 2YDEA 3MHHC 5B1NA 5HFMA 2ITDC 3ZHUA 3OTOO 4K0KB 3FB6C 2LJ2A 1VQ5V 2CK3G 3CCLV 2DYRC 4DRXB 3JD0A 2HJDA 3FKSG 3K58A 2PY5A 1Y6XA 4B3TO 1FXKA 4LCUC 1YCIA 1IX9A 1UPGA 2UUCB 1IBLO 2WWWA 1KB9F 1THZA 1GMGA 2BSKA 1TUBB 4UVAA 4O4JA 4B7KA 1SQXH 1GM7A 2WA3A 4PDRA 4E4EA 1VQLV 1AI4A 1JR9A 4J10A 3L74H 1W59A 4JI3B 2P4KA 1SQGA 4TSFG 5CN0A 3IGAC 3APQA 3CC2V 1R1BA 3T1HO 4K35A 1I5YA 4X20B 4DR1B 3N2KB 3B4SA 3ZMTA 4LNUA 4O2BA 2PF4E 4O4HA 2F93B 1KYOF 2XAQA 2QM4A 1SZTA 4OX9B 4ZHQA 1OCRC 4GX5A 1Y67A 4N23A 2B1IA 3KKYA 4JF3A 5IYZA 2DMXA 2DWEC 3L9DA 3OE7G 1JVMA 1I94B 1PNLA 3O9OA 4X88A 3IJ4A 3JARA 4I0XA 3JYCA 1Z2GA 3CRRA 2EZOA 4KUMA 2WPDG 3K5MA 2N04A 2JRIA 5IJ9A 4X65O 1VQPV 4FLUA 3SPHA 2P90A 4G27B 4LBEC 3HKEB 3ABKC 1Z5VA 2DOSA 5LYJA 4MS2A 3JAWB 2ZKOA 1J95A 3DXRB 1XILA 1HW7A 3M8AA 3CCQV 1Q43A 4P9PA 3P3PA 1H8EG 4TUYA 1Q86W 2ZR3A 4FLTA 3B09A 3RGBA 2GTAA 2LW7A 3BEHA 1KMIZ 3OGCC 1S5LZ 3RFRA 5K1XA 1WP8A 2ZE6A 4MVZA 3OTFA 1DTOA 3ZHSA 4W4LA 3SYQA 5EIBD 3OEHG 2XAGA 3OFNG 1N4CA 1Z5WA 5TISZ 1N0JA 4MVMA 1Y66A 2ZE5A 1M93A 4UUJC 1KKCA 1WLEA 3T4DA 3JD2A 5LBQA 4AQYB 1OCZC 1QBZA 2KKWA 1VF6C 3CRMA 5IYDO 3VQWA 2OCCB 2PGGA 4JZ2A 3WB2A 4B3MO 3P3NA 2BTOA 1VQMV 1YJWV 1R6NA 4J42A 2HFEC 4FJCC 5L3DA 4FLXA 2HHHB 4LC1A 5JQGB 4YIPA 2JVDA 1V54B 5JVDA 3CXHF 3RVZA 3N2GB 5BR8O 1IXBA 3T1CA 3D3IA 1AILA 3SPCA 2UUAO 3ZCCA 3TK1A 4MVSA 5FL7G 1K34A 3WG7B 2FTKA 1GK9A 3WG7C 5H2FZ 5ITZB 1EZVH 4X62O 2ZM6O 1QCEA 3CRQA 3FAVA 4FVMA 2GBOA 3ZRXA 4YJ3B 3L73H 4IGGA 4H37A 4O4IB 2EILB 1ORQC 4O2AA 3CX5F 2KB1A 1O9HA 4FM2A 1WPBA 1QU7A 3APOA 3OTOB 1M5IA 2IJJA 1K8AW 1YHQV 2YS8A 3B8NA 4NXNO 2NN4A 5L3FA 5LL6Y 1TA8A 3SGIA 4MTFA 5LXTB 4UFZA 1N33B 1AR1B 2E5LB 3RYFA 2QWQB 4LFBO 3CJHA 1IBLB 2BOBC 3SPIA 1JOYA 2XUMA 2Q6AA 5KLVH 4DUZO 3L72H 1SQVH 2YXLA 1H2MA 4PA4A 1KP2A 1FXHA 3BHPA 3NXSA 3ETDA 4DV0O 5GONA 2X6AA 4RQEA 4O4LB 3MDSA 2AHYA 2FL4A 1JCHA 4QE7A 4DRXA 1YTFB 1ZUQA 5D5PA 4MVQA 4DUYB 4UB6Z 3EVKA 1DF5A 4X1KB 3CSXA 2IH3C 3T1HB 2EINC 5LOVB 5L3EA 1SA0B 3CE2A 1M57B 3T4ZA 3HR0A 4D7SA 4BWAA 1M56B 1U97A 3ETQA 4JI7B 4DR3O 1M56C 4N21A 4XDJA 1WN7A 1OCOB 1OCOC 3AG4B 4ZBMA 1AJNA 1H8HG 3AG4C 4HBNA 3ZJZA 3JD3A 3U10A 3J7AU 2EIMC 4LWSB 4FFBB 4Q6GA 1TVKB 5E1AC 3CC4V 2XAHA 1BQZA 4BR6A 3QTCA 4BW5A 4CS2A 1HWYA 2WLHA 4P2ZA 3DTUB 1NKDA 1WP7A 2CGOA 4CS3A 2YI8A 3BABA 1S77D 2HLDG 3QNEA 1YIJV 2RDCA 3CEIA 1QR9A 1X59A 1SESA 2P5OA 3JATB 3UO2A 1VF7A 1N0NA 4UV9A 2IJIA 1Y4MA 3EXAA 2X6BA 5IYCO 2F95B 1NT2B 4BIZA 1GKFA 2P4VA 3OD4A 1MG1A 1XL6A 4DV1B 2ZXWC 3LDCA 5FLXN 5IY5B 3IAYA 2Y4UA 3K0GA 1YSCA 4GKJB 2AHZA 1M4UA 4DW0A 2ATKC 3HKEA 2BSKB 5GTHZ 4O4JB 1HR0B 4JI1O 3FB8C 5JJEB 4X89A 4LF5O 4DW1A 1B04A 4J7KA 3PN1A 2UUBO
chains in the Genus database with same CATH topology
1EFRG 3KG2A 5BZBA 1NVPD 1JJ2U 1VQ8V 4QPJA 4R7CA 5HFLA 1RM1B 1RM1C 4RO2A 2DWDC 2JJ2G 1QVGU 2JK5C 1V55B 3FB7C 1V55C 2W6IG 3VOUA 3CCMV 3RBZA 1VQ9V 5CA3A 2QA4V 1M1KW 3CCSV 3TCUA 2Y69B 4E2LA 3CYOA 3ZRVA 1E1QG 4XBFA 1S5HC 3K79A 1JQ0A 4FK5C 2EINB 4Z1MG 1K97A 3VBBA 3ZMUA 3E35A 3JD1A 5H6QA 2QEXV 4PELA 4MVOA 2A9HA 4OXSA 1VQ4V 3E2EA 2HJFC 3OEEG 4JTDB 1S0VA 4XDKA 2IW5A 1NBMG 4MTXA 3ZRSA 4U7NA 3F7VC 4GX0A 1GM9A 5LHHA 1YJ9V 1H38A 3ZN0A 2DYSB 3LSQA 1R3JC 2Z5UA 2DYSC 1P4RA 4MSWC 3ZMSA 3OAAG 1SETA 4WFFA 3OUSA 5IDJA 2YEVA 2EIMB 3OW2U 3G71V 3CCVV 3MHHC 5B1NA 4R8CA 5HFMA 3E8BA 1UJWB 2ITDC 2A0LA 4BIUA 2WLIA 2DQ3A 3AG3C 3FB6C 1VQ5V 4XDLA 2R9IA 3ZRWB 2CK3G 2EIKB 3SPJA 3CCLV 2DYRC 4X8AA 3OUFA 2EIKC 4FPPA 4JYCA 3JD0A 3FKSG 1BHAA 5EC2C 5B3SB 1GM8A 5B3SC 2QE7G 1FXKA 4P9OA 2HVJC 1AJQA 3FB5C 4LCUC 2BOCC 1BL8A 2OCCC 4UVCA 3IC7A 1PL0A 1ROPA 3LUTB 3CPWU 2WWWA 1THZA 2UXNA 1GMGA 2W0FC 3G4SV 1COWG 1YTFD 3TETA 4UVAA 4G28B 4PA7A 5B1AB 5KA6A 5B1AC 1VQLV 1GM7A 4PDRA 1OCCB 1AI4A 3BY6A 2PI5A 4G2KA 2K1EA 3LSSA 2ZXWB 1VQKV 3P30A 3QO7A 1Q7YW 1NVPB 1K33A 1V54C 2WAMA 3ETGA 1JPXA 5EBMC 5EK0A 3MD0A 4TSFG 5CN0A 3B77A 3IGAC 3ASNB 1NR7A 3CP1A 3CC2V 2IH1C 3B8MA 3E8FA 3CCJV 1VQNV 3W7XA 1GTOA 1I5YA 4HAMA 4JTAB 3DGEA 4P30A 3EHBB 4I5SA 3QO5A 1Q81W 3ABUA 3ZMTA 1KKDA 2XAQA 1MOFA 5L3BA 1SZTA 2QM8A 2X6CA 4QE9A 3OR7C 1OCRC 4GX5A 2EILC 2NLJC 4N23A 1KD1W 2QTOA 1G4YB 1BHBA 2B1IA 1K5QA 2W6JG 4JASA 4JF3A 1G8MA 2DWEC 3QO8A 2C2AA 3GWOA 3OE7G 1JVMA 1PNLA 3ZMVA 2Q67A 4X88A 3CMEV 3JYCA 4WCEV 3T2MA 2EZOA 1PNKA 4KUMA 1NH2D 2WPDG 4WFHA 5CBGA 2XASA 2EIJC 2JEUA 5LHIA 1VQPV 3SPHA 3STLC 4F4LA 2P90A 3LDDA 5LGUA 4G27B 4LBEC 2YSUB 3ABKC 2OTJV 1NQTA 3OM3B 4LP8A 4MS2A 1J95A 2ITCC 4WFGA 2Q68A 3CCQV 5J9PC 3ZIAG 4P9PA 4ASUG 2WLLB 5DN6G 1H8EG 2HKOA 1F4MA 3ZRWA 1Q86W 2ZR3A 2IU3A 1E79G 2JIZG 1SERA 3HPLC 3GB7C 4YXWG 1KC8W 3BEHA 1PD3A 5IYBO 1K4CC 3OGCC 4H33A 3CC7V 1S3JA 3R65A 2X0LA 3AG2C 4MVZA 3CD6V 1DTOA 4FMTA 4PDMA 1AROP 3SYQA 1NJIW 3E89A 4FIPC 2JDIG 2HG5C 1AJPA 2MK3A 1ENVA 2XAGA 1E1RG 3AEIA 3AG3B 3OEHG 3OFNG 1GO3F 4R50A 3RVYA 1DLBA 1M57C 4HZ3A 4MVMA 1Y66A 5LHGA 3M99B 1MABG 4UUJC 4BAYA 1CEZA 2DYRB 1WLEA 2F43G 3T4DA 3JD2A 5LBQA 1TUEB 2B5UA 1OCZC 1AI7A 1QBZA 4MW3A 3E83A 5IYDO 1K4DC 1K73W 2OCCB 1WPXA 3K04A 2A79B 3EFFK 4PDLA 1RPOA 3SJQC 1VQMV 2ZR2A 5B1OA 1YJWV 1R6NA 5LGNA 2HFEC 4UXNA 2JEXA 4RAIA 4JYBA 3WFVA 4GT1A 4FJCC 5L3DA 2EZPA 4LC1A 4L87A 2ZDIA 1KECA 5C93A 1L1FA 1R6KA 3ASOC 4QPKA 4HYOA 3CCUV 1VQ7V 2HR3A 2YEVB 1QLEB 2XAFA 3JCZA 1N8RW 1V54B 1NR1A 1QLEC 3RVZA 3LNMB 1NH2B 3ML0A 3T1CA 1OZ0A 3D3IA 3SPCA 4Q20A 3E86A 2XNDG 3ZCCA 1JX9A 3TK1A 1YITV 4MVSA 3UKMA 4DXWA 1QVFU 5H6RA 5FL7G 1K34A 1CPYA 2OT5A 3WG7B 2FTKA 1GK9A 3WG7C 4UV8A 1QCEA 1QLNA 1AI5A 1M9NA 4UVBA 2IJHA 1QR8A 5H9CA 3HB3B 4WFBV 3ABMB 3ABMC 3OMNB 3CXCU 2IJKA 1FXKB 1OHHG 5LGTA 3ZRXA 4MTGA 1FXKC 2GHYA 3X2QB 1KP3A 1RPRA 4MW8A 5IY5C 3X2QC 3FYIB 4H37A 1OCRB 2EILB 2X7RB 3PJSK 1ORQC 2KB1A 1VQOV 4QIWF 5EC1C 4U7OA 1K5SA 2IJJA 1K8AW 4KP4A 3OMAB 5CBFA 1LNQA 1YHQV 2WLMA 3B8NA 2H8PC 4WFAV 2WLKA 5L3FA 3SYOA 3K0DA 1K3EA 2WLLA 3CCEV 2R9RB 2D3OW 3F7YC 3K03A 3SYAA 2EIJB 1R73A 1YJNV 1H2GA 4MTFA 3E8HA 1M90W 3ETEA 3K06A 5L3CA 4DO2A 2NNUA 1AR1B 1PNMA 3ABKB 3STZC 1S72V 1P7BA 4QNHB 2BOBC 3SPIA 1KQSU 1JOYA 1YI2V 3CMAV 2Q6AA 2V7QG 3OMIB 3A0RA 4PA4A 1KP2A 1FXHA 2ZQMA 3NXSA 3IFXA 3ETDA 3ABTA 1BMFG 1DF4A 2X6AA 4RQEA 2EBOA 1W2BU 2OTLV 1VQ6V 2AHYA 1JCHA 2WLJA 3F5WC 4QE7A 4RUEA 1B6QA 1YTFB 3LDEA 1W0KG 1FXVA 3K08A 2P7TC 2Y69C 4JAUA 4MVQA 2LFRA 3AG2B 3W7SA 1DF5A 4JGSA 2IH3C 2JJ1G 2EINC 4PA9A 2Z3YA 3ABLB 3K3WA 3E8GA 3ABLC 4MT8A 4WF9V 1Q82W 5L3EA 1M57B 3ZN1A 2XOKG 5EBWC 3T4ZA 1EZJA 2QM7A 1EBOA 1M56B 3W7TA 1M56C 4N21A 4XDJA 3I55V 4JTCB 1K7DA 5B1BB 2Q69A 1OCZB 1OCOB 5DM6V 5B1BC 2EJRA 5KUKA 1OCOC 2LP7A 3AG4B 1AJNA 4ZBMA 3P32A 1H8HG 3AG4C 3SYPA 3UM7A 3ZJZA 2B1GA 4JPRA 3JD3A 4PA6A 2HVKC 2EIMC 2UXXA 4CZZA 1ZWIC 3CC4V 5E1AC 2GSMB 4GX1A 2XAHA 4BW5A 5EBLC 1HWYA 2QKSA 2WLHA 4P2ZA 3DTUB 3ZMZA 1NKDA 1R3IC 3SYCA 4R6ZA 4MVUA 2WSSG 4EKWA 2IU0A 2M7WA 2XAJA 1S77D 2HLDG 3QNEA 3OR6C 4TT3G 3W7WA 1YIJV 3ASOB 1QR9A 1SESA 1AI6A 3G6EV 1S76D 4KFMA 4UV9A 2IJIA 4J9ZB 1R3LC 2Y48A 2WLIB 4TWKA 3AG1B 1Y4MA 3AG1C 4QJFB 3W7UA 3I56V 2X6BA 5IYCO 1FFTB 3JD4A 1F51A 1SRYA 1K92A 4BIZA 1GKFA 4J9YB 4ZKIA 1F23A 3FYEB 1OCCC 4CBCA 1MG1A 3RW0A 5L3GA 1FS0G 1XL6A 4MTOA 2ZXWC 3LDCA 4GCZA 4PDVA 2P67A 3CCRV 5IY5B 3K0GA 1YSCA 2AHZA 3ASNC 1R3KC 3MHSC 2ATKC 2WLNA 4GX2A 4MVRA 4RUFA 5GW7A 1IXMA 1MSWD 1XL4A 2DQ0A 5CBHA 1K9MW 4I9WA 5CMUA 1CP9A 3FB8C 3K9AA 2ZDIC 2LFSA 4X89A 4JAVA 2DW4A 4PA3A 1W0JG 5KA5A 2P6JA 1F4NA 1I5XA 3H01A 1PKXA 5KUMA 2V1DA 2PI4A 3SPGA 4WFEA 4RQFA 3D36A 2ZD9A 2H94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GHY A;  1GMG A;  2IJI A;  1F4M A;  1B6Q A;  1RPO A;  1F4N A;  1GTO A;  1ROP A;  1PD3 A;  1RPR A;  3K79 A;  4DO2 A;  1NKD A;  2IJK A;  2IJJ A;  2IJH A; 
#chains in the Genus database with same CATH topology
 4UCU A;  4LNU B;  1NVP D;  1JJ2 U;  1VQ8 V;  4O4H B;  4JI5 O;  2JJ2 G;  4X9Q A;  1Y74 A;  4ZHQ B;  3RN4 A;  3CCS V;  5BR8 B;  3CWB H;  5IYZ B;  1VF6 A;  5KHG A;  2UUA B;  4XBF A;  1S5H C;  2QGN A;  1JQ0 A;  4FK5 C;  4Z1M G;  4I0X B;  3JD1 A;  2ZM6 B;  4PEL A;  2A9H A;  2UXB O;  2HJF C;  3S3X A;  1BSM A;  2IW5 A;  3BRC A;  5IJ9 B;  3VQX A;  5FPR A;  2DYS B;  1R3J C;  2DYS C;  3ZMS A;  3NR7 A;  3GVM A;  5IDJ A;  4CH4 A;  1XRE A;  5LYJ B;  2GUZ A;  2NR5 A;  3N2G A;  4PI0 A;  1UJW B;  2G38 A;  4BIU A;  2WLI A;  3AG3 C;  3E22 A;  4XDL A;  4TUY B;  2RJZ A;  2PYJ A;  4FPP A;  4JYC A;  4H44 B;  1IBM B;  3SDL A;  1GM8 A;  1KU9 A;  4DR4 O;  4NR1 A;  2VWJ A;  1AJQ A;  1L0N H;  4YJ3 A;  5IE9 A;  2OIE A;  1AVM A;  2UXN A;  4DUZ B;  2E75 B;  1A32 A;  2W0F C;  1N34 B;  5LMN B;  1COW G;  3TET A;  4G28 B;  4DV0 B;  4LF9 O;  4PA7 A;  1OCC B;  5FNV B;  1I7F A;  4NB5 A;  1F7Y A;  4G2K A;  2K1E A;  3LSS A;  1WB7 A;  1VQK V;  3QO7 A;  1NVP B;  1D5A A;  4D7T A;  3ETG A;  5EK0 A;  3MD0 A;  5LXT A;  4WBN A;  1URF A;  3JAL A;  3ASN B;  1NR7 A;  3CP1 A;  3E8F A;  1VQN V;  1Q90 D;  4HAM A;  4JTA B;  3DGE A;  4P30 A;  3EHB B;  4B3S B;  2H3O A;  4PHZ A;  3ABU A;  4DR3 B;  1KKD A;  5JJN B;  1WB8 A;  2PYL A;  5JVD B;  1JFF A;  4JI4 O;  4W4K A;  3OR7 C;  2VQF B;  1KD1 W;  1BHB A;  1K5Q A;  4JAS A;  4I7Z B;  4DYL A;  2C2A A;  3GWO A;  4GUN A;  2Q8V A;  3FAV B;  1EN6 A;  3ZMV A;  1YDX A;  3CME V;  1GN3 A;  4YJ2 A;  2YXH A;  3T2M A;  1SA0 A;  1NH2 D;  3A8T A;  2XAS A;  2EIJ C;  4I55 A;  5LHI A;  4X64 B;  2Q0O C;  1JMK C;  4O2A B;  3AG7 A;  1SC5 B;  2YIB A;  4LP8 A;  3OM3 B;  3U0Z A;  2ITC C;  5J9P C;  1XEQ A;  4ASU G;  1XNR O;  3ZRW A;  2VWK A;  3HPL C;  1WNS A;  1O9G A;  1KC8 W;  3RYF B;  5IYB O;  3CJH B;  3R66 A;  3R65 A;  5IJ0 A;  3AG2 C;  3C90 A;  1ZL8 A;  2FB5 A;  3CD6 V;  4PDM A;  3CB2 A;  2AGA A;  5IWA O;  2JDI G;  2HG5 C;  4R50 A;  1E1R G;  3AEI A;  5GON B;  3QG5 A;  4H13 B;  2DYR B;  2F43 G;  1XDC A;  5D5Q A;  4JYA B;  3H1K H;  1K4D C;  1WPX A;  3N27 A;  2UUB B;  3K04 A;  3ZHV A;  3EFF K;  1WAZ A;  2ZIN A;  5LGN A;  4JI5 B;  2JEX A;  4RAI A;  3D8C A;  2A7W A;  4I9Q A;  5KHI A;  4L87 A;  4TV9 A;  2A3Q A;  4NXM O;  3ASO C;  4QPK A;  4HYO A;  1N8R W;  2YEV B;  4JV5 B;  1QLE B;  2XAF A;  1QLE C;  3RYH A;  5FPO A;  1NH2 B;  3ML0 A;  3E86 A;  1QVF U;  5H6R A;  1G1X B;  4IIJ A;  4DV7 O;  2CH7 B;  4K3A A;  5J2U B;  4DV6 B;  1L0L H;  2AW9 A;  2IJH A;  1QR8 A;  5H9C A;  1QNM A;  4JI2 O;  2QWR B;  3OMN B;  1OHH G;  4MTG A;  2GHY A;  4JYY A;  4B7E A;  1OCR B;  1RP3 B;  2QR4 A;  2A06 H;  4CC5 A;  5EC1 C;  1K5S A;  4KP4 A;  3OMA B;  2CDY A;  4PD4 F;  1LNQ A;  4JI8 O;  4DR6 O;  2VQE B;  2H8P C;  2WLK A;  3ZX6 A;  2WLL A;  2D3O W;  2CGN A;  3F7Y C;  3SYA A;  2Y4T A;  3UO3 A;  2AZ2 A;  4UB8 Z;  1YJN V;  1HP8 A;  2GTS A;  3L75 H;  5DED A;  4FLV A;  1BT8 A;  1N36 O;  1PNM A;  3ABK B;  3RYI B;  1XI1 A;  1KQS U;  4TQF A;  2HEP A;  2Q73 A;  3A0R A;  3OT7 A;  3ABT A;  1CXZ B;  2EBO A;  1HNX B;  1W2B U;  5EZY A;  3F5W C;  3VQY A;  1RFY A;  3K08 A;  3A2F A;  3W7S A;  4TV8 A;  5BY1 A;  4CH3 A;  3K3W A;  1IBK O;  3E8G A;  1XNQ B;  1NZ6 A;  5EBW C;  3ICX A;  1SQB H;  1SS3 A;  1Y74 B;  4DR7 B;  4Z2W A;  2M6Y A;  1FJG O;  1OCZ B;  3H1J H;  5DM6 V;  5KUK A;  5FNV A;  2LP7 A;  4LF4 O;  1QQC A;  3SYP A;  2B1G A;  4OGQ B;  2N05 A;  3UT5 A;  2Q4P A;  1ZWI C;  4CZZ A;  3L71 H;  4J11 A;  4X66 O;  3AK2 A;  3ZMZ A;  3VQV A;  4MVU A;  2WSS G;  4DR5 O;  2LO1 A;  2M7W A;  3FX7 A;  1YEW A;  5BXZ A;  1FYJ A;  1AI6 A;  2GUZ B;  4KFM A;  2F23 A;  2Y48 A;  2WLI B;  3AG1 B;  1BS3 A;  1NTZ H;  3RWR D;  3AG1 C;  3E22 B;  4QJF B;  1MZE A;  1FFT B;  4J7Z A;  1SRY A;  1K92 A;  1Q3E A;  1XNR B;  1QHT A;  2YIB D;  3JAS A;  1AP6 A;  5CB4 A;  1FS0 G;  2OCH A;  4PDV A;  1EN4 A;  1GAX A;  4LF6 B;  4DK1 A;  5GW7 A;  2QSA A;  3MHS C;  4YIO A;  4RUF A;  5IWA B;  2DQ0 A;  1AP5 A;  4I9W A;  1CP9 A;  1GN4 A;  3K9A A;  1HNZ O;  5JCO C;  1SZX A;  1LR1 A;  2O57 A;  4WBN B;  4B3T B;  3JAL B;  2LGW A;  2UXC O;  1PKX A;  5KUM A;  2V1D A;  2BTQ A;  4WFE A;  1NS1 A;  4JI0 O;  2ZD9 A;  2H94 A;  2JGD A;  5IT9 N;  5BZB A;  4LFA O;  1AR5 A;  3ZS8 C;  1MZF A;  2JK5 C;  1JFF B;  4KHP O;  3B2E E;  2W6I G;  3BA9 A;  3LSU A;  5CA3 A;  4TQD A;  4E2L A;  1GN2 A;  4DV2 O;  3ZRV A;  1MA1 A;  2EIN B;  2ZIM A;  4DV7 B;  3MAQ A;  4YJ2 B;  4MVO A;  2YIA A;  1Y76 B;  4JTD B;  4JI2 B;  3ZRS A;  4U7N A;  4I55 B;  2IM9 A;  2Z5U A;  2JS3 A;  4LFC O;  1SQP H;  2YEV A;  2EIM B;  5CA0 A;  1EM1 A;  1U96 A;  4DV5 O;  4R8C A;  3T1Y O;  4EB6 A;  2A0L A;  3WU2 Z;  2DQ3 A;  3JAK A;  2R9I A;  3ZRW B;  2GDS A;  2CH7 A;  5J2U A;  4X8A A;  3A0H Z;  4X65 B;  2OWO A;  1MNG A;  3GWK C;  3DSQ A;  5IJ0 B;  4IYH A;  4P9O A;  1ZL8 B;  3FB5 C;  4DR2 O;  4UVC A;  1XUQ A;  3IC7 A;  1ROP A;  5C8Y A;  3K59 A;  4TOI A;  3H1I H;  2HP8 A;  5KX5 A;  3THO A;  1ZX3 A;  2KQX A;  4YHH O;  1PPJ H;  4X1I B;  2PI5 A;  2ZXW B;  1Q7Y W;  4CS4 A;  1K33 A;  3FFQ A;  1JPX A;  2QKA A;  5EBM C;  1NU1 H;  3B77 A;  1GRJ A;  5B5E Z;  2R72 A;  1MSD A;  1N32 O;  3CRA A;  3B8M A;  3FD9 A;  3CCJ V;  3W7X A;  3RYI A;  5E79 Z;  1GTO A;  4I5S A;  4CH6 A;  4TV9 B;  1SQF A;  4OPH A;  5A9G A;  1ZLZ A;  4LF4 B;  1MOF A;  3RYH B;  2P06 A;  1H2K A;  2QM8 A;  4QE9 A;  2QTO A;  1G4Y B;  2W6J G;  5JWP A;  1G8M A;  2F4V O;  3QO8 A;  4IIJ B;  4EFB A;  4B3M B;  1T5E A;  4GZR B;  4J41 A;  4K0K O;  4JAA A;  2UU9 O;  4DR5 B;  4NTW A;  4WFH A;  1D2D A;  1FAF A;  4UCV A;  2XT9 A;  2JEU A;  4F4L A;  4FZ1 A;  5LGU A;  1WA8 A;  1Q6I A;  3G80 A;  1NQT A;  4X62 B;  4WFG A;  2Q68 A;  3K57 A;  2WLL B;  5DN6 G;  2HKO A;  1F4M A;  2ZNI A;  4ICG A;  1J5E O;  2IU3 A;  1E79 G;  2JIZ G;  1SKV A;  3BA8 A;  1D5N A;  1VF5 B;  4YXW G;  3KZI Z;  2AZ0 A;  3CHX A;  4J80 A;  4H33 A;  3D36 C;  1S3J A;  1X4T A;  1JJO A;  2X0L A;  4J7J A;  1BZK A;  4FMT A;  1ARO P;  5JJJ B;  3E89 A;  4FIP C;  1ENV A;  3AG3 B;  1GO3 F;  4NXN B;  4AI8 A;  5LHG A;  5B66 Z;  1BE3 H;  1HNZ B;  4BAY A;  1CEZ A;  5EZY B;  4LR3 A;  2B5U A;  1AI7 A;  3E83 A;  1ZTE A;  4I4T A;  4TV8 B;  4OX9 O;  5CA1 A;  2QWO B;  4LFB B;  4JI0 B;  3RT3 C;  1KUQ A;  4PJ0 Z;  2A79 B;  3F5T A;  1I94 O;  2RMK B;  4NKG B;  3SJQ C;  5AG2 A;  3LNN A;  3S3W A;  1KEC A;  3TJT A;  1L1F A;  5JCO A;  3CCU V;  1VQ7 V;  3JCZ A;  1VEW A;  3UT5 B;  3SJC C;  4Q20 A;  2K9P A;  1JX9 A;  2Q7G A;  1YIT V;  3UKM A;  5JH7 A;  4UV8 A;  4H0L B;  1AI5 A;  1M9N A;  4UVB A;  4B3R O;  3HB3 B;  4YY3 O;  3ABM B;  1RSO A;  3ABM C;  2IJK A;  2EX3 A;  1RPR A;  1Q8I A;  4DV5 B;  2ZT9 B;  3J80 N;  5CBF A;  1DK1 A;  1L8D A;  2WLM A;  3JAS B;  2EJ7 A;  1Y76 A;  5CB4 B;  2CUG A;  1K3E A;  3CCE V;  2R9R B;  3K03 A;  4AQY O;  2EIJ B;  2CTW A;  1H2G A;  3ETE A;  5L3C A;  4DO2 A;  4UCT A;  3RYC A;  1YF2 A;  4U3F H;  1AR4 A;  3STZ C;  1S72 V;  2R70 A;  4LF7 O;  2DJV A;  2L35 A;  1YI2 V;  3CMA V;  3OMI B;  2ZQM A;  3IFX A;  4X1Y A;  3K5N A;  1P84 F;  4FZ0 A;  1DF4 A;  2PZS A;  2LQT A;  2WLJ A;  3HKB A;  2AXT Z;  4RUE A;  1NTK H;  2ZE7 A;  1W0K G;  3BPZ A;  1FXV A;  2ETN A;  2Y69 C;  2BTQ B;  1XHX A;  2LFR A;  3AG2 B;  1LUW A;  4JGS A;  3WB1 A;  2JJ1 G;  1JA8 A;  3K9S A;  3TGU H;  2RN9 A;  2Z3Y A;  2JGD B;  3BAA A;  1EN5 A;  1Q82 W;  4JI1 B;  2XOK G;  1EZJ A;  1MMM A;  2QM7 A;  1EBO A;  3W7T A;  4LF5 B;  5B1B B;  2FYU H;  2Q69 A;  5B1B C;  2EJR A;  3P32 A;  2ZIO A;  4X1I A;  4NVP A;  4JPR A;  2UXX A;  2F4V B;  2GSM B;  4ZOL B;  4K8Z A;  3UQ8 A;  2V4D A;  4GLX A;  5EBL C;  2BE3 A;  3AK1 A;  2ILM A;  2UU9 B;  4ZIB A;  1XMQ O;  1R3I C;  4R6Z A;  4U3J B;  4EKW A;  2Q5Z A;  4IT5 A;  1NI8 A;  4IL6 Z;  3W7W A;  3ASO B;  1XQ8 A;  4KXR A;  1N33 O;  4AHC A;  5CA0 B;  3G6E V;  5GTI Z;  5EYP B;  3OGI B;  1ZSP A;  3TXS A;  2E5L O;  4EB6 B;  4UCS A;  1BCC H;  3H9V A;  4TWK A;  2MW2 B;  3JAK B;  3BVO A;  2IBZ H;  5KHH A;  3I56 V;  2UXB B;  1F51 A;  5KAF Z;  2RQ6 A;  2FKX A;  4J9Y B;  4HNA B;  4ZKI A;  3FYE B;  1J5E B;  1I08 A;  4CBC A;  2ADQ B;  2Q7H A;  3HKC A;  1HDJ A;  5L3G A;  4MTO A;  3QVN A;  2P67 A;  4EFE A;  1OV9 A;  4DUY O;  1SF9 A;  5C8Y B;  2LW1 A;  1XL4 A;  2ZE8 A;  5KX5 B;  4FLZ A;  5CMU A;  4GKK O;  1XMO O;  1IUR A;  2ZDI C;  3ZHQ A;  2LFS A;  4JI7 O;  1XBL A;  1XOU A;  1US6 A;  2DW4 A;  1PV0 A;  3IC9 A;  4LH7 A;  5KA5 A;  4DR4 B;  1BQ0 A;  2LGQ A;  1I5X A;  3SPG A;  4RQF A;  2ARH A;  3D36 A;  2E3C A;  4I50 A;  1MSW D;  4CC6 A;  4EEQ A;  2PUS A;  3KG2 A;  3JCU Z;  4LF9 B;  3J81 N;  4QPJ A;  1RM1 B;  5LMU O;  1RM1 C;  2DWD C;  2W0X A;  3ZHT A;  3FB7 C;  4FFK A;  3VOU A;  3BCC H;  1Q6H A;  4NTX A;  3HKD A;  3RBZ A;  4IHJ A;  2E74 B;  3CYO A;  1E1Q G;  1HNW O;  3ZMU A;  2YUA A;  3C3S A;  4PI2 A;  2KSD A;  3OEE G;  1KBH A;  4B3R B;  4XDK A;  4YY3 B;  2XHB A;  1NBM G;  3KCX A;  4MTX A;  3F7V C;  1Q5O A;  4ZI7 B;  5LHH A;  1H38 A;  3ZN0 A;  4FLY A;  1FFX A;  1WA8 B;  5J2T A;  4DV1 O;  4JI4 B;  1P4R A;  4MSW C;  3OAA G;  3D3Q A;  5F2V O;  4K8X A;  4GKJ O;  3OW2 U;  3G71 V;  3JSN A;  3CCV V;  3E8B A;  4KL1 A;  3C3T A;  2XTA A;  3I5D A;  1HR0 O;  1BGY H;  3QF7 A;  3U11 A;  2CTP A;  5KHJ A;  2EIK B;  3SPJ A;  3OUF A;  2EIK C;  4F6R A;  1R6T A;  1BHA A;  5EC2 C;  5B3S B;  2QKC A;  2QE7 G;  5B3S C;  4JZG A;  2ZCE A;  2HVJ C;  2BOC C;  1BL8 A;  2KG7 B;  2OCC C;  4LF7 B;  1PL0 A;  3LUT B;  3CPW U;  1H2S B;  1IDS A;  2ADP A;  3G67 A;  4DV4 O;  3G4S V;  1YTF D;  3WB0 A;  4C7U A;  5B1A B;  5KA6 A;  1PP9 H;  5B1A C;  2Z0A A;  3BY6 A;  4FM0 A;  4I4T B;  2F66 C;  3P30 A;  5CA1 B;  1V54 C;  2B9Z A;  2WAM A;  1GN6 A;  2IH1 C;  2QDO A;  1UFI A;  5LA6 B;  3ZBH A;  3QO5 A;  5DEC A;  1Q81 W;  2EUL A;  4BIO A;  1P49 A;  4JI6 O;  5L3B A;  1TGO A;  5BMV A;  2X6C A;  3DC5 A;  2EIL C;  1VP7 A;  2NLJ C;  2F1M A;  2JGU A;  5JH7 B;  1AB3 A;  3H1L H;  3CRC A;  2Q67 A;  1XMQ B;  4D6T H;  2L6L A;  4WCE V;  1RSO B;  1PNK A;  5CBG A;  4NXM B;  5EIB C;  1IBM O;  3Q4H A;  3STL C;  3LDD A;  3UCS C;  5KMG A;  2YSU B;  2OTJ V;  5H5N A;  4QGP A;  2RNB A;  1XHZ A;  4ZOL A;  1N34 O;  5LMN O;  4NTY A;  3ZIA G;  2UXD O;  1VMG A;  1SER A;  3K5L A;  4U3J A;  3GB7 C;  3RYC B;  1G6U A;  1PD3 A;  1K4C C;  3L70 H;  4B08 A;  4DV3 O;  3CC7 V;  4UCO A;  5EYP A;  1NJI W;  1YVW A;  1AJP A;  2MK3 A;  4JI8 B;  1XMO B;  4GKK B;  4X1Y B;  4DR6 B;  3RVY A;  1DLB A;  1M57 C;  4HZ3 A;  4B3S O;  3M99 B;  1MAB G;  1TUB A;  3O65 A;  4UCR A;  5K1P A;  3HKB B;  3G6B A;  1TUE B;  4HNA A;  5LP6 B;  4MW3 A;  5LP6 C;  3DC6 A;  1N36 B;  2VQF O;  1K73 W;  2RCV A;  3SJB C;  2QJ1 A;  1FD9 A;  4LF8 O;  4PDL A;  2DE0 X;  1RPO A;  1DGS A;  2ZR2 A;  5B1O A;  5LMU B;  4UXN A;  3WFV A;  4JYB A;  4GT1 A;  2JS5 A;  4X20 A;  2EZP A;  3CS5 A;  1YZB A;  3N2K A;  2Q0A A;  2ZDI A;  5C93 A;  1R6K A;  1IZ3 A;  2HR3 A;  3ZHR A;  1NR1 A;  4X64 O;  2ODM A;  3LNM B;  2Y0I A;  3H1H H;  1HNW B;  1OZ0 A;  2XND G;  1IBK B;  4DXW A;  1CPY A;  2OT5 A;  1VIB A;  1QLN A;  4L8J A;  4WFB V;  3BFR A;  1FJG B;  3CXC U;  1FXK B;  5LGT A;  1FXK C;  3X2Q B;  1PM9 A;  2OIG A;  1KP3 A;  4MW8 A;  5IY5 C;  4AIL C;  3X2Q C;  3FYI B;  2X7R B;  3PJS K;  1VQO V;  4QIW F;  2PTM A;  4U7O A;  4X66 B;  1B3Q A;  2ZNJ A;  4Z1V A;  3JAW A;  3DXR A;  4WFA V;  2CE4 A;  3HKC B;  3SYO A;  1B06 A;  3K0D A;  4JYA O;  1R73 A;  3E8H A;  1M90 W;  3K06 A;  4ZI7 A;  2NNU A;  1H2L A;  1PL4 A;  1P7B A;  4QNH B;  4GYC B;  2BCC H;  2CAZ C;  4DV4 B;  2UUC O;  2V7Q G;  4O2B B;  1VAR A;  1BMF G;  1I0H A;  2GV9 A;  2OTL V;  1VQ6 V;  1H2N A;  1B6Q A;  4JV5 O;  3LDE A;  2YIC A;  4JI3 O;  2P7T C;  4CH5 A;  4JAU A;  4I50 B;  3JAR B;  2Q9L A;  4PA9 A;  3ABL B;  2KG7 A;  3ABL C;  4MT8 A;  4WF9 V;  1YXB A;  3A0B Z;  3ZN1 A;  4DV6 O;  3SR2 C;  4DR1 O;  2QTS A;  1TAE A;  3I55 V;  2YI9 A;  3HKD B;  4JTC B;  1K7D A;  1WJZ A;  4JI6 B;  4IHJ B;  5JQG A;  4FM1 A;  3UM7 A;  4PA6 A;  2HVK C;  2UXC B;  3AK3 A;  1Q6U A;  4GX1 A;  4DK0 A;  2QKS A;  4LFA B;  5ITZ A;  3SYC A;  2VQE O;  1P7G A;  2CTR A;  4A5U B;  1FFX B;  5LA6 A;  2IU0 A;  5J2T B;  2XAJ A;  4KHP B;  3OR6 C;  2DN9 A;  4TT3 G;  2E76 B;  1V9P A;  4PV1 B;  1S5J A;  4DV2 B;  1S76 D;  4J9Z B;  2Y0P A;  4O4I A;  4F6E A;  1R3L C;  1SQQ H;  5KAI Z;  3W7U A;  4OPA A;  2UXD B;  3JAM N;  2D2C B;  2P22 C;  3JD4 A;  2Q7E A;  4F6R B;  1F23 A;  2R9A A;  1OCC C;  3RW0 A;  1HNX O;  4GCZ A;  3KCY A;  3CCR V;  4DV3 B;  2WA4 A;  4LFC B;  3ASN C;  1R3K C;  2WLN A;  1NTM H;  4GX2 A;  4MVR A;  5KHK A;  3T1Y B;  4FLW A;  1IXM A;  1IVS A;  2QWN B;  5CBH A;  1XNQ O;  1K9M W;  2YXY A;  1OJH A;  4LH6 A;  4DR7 O;  1GH6 A;  4JAV A;  2YC0 A;  4IYI A;  4PA3 A;  1W0J G;  2P6J A;  4O4L A;  1F4N A;  4NYK A;  3H01 A;  4DR2 B;  2PI4 A;  4LF8 B;  3TXQ A;  2N74 A;  4X1K A;  5LOV A;  2VRZ A;  4BW9 A;  1EFR G;  4R7C A;  5HFL A;  3K5O A;  4RO2 A;  1QVG U;  4YHH B;  2HHH O;  1V55 B;  1FPO A;  1V55 C;  3B40 A;  3CCM V;  5BMV B;  1VQ9 V;  1ZAU A;  4ABM A;  2QA4 V;  1M1K W;  3JSL A;  3M7M X;  3TCU A;  2Y69 B;  5LP6 A;  2QWP B;  1LUV A;  1N32 B;  1FKA O;  3K79 A;  2OYQ A;  4LWS A;  1K97 A;  3VBB A;  4FFB A;  5H6Q A;  3E35 A;  1TVK A;  2QEX V;  4OXS A;  1VQ4 V;  2CTQ A;  3E2E A;  1S0V A;  3ZED A;  5A2Q N;  4GX0 A;  1GM9 A;  3Q4H B;  3SJA C;  1YJ9 V;  4RWU A;  2FML A;  3LSQ A;  5KMG B;  2YID A;  4LF6 O;  1SET A;  4WFF A;  3OUS A;  3JAT A;  2VS0 A;  2YDE A;  3MHH C;  5B1N A;  5HFM A;  2ITD C;  3ZHU A;  3OTO O;  4K0K B;  3FB6 C;  2LJ2 A;  1VQ5 V;  2CK3 G;  3CCL V;  2DYR C;  4DRX B;  3JD0 A;  2HJD A;  3FKS G;  3K58 A;  2PY5 A;  1Y6X A;  4B3T O;  1FXK A;  4LCU C;  1YCI A;  1IX9 A;  1UPG A;  2UUC B;  1IBL O;  2WWW A;  1KB9 F;  1THZ A;  1GMG A;  2BSK A;  1TUB B;  4UVA A;  4O4J A;  4B7K A;  1SQX H;  1GM7 A;  2WA3 A;  4PDR A;  4E4E A;  1VQL V;  1AI4 A;  1JR9 A;  4J10 A;  3L74 H;  1W59 A;  4JI3 B;  2P4K A;  1SQG A;  4TSF G;  5CN0 A;  3IGA C;  3APQ A;  3CC2 V;  1R1B A;  3T1H O;  4K35 A;  1I5Y A;  4X20 B;  4DR1 B;  3N2K B;  3B4S A;  3ZMT A;  4LNU A;  4O2B A;  2PF4 E;  4O4H A;  2F93 B;  1KYO F;  2XAQ A;  2QM4 A;  1SZT A;  4OX9 B;  4ZHQ A;  1OCR C;  4GX5 A;  1Y67 A;  4N23 A;  2B1I A;  3KKY A;  4JF3 A;  5IYZ A;  2DMX A;  2DWE C;  3L9D A;  3OE7 G;  1JVM A;  1I94 B;  1PNL A;  3O9O A;  4X88 A;  3IJ4 A;  3JAR A;  4I0X A;  3JYC A;  1Z2G A;  3CRR A;  2EZO A;  4KUM A;  2WPD G;  3K5M A;  2N04 A;  2JRI A;  5IJ9 A;  4X65 O;  1VQP V;  4FLU A;  3SPH A;  2P90 A;  4G27 B;  4LBE C;  3HKE B;  3ABK C;  1Z5V A;  2DOS A;  5LYJ A;  4MS2 A;  3JAW B;  2ZKO A;  1J95 A;  3DXR B;  1XIL A;  1HW7 A;  3M8A A;  3CCQ V;  1Q43 A;  4P9P A;  3P3P A;  1H8E G;  4TUY A;  1Q86 W;  2ZR3 A;  4FLT A;  3B09 A;  3RGB A;  2GTA A;  2LW7 A;  3BEH A;  1KMI Z;  3OGC C;  1S5L Z;  3RFR A;  5K1X A;  1WP8 A;  2ZE6 A;  4MVZ A;  3OTF A;  1DTO A;  3ZHS A;  4W4L A;  3SYQ A;  5EIB D;  3OEH G;  2XAG A;  3OFN G;  1N4C A;  1Z5W A;  5TIS Z;  1N0J A;  4MVM A;  1Y66 A;  2ZE5 A;  1M93 A;  4UUJ C;  1KKC A;  1WLE A;  3T4D A;  3JD2 A;  5LBQ A;  4AQY B;  1OCZ C;  1QBZ A;  2KKW A;  1VF6 C;  3CRM A;  5IYD O;  3VQW A;  2OCC B;  2PGG A;  4JZ2 A;  3WB2 A;  4B3M O;  3P3N A;  2BTO A;  1VQM V;  1YJW V;  1R6N A;  4J42 A;  2HFE C;  4FJC C;  5L3D A;  4FLX A;  2HHH B;  4LC1 A;  5JQG B;  4YIP A;  2JVD A;  1V54 B;  5JVD A;  3CXH F;  3RVZ A;  3N2G B;  5BR8 O;  1IXB A;  3T1C A;  3D3I A;  1AIL A;  3SPC A;  2UUA O;  3ZCC A;  3TK1 A;  4MVS A;  5FL7 G;  1K34 A;  3WG7 B;  2FTK A;  1GK9 A;  3WG7 C;  5H2F Z;  5ITZ B;  1EZV H;  4X62 O;  2ZM6 O;  1QCE A;  3CRQ A;  3FAV A;  4FVM A;  2GBO A;  3ZRX A;  4YJ3 B;  3L73 H;  4IGG A;  4H37 A;  4O4I B;  2EIL B;  1ORQ C;  4O2A A;  3CX5 F;  2KB1 A;  1O9H A;  4FM2 A;  1WPB A;  1QU7 A;  3APO A;  3OTO B;  1M5I A;  2IJJ A;  1K8A W;  1YHQ V;  2YS8 A;  3B8N A;  4NXN O;  2NN4 A;  5L3F A;  5LL6 Y;  1TA8 A;  3SGI A;  4MTF A;  5LXT B;  4UFZ A;  1N33 B;  1AR1 B;  2E5L B;  3RYF A;  2QWQ B;  4LFB O;  3CJH A;  1IBL B;  2BOB C;  3SPI A;  1JOY A;  2XUM A;  2Q6A A;  5KLV H;  4DUZ O;  3L72 H;  1SQV H;  2YXL A;  1H2M A;  4PA4 A;  1KP2 A;  1FXH A;  3BHP A;  3NXS A;  3ETD A;  4DV0 O;  5GON A;  2X6A A;  4RQE A;  4O4L B;  3MDS A;  2AHY A;  2FL4 A;  1JCH A;  4QE7 A;  4DRX A;  1YTF B;  1ZUQ A;  5D5P A;  4MVQ A;  4DUY B;  4UB6 Z;  3EVK A;  1DF5 A;  4X1K B;  3CSX A;  2IH3 C;  3T1H B;  2EIN C;  5LOV B;  5L3E A;  1SA0 B;  3CE2 A;  1M57 B;  3T4Z A;  3HR0 A;  4D7S A;  4BWA A;  1M56 B;  1U97 A;  3ETQ A;  4JI7 B;  4DR3 O;  1M56 C;  4N21 A;  4XDJ A;  1WN7 A;  1OCO B;  1OCO C;  3AG4 B;  4ZBM A;  1AJN A;  1H8H G;  3AG4 C;  4HBN A;  3ZJZ A;  3JD3 A;  3U10 A;  3J7A U;  2EIM C;  4LWS B;  4FFB B;  4Q6G A;  1TVK B;  5E1A C;  3CC4 V;  2XAH A;  1BQZ A;  4BR6 A;  3QTC A;  4BW5 A;  4CS2 A;  1HWY A;  2WLH A;  4P2Z A;  3DTU B;  1NKD A;  1WP7 A;  2CGO A;  4CS3 A;  2YI8 A;  3BAB A;  1S77 D;  2HLD G;  3QNE A;  1YIJ V;  2RDC A;  3CEI A;  1QR9 A;  1X59 A;  1SES A;  2P5O A;  3JAT B;  3UO2 A;  1VF7 A;  1N0N A;  4UV9 A;  2IJI A;  1Y4M A;  3EXA A;  2X6B A;  5IYC O;  2F95 B;  1NT2 B;  4BIZ A;  1GKF A;  2P4V A;  3OD4 A;  1MG1 A;  1XL6 A;  4DV1 B;  2ZXW C;  3LDC A;  5FLX N;  5IY5 B;  3IAY A;  2Y4U A;  3K0G A;  1YSC A;  4GKJ B;  2AHZ A;  1M4U A;  4DW0 A;  2ATK C;  3HKE A;  2BSK B;  5GTH Z;  4O4J B;  1HR0 B;  4JI1 O;  3FB8 C;  5JJE B;  4X89 A;  4LF5 O;  4DW1 A;  1B04 A;  4J7K A;  3PN1 A;  2UUB O; 
#chains in the Genus database with same CATH homology
 1EFR G;  3KG2 A;  5BZB A;  1NVP D;  1JJ2 U;  1VQ8 V;  4QPJ A;  4R7C A;  5HFL A;  1RM1 B;  1RM1 C;  4RO2 A;  2DWD C;  2JJ2 G;  1QVG U;  2JK5 C;  1V55 B;  3FB7 C;  1V55 C;  2W6I G;  3VOU A;  3CCM V;  3RBZ A;  1VQ9 V;  5CA3 A;  2QA4 V;  1M1K W;  3CCS V;  3TCU A;  2Y69 B;  4E2L A;  3CYO A;  3ZRV A;  1E1Q G;  4XBF A;  1S5H C;  3K79 A;  1JQ0 A;  4FK5 C;  2EIN B;  4Z1M G;  1K97 A;  3VBB A;  3ZMU A;  3E35 A;  3JD1 A;  5H6Q A;  2QEX V;  4PEL A;  4MVO A;  2A9H A;  4OXS A;  1VQ4 V;  3E2E A;  2HJF C;  3OEE G;  4JTD B;  1S0V A;  4XDK A;  2IW5 A;  1NBM G;  4MTX A;  3ZRS A;  4U7N A;  3F7V C;  4GX0 A;  1GM9 A;  5LHH A;  1YJ9 V;  1H38 A;  3ZN0 A;  2DYS B;  3LSQ A;  1R3J C;  2Z5U A;  2DYS C;  1P4R A;  4MSW C;  3ZMS A;  3OAA G;  1SET A;  4WFF A;  3OUS A;  5IDJ A;  2YEV A;  2EIM B;  3OW2 U;  3G71 V;  3CCV V;  3MHH C;  5B1N A;  4R8C A;  5HFM A;  3E8B A;  1UJW B;  2ITD C;  2A0L A;  4BIU A;  2WLI A;  2DQ3 A;  3AG3 C;  3FB6 C;  1VQ5 V;  4XDL A;  2R9I A;  3ZRW B;  2CK3 G;  2EIK B;  3SPJ A;  3CCL V;  2DYR C;  4X8A A;  3OUF A;  2EIK C;  4FPP A;  4JYC A;  3JD0 A;  3FKS G;  1BHA A;  5EC2 C;  5B3S B;  1GM8 A;  5B3S C;  2QE7 G;  1FXK A;  4P9O A;  2HVJ C;  1AJQ A;  3FB5 C;  4LCU C;  2BOC C;  1BL8 A;  2OCC C;  4UVC A;  3IC7 A;  1PL0 A;  1ROP A;  3LUT B;  3CPW U;  2WWW A;  1THZ A;  2UXN A;  1GMG A;  2W0F C;  3G4S V;  1COW G;  1YTF D;  3TET A;  4UVA A;  4G28 B;  4PA7 A;  5B1A B;  5KA6 A;  5B1A C;  1VQL V;  1GM7 A;  4PDR A;  1OCC B;  1AI4 A;  3BY6 A;  2PI5 A;  4G2K A;  2K1E A;  3LSS A;  2ZXW B;  1VQK V;  3P30 A;  3QO7 A;  1Q7Y W;  1NVP B;  1K33 A;  1V54 C;  2WAM A;  3ETG A;  1JPX A;  5EBM C;  5EK0 A;  3MD0 A;  4TSF G;  5CN0 A;  3B77 A;  3IGA C;  3ASN B;  1NR7 A;  3CP1 A;  3CC2 V;  2IH1 C;  3B8M A;  3E8F A;  3CCJ V;  1VQN V;  3W7X A;  1GTO A;  1I5Y A;  4HAM A;  4JTA B;  3DGE A;  4P30 A;  3EHB B;  4I5S A;  3QO5 A;  1Q81 W;  3ABU A;  3ZMT A;  1KKD A;  2XAQ A;  1MOF A;  5L3B A;  1SZT A;  2QM8 A;  2X6C A;  4QE9 A;  3OR7 C;  1OCR C;  4GX5 A;  2EIL C;  2NLJ C;  4N23 A;  1KD1 W;  2QTO A;  1G4Y B;  1BHB A;  2B1I A;  1K5Q A;  2W6J G;  4JAS A;  4JF3 A;  1G8M A;  2DWE C;  3QO8 A;  2C2A A;  3GWO A;  3OE7 G;  1JVM A;  1PNL A;  3ZMV A;  2Q67 A;  4X88 A;  3CME V;  3JYC A;  4WCE V;  3T2M A;  2EZO A;  1PNK A;  4KUM A;  1NH2 D;  2WPD G;  4WFH A;  5CBG A;  2XAS A;  2EIJ C;  2JEU A;  5LHI A;  1VQP V;  3SPH A;  3STL C;  4F4L A;  2P90 A;  3LDD A;  5LGU A;  4G27 B;  4LBE C;  2YSU B;  3ABK C;  2OTJ V;  1NQT A;  3OM3 B;  4LP8 A;  4MS2 A;  1J95 A;  2ITC C;  4WFG A;  2Q68 A;  3CCQ V;  5J9P C;  3ZIA G;  4P9P A;  4ASU G;  2WLL B;  5DN6 G;  1H8E G;  2HKO A;  1F4M A;  3ZRW A;  1Q86 W;  2ZR3 A;  2IU3 A;  1E79 G;  2JIZ G;  1SER A;  3HPL C;  3GB7 C;  4YXW G;  1KC8 W;  3BEH A;  1PD3 A;  5IYB O;  1K4C C;  3OGC C;  4H33 A;  3CC7 V;  1S3J A;  3R65 A;  2X0L A;  3AG2 C;  4MVZ A;  3CD6 V;  1DTO A;  4FMT A;  4PDM A;  1ARO P;  3SYQ A;  1NJI W;  3E89 A;  4FIP C;  2JDI G;  2HG5 C;  1AJP A;  2MK3 A;  1ENV A;  2XAG A;  1E1R G;  3AEI A;  3AG3 B;  3OEH G;  3OFN G;  1GO3 F;  4R50 A;  3RVY A;  1DLB A;  1M57 C;  4HZ3 A;  4MVM A;  1Y66 A;  5LHG A;  3M99 B;  1MAB G;  4UUJ C;  4BAY A;  1CEZ A;  2DYR B;  1WLE A;  2F43 G;  3T4D A;  3JD2 A;  5LBQ A;  1TUE B;  2B5U A;  1OCZ C;  1AI7 A;  1QBZ A;  4MW3 A;  3E83 A;  5IYD O;  1K4D C;  1K73 W;  2OCC B;  1WPX A;  3K04 A;  2A79 B;  3EFF K;  4PDL A;  1RPO A;  3SJQ C;  1VQM V;  2ZR2 A;  5B1O A;  1YJW V;  1R6N A;  5LGN A;  2HFE C;  4UXN A;  2JEX A;  4RAI A;  4JYB A;  3WFV A;  4GT1 A;  4FJC C;  5L3D A;  2EZP A;  4LC1 A;  4L87 A;  2ZDI A;  1KEC A;  5C93 A;  1L1F A;  1R6K A;  3ASO C;  4QPK A;  4HYO A;  3CCU V;  1VQ7 V;  2HR3 A;  2YEV B;  1QLE B;  2XAF A;  3JCZ A;  1N8R W;  1V54 B;  1NR1 A;  1QLE C;  3RVZ A;  3LNM B;  1NH2 B;  3ML0 A;  3T1C A;  1OZ0 A;  3D3I A;  3SPC A;  4Q20 A;  3E86 A;  2XND G;  3ZCC A;  1JX9 A;  3TK1 A;  1YIT V;  4MVS A;  3UKM A;  4DXW A;  1QVF U;  5H6R A;  5FL7 G;  1K34 A;  1CPY A;  2OT5 A;  3WG7 B;  2FTK A;  1GK9 A;  3WG7 C;  4UV8 A;  1QCE A;  1QLN A;  1AI5 A;  1M9N A;  4UVB A;  2IJH A;  1QR8 A;  5H9C A;  3HB3 B;  4WFB V;  3ABM B;  3ABM C;  3OMN B;  3CXC U;  2IJK A;  1FXK B;  1OHH G;  5LGT A;  3ZRX A;  4MTG A;  1FXK C;  2GHY A;  3X2Q B;  1KP3 A;  1RPR A;  4MW8 A;  5IY5 C;  3X2Q C;  3FYI B;  4H37 A;  1OCR B;  2EIL B;  2X7R B;  3PJS K;  1ORQ C;  2KB1 A;  1VQO V;  4QIW F;  5EC1 C;  4U7O A;  1K5S A;  2IJJ A;  1K8A W;  4KP4 A;  3OMA B;  5CBF A;  1LNQ A;  1YHQ V;  2WLM A;  3B8N A;  2H8P C;  4WFA V;  2WLK A;  5L3F A;  3SYO A;  3K0D A;  1K3E A;  2WLL A;  3CCE V;  2R9R B;  2D3O W;  3F7Y C;  3K03 A;  3SYA A;  2EIJ B;  1R73 A;  1YJN V;  1H2G A;  4MTF A;  3E8H A;  1M90 W;  3ETE A;  3K06 A;  5L3C A;  4DO2 A;  2NNU A;  1AR1 B;  1PNM A;  3ABK B;  3STZ C;  1S72 V;  1P7B A;  4QNH B;  2BOB C;  3SPI A;  1KQS U;  1JOY A;  1YI2 V;  3CMA V;  2Q6A A;  2V7Q G;  3OMI B;  3A0R A;  4PA4 A;  1KP2 A;  1FXH A;  2ZQM A;  3NXS A;  3IFX A;  3ETD A;  3ABT A;  1BMF G;  1DF4 A;  2X6A A;  4RQE A;  2EBO A;  1W2B U;  2OTL V;  1VQ6 V;  2AHY A;  1JCH A;  2WLJ A;  3F5W C;  4QE7 A;  4RUE A;  1B6Q A;  1YTF B;  3LDE A;  1W0K G;  1FXV A;  3K08 A;  2P7T C;  2Y69 C;  4JAU A;  4MVQ A;  2LFR A;  3AG2 B;  3W7S A;  1DF5 A;  4JGS A;  2IH3 C;  2JJ1 G;  2EIN C;  4PA9 A;  2Z3Y A;  3ABL B;  3K3W A;  3E8G A;  3ABL C;  4MT8 A;  4WF9 V;  1Q82 W;  5L3E A;  1M57 B;  3ZN1 A;  2XOK G;  5EBW C;  3T4Z A;  1EZJ A;  2QM7 A;  1EBO A;  1M56 B;  3W7T A;  1M56 C;  4N21 A;  4XDJ A;  3I55 V;  4JTC B;  1K7D A;  5B1B B;  2Q69 A;  1OCZ B;  1OCO B;  5DM6 V;  5B1B C;  2EJR A;  5KUK A;  1OCO C;  2LP7 A;  3AG4 B;  1AJN A;  4ZBM A;  3P32 A;  1H8H G;  3AG4 C;  3SYP A;  3UM7 A;  3ZJZ A;  2B1G A;  4JPR A;  3JD3 A;  4PA6 A;  2HVK C;  2EIM C;  2UXX A;  4CZZ A;  1ZWI C;  3CC4 V;  5E1A C;  2GSM B;  4GX1 A;  2XAH A;  4BW5 A;  5EBL C;  1HWY A;  2QKS A;  2WLH A;  4P2Z A;  3DTU B;  3ZMZ A;  1NKD A;  1R3I C;  3SYC A;  4R6Z A;  4MVU A;  2WSS G;  4EKW A;  2IU0 A;  2M7W A;  2XAJ A;  1S77 D;  2HLD G;  3QNE A;  3OR6 C;  4TT3 G;  3W7W A;  1YIJ V;  3ASO B;  1QR9 A;  1SES A;  1AI6 A;  3G6E V;  1S76 D;  4KFM A;  4UV9 A;  2IJI A;  4J9Z B;  1R3L C;  2Y48 A;  2WLI B;  4TWK A;  3AG1 B;  1Y4M A;  3AG1 C;  4QJF B;  3W7U A;  3I56 V;  2X6B A;  5IYC O;  1FFT B;  3JD4 A;  1F51 A;  1SRY A;  1K92 A;  4BIZ A;  1GKF A;  4J9Y B;  4ZKI A;  1F23 A;  3FYE B;  1OCC C;  4CBC A;  1MG1 A;  3RW0 A;  5L3G A;  1FS0 G;  1XL6 A;  4MTO A;  2ZXW C;  3LDC A;  4GCZ A;  4PDV A;  2P67 A;  3CCR V;  5IY5 B;  3K0G A;  1YSC A;  2AHZ A;  3ASN C;  1R3K C;  3MHS C;  2ATK C;  2WLN A;  4GX2 A;  4MVR A;  4RUF A;  5GW7 A;  1IXM A;  1MSW D;  1XL4 A;  2DQ0 A;  5CBH A;  1K9M W;  4I9W A;  5CMU A;  1CP9 A;  3FB8 C;  3K9A A;  2ZDI C;  2LFS A;  4X89 A;  4JAV A;  2DW4 A;  4PA3 A;  1W0J G;  5KA5 A;  2P6J A;  1F4N A;  1I5X A;  3H01 A;  1PKX A;  5KUM A;  2V1D A;  2PI4 A;  3SPG A;  4WFE A;  4RQF A;  3D36 A;  2ZD9 A;  2H94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...