2IJIA

Structure of f14h mutant of cole1 rom protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
56
structure length
56
Chain Sequence
GTKQEKTALNMARHIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 27
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijiA00
1RPOA 1F4NA 1RPRA 2IJJA 4DO2A 2IJIA 3K79A 2IJKA 2GHYA 1GTOA 1NKDA 2IJHA 1PD3A 1B6QA 1F4MA 1ROPA 1GMGA
chains in the Genus database with same CATH superfamily
5CBFA 1EZVH 3DTUB 3HPLC 1KU9A 5IT9N 4X88A 3GVMA 3ZMSA 5GONA 1BGYH 5CBGA 4RQFA 4JI1B 1LNQA 3ZRWB 1GM9A 3Q4HB 4JZGA 1IDSA 1V54C 1VMGA 4YJ2B 5IJ0A 4DV7B 3C3TA 2Q7GA 5FNVB 1ZX3A 3UKMA 3CE2A 5IJ9A 4JI5O 4I55B 1XNQO 2DQ3A 3SYOA 1I5YA 4CS4A 1BL8A 3CCMV 1N0NA 2QJ1A 1US6A 2UUAB 1WN7A 2IH1C 4IIJB 2OT5A 4TUYA 2OCCB 1R3JC 3G71V 3TXSA 3EXAA 3ZX6A 1SA0A 3IFXA 3UM7A 2VQEO 3DXRA 1S3JA 2ZE8A 1QU7A 1AILA 2VRZA 3K0DA 3T1YO 4JF3A 1VQOV 5EIBC 3TETA 3THOA 4FFBA 3OAAG 1Q6UA 4IT5A 2WA3A 4ZOLA 4CH3A 1IBLO 3T1HB 1J5EB 5L3GA 1QR8A 1N34O 2YIDA 1TAEA 4NXNB 4LF9B 4X65B 2GV9A 3ZN0A 1P7GA 2LP7A 4LC1A 3ZRWA 4QNHB 3A0RA 1ZAUA 4WFAV 2E3CA 4YJ2A 4LF8B 5BMVA 3BA8A 2HVKC 4DUZO 1FFXA 4I0XB 3HR0A 1RFYA 1WJZA 4DV3B 4ABMA 3EVKA 5C8YA 1TGOA 1XMQB 1ZL8A 3AG2B 4OX9B 2LQTA 4PA6A 1PM9A 3IGAC 3H1HH 5CA0B 3CRQA 1P49A 2R72A 5LXTA 3SPHA 1WP7A 5LMUO 3FFQA 4KP4A 5EBMC 4IIJA 4L8JA 4B3RB 1OCCC 1VEWA 1RSOA 3AG4B 3OMNB 4DRXB 1HR0O 3H1IH 3MHSC 4CH4A 1BT8A 4YJ3B 5D5QA 4JI3B 5CA1A 3HKEA 3DGEA 1LUVA 5JQGB 4DW1A 1H38A 4LF5B 3HKDB 1GH6A 3JD4A 2OCCC 4JV5O 4DV6O 3AG1C 3CCLV 1S72V 2ZR3A 4NR1A 1D5AA 3JAWA 2JEUA 3C90A 3TCUA 3I55V 2QWRB 2YXLA 3P30A 5KHJA 3W7SA 2F4VO 1T5EA 2VWJA 1FYJA 3W7XA 4LFAB 3L9DA 2FL4A 3QTCA 1L0LH 5LA6B 1QQCA 4EEQA 2OTLV 4R6ZA 3RYHB 4X8AA 1K4CC 1V55B 2WLMA 1HNWB 1AP6A 1GO3F 4MW3A 1YHQV 4JI4B 1BE3H 3N2KB 3ZRXA 2KQXA 3K3WA 1JX9A 1W59A 2ZNIA 4DR4B 2GTSA 4H33A 2GHYA 1AI7A 2HEPA 1LR1A 2ITCC 1NH2B 3ZHVA 3K08A 5CN0A 1H2LA 2UUBB 3AG2C 2UXBB 4YJ3A 4W4LA 4MVUA 3P3NA 1EN5A 1SZXA 1URFA 2BSKA 3K79A 4PA7A 1G4YB 1EN6A 4TOIA 1NTKH 1OCRC 2EZPA 1WB8A 1WLEA 4UVAA 1JJOA 5IYDO 1R3KC 2BCCH 2ZE7A 4MS2A 1XQ8A 5HFMA 5IDJA 5KA6A 2RN9A 4YIPA 3RGBA 1JJ2U 1XMOO 2IJHA 3D8CA 2QKSA 3SJBC 2KB1A 1FXKC 4MVRA 3CYOA 1AVMA 2XAFA 4DW0A 3E8BA 2M6YA 1ROPA 5DECA 2ZIMA 4GZRB 3KZIZ 1M93A 4YY3O 1HWYA 3T4ZA 4DK1A 4JI7O 1RPRA 3FX7A 1DK1A 1AB3A 4B08A 4JI0B 1Y6XA 2YUAA 4N21A 1M1KW 4GUNA 1Q7YW 4JZ2A 3CHXA 4H13B 5CA3A 2X7RB 3DC5A 3RYFA 4UCRA 2Y0PA 4TV9B 5CB4A 1KBHA 3ABTA 1GMGA 1HNXO 4GX2A 1M5IA 3K5LA 2HVJC 1MSDA 4RWUA 1RP3B 2JGDB 4HZ3A 4KHPO 1SQXH 5JVDB 2ZKOA 3CJHA 2RDCA 1I7FA 1QHTA 1VIBA 1DGSA 2EBOA 4YIOA 3JCZA 3SJQC 4CS2A 5ITZB 1VQKV 2AZ2A 1W0KG 2XOKG 4HNAB 1N32O 2KKWA 2YIBD 3AG7A 1IURA 3LNNA 4NTWA 4R8CA 3U11A 4FK5C 5DN6G 5B3SC 4JI6O 4WFFA 5LHIA 4J9ZB 3O9OA 5EZYA 4BW5A 4GKKB 5AG2A 2Z0AA 4EB6B 1QVFU 1NS1A 3IAYA 1PKXA 3CXHF 4UV9A 2B1IA 4O4HA 3HKBA 1H8HG 3H1JH 2EIKB 1H2KA 2WLHA 3LUTB 3EFFK 3OR6C 4G27B 3OMIB 2P7TC 1GM8A 1XL4A 2KSDA 4DV4O 4LFCO 5GW7A 1YTFD 3TGUH 4EKWA 2EIJB 2ZQMA 1IXMA 1FJGO 3OD4A 4PA9A 2EIMB 1VF7A 2HR3A 4FIPC 2GDSA 4UFZA 4I50B 3ZHRA 5J9PC 1N33O 2UXDB 4DUYO 3OW2U 2AHZA 3QO7A 5LOVB 2QKCA 1JPXA 1ZLZA 1NVPB 1UFIA 4EFBA 4LF6B 2F93B 2XUMA 2FB5A 2HP8A 3QF7A 4O4JA 2XAQA 3OGCC 3CCRV 1S5LZ 5F2VO 3ASNC 1GN4A 2YC0A 4FZ1A 1O9HA 3ASOC 2QE7G 4NKGB 5B1OA 1OZ0A 2ZXWC 1SKVA 3H1LH 4J11A 1YCIA 4Z1VA 1AJQA 1K92A 2QM7A 4NYKA 4DUZB 3BRCA 1EFRG 5LP6B 2YIAA 4UVBA 1Q5OA 3SPIA 4WBNB 5EK0A 2PZSA 2QGNA 2IJIA 4QE7A 3BY6A 4X62B 1JOYA 2Q67A 4HYOA 5LMUB 2JVDA 4TV8B 4OPAA 1OJHA 3PJSK 2EILC 2CH7A 2H8PC 1L0NH 4X1IA 2ZT9B 2EULA 3RT3C 2OWOA 3VBBA 4Z2WA 4ICGA 4PDMA 1OHHG 3CC2V 4FLXA 1A32A 4R50A 4TT3G 2YS8A 3RFRA 2UUCO 3OTFA 3NR7A 2OYQA 2WLLB 3J81N 3AK2A 3LSQA 1QLEB 4H0LB 4HAMA 4KL1A 4A5UB 3KG2A 1PL4A 3IJ4A 1BZKA 4B3TB 1O9GA 3JALB 2YICA 3SYAA 2ZM6O 3SJAC 3APQA 1E1RG 4LBEC 1NTMH 3JCUZ 1SZTA 4G28B 3JARB 4NTXA 4FM0A 4H37A 2LGQA 1XHZA 4DV2O 4MW8A 1THZA 3MHHC 3BCCH 3K03A 3K04A 2XNDG 1V9PA 1QLNA 1MABG 3E86A 1P4RA 4PDRA 2LFRA 3U0ZA 1MZEA 1RM1C 3SPJA 2E75B 2CTWA 1IXBA 2D3OW 2HHHO 1B3QA 3F5TA 5L3CA 1KYOF 4O4LA 3ABMC 4IL6Z 3JD3A 5KMGB 5IYCO 1CXZB 5J2TA 2FYUH 3T2MA 2F1MA 1XMOB 4DV0O 2WWWA 1I94O 1E1QG 4AILC 2OIEA 1AI6A 2ZE6A 3W7WA 1MNGA 3OT7A 1IVSA 4O2AA 5EBLC 2E5LO 4MTGA 4MSWC 4Z1MG 3E8FA 4X9QA 3QG5A 3E8GA 2BTOA 3E89A 4IHJA 2Q68A 4CC5A 2C2AA 1TUBA 4JI7B 4LFBO 5J2UB 4DR6O 1JCHA 3JSLA 2N05A 4AQYB 1M56B 2F66C 1IZ3A 1LUWA 1N0JA 1N8RW 3MDSA 3SJCC 4X64O 3RYCB 3ZMUA 4ZI7A 1K3EA 2M7WA 1YTFB 4B3MB 2E74B 2BTQB 1DF4A 3ABLB 2P6JA 1XUQA 2X6CA 2P67A 2A79B 1VQ4V 1JQ0A 1J95A 3B4SA 1AI5A 3K06A 3FYEB 2UU9O 1FD9A 1DTOA 4FLYA 2QTSA 4DR5O 1F23A 3D3IA 4YHHB 2N74A 2ZCEA 2QEXV 2W0XA 5KUKA 2OIGA 1FS0G 2Q8VA 1AP5A 4JTAB 1OCZB 4ZHQA 3WFVA 4BIOA 3MAQA 4GKJO 5B1AC 5KHGA 2A3QA 3WB0A 1N32B 2CK3G 5KLVH 1Z5VA 4K0KO 1DLBA 4K35A 4DXWA 2Q69A 3W7UA 2LW1A 4MTFA 4P9PA 4U3JB 3UO2A 2NN4A 4GX0A 2Q7HA 1M9NA 3Q4HA 3CCVV 1WNSA 1VF5B 1NQTA 4X1KB 2AW9A 2EX3A 5FNVA 3S3XA 4PI0A 4JYAO 4RQEA 4I55A 1BQZA 2ZD9A 1JA8A 3VQVA 2X6BA 4W4KA 3ETDA 2E76B 4RUFA 3HKCB 4ASUG 3CEIA 5IYZB 1Q8IA 1OV9A 4E2LA 4DV4B 4LFCB 4DO2A 4DR1O 1TUEB 5KHKA 4DV1O 5LGNA 3PN1A 1P84F 2JIZG 3A8TA 2DWEC 1BMFG 1YJWV 2ZR2A 2QSAA 4QGPA 1M56C 5LGUA 2ITDC 1Y4MA 4DV5B 2FKXA 4DUYB 1KQSU 3BFRA 1M57B 2UXCO 4DR7O 4LF4O 1R1BA 3B09A 3CRAA 3S3WA 5FPRA 3BVOA 4UV8A 5GTIZ 2VQFO 2Q5ZA 2W6JG 4CH6A 5B1NA 5JH7B 4JASA 5LMNO 1PD3A 1U97A 3CCSV 4KFMA 5L3EA 2DJVA 3OGIB 4K8XA 2IJJA 2F23A 1IBKO 4KUMA 3SYCA 4Q6GA 2CUGA 1AR4A 1HNZO 3FAVB 4P2ZA 1JVMA 2AZ0A 3VQYA 1IBMO 2GTAA 4UXNA 4I0XA 4PJ0Z 2VWKA 5JWPA 1FAFA 3OTOO 4MVZA 5FL7G 1XOUA 2Y0IA 4QJFB 3P32A 3K5MA 3GB7C 5CA0A 4JAUA 1X59A 4UVCA 4MTOA 5BR8O 2PI4A 2HKOA 2QDOA 2OTJV 4RAIA 4DRXA 4NXMO 4JTCB 1G1XB 4J7KA 2HFEC 5EBWC 1EZJA 1QNMA 2WLIB 3E35A 4I7ZB 1K5QA 1PV0A 1DF5A 5JQGA 1KP2A 1Q90D 3HKDA 2CTQA 4JYYA 1SF9A 5BZBA 2JEXA 3AG4C 4OPHA 1MG1A 5H9CA 2X6AA 4YXWG 1QCEA 1ZSPA 4J42A 1NTZH 1YEWA 4O4IB 4X20B 3N27A 1TVKB 2ZM6B 2JGUA 3VQXA 1XI1A 4FVMA 4H44B 4JAAA 1H2MA 2EINB 3QO5A 3M7MX 2W0FC 3SGIA 3UQ8A 3L71H 4IGGA 4BR6A 2K1EA 3U10A 2NNUA 5LA6A 1XBLA 4DV2B 2NLJC 2YI9A 3RYHA 4P30A 3E83A 3B77A 3OFNG 2QWQB 2ZINA 4I9WA 1ZUQA 3DSQA 5JJEB 4JI1O 2YXYA 3GWOA 1Z2GA 3I5DA 3N2KA 1Q86W 1MZFA 2IW5A 2JS5A 4BWAA 1H2SB 4DV7O 2ODMA 1UPGA 3RYIB 1V55C 1UJWB 3O65A 1GM7A 3E22B 4JYBA 3B40A 1ENVA 1BS3A 1GK9A 4FLWA 2HHHB 2YSUB 3JATB 2LGWA 2WLIA 4UB6Z 4LF7O 1YF2A 2Y4TA 4LNUB 1Y76B 1VQPV 4J7JA 4FM2A 1R3LC 1WA8B 3ZMZA 1JMKC 5EIBD 2XASA 4JI2B 1CEZA 3B8MA 2R9IA 2UUAO 3UO3A 3AK3A 3LSUA 4TWKA 4GLXA 1HDJA 4U3FH 4X1YB 1S76D 3BEHA 2H3OA 1Q6HA 2BOBC 1AR1B 5TISZ 2E5LB 4UCTA 3OR7C 3BABA 4JI5B 4DR3O 4UCVA 2A0LA 3T1HO 1J5EO 1XNQB 4DR6B 5IWAO 3N2GB 4X64B 4LF9O 3AK1A 4LCUC 1FFTB 4LP8A 1SRYA 1VARA 1BQ0A 4TV9A 2P4KA 1RPOA 4IYHA 3JAMN 4LF8O 2UU9B 3K59A 2KG7B 4DV3O 4DR5B 2JGDA 2VQEB 2JRIA 1QBZA 5JVDA 1XMQO 1AJPA 3T1YB 4OX9O 4CC6A 4R7CA 1K34A 1WPBA 2PF4E 4UCOA 3F7YC 3X2QB 1K8AW 1WPXA 2GUZB 3IC9A 4GKJB 5ITZA 1IBLB 4B3RO 1N34B 1KECA 4HNAA 5B1BB 3WU2Z 5EC1C 3ABKB 4I4TB 2AXTZ 1YSCA 4JI3O 3ZHQA 5A2QN 4LR3A 4PDLA 4EB6A 3SR2C 1NR7A 2UXNA 1EM1A 3OUSA 4MVMA 4FLVA 2DN9A 1NJIW 4JI8O 2CGNA 4JYAB 1R73A 4WFGA 1OCOB 4PHZA 1K4DC 2Y69B 3WG7B 5JCOA 1ZTEA 3CRMA 4B3SO 2Z3YA 3OM3B 3APOA 4ZIBA 3OEEG 3TJTA 1WAZA 2QWPB 1VQLV 1ORQC 4GX5A 3B8NA 3UT5B 2F95B 3AEIA 3G67A 2H94A 2DYSB 5JCOC 1P7BA 2EIKC 1HR0B 4FFKA 1G6UA 1M4UA 3OEHG 5JJNB 3ZS8C 3F7VC 2JS3A 1SC5B 2CAZC 4I50A 2XT9A 1HNWO 1YJ9V 3JAKB 4U7NA 1YZBA 5DM6V 2Q0AA 1GKFA 2LW7A 3LDDA 4JI4O 5LOVA 1HP8A 4LF4B 4HBNA 4PA3A 1JFFB 2EIJC 1Y67A 5D5PA 4L87A 4JV5B 4LH6A 2EIMC 1AROP 3CRRA 5K1PA 1MA1A 5DEDA 4JYCA 5LHHA 2VQFB 4DV6B 4DR4O 2Q7EA 3WB1A 3JD1A 3OMAB 5LMNB 2UUBO 2R70A 1KC8W 4LWSB 1S0VA 3SDLA 2F4VB 2V7QG 5FLXN 3L72H 1H8EG 4N23A 2AHYA 1KUQA 1AR5A 2A9HA 5KHHA 5KUMA 2OCHA 3FB6C 4F6RB 2CE4A 1IBMB 1GN3A 1N36O 1V54B 5LP6A 3R66A 3OTOB 4WBNA 3CB2A 1K7DA 2B1GA 2R9RB 4JGSA 5GONB 1PNLA 1XNRO 4FLZA 4BIZA 1MMMA 2CDYA 2YDEA 3OE7G 2Q4PA 3BA9A 4TV8A 3J7AU 2Q6AA 5LP6C 5IJ0B 4XDLA 3ML0A 3QO8A 1Y74B 2XHBA 1SERA 4WFBV 4CBCA 5EC2C 3K5OA 4TSFG 1BHBA 2WLKA 3TK1A 4MVOA 3G6EV 5B66Z 2RCVA 5EYPB 4NB5A 2VS0A 2DYSC 2WLLA 3C3SA 3SPGA 3ZHTA 4TUYB 1Q81W 2IU3A 1NH2D 3WB2A 3G80A 1SA0B 3DXRB 5CMUA 3A2FA 4NVPA 3JALA 4FLTA 2IH3C 3J80N 2PYJA 2CGOA 3TXQA 5K1XA 3D36A 3FKSG 4FFBB 1Q3EA 3CWBH 2XAJA 4MTXA 3W7TA 3FB5C 1K73W 3JARA 4AI8A 1QLEC 4PI2A 3K9AA 1KMIZ 5LBQA 1VQ7V 1N4CA 4IYIA 4YY3B 2ZNJA 2L35A 2YI8A 3ZCCA 1KKCA 3UCSC 3VQWA 1B06A 2ZIOA 1VQ5V 3D36C 1K9MW 4GKKO 1SESA 3ABUA 1QR9A 3CRCA 2X0LA 3CCJV 1HNXB 4B7EA 1GAXA 1BCCH 5BMVB 3CCQV 3H9VA 2LFSA 4GX1A 1FFXB 1Y74A 5H6QA 1OCCB 4KHPB 2DQ0A 1Q43A 5C8YB 4LF7B 5B5EZ 1ZL8B 2G38A 3ICXA 4QPJA 3IC7A 1BSMA 4U7OA 3ETGA 5LXTB 2D2CB 5KMGA 3HB3B 5EYPA 2DWDC 4K8ZA 3DC6A 4WFHA 1XL6A 1R6NA 3K58A 3CD6V 3L74H 2YIBA 4JAVA 1F51A 1RSOB 3AG1B 4I5SA 1I08A 5E79Z 4JI6B 1R3IC 3L73H 5CA1B 5IYBO 1VQ9V 3HKEB 2UXDO 2RJZA 5BXZA 3GWKC 2QTOA 2YXHA 4MT8A 4DR3B 4LF6O 5IWAB 4X66O 4K3AA 2PUSA 2R9AA 1QVGU 3E8HA 3P3PA 2EJ7A 3D3QA 5J2UA 3JAWB 3BPZA 2QWNB 1NU1H 2BOCC 3ETQA 1WP8A 3RYCA 1U96A 5A9GA 4BW9A 2WSSG 4XDKA 4CS3A 1YXBA 4DR2O 5JJJB 3KCXA 2BTQA 3RWRD 2Q9LA 1YVWA 2WLJA 1KD1W 4J41A 1FJGB 3JYCA 3L70H 5KHIA 5IY5B 2AGAA 1N33B 4MVQA 1X4TA 4CH5A 1YDXA 4X62O 2JDIG 3ABLC 2A06H 1MSWD 1OCRB 2QM4A 2F43G 3SYQA 2K9PA 3M8AA 3ZJZA 2WLNA 3FB7C 1YITV 4EFEA 4F4LA 1B04A 2Q0OC 2HG5C 2GBOA 3B2EE 1FXKB 1NKDA 2GSMB 2BSKB 4U3JA 3ZHUA 1KB9F 1VQNV 1OCZC 1YIJV 2RNBA 3RBZA 4JI8B 3CMEV 4X1KA 2P22C 2ADQB 2QR4A 1NVPD 5LHGA 1COWG 1D2DA 2PY5A 2HLDG 1PP9H 4I9QA 3I56V 2WA4A 4B3SB 3HKCA 4X89A 4B3TO 4PV1B 5IYZA 4DYLA 3K5NA 5L3BA 5KX5B 2B5UA 4F6EA 2P06A 4JTDB 2PTMA 3VOUA 3LNMB 1S5HC 2UXXA 1BHAA 1NR1A 2P90A 1KP3A 3LSSA 3K9SA 5H5NA 2ETNA 2HJDA 3RYFB 3ZRVA 1PL0A 2EJRA 1XDCA 2UUCB 5CB4B 5CBHA 2FMLA 5IY5C 2Q73A 2ATKC 3ZRSA 5KAFZ 3CCEV 1ZWIC 3F5WC 2XAGA 5JH7A 4J80A 1W2BU 2ARHA 4P9OA 3RVZA 3CJHB 5C93A 1FXKA 1K33A 3LDCA 3SYPA 1GTOA 2JK5C 3CP1A 4BIUA 4GCZA 1M57C 5B3SB 2ADPA 4UUJC 2RQ6A 3L75H 3FAVA 1N36B 3OUFA 4D6TH 1PNKA 4E4EA 1XHXA 2P5OA 2XAHA 1CP9A 4QPKA 3E2EA 2DYRB 1XNRB 5EZYB 2O57A 5KX5A 2PGGA 2WAMA 1D5NA 1SQQH 3QVNA 2DW4A 3ZMTA 1PNMA 1SQFA 4O4HB 4AHCA 3HKBB 4QIWF 3R65A 5HFLA 1K5SA 3G4SV 4CZZA 4O2BB 4AQYO 1SETA 3CC4V 2Y48A 3A0HZ 3BAAA 3H01A 4J10A 2RMKB 3EHBB 2V4DA 5LGTA 1NZ6A 1F4MA 4B3MO 1NI8A 5H6RA 2JJ2G 1VQ6V 2MW2B 2YEVB 3NXSA 4DV0B 1I94B 4PDVA 1B6QA 5H2FZ 4O4IA 4X20A 1R6KA 4YHHO 4RO2A 1SQPH 1TVKA 3ASNB 4UCUA 2NR5A 3ASOB 4TQDA 1YJNV 2CTRA 2CTPA 2ZXWB 1XREA 1PPJH 1SQVH 4OXSA 1TA8A 1VQMV 2PI5A 4WF9V 1W0JG 2Z5UA 4O4JB 4XDJA 4LFBB 1H2NA 4JPRA 4NXNO 2QKAA 4X65O 1G8MA 2EINC 1S77D 1KKDA 1FKAO 1K97A 2EILB 3RYIA 5FPOA 2BE3A 3ZMVA 3E22A 4O2BA 2DYRC 5BY1A 3JATA 3CC7V 3BHPA 3ETEA 1VP7A 5L3DA 4LNUA 1Y76A 1R6TA 4ZKIA 2ZE5A 3CS5A 1WA8A 1M90W 1Z5WA 2CH7B 2YEVA 1SQGA 1FXHA 4KXRA 4X1IB 3STLC 1GRJA 1WB7A 4K0KB 4X1YA 1EBOA 3RVYA 3CSXA 1Q6IA 3CX5F 1YI2V 4DV5O 1Y66A 3ZHSA 3AG3B 3CMAV 4QE9A 2IBZH 4LF5O 1JR9A 4X66B 1GN6A 4GT1A 1VF6A 5L3FA 4OGQB 1XILA 3KCYA 3N2GA 4Q20A 4B7KA 1AI4A 1GN2A 4J7ZA 3CCUV 1F4NA 4DR2B 4WFEA 4DV1B 4DR1B 4UCSA 2PYLA 4LFAO 1NT2B 2DOSA 4DK0A 1FPOA 4C7UA 1VF6C 2HJFC 4PA4A 3JASB 2KG7A 1CPYA 1RM1B 1I5XA 3G6BA 2FTKA 5LL6Y 2EZOA 4D7TA 4D7SA 5LYJB 3KKYA 2W6IG 4TQFA 3M99B 2UXCB 3CXCU 2WPDG 4DR7B 3ABMB 3MD0A 2LO1A 2GUZA 3FB8C 1F7YA 2DMXA 4UB8Z 4NTYA 1Q82W 1EN4A 3RN4A 1MOFA 1VQ8V 3QNEA 2UXBO 4I4TA 4PD4F 3T4DA 3X2QC 1NBMG 4O4LB 3JD2A 1IBKB 3JSNA 4FPPA 4J9YB 2L6LA 4XBFA 2P4VA 1HNZB 3ZN1A 2DE0X 5IE9A 4PELA 1H2GA 2Y4UA 5KA5A 2IJKA 4FM1A 5B1BC 5J2TB 4GYCB 3ABKC 5E1AC 4BAYA 1AJNA 3ZEDA 2N04A 3AG3C 4O2AB 3UT5A 2MK3A 3K0GA 5BR8B 1L8DA 1FXVA 1OCOC 3JASA 3CPWU 4IHJB 2IU0A 2Y69C 4FJCC 3WG7C 1TUBB 4FZ0A 1SQBH 5IJ9B 2LJ2A 2JJ1G 4NXMB 1S5JA 4G2KA 3SPCA 2ZDIA 3JAKA 4JI0O 3FYIB 5LYJA 1L1FA 3ZIAG 4ZI7B 4WCEV 2QWOB 1JFFA 3STZC 2IM9A 2A7WA 5GTHZ 4FLUA 2QM8A 2XTAA 3LDEA 4ZBMA 3T1CA 3A0BZ 2V1DA 5B1AB 5KAIZ 4FMTA 2ZDIC 4RUEA 1E79G 4LWSA 3FD9A 3ZBHA 2QA4V 1HW7A 2B9ZA 2ILMA 3H1KH 3K57A 1XEQA 1SS3A 4F6RA 4LH7A 1I0HA 4MVSA 3JD0A 4ZHQB 3RW0A 4JI2O 4ZOLB 1IX9A
chains in the Genus database with same CATH topology
4UVBA 3SPIA 5CBFA 5EK0A 1V55C 3DTUB 3HPLC 1UJWB 1GM7A 4JYBA 1ENVA 2HG5C 1GK9A 2YSUB 4X88A 3ZMSA 2WLIA 2IJIA 4QE7A 5CBGA 4RQFA 1FXKB 1NKDA 2GSMB 3BY6A 1LNQA 3ZRWB 1JOYA 4BIUA 1VQPV 1VQNV 2Q67A 4HYOA 1OCZC 1R3LC 1YIJV 1GM9A 3RBZA 3ZMZA 3CMEV 3PJSK 1V54C 2EILC 2XASA 1CEZA 3B8MA 2R9IA 1NVPD 5LHGA 1COWG 2H8PC 3UKMA 4TWKA 2HLDG 1S76D 3I56V 3BEHA 2DQ3A 4X89A 3SYOA 3VBBA 1I5YA 4PDMA 2BOBC 1OHHG 3CC2V 5L3BA 1BL8A 4R50A 3CCMV 4TT3G 1AR1B 2B5UA 3OR7C 2WLLB 4JTDB 2IH1C 3LSQA 2OT5A 1QLEB 4HAMA 2A0LA 2OCCB 1R3JC 3KG2A 3VOUA 3LNMB 1S5HC 3G71V 2UXXA 1BHAA 1NR1A 3IFXA 3UM7A 2P90A 1KP3A 1S3JA 3LSSA 3K0DA 4LCUC 3SYAA 1FFTB 4JF3A 1VQOV 4LP8A 1SRYA 3ZRVA 3TETA 1PL0A 2EJRA 1E1RG 3OAAG 4LBEC 1RPOA 1SZTA 4G28B 5CBHA 5IY5C 2ATKC 4H37A 5L3GA 3ZRSA 3CCEV 1QR8A 1ZWIC 3F5WC 4MW8A 1THZA 2XAGA 3MHHC 1QBZA 4P9OA 1W2BU 3RVZA 3K03A 3K04A 2XNDG 5C93A 1AJPA 1FXKA 1K33A 3LDCA 3SYPA 1GTOA 2JK5C 2LP7A 1K34A 3CP1A 1M57C 4GCZA 4LC1A 4R7CA 3ZRWA 1QLNA 1MABG 3F7YC 3E86A 1P4RA 3X2QB 1K8AW 4QNHB 3A0RA 4PDRA 4UUJC 4WFAV 1WPXA 2LFRA 3OUFA 2HVKC 1PNKA 1RM1C 1KECA 5B1BB 3SPJA 2XAHA 1CP9A 5EC1C 4QPKA 3ABKB 2D3OW 3E2EA 2DYRB 3AG2B 1YSCA 5L3CA 4PA6A 3IGAC 4PDLA 5B3SB 3ABMC 3JD3A 2WAMA 1NR7A 3SPHA 2UXNA 5IYCO 2DW4A 3ZMTA 1PNMA 3OUSA 4MVMA 1NJIW 4KP4A 5EBMC 1R73A 4QIWF 3R65A 5HFLA 1OCCC 4WFGA 1OCOB 3T2MA 1K5SA 3G4SV 2WWWA 3AG4B 1K4DC 3OMNB 2Y69B 3WG7B 3ZN0A 4CZZA 1E1QG 3MHSC 3W7WA 1AI6A 1SETA 3CC4V 2Y48A 3H01A 2Z3YA 3OM3B 3EHBB 3DGEA 3OEEG 5EBLC 1VQLV 1ORQC 5LGTA 4GX5A 1H38A 3B8NA 1F4MA 5H6RA 2JJ2G 4MTGA 4MSWC 4Z1MG 3JD4A 3E8FA 2OCCC 3E8GA 3AEIA 2H94A 3AG1C 3CCLV 1S72V 3E89A 1VQ6V 2YEVB 2Q68A 2DYSB 3NXSA 2C2AA 1P7BA 2EIKC 2ZR3A 1JCHA 3OEHG 4PDVA 2JEUA 3F7VC 1B6QA 3TCUA 3I55V 1R6KA 1M56B 3P30A 4RO2A 3W7SA 3ASNB 1YJ9V 1N8RW 4U7NA 3ZMUA 3ASOB 5DM6V 3W7XA 1GKFA 1K3EA 1YJNV 3LDDA 2ZXWB 2M7WA 1YTFB 4PA3A 2EIJC 1DF4A 3ABLB 2P6JA 4L87A 4OXSA 2X6CA 2EIMC 1AROP 2P67A 2A79B 1VQ4V 5LHHA 4JYCA 1VQMV 1JQ0A 2PI5A 1J95A 2OTLV 3JD1A 4WF9V 1W0JG 1AI5A 2Z5UA 4XDJA 4R6ZA 3OMAB 3K06A 3FYEB 1K4CC 4X8AA 1V55B 1DTOA 1KC8W 2WLMA 1F23A 3D3IA 1S0VA 2V7QG 4JPRA 1H8EG 4N23A 2AHYA 1GO3F 1G8MA 2EINC 4MW3A 2QEXV 1S77D 2A9HA 5KUMA 5KUKA 1YHQV 3FB6C 1FS0G 3ZRXA 4JTAB 3K3WA 1JX9A 1KKDA 1OCZB 3WFVA 4H33A 1K97A 2GHYA 1V54B 2EILB 5B1AC 1AI7A 2ITCC 1NH2B 2CK3G 1K7DA 2B1GA 3K08A 5CN0A 3ZMVA 2DYRC 3AG2C 2R9RB 4JGSA 1DLBA 4DXWA 2Q69A 1PNLA 4MVUA 3CC7V 3W7UA 4BIZA 3ETEA 3K79A 4MTFA 5L3DA 4PA7A 4P9PA 1G4YB 3OE7G 4GX0A 4ZKIA 1M9NA 1OCRC 2EZPA 1WLEA 4UVAA 3CCVV 5IYDO 1R3KC 2Q6AA 1M90W 1NQTA 4XDLA 4MS2A 5HFMA 2YEVA 5IDJA 3ML0A 5KA6A 1FXHA 3QO8A 4RQEA 3STLC 2ZD9A 1JJ2U 2X6BA 1SERA 3ETDA 2IJHA 4WFBV 1EBOA 2QKSA 3RVYA 4RUFA 2KB1A 4CBCA 4ASUG 5EC2C 1FXKC 4MVRA 1YI2V 4TSFG 4E2LA 1BHBA 2WLKA 3CYOA 3TK1A 1Y66A 4DO2A 4MVOA 1TUEB 3G6EV 5LGNA 2JIZG 2XAFA 3AG3B 3CMAV 4QE9A 2DWEC 1BMFG 2DYSC 2WLLA 3E8BA 1YJWV 3SPGA 2ZR2A 4GT1A 1ROPA 5L3FA 1Q81W 2IU3A 1NH2D 1HWYA 1M56C 3T4ZA 1RPRA 5LGUA 4Q20A 2ITDC 1AI4A 5CMUA 1Y4MA 4N21A 1M1KW 1Q7YW 3CCUV 1KQSU 5CA3A 2X7RB 1F4NA 2IH3C 4WFEA 1M57B 3D36A 3FKSG 3ABTA 1GMGA 2XAJA 4MTXA 3W7TA 3FB5C 1K73W 4GX2A 1QLEC 2HJFC 3K9AA 4UV8A 4PA4A 2HVJC 5LBQA 1VQ7V 2W6JG 1CPYA 1RM1B 1I5XA 5B1NA 3ZCCA 4HZ3A 4JASA 2FTKA 1PD3A 3CCSV 4KFMA 5L3EA 2EZOA 1VQ5V 2IJJA 2W6IG 4KUMA 3SYCA 1SESA 3M99B 1K9MW 2EBOA 3ABUA 3CXCU 2WPDG 3ABMB 1QR9A 3MD0A 2X0LA 3FB8C 3CCJV 3JCZA 3SJQC 4P2ZA 1JVMA 3CCQV 1VQKV 2LFSA 1W0KG 4GX1A 4UXNA 5H6QA 1Q82W 2XOKG 1OCCB 2DQ0A 1MOFA 4MVZA 4R8CA 5FL7G 1VQ8V 3QNEA 4FK5C 5DN6G 5B3SC 4QJFB 3P32A 3T4DA 4WFFA 5LHIA 4J9ZB 1NBMG 3X2QC 3GB7C 4BW5A 3JD2A 4QPJA 4JAUA 4UVCA 3IC7A 4MTOA 4U7OA 4FPPA 3ETGA 4J9YB 1QVFU 4XBFA 3HB3B 3ZN1A 2DWDC 1PKXA 4WFHA 1XL6A 4PELA 4UV9A 1H2GA 1R6NA 5KA5A 2IJKA 2B1IA 3CD6V 5B1BC 4JAVA 2PI4A 1F51A 2HKOA 3AG1B 1H8HG 4I5SA 2OTJV 4RAIA 3ABKC 4JTCB 2EIKB 5E1AC 2HFEC 5EBWC 1EZJA 1R3IC 2WLHA 4BAYA 3LUTB 1AJNA 3EFFK 3OR6C 4G27B 2WLIB 3OMIB 5IYBO 1VQ9V 2P7TC 3E35A 1GM8A 1XL4A 1K5QA 3AG3C 1DF5A 5GW7A 1KP2A 2MK3A 3K0GA 2QTOA 1YTFD 4EKWA 2EIJB 2ZQMA 1IXMA 1FXVA 4MT8A 1OCOC 3CPWU 4PA9A 5BZBA 3AG4C 2JEXA 2EIMB 1MG1A 2Y69C 4FJCC 5H9CA 2X6AA 4YXWG 2IU0A 3E8HA 3WG7C 1QCEA 1QVGU 2JJ1G 2HR3A 4FIPC 4G2KA 3SPCA 2ZDIA 2BOCC 5J9PC 3FYIB 1L1FA 3ZIAG 4WCEV 3OW2U 2WSSG 4XDKA 2AHZA 3QO7A 3QO5A 2EINB 1JPXA 2W0FC 3STZC 2QM8A 2K1EA 2WLJA 1KD1W 1NVPB 3LDEA 4ZBMA 2NNUA 3T1CA 2NLJC 3JYCA 2V1DA 5B1AB 5IY5B 4FMTA 2XAQA 4P30A 3E83A 3B77A 2ZDIC 3OGCC 3OFNG 3CCRV 4RUEA 3ASNC 1E79G 4I9WA 3ASOC 2QE7G 5B1OA 1OZ0A 2QA4V 2ZXWC 4MVQA 3GWOA 1Q86W 2JDIG 1AJQA 1K92A 2IW5A 3ABLC 4MVSA 1MSWD 1OCRB 2QM7A 3JD0A 2F43G 3SYQA 3RW0A 3ZJZA 2WLNA 3FB7C 1EFRG 1YITV 4F4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPO A;  1F4N A;  1RPR A;  2IJJ A;  4DO2 A;  2IJI A;  3K79 A;  2IJK A;  2GHY A;  1GTO A;  1NKD A;  2IJH A;  1PD3 A;  1B6Q A;  1F4M A;  1ROP A;  1GMG A; 
#chains in the Genus database with same CATH topology
 5CBF A;  1EZV H;  3DTU B;  3HPL C;  1KU9 A;  5IT9 N;  4X88 A;  3GVM A;  3ZMS A;  5GON A;  1BGY H;  5CBG A;  4RQF A;  4JI1 B;  1LNQ A;  3ZRW B;  1GM9 A;  3Q4H B;  4JZG A;  1IDS A;  1V54 C;  1VMG A;  4YJ2 B;  5IJ0 A;  4DV7 B;  3C3T A;  2Q7G A;  5FNV B;  1ZX3 A;  3UKM A;  3CE2 A;  5IJ9 A;  4JI5 O;  4I55 B;  1XNQ O;  2DQ3 A;  3SYO A;  1I5Y A;  4CS4 A;  1BL8 A;  3CCM V;  1N0N A;  2QJ1 A;  1US6 A;  2UUA B;  1WN7 A;  2IH1 C;  4IIJ B;  2OT5 A;  4TUY A;  2OCC B;  1R3J C;  3G71 V;  3TXS A;  3EXA A;  3ZX6 A;  1SA0 A;  3IFX A;  3UM7 A;  2VQE O;  3DXR A;  1S3J A;  2ZE8 A;  1QU7 A;  1AIL A;  2VRZ A;  3K0D A;  3T1Y O;  4JF3 A;  1VQO V;  5EIB C;  3TET A;  3THO A;  4FFB A;  3OAA G;  1Q6U A;  4IT5 A;  2WA3 A;  4ZOL A;  4CH3 A;  1IBL O;  3T1H B;  1J5E B;  5L3G A;  1QR8 A;  1N34 O;  2YID A;  1TAE A;  4NXN B;  4LF9 B;  4X65 B;  2GV9 A;  3ZN0 A;  1P7G A;  2LP7 A;  4LC1 A;  3ZRW A;  4QNH B;  3A0R A;  1ZAU A;  4WFA V;  2E3C A;  4YJ2 A;  4LF8 B;  5BMV A;  3BA8 A;  2HVK C;  4DUZ O;  1FFX A;  4I0X B;  3HR0 A;  1RFY A;  1WJZ A;  4DV3 B;  4ABM A;  3EVK A;  5C8Y A;  1TGO A;  1XMQ B;  1ZL8 A;  3AG2 B;  4OX9 B;  2LQT A;  4PA6 A;  1PM9 A;  3IGA C;  3H1H H;  5CA0 B;  3CRQ A;  1P49 A;  2R72 A;  5LXT A;  3SPH A;  1WP7 A;  5LMU O;  3FFQ A;  4KP4 A;  5EBM C;  4IIJ A;  4L8J A;  4B3R B;  1OCC C;  1VEW A;  1RSO A;  3AG4 B;  3OMN B;  4DRX B;  1HR0 O;  3H1I H;  3MHS C;  4CH4 A;  1BT8 A;  4YJ3 B;  5D5Q A;  4JI3 B;  5CA1 A;  3HKE A;  3DGE A;  1LUV A;  5JQG B;  4DW1 A;  1H38 A;  4LF5 B;  3HKD B;  1GH6 A;  3JD4 A;  2OCC C;  4JV5 O;  4DV6 O;  3AG1 C;  3CCL V;  1S72 V;  2ZR3 A;  4NR1 A;  1D5A A;  3JAW A;  2JEU A;  3C90 A;  3TCU A;  3I55 V;  2QWR B;  2YXL A;  3P30 A;  5KHJ A;  3W7S A;  2F4V O;  1T5E A;  2VWJ A;  1FYJ A;  3W7X A;  4LFA B;  3L9D A;  2FL4 A;  3QTC A;  1L0L H;  5LA6 B;  1QQC A;  4EEQ A;  2OTL V;  4R6Z A;  3RYH B;  4X8A A;  1K4C C;  1V55 B;  2WLM A;  1HNW B;  1AP6 A;  1GO3 F;  4MW3 A;  1YHQ V;  4JI4 B;  1BE3 H;  3N2K B;  3ZRX A;  2KQX A;  3K3W A;  1JX9 A;  1W59 A;  2ZNI A;  4DR4 B;  2GTS A;  4H33 A;  2GHY A;  1AI7 A;  2HEP A;  1LR1 A;  2ITC C;  1NH2 B;  3ZHV A;  3K08 A;  5CN0 A;  1H2L A;  2UUB B;  3AG2 C;  2UXB B;  4YJ3 A;  4W4L A;  4MVU A;  3P3N A;  1EN5 A;  1SZX A;  1URF A;  2BSK A;  3K79 A;  4PA7 A;  1G4Y B;  1EN6 A;  4TOI A;  1NTK H;  1OCR C;  2EZP A;  1WB8 A;  1WLE A;  4UVA A;  1JJO A;  5IYD O;  1R3K C;  2BCC H;  2ZE7 A;  4MS2 A;  1XQ8 A;  5HFM A;  5IDJ A;  5KA6 A;  2RN9 A;  4YIP A;  3RGB A;  1JJ2 U;  1XMO O;  2IJH A;  3D8C A;  2QKS A;  3SJB C;  2KB1 A;  1FXK C;  4MVR A;  3CYO A;  1AVM A;  2XAF A;  4DW0 A;  3E8B A;  2M6Y A;  1ROP A;  5DEC A;  2ZIM A;  4GZR B;  3KZI Z;  1M93 A;  4YY3 O;  1HWY A;  3T4Z A;  4DK1 A;  4JI7 O;  1RPR A;  3FX7 A;  1DK1 A;  1AB3 A;  4B08 A;  4JI0 B;  1Y6X A;  2YUA A;  4N21 A;  1M1K W;  4GUN A;  1Q7Y W;  4JZ2 A;  3CHX A;  4H13 B;  5CA3 A;  2X7R B;  3DC5 A;  3RYF A;  4UCR A;  2Y0P A;  4TV9 B;  5CB4 A;  1KBH A;  3ABT A;  1GMG A;  1HNX O;  4GX2 A;  1M5I A;  3K5L A;  2HVJ C;  1MSD A;  4RWU A;  1RP3 B;  2JGD B;  4HZ3 A;  4KHP O;  1SQX H;  5JVD B;  2ZKO A;  3CJH A;  2RDC A;  1I7F A;  1QHT A;  1VIB A;  1DGS A;  2EBO A;  4YIO A;  3JCZ A;  3SJQ C;  4CS2 A;  5ITZ B;  1VQK V;  2AZ2 A;  1W0K G;  2XOK G;  4HNA B;  1N32 O;  2KKW A;  2YIB D;  3AG7 A;  1IUR A;  3LNN A;  4NTW A;  4R8C A;  3U11 A;  4FK5 C;  5DN6 G;  5B3S C;  4JI6 O;  4WFF A;  5LHI A;  4J9Z B;  3O9O A;  5EZY A;  4BW5 A;  4GKK B;  5AG2 A;  2Z0A A;  4EB6 B;  1QVF U;  1NS1 A;  3IAY A;  1PKX A;  3CXH F;  4UV9 A;  2B1I A;  4O4H A;  3HKB A;  1H8H G;  3H1J H;  2EIK B;  1H2K A;  2WLH A;  3LUT B;  3EFF K;  3OR6 C;  4G27 B;  3OMI B;  2P7T C;  1GM8 A;  1XL4 A;  2KSD A;  4DV4 O;  4LFC O;  5GW7 A;  1YTF D;  3TGU H;  4EKW A;  2EIJ B;  2ZQM A;  1IXM A;  1FJG O;  3OD4 A;  4PA9 A;  2EIM B;  1VF7 A;  2HR3 A;  4FIP C;  2GDS A;  4UFZ A;  4I50 B;  3ZHR A;  5J9P C;  1N33 O;  2UXD B;  4DUY O;  3OW2 U;  2AHZ A;  3QO7 A;  5LOV B;  2QKC A;  1JPX A;  1ZLZ A;  1NVP B;  1UFI A;  4EFB A;  4LF6 B;  2F93 B;  2XUM A;  2FB5 A;  2HP8 A;  3QF7 A;  4O4J A;  2XAQ A;  3OGC C;  3CCR V;  1S5L Z;  5F2V O;  3ASN C;  1GN4 A;  2YC0 A;  4FZ1 A;  1O9H A;  3ASO C;  2QE7 G;  4NKG B;  5B1O A;  1OZ0 A;  2ZXW C;  1SKV A;  3H1L H;  4J11 A;  1YCI A;  4Z1V A;  1AJQ A;  1K92 A;  2QM7 A;  4NYK A;  4DUZ B;  3BRC A;  1EFR G;  5LP6 B;  2YIA A;  4UVB A;  1Q5O A;  3SPI A;  4WBN B;  5EK0 A;  2PZS A;  2QGN A;  2IJI A;  4QE7 A;  3BY6 A;  4X62 B;  1JOY A;  2Q67 A;  4HYO A;  5LMU B;  2JVD A;  4TV8 B;  4OPA A;  1OJH A;  3PJS K;  2EIL C;  2CH7 A;  2H8P C;  1L0N H;  4X1I A;  2ZT9 B;  2EUL A;  3RT3 C;  2OWO A;  3VBB A;  4Z2W A;  4ICG A;  4PDM A;  1OHH G;  3CC2 V;  4FLX A;  1A32 A;  4R50 A;  4TT3 G;  2YS8 A;  3RFR A;  2UUC O;  3OTF A;  3NR7 A;  2OYQ A;  2WLL B;  3J81 N;  3AK2 A;  3LSQ A;  1QLE B;  4H0L B;  4HAM A;  4KL1 A;  4A5U B;  3KG2 A;  1PL4 A;  3IJ4 A;  1BZK A;  4B3T B;  1O9G A;  3JAL B;  2YIC A;  3SYA A;  2ZM6 O;  3SJA C;  3APQ A;  1E1R G;  4LBE C;  1NTM H;  3JCU Z;  1SZT A;  4G28 B;  3JAR B;  4NTX A;  4FM0 A;  4H37 A;  2LGQ A;  1XHZ A;  4DV2 O;  4MW8 A;  1THZ A;  3MHH C;  3BCC H;  3K03 A;  3K04 A;  2XND G;  1V9P A;  1QLN A;  1MAB G;  3E86 A;  1P4R A;  4PDR A;  2LFR A;  3U0Z A;  1MZE A;  1RM1 C;  3SPJ A;  2E75 B;  2CTW A;  1IXB A;  2D3O W;  2HHH O;  1B3Q A;  3F5T A;  5L3C A;  1KYO F;  4O4L A;  3ABM C;  4IL6 Z;  3JD3 A;  5KMG B;  5IYC O;  1CXZ B;  5J2T A;  2FYU H;  3T2M A;  2F1M A;  1XMO B;  4DV0 O;  2WWW A;  1I94 O;  1E1Q G;  4AIL C;  2OIE A;  1AI6 A;  2ZE6 A;  3W7W A;  1MNG A;  3OT7 A;  1IVS A;  4O2A A;  5EBL C;  2E5L O;  4MTG A;  4MSW C;  4Z1M G;  3E8F A;  4X9Q A;  3QG5 A;  3E8G A;  2BTO A;  3E89 A;  4IHJ A;  2Q68 A;  4CC5 A;  2C2A A;  1TUB A;  4JI7 B;  4LFB O;  5J2U B;  4DR6 O;  1JCH A;  3JSL A;  2N05 A;  4AQY B;  1M56 B;  2F66 C;  1IZ3 A;  1LUW A;  1N0J A;  1N8R W;  3MDS A;  3SJC C;  4X64 O;  3RYC B;  3ZMU A;  4ZI7 A;  1K3E A;  2M7W A;  1YTF B;  4B3M B;  2E74 B;  2BTQ B;  1DF4 A;  3ABL B;  2P6J A;  1XUQ A;  2X6C A;  2P67 A;  2A79 B;  1VQ4 V;  1JQ0 A;  1J95 A;  3B4S A;  1AI5 A;  3K06 A;  3FYE B;  2UU9 O;  1FD9 A;  1DTO A;  4FLY A;  2QTS A;  4DR5 O;  1F23 A;  3D3I A;  4YHH B;  2N74 A;  2ZCE A;  2QEX V;  2W0X A;  5KUK A;  2OIG A;  1FS0 G;  2Q8V A;  1AP5 A;  4JTA B;  1OCZ B;  4ZHQ A;  3WFV A;  4BIO A;  3MAQ A;  4GKJ O;  5B1A C;  5KHG A;  2A3Q A;  3WB0 A;  1N32 B;  2CK3 G;  5KLV H;  1Z5V A;  4K0K O;  1DLB A;  4K35 A;  4DXW A;  2Q69 A;  3W7U A;  2LW1 A;  4MTF A;  4P9P A;  4U3J B;  3UO2 A;  2NN4 A;  4GX0 A;  2Q7H A;  1M9N A;  3Q4H A;  3CCV V;  1WNS A;  1VF5 B;  1NQT A;  4X1K B;  2AW9 A;  2EX3 A;  5FNV A;  3S3X A;  4PI0 A;  4JYA O;  4RQE A;  4I55 A;  1BQZ A;  2ZD9 A;  1JA8 A;  3VQV A;  2X6B A;  4W4K A;  3ETD A;  2E76 B;  4RUF A;  3HKC B;  4ASU G;  3CEI A;  5IYZ B;  1Q8I A;  1OV9 A;  4E2L A;  4DV4 B;  4LFC B;  4DO2 A;  4DR1 O;  1TUE B;  5KHK A;  4DV1 O;  5LGN A;  3PN1 A;  1P84 F;  2JIZ G;  3A8T A;  2DWE C;  1BMF G;  1YJW V;  2ZR2 A;  2QSA A;  4QGP A;  1M56 C;  5LGU A;  2ITD C;  1Y4M A;  4DV5 B;  2FKX A;  4DUY B;  1KQS U;  3BFR A;  1M57 B;  2UXC O;  4DR7 O;  4LF4 O;  1R1B A;  3B09 A;  3CRA A;  3S3W A;  5FPR A;  3BVO A;  4UV8 A;  5GTI Z;  2VQF O;  2Q5Z A;  2W6J G;  4CH6 A;  5B1N A;  5JH7 B;  4JAS A;  5LMN O;  1PD3 A;  1U97 A;  3CCS V;  4KFM A;  5L3E A;  2DJV A;  3OGI B;  4K8X A;  2IJJ A;  2F23 A;  1IBK O;  4KUM A;  3SYC A;  4Q6G A;  2CUG A;  1AR4 A;  1HNZ O;  3FAV B;  4P2Z A;  1JVM A;  2AZ0 A;  3VQY A;  1IBM O;  2GTA A;  4UXN A;  4I0X A;  4PJ0 Z;  2VWK A;  5JWP A;  1FAF A;  3OTO O;  4MVZ A;  5FL7 G;  1XOU A;  2Y0I A;  4QJF B;  3P32 A;  3K5M A;  3GB7 C;  5CA0 A;  4JAU A;  1X59 A;  4UVC A;  4MTO A;  5BR8 O;  2PI4 A;  2HKO A;  2QDO A;  2OTJ V;  4RAI A;  4DRX A;  4NXM O;  4JTC B;  1G1X B;  4J7K A;  2HFE C;  5EBW C;  1EZJ A;  1QNM A;  2WLI B;  3E35 A;  4I7Z B;  1K5Q A;  1PV0 A;  1DF5 A;  5JQG A;  1KP2 A;  1Q90 D;  3HKD A;  2CTQ A;  4JYY A;  1SF9 A;  5BZB A;  2JEX A;  3AG4 C;  4OPH A;  1MG1 A;  5H9C A;  2X6A A;  4YXW G;  1QCE A;  1ZSP A;  4J42 A;  1NTZ H;  1YEW A;  4O4I B;  4X20 B;  3N27 A;  1TVK B;  2ZM6 B;  2JGU A;  3VQX A;  1XI1 A;  4FVM A;  4H44 B;  4JAA A;  1H2M A;  2EIN B;  3QO5 A;  3M7M X;  2W0F C;  3SGI A;  3UQ8 A;  3L71 H;  4IGG A;  4BR6 A;  2K1E A;  3U10 A;  2NNU A;  5LA6 A;  1XBL A;  4DV2 B;  2NLJ C;  2YI9 A;  3RYH A;  4P30 A;  3E83 A;  3B77 A;  3OFN G;  2QWQ B;  2ZIN A;  4I9W A;  1ZUQ A;  3DSQ A;  5JJE B;  4JI1 O;  2YXY A;  3GWO A;  1Z2G A;  3I5D A;  3N2K A;  1Q86 W;  1MZF A;  2IW5 A;  2JS5 A;  4BWA A;  1H2S B;  4DV7 O;  2ODM A;  1UPG A;  3RYI B;  1V55 C;  1UJW B;  3O65 A;  1GM7 A;  3E22 B;  4JYB A;  3B40 A;  1ENV A;  1BS3 A;  1GK9 A;  4FLW A;  2HHH B;  2YSU B;  3JAT B;  2LGW A;  2WLI A;  4UB6 Z;  4LF7 O;  1YF2 A;  2Y4T A;  4LNU B;  1Y76 B;  1VQP V;  4J7J A;  4FM2 A;  1R3L C;  1WA8 B;  3ZMZ A;  1JMK C;  5EIB D;  2XAS A;  4JI2 B;  1CEZ A;  3B8M A;  2R9I A;  2UUA O;  3UO3 A;  3AK3 A;  3LSU A;  4TWK A;  4GLX A;  1HDJ A;  4U3F H;  4X1Y B;  1S76 D;  3BEH A;  2H3O A;  1Q6H A;  2BOB C;  1AR1 B;  5TIS Z;  2E5L B;  4UCT A;  3OR7 C;  3BAB A;  4JI5 B;  4DR3 O;  4UCV A;  2A0L A;  3T1H O;  1J5E O;  1XNQ B;  4DR6 B;  5IWA O;  3N2G B;  4X64 B;  4LF9 O;  3AK1 A;  4LCU C;  1FFT B;  4LP8 A;  1SRY A;  1VAR A;  1BQ0 A;  4TV9 A;  2P4K A;  1RPO A;  4IYH A;  3JAM N;  4LF8 O;  2UU9 B;  3K59 A;  2KG7 B;  4DV3 O;  4DR5 B;  2JGD A;  2VQE B;  2JRI A;  1QBZ A;  5JVD A;  1XMQ O;  1AJP A;  3T1Y B;  4OX9 O;  4CC6 A;  4R7C A;  1K34 A;  1WPB A;  2PF4 E;  4UCO A;  3F7Y C;  3X2Q B;  1K8A W;  1WPX A;  2GUZ B;  3IC9 A;  4GKJ B;  5ITZ A;  1IBL B;  4B3R O;  1N34 B;  1KEC A;  4HNA A;  5B1B B;  3WU2 Z;  5EC1 C;  3ABK B;  4I4T B;  2AXT Z;  1YSC A;  4JI3 O;  3ZHQ A;  5A2Q N;  4LR3 A;  4PDL A;  4EB6 A;  3SR2 C;  1NR7 A;  2UXN A;  1EM1 A;  3OUS A;  4MVM A;  4FLV A;  2DN9 A;  1NJI W;  4JI8 O;  2CGN A;  4JYA B;  1R73 A;  4WFG A;  1OCO B;  4PHZ A;  1K4D C;  2Y69 B;  3WG7 B;  5JCO A;  1ZTE A;  3CRM A;  4B3S O;  2Z3Y A;  3OM3 B;  3APO A;  4ZIB A;  3OEE G;  3TJT A;  1WAZ A;  2QWP B;  1VQL V;  1ORQ C;  4GX5 A;  3B8N A;  3UT5 B;  2F95 B;  3AEI A;  3G67 A;  2H94 A;  2DYS B;  5JCO C;  1P7B A;  2EIK C;  1HR0 B;  4FFK A;  1G6U A;  1M4U A;  3OEH G;  5JJN B;  3ZS8 C;  3F7V C;  2JS3 A;  1SC5 B;  2CAZ C;  4I50 A;  2XT9 A;  1HNW O;  1YJ9 V;  3JAK B;  4U7N A;  1YZB A;  5DM6 V;  2Q0A A;  1GKF A;  2LW7 A;  3LDD A;  4JI4 O;  5LOV A;  1HP8 A;  4LF4 B;  4HBN A;  4PA3 A;  1JFF B;  2EIJ C;  1Y67 A;  5D5P A;  4L87 A;  4JV5 B;  4LH6 A;  2EIM C;  1ARO P;  3CRR A;  5K1P A;  1MA1 A;  5DED A;  4JYC A;  5LHH A;  2VQF B;  4DV6 B;  4DR4 O;  2Q7E A;  3WB1 A;  3JD1 A;  3OMA B;  5LMN B;  2UUB O;  2R70 A;  1KC8 W;  4LWS B;  1S0V A;  3SDL A;  2F4V B;  2V7Q G;  5FLX N;  3L72 H;  1H8E G;  4N23 A;  2AHY A;  1KUQ A;  1AR5 A;  2A9H A;  5KHH A;  5KUM A;  2OCH A;  3FB6 C;  4F6R B;  2CE4 A;  1IBM B;  1GN3 A;  1N36 O;  1V54 B;  5LP6 A;  3R66 A;  3OTO B;  4WBN A;  3CB2 A;  1K7D A;  2B1G A;  2R9R B;  4JGS A;  5GON B;  1PNL A;  1XNR O;  4FLZ A;  4BIZ A;  1MMM A;  2CDY A;  2YDE A;  3OE7 G;  2Q4P A;  3BA9 A;  4TV8 A;  3J7A U;  2Q6A A;  5LP6 C;  5IJ0 B;  4XDL A;  3ML0 A;  3QO8 A;  1Y74 B;  2XHB A;  1SER A;  4WFB V;  4CBC A;  5EC2 C;  3K5O A;  4TSF G;  1BHB A;  2WLK A;  3TK1 A;  4MVO A;  3G6E V;  5B66 Z;  2RCV A;  5EYP B;  4NB5 A;  2VS0 A;  2DYS C;  2WLL A;  3C3S A;  3SPG A;  3ZHT A;  4TUY B;  1Q81 W;  2IU3 A;  1NH2 D;  3WB2 A;  3G80 A;  1SA0 B;  3DXR B;  5CMU A;  3A2F A;  4NVP A;  3JAL A;  4FLT A;  2IH3 C;  3J80 N;  2PYJ A;  2CGO A;  3TXQ A;  5K1X A;  3D36 A;  3FKS G;  4FFB B;  1Q3E A;  3CWB H;  2XAJ A;  4MTX A;  3W7T A;  3FB5 C;  1K73 W;  3JAR A;  4AI8 A;  1QLE C;  4PI2 A;  3K9A A;  1KMI Z;  5LBQ A;  1VQ7 V;  1N4C A;  4IYI A;  4YY3 B;  2ZNJ A;  2L35 A;  2YI8 A;  3ZCC A;  1KKC A;  3UCS C;  3VQW A;  1B06 A;  2ZIO A;  1VQ5 V;  3D36 C;  1K9M W;  4GKK O;  1SES A;  3ABU A;  1QR9 A;  3CRC A;  2X0L A;  3CCJ V;  1HNX B;  4B7E A;  1GAX A;  1BCC H;  5BMV B;  3CCQ V;  3H9V A;  2LFS A;  4GX1 A;  1FFX B;  1Y74 A;  5H6Q A;  1OCC B;  4KHP B;  2DQ0 A;  1Q43 A;  5C8Y B;  4LF7 B;  5B5E Z;  1ZL8 B;  2G38 A;  3ICX A;  4QPJ A;  3IC7 A;  1BSM A;  4U7O A;  3ETG A;  5LXT B;  2D2C B;  5KMG A;  3HB3 B;  5EYP A;  2DWD C;  4K8Z A;  3DC6 A;  4WFH A;  1XL6 A;  1R6N A;  3K58 A;  3CD6 V;  3L74 H;  2YIB A;  4JAV A;  1F51 A;  1RSO B;  3AG1 B;  4I5S A;  1I08 A;  5E79 Z;  4JI6 B;  1R3I C;  3L73 H;  5CA1 B;  5IYB O;  1VQ9 V;  3HKE B;  2UXD O;  2RJZ A;  5BXZ A;  3GWK C;  2QTO A;  2YXH A;  4MT8 A;  4DR3 B;  4LF6 O;  5IWA B;  4X66 O;  4K3A A;  2PUS A;  2R9A A;  1QVG U;  3E8H A;  3P3P A;  2EJ7 A;  3D3Q A;  5J2U A;  3JAW B;  3BPZ A;  2QWN B;  1NU1 H;  2BOC C;  3ETQ A;  1WP8 A;  3RYC A;  1U96 A;  5A9G A;  4BW9 A;  2WSS G;  4XDK A;  4CS3 A;  1YXB A;  4DR2 O;  5JJJ B;  3KCX A;  2BTQ A;  3RWR D;  2Q9L A;  1YVW A;  2WLJ A;  1KD1 W;  4J41 A;  1FJG B;  3JYC A;  3L70 H;  5KHI A;  5IY5 B;  2AGA A;  1N33 B;  4MVQ A;  1X4T A;  4CH5 A;  1YDX A;  4X62 O;  2JDI G;  3ABL C;  2A06 H;  1MSW D;  1OCR B;  2QM4 A;  2F43 G;  3SYQ A;  2K9P A;  3M8A A;  3ZJZ A;  2WLN A;  3FB7 C;  1YIT V;  4EFE A;  4F4L A;  1B04 A;  2Q0O C;  2HG5 C;  2GBO A;  3B2E E;  1FXK B;  1NKD A;  2GSM B;  2BSK B;  4U3J A;  3ZHU A;  1KB9 F;  1VQN V;  1OCZ C;  1YIJ V;  2RNB A;  3RBZ A;  4JI8 B;  3CME V;  4X1K A;  2P22 C;  2ADQ B;  2QR4 A;  1NVP D;  5LHG A;  1COW G;  1D2D A;  2PY5 A;  2HLD G;  1PP9 H;  4I9Q A;  3I56 V;  2WA4 A;  4B3S B;  3HKC A;  4X89 A;  4B3T O;  4PV1 B;  5IYZ A;  4DYL A;  3K5N A;  5L3B A;  5KX5 B;  2B5U A;  4F6E A;  2P06 A;  4JTD B;  2PTM A;  3VOU A;  3LNM B;  1S5H C;  2UXX A;  1BHA A;  1NR1 A;  2P90 A;  1KP3 A;  3LSS A;  3K9S A;  5H5N A;  2ETN A;  2HJD A;  3RYF B;  3ZRV A;  1PL0 A;  2EJR A;  1XDC A;  2UUC B;  5CB4 B;  5CBH A;  2FML A;  5IY5 C;  2Q73 A;  2ATK C;  3ZRS A;  5KAF Z;  3CCE V;  1ZWI C;  3F5W C;  2XAG A;  5JH7 A;  4J80 A;  1W2B U;  2ARH A;  4P9O A;  3RVZ A;  3CJH B;  5C93 A;  1FXK A;  1K33 A;  3LDC A;  3SYP A;  1GTO A;  2JK5 C;  3CP1 A;  4BIU A;  4GCZ A;  1M57 C;  5B3S B;  2ADP A;  4UUJ C;  2RQ6 A;  3L75 H;  3FAV A;  1N36 B;  3OUF A;  4D6T H;  1PNK A;  4E4E A;  1XHX A;  2P5O A;  2XAH A;  1CP9 A;  4QPK A;  3E2E A;  2DYR B;  1XNR B;  5EZY B;  2O57 A;  5KX5 A;  2PGG A;  2WAM A;  1D5N A;  1SQQ H;  3QVN A;  2DW4 A;  3ZMT A;  1PNM A;  1SQF A;  4O4H B;  4AHC A;  3HKB B;  4QIW F;  3R65 A;  5HFL A;  1K5S A;  3G4S V;  4CZZ A;  4O2B B;  4AQY O;  1SET A;  3CC4 V;  2Y48 A;  3A0H Z;  3BAA A;  3H01 A;  4J10 A;  2RMK B;  3EHB B;  2V4D A;  5LGT A;  1NZ6 A;  1F4M A;  4B3M O;  1NI8 A;  5H6R A;  2JJ2 G;  1VQ6 V;  2MW2 B;  2YEV B;  3NXS A;  4DV0 B;  1I94 B;  4PDV A;  1B6Q A;  5H2F Z;  4O4I A;  4X20 A;  1R6K A;  4YHH O;  4RO2 A;  1SQP H;  1TVK A;  3ASN B;  4UCU A;  2NR5 A;  3ASO B;  4TQD A;  1YJN V;  2CTR A;  2CTP A;  2ZXW B;  1XRE A;  1PPJ H;  1SQV H;  4OXS A;  1TA8 A;  1VQM V;  2PI5 A;  4WF9 V;  1W0J G;  2Z5U A;  4O4J B;  4XDJ A;  4LFB B;  1H2N A;  4JPR A;  4NXN O;  2QKA A;  4X65 O;  1G8M A;  2EIN C;  1S77 D;  1KKD A;  1FKA O;  1K97 A;  2EIL B;  3RYI A;  5FPO A;  2BE3 A;  3ZMV A;  3E22 A;  4O2B A;  2DYR C;  5BY1 A;  3JAT A;  3CC7 V;  3BHP A;  3ETE A;  1VP7 A;  5L3D A;  4LNU A;  1Y76 A;  1R6T A;  4ZKI A;  2ZE5 A;  3CS5 A;  1WA8 A;  1M90 W;  1Z5W A;  2CH7 B;  2YEV A;  1SQG A;  1FXH A;  4KXR A;  4X1I B;  3STL C;  1GRJ A;  1WB7 A;  4K0K B;  4X1Y A;  1EBO A;  3RVY A;  3CSX A;  1Q6I A;  3CX5 F;  1YI2 V;  4DV5 O;  1Y66 A;  3ZHS A;  3AG3 B;  3CMA V;  4QE9 A;  2IBZ H;  4LF5 O;  1JR9 A;  4X66 B;  1GN6 A;  4GT1 A;  1VF6 A;  5L3F A;  4OGQ B;  1XIL A;  3KCY A;  3N2G A;  4Q20 A;  4B7K A;  1AI4 A;  1GN2 A;  4J7Z A;  3CCU V;  1F4N A;  4DR2 B;  4WFE A;  4DV1 B;  4DR1 B;  4UCS A;  2PYL A;  4LFA O;  1NT2 B;  2DOS A;  4DK0 A;  1FPO A;  4C7U A;  1VF6 C;  2HJF C;  4PA4 A;  3JAS B;  2KG7 A;  1CPY A;  1RM1 B;  1I5X A;  3G6B A;  2FTK A;  5LL6 Y;  2EZO A;  4D7T A;  4D7S A;  5LYJ B;  3KKY A;  2W6I G;  4TQF A;  3M99 B;  2UXC B;  3CXC U;  2WPD G;  4DR7 B;  3ABM B;  3MD0 A;  2LO1 A;  2GUZ A;  3FB8 C;  1F7Y A;  2DMX A;  4UB8 Z;  4NTY A;  1Q82 W;  1EN4 A;  3RN4 A;  1MOF A;  1VQ8 V;  3QNE A;  2UXB O;  4I4T A;  4PD4 F;  3T4D A;  3X2Q C;  1NBM G;  4O4L B;  3JD2 A;  1IBK B;  3JSN A;  4FPP A;  4J9Y B;  2L6L A;  4XBF A;  2P4V A;  1HNZ B;  3ZN1 A;  2DE0 X;  5IE9 A;  4PEL A;  1H2G A;  2Y4U A;  5KA5 A;  2IJK A;  4FM1 A;  5B1B C;  5J2T B;  4GYC B;  3ABK C;  5E1A C;  4BAY A;  1AJN A;  3ZED A;  2N04 A;  3AG3 C;  4O2A B;  3UT5 A;  2MK3 A;  3K0G A;  5BR8 B;  1L8D A;  1FXV A;  1OCO C;  3JAS A;  3CPW U;  4IHJ B;  2IU0 A;  2Y69 C;  4FJC C;  3WG7 C;  1TUB B;  4FZ0 A;  1SQB H;  5IJ9 B;  2LJ2 A;  2JJ1 G;  4NXM B;  1S5J A;  4G2K A;  3SPC A;  2ZDI A;  3JAK A;  4JI0 O;  3FYI B;  5LYJ A;  1L1F A;  3ZIA G;  4ZI7 B;  4WCE V;  2QWO B;  1JFF A;  3STZ C;  2IM9 A;  2A7W A;  5GTH Z;  4FLU A;  2QM8 A;  2XTA A;  3LDE A;  4ZBM A;  3T1C A;  3A0B Z;  2V1D A;  5B1A B;  5KAI Z;  4FMT A;  2ZDI C;  4RUE A;  1E79 G;  4LWS A;  3FD9 A;  3ZBH A;  2QA4 V;  1HW7 A;  2B9Z A;  2ILM A;  3H1K H;  3K57 A;  1XEQ A;  1SS3 A;  4F6R A;  4LH7 A;  1I0H A;  4MVS A;  3JD0 A;  4ZHQ B;  3RW0 A;  4JI2 O;  4ZOL B;  1IX9 A; 
#chains in the Genus database with same CATH homology
 4UVB A;  3SPI A;  5CBF A;  5EK0 A;  1V55 C;  3DTU B;  3HPL C;  1UJW B;  1GM7 A;  4JYB A;  1ENV A;  2HG5 C;  1GK9 A;  2YSU B;  4X88 A;  3ZMS A;  2WLI A;  2IJI A;  4QE7 A;  5CBG A;  4RQF A;  1FXK B;  1NKD A;  2GSM B;  3BY6 A;  1LNQ A;  3ZRW B;  1JOY A;  4BIU A;  1VQP V;  1VQN V;  2Q67 A;  4HYO A;  1OCZ C;  1R3L C;  1YIJ V;  1GM9 A;  3RBZ A;  3ZMZ A;  3CME V;  3PJS K;  1V54 C;  2EIL C;  2XAS A;  1CEZ A;  3B8M A;  2R9I A;  1NVP D;  5LHG A;  1COW G;  2H8P C;  3UKM A;  4TWK A;  2HLD G;  1S76 D;  3I56 V;  3BEH A;  2DQ3 A;  4X89 A;  3SYO A;  3VBB A;  1I5Y A;  4PDM A;  2BOB C;  1OHH G;  3CC2 V;  5L3B A;  1BL8 A;  4R50 A;  3CCM V;  4TT3 G;  1AR1 B;  2B5U A;  3OR7 C;  2WLL B;  4JTD B;  2IH1 C;  3LSQ A;  2OT5 A;  1QLE B;  4HAM A;  2A0L A;  2OCC B;  1R3J C;  3KG2 A;  3VOU A;  3LNM B;  1S5H C;  3G71 V;  2UXX A;  1BHA A;  1NR1 A;  3IFX A;  3UM7 A;  2P90 A;  1KP3 A;  1S3J A;  3LSS A;  3K0D A;  4LCU C;  3SYA A;  1FFT B;  4JF3 A;  1VQO V;  4LP8 A;  1SRY A;  3ZRV A;  3TET A;  1PL0 A;  2EJR A;  1E1R G;  3OAA G;  4LBE C;  1RPO A;  1SZT A;  4G28 B;  5CBH A;  5IY5 C;  2ATK C;  4H37 A;  5L3G A;  3ZRS A;  3CCE V;  1QR8 A;  1ZWI C;  3F5W C;  4MW8 A;  1THZ A;  2XAG A;  3MHH C;  1QBZ A;  4P9O A;  1W2B U;  3RVZ A;  3K03 A;  3K04 A;  2XND G;  5C93 A;  1AJP A;  1FXK A;  1K33 A;  3LDC A;  3SYP A;  1GTO A;  2JK5 C;  2LP7 A;  1K34 A;  3CP1 A;  1M57 C;  4GCZ A;  4LC1 A;  4R7C A;  3ZRW A;  1QLN A;  1MAB G;  3F7Y C;  3E86 A;  1P4R A;  3X2Q B;  1K8A W;  4QNH B;  3A0R A;  4PDR A;  4UUJ C;  4WFA V;  1WPX A;  2LFR A;  3OUF A;  2HVK C;  1PNK A;  1RM1 C;  1KEC A;  5B1B B;  3SPJ A;  2XAH A;  1CP9 A;  5EC1 C;  4QPK A;  3ABK B;  2D3O W;  3E2E A;  2DYR B;  3AG2 B;  1YSC A;  5L3C A;  4PA6 A;  3IGA C;  4PDL A;  5B3S B;  3ABM C;  3JD3 A;  2WAM A;  1NR7 A;  3SPH A;  2UXN A;  5IYC O;  2DW4 A;  3ZMT A;  1PNM A;  3OUS A;  4MVM A;  1NJI W;  4KP4 A;  5EBM C;  1R73 A;  4QIW F;  3R65 A;  5HFL A;  1OCC C;  4WFG A;  1OCO B;  3T2M A;  1K5S A;  3G4S V;  2WWW A;  3AG4 B;  1K4D C;  3OMN B;  2Y69 B;  3WG7 B;  3ZN0 A;  4CZZ A;  1E1Q G;  3MHS C;  3W7W A;  1AI6 A;  1SET A;  3CC4 V;  2Y48 A;  3H01 A;  2Z3Y A;  3OM3 B;  3EHB B;  3DGE A;  3OEE G;  5EBL C;  1VQL V;  1ORQ C;  5LGT A;  4GX5 A;  1H38 A;  3B8N A;  1F4M A;  5H6R A;  2JJ2 G;  4MTG A;  4MSW C;  4Z1M G;  3JD4 A;  3E8F A;  2OCC C;  3E8G A;  3AEI A;  2H94 A;  3AG1 C;  3CCL V;  1S72 V;  3E89 A;  1VQ6 V;  2YEV B;  2Q68 A;  2DYS B;  3NXS A;  2C2A A;  1P7B A;  2EIK C;  2ZR3 A;  1JCH A;  3OEH G;  4PDV A;  2JEU A;  3F7V C;  1B6Q A;  3TCU A;  3I55 V;  1R6K A;  1M56 B;  3P30 A;  4RO2 A;  3W7S A;  3ASN B;  1YJ9 V;  1N8R W;  4U7N A;  3ZMU A;  3ASO B;  5DM6 V;  3W7X A;  1GKF A;  1K3E A;  1YJN V;  3LDD A;  2ZXW B;  2M7W A;  1YTF B;  4PA3 A;  2EIJ C;  1DF4 A;  3ABL B;  2P6J A;  4L87 A;  4OXS A;  2X6C A;  2EIM C;  1ARO P;  2P67 A;  2A79 B;  1VQ4 V;  5LHH A;  4JYC A;  1VQM V;  1JQ0 A;  2PI5 A;  1J95 A;  2OTL V;  3JD1 A;  4WF9 V;  1W0J G;  1AI5 A;  2Z5U A;  4XDJ A;  4R6Z A;  3OMA B;  3K06 A;  3FYE B;  1K4C C;  4X8A A;  1V55 B;  1DTO A;  1KC8 W;  2WLM A;  1F23 A;  3D3I A;  1S0V A;  2V7Q G;  4JPR A;  1H8E G;  4N23 A;  2AHY A;  1GO3 F;  1G8M A;  2EIN C;  4MW3 A;  2QEX V;  1S77 D;  2A9H A;  5KUM A;  5KUK A;  1YHQ V;  3FB6 C;  1FS0 G;  3ZRX A;  4JTA B;  3K3W A;  1JX9 A;  1KKD A;  1OCZ B;  3WFV A;  4H33 A;  1K97 A;  2GHY A;  1V54 B;  2EIL B;  5B1A C;  1AI7 A;  2ITC C;  1NH2 B;  2CK3 G;  1K7D A;  2B1G A;  3K08 A;  5CN0 A;  3ZMV A;  2DYR C;  3AG2 C;  2R9R B;  4JGS A;  1DLB A;  4DXW A;  2Q69 A;  1PNL A;  4MVU A;  3CC7 V;  3W7U A;  4BIZ A;  3ETE A;  3K79 A;  4MTF A;  5L3D A;  4PA7 A;  4P9P A;  1G4Y B;  3OE7 G;  4GX0 A;  4ZKI A;  1M9N A;  1OCR C;  2EZP A;  1WLE A;  4UVA A;  3CCV V;  5IYD O;  1R3K C;  2Q6A A;  1M90 W;  1NQT A;  4XDL A;  4MS2 A;  5HFM A;  2YEV A;  5IDJ A;  3ML0 A;  5KA6 A;  1FXH A;  3QO8 A;  4RQE A;  3STL C;  2ZD9 A;  1JJ2 U;  2X6B A;  1SER A;  3ETD A;  2IJH A;  4WFB V;  1EBO A;  2QKS A;  3RVY A;  4RUF A;  2KB1 A;  4CBC A;  4ASU G;  5EC2 C;  1FXK C;  4MVR A;  1YI2 V;  4TSF G;  4E2L A;  1BHB A;  2WLK A;  3CYO A;  3TK1 A;  1Y66 A;  4DO2 A;  4MVO A;  1TUE B;  3G6E V;  5LGN A;  2JIZ G;  2XAF A;  3AG3 B;  3CMA V;  4QE9 A;  2DWE C;  1BMF G;  2DYS C;  2WLL A;  3E8B A;  1YJW V;  3SPG A;  2ZR2 A;  4GT1 A;  1ROP A;  5L3F A;  1Q81 W;  2IU3 A;  1NH2 D;  1HWY A;  1M56 C;  3T4Z A;  1RPR A;  5LGU A;  4Q20 A;  2ITD C;  1AI4 A;  5CMU A;  1Y4M A;  4N21 A;  1M1K W;  1Q7Y W;  3CCU V;  1KQS U;  5CA3 A;  2X7R B;  1F4N A;  2IH3 C;  4WFE A;  1M57 B;  3D36 A;  3FKS G;  3ABT A;  1GMG A;  2XAJ A;  4MTX A;  3W7T A;  3FB5 C;  1K73 W;  4GX2 A;  1QLE C;  2HJF C;  3K9A A;  4UV8 A;  4PA4 A;  2HVJ C;  5LBQ A;  1VQ7 V;  2W6J G;  1CPY A;  1RM1 B;  1I5X A;  5B1N A;  3ZCC A;  4HZ3 A;  4JAS A;  2FTK A;  1PD3 A;  3CCS V;  4KFM A;  5L3E A;  2EZO A;  1VQ5 V;  2IJJ A;  2W6I G;  4KUM A;  3SYC A;  1SES A;  3M99 B;  1K9M W;  2EBO A;  3ABU A;  3CXC U;  2WPD G;  3ABM B;  1QR9 A;  3MD0 A;  2X0L A;  3FB8 C;  3CCJ V;  3JCZ A;  3SJQ C;  4P2Z A;  1JVM A;  3CCQ V;  1VQK V;  2LFS A;  1W0K G;  4GX1 A;  4UXN A;  5H6Q A;  1Q82 W;  2XOK G;  1OCC B;  2DQ0 A;  1MOF A;  4MVZ A;  4R8C A;  5FL7 G;  1VQ8 V;  3QNE A;  4FK5 C;  5DN6 G;  5B3S C;  4QJF B;  3P32 A;  3T4D A;  4WFF A;  5LHI A;  4J9Z B;  1NBM G;  3X2Q C;  3GB7 C;  4BW5 A;  3JD2 A;  4QPJ A;  4JAU A;  4UVC A;  3IC7 A;  4MTO A;  4U7O A;  4FPP A;  3ETG A;  4J9Y B;  1QVF U;  4XBF A;  3HB3 B;  3ZN1 A;  2DWD C;  1PKX A;  4WFH A;  1XL6 A;  4PEL A;  4UV9 A;  1H2G A;  1R6N A;  5KA5 A;  2IJK A;  2B1I A;  3CD6 V;  5B1B C;  4JAV A;  2PI4 A;  1F51 A;  2HKO A;  3AG1 B;  1H8H G;  4I5S A;  2OTJ V;  4RAI A;  3ABK C;  4JTC B;  2EIK B;  5E1A C;  2HFE C;  5EBW C;  1EZJ A;  1R3I C;  2WLH A;  4BAY A;  3LUT B;  1AJN A;  3EFF K;  3OR6 C;  4G27 B;  2WLI B;  3OMI B;  5IYB O;  1VQ9 V;  2P7T C;  3E35 A;  1GM8 A;  1XL4 A;  1K5Q A;  3AG3 C;  1DF5 A;  5GW7 A;  1KP2 A;  2MK3 A;  3K0G A;  2QTO A;  1YTF D;  4EKW A;  2EIJ B;  2ZQM A;  1IXM A;  1FXV A;  4MT8 A;  1OCO C;  3CPW U;  4PA9 A;  5BZB A;  3AG4 C;  2JEX A;  2EIM B;  1MG1 A;  2Y69 C;  4FJC C;  5H9C A;  2X6A A;  4YXW G;  2IU0 A;  3E8H A;  3WG7 C;  1QCE A;  1QVG U;  2JJ1 G;  2HR3 A;  4FIP C;  4G2K A;  3SPC A;  2ZDI A;  2BOC C;  5J9P C;  3FYI B;  1L1F A;  3ZIA G;  4WCE V;  3OW2 U;  2WSS G;  4XDK A;  2AHZ A;  3QO7 A;  3QO5 A;  2EIN B;  1JPX A;  2W0F C;  3STZ C;  2QM8 A;  2K1E A;  2WLJ A;  1KD1 W;  1NVP B;  3LDE A;  4ZBM A;  2NNU A;  3T1C A;  2NLJ C;  3JYC A;  2V1D A;  5B1A B;  5IY5 B;  4FMT A;  2XAQ A;  4P30 A;  3E83 A;  3B77 A;  2ZDI C;  3OGC C;  3OFN G;  3CCR V;  4RUE A;  3ASN C;  1E79 G;  4I9W A;  3ASO C;  2QE7 G;  5B1O A;  1OZ0 A;  2QA4 V;  2ZXW C;  4MVQ A;  3GWO A;  1Q86 W;  2JDI G;  1AJQ A;  1K92 A;  2IW5 A;  3ABL C;  4MVS A;  1MSW D;  1OCR B;  2QM7 A;  3JD0 A;  2F43 G;  3SYQ A;  3RW0 A;  3ZJZ A;  2WLN A;  3FB7 C;  1EFR G;  1YIT V;  4F4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...