2IJJA

Crystal structure analysis of cole1 rom mutant f14y
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
58
structure length
58
Chain Sequence
GTKQEKTALNMARYIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 27
structure length 58
sequence length 58
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijjA00
1RPRA 2IJKA 2IJHA 4DO2A 1GTOA 1GMGA 2GHYA 1NKDA 1PD3A 2IJIA 1F4NA 1F4MA 1RPOA 3K79A 1B6QA 1ROPA 2IJJA
chains in the Genus database with same CATH superfamily
3P3NA 2W0XA 2JS5A 2HFEC 1R1BA 1YVWA 1R3LC 3SPIA 1QVFU 5IWAB 1YF2A 1PL4A 5DECA 3B77A 4L8JA 4KL1A 2CTPA 1WA8A 2RNBA 3OEEG 5FNVA 1WNSA 4DUZB 3KCYA 3E8GA 3OGIB 3J80N 4B3TB 1THZA 4MSWC 4JASA 4B3MB 2XAGA 2QTOA 2CGOA 3ZCCA 2WLIB 1XEQA 3AG2C 3E22A 4G2KA 4GX5A 2F4VB 2OCHA 1ZL8A 1N36B 2E5LB 1SERA 1L0LH 5D5PA 1NR7A 2OT5A 1BQ0A 2X0LA 3OR7C 2Q69A 2R72A 3VQYA 4W4LA 4U3JA 4GKKB 3CCJV 3K3WA 3OAAG 3UCSC 1AR5A 1M56B 1GM9A 5EBMC 4J10A 3BHPA 1OCZC 5IYZB 4PJ0Z 5B1BC 1H2NA 2ZNJA 1IBKB 5DN6G 4HZ3A 4IYHA 3WG7B 2BTOA 1RSOB 2LQTA 1P49A 3FD9A 1VQ9V 2RMKB 5KHGA 2E75B 3ABMC 5BXZA 5KX5B 1SETA 2EX3A 5B1AB 3ZHSA 1HR0O 1N33B 4O2BB 2UUAO 4X20A 1KMIZ 2ZE5A 4YJ2A 1Y4MA 4I50B 5CA3A 1TUBA 4NTYA 5LYJA 4J9YB 3JASB 4BWAA 4F6RA 2QKSA 2Y4UA 4FLXA 1N4CA 1MZEA 1W0KG 1AI7A 2ILMA 1S77D 2DQ3A 2R70A 1KC8W 3TK1A 3G6BA 3AG3C 4JI6B 1Q7YW 2JK5C 4LF8O 4X65B 3ZMSA 3N2KA 1NZ6A 1NT2B 1ENVA 1WN7A 3K03A 3CCEV 1LNQA 1VEWA 1UPGA 5JH7A 1JR9A 2JEXA 2Q0OC 3EFFK 5EZYA 1RP3B 5H2FZ 4R6ZA 1W2BU 2QEXV 3OTFA 4MVOA 4FM0A 4GKJB 1Z5VA 3FFQA 4OX9O 2G38A 1N34O 1HP8A 2WLLA 2BTQB 3CPWU 4DV4B 1QLEC 2JJ1G 4X64O 5LMUB 1XMOO 2EZPA 3UT5A 3ZMTA 2ARHA 4MVZA 1I94O 2IJKA 1WP8A 1KP3A 1Q86W 1BQZA 3W7WA 2DYRC 1KECA 4LFAB 3CCLV 3ZRVA 3SYCA 1ZWIC 1M57C 2KKWA 3T1YO 2WSSG 4H13B 5L3CA 4X62B 5KMGB 4NVPA 3QO8A 2D3OW 3L71H 4MVSA 1N0NA 2YI8A 4JGSA 1KUQA 2Q9LA 3LDCA 5LGUA 2AHZA 5B1OA 3J7AU 3CCRV 3K04A 4DR1B 2O57A 2BSKB 2EILB 4X66B 4F6EA 4FZ0A 2GV9A 3SYPA 2YUAA 5FPOA 1ZLZA 5JJNB 2AXTZ 1SQFA 5BR8B 4FM1A 2VS0A 2K1EA 1W0JG 3N2GA 1VF7A 1FFXB 2VQEO 3ETQA 2F95B 2FTKA 5LOVA 1OCOC 1M5IA 1VQKV 2FMLA 4YJ3B 3OD4A 4HNAA 3AG4C 4JZGA 5DEDA 2VQFO 2CH7B 3ABLC 3G6EV 4MT8A 4DYLA 3LSSA 4HYOA 4LFCO 2ETNA 1SS3A 4UCTA 4O2AB 1FJGB 1EM1A 1Q90D 4Z1VA 2UU9B 3JD1A 4BIUA 1JMKC 1NJIW 4J7ZA 1XHZA 4YXWG 2WAMA 2QM4A 2WLNA 3SR2C 3CXHF 2EIJB 4TQFA 2MW2B 4O4IB 1IZ3A 2H8PC 1E1RG 5IDJA 2Q5ZA 2RN9A 5H6RA 3GWOA 5CB4A 3HKDB 3CD6V 2JVDA 4I4TA 4LF4O 3QNEA 4GX1A 1OCRB 2ZXWC 1FXKC 4B3MO 1S5HC 2XAFA 4DV5O 5LGNA 4MVRA 4KFMA 3SPCA 2F4VO 4DR6O 3D36C 1N36O 2D2CB 1M1KW 2E76B 4LF9O 3C3TA 2QA4V 2Y69C 2YS8A 4JI4O 3GVMA 4P30A 4WFEA 4WBNA 4ZI7A 3HKEB 3OFNG 3O65A 3UO3A 4GYCB 3TCUA 2UUBO 4NTWA 4DK0A 3AEIA 2XT9A 5J2TA 2YSUB 1SC5B 4JI7B 5J2UB 4TOIA 3H1LH 3STZC 1YTFB 1XILA 4O4HA 2P4KA 4ZHQB 1QNMA 1XUQA 1QR8A 5A9GA 5FLXN 2JIZG 5KLVH 3CJHA 1Y74A 4HBNA 1BT8A 2R9IA 2IBZH 3VBBA 4O4JB 1R6KA 1YHQV 1BMFG 4KP4A 1YTFD 3E89A 3FB6C 4DV2O 2A7WA 1HR0B 1AI4A 3IJ4A 2UXNA 4X9QA 2B1IA 2UUAB 2YDEA 5E1AC 2QR4A 1QBZA 1U96A 3BPZA 5EBLC 4EEQA 2BOBC 3P3PA 3S3WA 5KAFZ 1EBOA 3IGAC 2P6JA 1F4MA 5JQGA 1TUEB 5IJ9B 1KU9A 4UV8A 1OZ0A 1K3EA 3QVNA 3OUFA 3H1IH 3PN1A 2WLHA 2QDOA 2BOCC 4ASUG 3ZN0A 4LF8B 2PI4A 3WB0A 5C93A 5JVDB 1SQPH 1IVSA 3F5WC 2Z5UA 1JVMA 1Q6UA 3ZRXA 3JCUZ 5DM6V 2K9PA 1VQ6V 2HJDA 4I9WA 4DV7O 5CN0A 1FXKA 4MTOA 1TVKB 3ZHRA 3D36A 2KG7B 2N04A 4CC6A 2C2AA 5IY5C 1VF5B 3A2FA 1NVPB 5LMUO 1MZFA 2B1GA 4DV1B 2ZE8A 4OPAA 4TQDA 2V7QG 4P9OA 3VQWA 4OX9B 4AILC 2EIKC 1N34B 4LF5O 4QPKA 1CP9A 4UVAA 3FB8C 3K06A 4I9QA 4Z2WA 3SPHA 1J5EO 4R7CA 3ABKC 4X64B 5J9PC 2X6BA 1XMOB 4TV8A 2Q73A 4U7NA 1GO3F 1FPOA 1I94B 4BW9A 1WAZA 5H5NA 3OMIB 1AILA 3K08A 1XNRO 3F7VC 1NU1H 4JTAB 1AB3A 2LFSA 1CPYA 3JAWB 2L35A 1KD1W 3JD3A 2P06A 2QGNA 3RYFB 4Z1MG 5LMNO 4DV6O 4LR3A 3UM7A 3ZHVA 2ZCEA 3D8CA 3JAMN 1ZSPA 2PYJA 3SDLA 2M7WA 5L3EA 2JRIA 3RGBA 4PDVA 2ZR2A 4QNHB 4LWSA 1IXMA 2KQXA 4TV9A 4ZKIA 1I7FA 1DTOA 4GX2A 4IGGA 4EB6B 1XDCA 1Z2GA 5GTHZ 3DC5A 3I5DA 4O4LB 2AZ2A 4G28B 2VQEB 1JOYA 2DW4A 4N23A 1SQXH 2LJ2A 1PNMA 4JI5O 3FX7A 1Q8IA 5KHIA 2AHYA 2ZM6O 4DR2O 1QLNA 2VQFB 3SGIA 1TAEA 3B09A 4NXNO 3ML0A 4FFBB 2EIMB 1V54B 3BABA 4H37A 1JCHA 3CCUV 2ITDC 3E8BA 4LFCB 4QJFB 3T2MA 4EFBA 2JGDB 2YXLA 1M93A 3P30A 3OR6C 3CC7V 1XNQO 3A8TA 5BMVB 5IYBO 1RPRA 1JJOA 2V4DA 4CS2A 3JSNA 4YIOA 1MABG 5AG2A 1Y67A 1SESA 4FVMA 4PV1B 2WLKA 4PA7A 3EXAA 2GSMB 1P4RA 1Z5WA 2GBOA 1H38A 4B3RO 4XDKA 5CA0B 3RT3C 5LA6A 1FS0G 3VQVA 2IJHA 2KSDA 3CRAA 1M56C 2ZKOA 2IU3A 3SYQA 4LF4B 5EYPA 1B06A 2ZE6A 4HAMA 4DV5B 4C7UA 3RYHA 3WG7C 4DR6B 3Q4HA 4I55A 5L3GA 5GTIZ 1Q81W 4DK1A 4LF9B 1ZUQA 1MOFA 1PPJH 4KUMA 3OMNB 4JI4B 2V1DA 1GN4A 5B1AC 4JI7O 2E3CA 3F7YC 1P7GA 3RYIB 3CB2A 2CE4A 3H1JH 1OHHG 1EFRG 1K4CC 3ZHTA 1N8RW 1LUVA 2UUBB 4CH6A 2LW7A 3BCCH 4LFBO 1M4UA 2DWDC 4FLYA 3AG1B 3FKSG 1I5YA 5IJ0B 4IHJA 4X1KA 5H6QA 5D5QA 4OPHA 1XREA 1AI6A 1D5AA 1PL0A 1H8HG 4CH3A 1Y6XA 1VQ7V 1S0VA 4TUYA 1BHAA 1SF9A 3CSXA 2FB5A 1D5NA 4QPJA 3CE2A 3JARB 2RJZA 3CEIA 1XL6A 2N74A 2YIAA 1SQQH 4DV2B 4A5UB 1HDJA 3ZMUA 5EC2C 4J9ZB 3FYEB 2UUCO 1COWG 3JCZA 2QWOB 3CC4V 2YEVB 1NS1A 2Q7EA 2IU0A 3B8NA 1KBHA 5LXTB 4E2LA 2QWNB 4DR5O 2WLIA 3CS5A 1G1XB 2WWWA 1XL4A 3JYCA 4MTGA 3RN4A 3CC2V 3L70H 2F66C 1G4YB 2F23A 1AVMA 2AW9A 1SQVH 4JI3O 4DRXB 2H94A 1MA1A 3U0ZA 4PELA 4FJCC 4B3SO 3CX5F 1Q43A 2CDYA 2P7TC 1AI5A 2Z3YA 5KHHA 4DXWA 4DV1O 4DV7B 3ASOB 5IYZA 1NQTA 5C8YB 4OGQB 2QTSA 2NNUA 1BSMA 4WF9V 2NR5A 1AJNA 4UB6Z 1RSOA 4P2ZA 2HG5C 2ZNIA 1S76D 4JI8O 4K3AA 1V55B 3HKBB 3WB2A 5KX5A 4LF7O 2VWJA 4O2BA 4UFZA 4LF5B 3UKMA 2E74B 3P32A 2CGNA 4UXNA 4I50A 2EILC 5K1XA 1J5EB 1S5LZ 2NN4A 3B4SA 4AI8A 3T4DA 3CRQA 3W7TA 1ORQC 2W0FC 3JASA 4KXRA 2B9ZA 2DYSB 2UXCO 1PV0A 4QIWF 4ZBMA 3ZMZA 1G6UA 4FMTA 3DXRB 3W7XA 1XNRB 1V9PA 2WLMA 2AZ0A 2HP8A 1WB8A 3ABTA 1EN4A 3TETA 4WFHA 3FAVB 3K5NA 4K0KO 4GUNA 2YC0A 2ZINA 5LMNB 2P22C 4DV6B 5KA5A 3MHSC 3RVZA 3KKYA 1R73A 4BIZA 4UV9A 3RYCB 1GRJA 3GB7C 2DOSA 3DGEA 2EIJC 1VQNV 4RQFA 1US6A 5CBGA 1KB9F 4GCZA 3B40A 3CCQV 4LP8A 4MVQA 5EK0A 1WPXA 2BTQA 4JTDB 2RDCA 1KP2A 4AQYO 4J11A 4GLXA 1FXHA 1VMGA 1SA0B 3E8FA 1PM9A 1YCIA 2IM9A 4JI5B 2M6YA 3ETDA 1E79G 3D3IA 4ZIBA 2ZM6B 4DR2B 2YIBD 1LUWA 1OCRC 4NXNB 3HB3B 1QQCA 3WU2Z 3U11A 4CH4A 4IIJB 1XNQB 1XMQO 3B8MA 3VOUA 2DMXA 3JALB 1EZJA 4X1IB 1M9NA 3ZHQA 3K5OA 1B3QA 2UXBO 2Y0IA 3UO2A 5KMGA 1F23A 3RWRD 2OCCC 4RAIA 1M90W 1OCCB 1SZTA 4JZ2A 4JPRA 2BSKA 4JYBA 3I56V 1JFFB 3LDEA 4NB5A 4PDLA 4B3RB 2XOKG 3ZRWB 1HWYA 1XQ8A 3X2QB 3E83A 3FB5C 5GONB 1VQPV 1RPOA 1K5QA 3AG7A 3QTCA 1K8AW 4LF6B 1FFXA 3ZN1A 2YIBA 2N05A 1VQOV 1O9GA 1OJHA 3K0GA 4Q20A 1FYJA 1VP7A 4YJ3A 3OGCC 3OTOO 1YJNV 1YJWV 2A0LA 1L8DA 2OCCB 4TT3G 1GTOA 2CH7A 1GN2A 3HKCB 5JJJB 1VARA 2ODMA 3BRCA 1IBMO 4O2AA 2VWKA 1ZTEA 4YHHO 3JAKB 2NLJC 3CRMA 3STLC 5B3SB 1H8EG 1N32O 1H2KA 1K97A 4X88A 1GM8A 1GH6A 1GN6A 5L3DA 4LFBB 1A32A 4O4IA 1VQ5V 4FLTA 3E86A 3DC6A 5B66Z 1K92A 4R50A 3K5LA 1AROP 2GDSA 3B2EE 2B5UA 3HKDA 4BAYA 1WP7A 3SPJA 1JQ0A 1NKDA 2LO1A 1K73W 3ETGA 1I0HA 2IJJA 1MNGA 5JCOC 2UUCB 3L9DA 2P4VA 4DR3O 4H0LB 2LGWA 2A06H 1LR1A 4LNUB 1ZX3A 4H44B 3ZJZA 4I0XB 4DR5B 1YIJV 1Q6HA 3HKEA 4JF3A 2GUZB 2VRZA 4LC1A 3VQXA 3ASNB 4DV3O 1GN3A 4N21A 3MD0A 4ZOLB 5J2UA 3BEHA 3SJBC 3FB7C 4JI3B 5LHHA 4ZHQA 2GHYA 3T1HO 3M99B 4B3SB 1JX9A 1RM1B 1SKVA 1DF4A 4LCUC 3K0DA 3L72H 1SZXA 5ITZB 3ZRSA 3H1KH 2FYUH 4J41A 3JATB 1R3IC 3LUTB 1BGYH 4QE7A 2F1MA 2X6CA 4O4JA 4JI2O 1PD3A 4JI8B 3ZBHA 1QR9A 1KQSU 4LF7B 4PA3A 5LHGA 1Q3EA 2BCCH 3G80A 4W4KA 1NVPD 2JDIG 1O9HA 3U10A 3A0RA 2XNDG 1WB7A 5LGTA 4PI0A 5IJ9A 1NBMG 1Y76B 3ABUA 1GM7A 3H9VA 4FLWA 2IH3C 2UXCB 4E4EA 1JPXA 1GMGA 1L0NH 4I7ZB 2PTMA 3CYOA 4YIPA 4UCUA 1R6NA 4X1YB 4JTCB 3C90A 2DE0X 5JVDA 5BY1A 2LGQA 5L3BA 4K0KB 2EIMC 1V54C 1MMMA 2Y0PA 4EKWA 2UXDO 2HVJC 1BE3H 1AJQA 3OMAB 4H33A 4B7KA 3IAYA 1TVKA 1DK1A 3EHBB 5JCOA 2KG7A 1WA8B 3BAAA 3JSLA 5FNVB 5HFLA 4CC5A 4JYAO 4NKGB 2PI5A 3C3SA 4PD4F 3AK3A 2W6IG 4AQYB 5EBWC 2EINB 3E22B 3LNMB 2DQ0A 3L74H 3O9OA 1ZL8B 1R3JC 3D3QA 3SYAA 4CS3A 2QWQB 3K9AA 2QM7A 4G27B 3BY6A 4ICGA 1BZKA 2Y48A 3OUSA 1SQGA 5EIBC 3K5MA 4U3JB 4LBEC 2XAQA 1QHTA 3ZS8C 4FM2A 1IXBA 2QE7G 1MSWD 1NR1A 4PHZA 4UCRA 1I08A 1EZVH 2YI9A 1PP9H 4K8XA 3JAWA 1URFA 4B7EA 1Q82W 5LL6Y 3J81N 5KHKA 1XMQB 4CBCA 4XDLA 5EC1C 3K58A 3RYFA 3CXCU 2HKOA 4QGPA 2UXBB 1FD9A 1VQ4V 3RBZA 3TJTA 5KA6A 1Q6IA 2P67A 3BA8A 4DV0B 4JAAA 1YITV 1XHXA 2OIGA 4LF6O 4X20B 4YJ2B 2YICA 1X4TA 3AG1C 2PZSA 2OYQA 1TUBB 4BIOA 4UVBA 1YDXA 5LYJB 2ATKC 4U3FH 4F6RB 4EB6A 4CZZA 1IBLO 5HFMA 2ADPA 2QM8A 4O4LA 2YXHA 2CUGA 4FZ1A 3K59A 2KB1A 3APQA 2ZE7A 3OTOB 4UCSA 4KHPO 4L87A 5EIBD 1U97A 3APOA 3PJSK 4IT5A 4FFBA 2PF4E 5H9CA 3N2KB 4FPPA 1IBMB 2JGDA 1GKFA 4YHHB 5E79Z 5BMVA 5JH7B 4WFBV 1OV9A 1VQLV 5EZYB 4J42A 2RQ6A 3OEHG 1N32B 4MVMA 3E8HA 3TXQA 2EULA 5LBQA 1L1FA 3TXSA 4LH6A 1H2GA 1K33A 5IT9N 4FK5C 2X7RB 2WLLB 5FPRA 3AG2B 4NR1A 2A79B 2L6LA 4JI1O 4UCVA 5CA0A 1PNKA 5L3FA 1NTMH 3UT5B 4J7JA 1HNZO 3LSQA 1PKXA 5JWPA 4MTXA 3ASOC 1DF5A 4DO2A 2HHHO 2LFRA 2JJ2G 3SPGA 3SYOA 4P9PA 4DR3B 1OCZB 1V55C 2R9AA 5B1BB 4NXMO 2QKCA 1AR1B 2DWEC 2R9RB 3RYIA 1HNWO 2P90A 4DV3B 2RCVA 3ABMB 5TISZ 3CHXA 1JJ2U 1K4DC 5IE9A 5KUMA 2DYSC 4X8AA 4JAUA 3MAQA 5IJ0A 1H2SB 1K7DA 3T1HB 1Q5OA 4RO2A 2JGUA 2OIEA 1VIBA 3K79A 3N2GB 1QVGU 2QWPB 3DTUB 3TGUH 2CTRA 2QWRB 2ZD9A 5CA1B 5LOVB 3M8AA 2PGGA 4IYIA 3AG3B 3JARA 2PYLA 4D7SA 4XDJA 4HNAB 3G71V 4YY3O 4JI2B 2Q7HA 2Q4PA 1XOUA 3ZHUA 5CBFA 3M7MX 3A0HZ 2Q6AA 3ZIAG 1S72V 2YEVA 1K5SA 3CRCA 5LXTA 4DUYO 1FXVA 3AK2A 4LH7A 4MS2A 3T1CA 3W7SA 3G4SV 4DR7O 5K1PA 2Q68A 3HPLC 1QLEB 4DRXA 1UFIA 4JI0O 4X89A 2Y4TA 5CB4B 1QU7A 2XTAA 2XUMA 2ZT9B 2GTSA 2UXDB 4I4TB 5C8YA 3WFVA 2Q8VA 1SRYA 5KHJA 3I55V 2DYRB 4WCEV 1HW7A 3OE7G 4B08A 1B04A 1YJ9V 2A9HA 4MTFA 3RW0A 2LW1A 2CTQA 3QO7A 1M57B 3HKBA 4JYAB 1OCCC 5CA1A 4WBNB 4TSFG 2DJVA 4RUFA 4ZI7B 3ZEDA 4BW5A 1R6TA 3ETEA 3ICXA 2XAHA 4DR4O 3BA9A 3F5TA 4JV5O 1QCEA 2MK3A 4RUEA 3X2QC 5J2TB 4UVCA 3IC9A 3GWKC 1W59A 3ZMVA 4O4HB 3DXRA 1TGOA 1HNXO 1FFTB 1GAXA 4RQEA 3H01A 4JYCA 4PA6A 3K9SA 4NYKA 3FAVA 3CJHB 2JEUA 4DV0O 2WPDG 3OT7A 1Y74B 1OCOB 3JD2A 3L75H 4FIPC 3AG4B 2HLDG 1TA8A 1WJZA 2UXXA 4JYYA 4ABMA 4J7KA 3ABLB 3RYCA 5IWAO 5B5EZ 5B3SC 1IX9A 1F51A 1P84F 2QKAA 2CTWA 1FKAO 1I5XA 4DUZO 5CBHA 4R8CA 1VF6C 1CEZA 3NR7A 4B3TO 1FAFA 5LHIA 1H2LA 1KKDA 5JQGB 1IBLB 4PA9A 3E2EA 4NTXA 1SA0A 1YXBA 4WFFA 3BVOA 2E5LO 4DW0A 3JD4A 4FLVA 1BS3A 4DW1A 4KHPB 1MSDA 4GZRB 2OTJV 3IC7A 4GKKO 1KYOF 4IL6Z 4EFEA 3BFRA 1N0JA 2XAJA 3AK1A 3NXSA 4IIJA 3CMEV 3KZIZ 2WA4A 2ZXWB 2HJFC 4JAVA 1FXKB 3JALA 1IBKO 3QF7A 4X1IA 2ZDIC 2ITCC 2F43G 5KUKA 1YSCA 1AP5A 1NH2B 3KG2A 2Y69B 3ASNC 4D7TA 4TWKA 1BHBA 1N33O 1JFFA 4PDRA 1IURA 3CCMV 3H1HH 3JD0A 4JI1B 3OM3B 3WB1A 3ZRWA 1R3KC 3RVYA 3N27A 2H3OA 5GONA 1RM1C 1ZAUA 4TV8B 1HNZB 1EN5A 1P7BA 1NH2D 4UB8Z 2HHHB 2GTAA 2WA3A 3R65A 2Q0AA 5FL7G 5KAIZ 3DSQA 4JI6O 1PNLA 1VQ8V 2PUSA 3KCXA 2ZR3A 4XBFA 1K34A 3HKCA 3MDSA 2F93B 4X65O 4NXMB 4GX0A 3MHHC 1NTKH 4J80A 5F2VO 1HNWB 2BE3A 2OWOA 2X6AA 4AHCA 3JAKA 3OW2U 4PA4A 5A2QN 4MW3A 2EBOA 2ZIOA 2XASA 2P5OA 3R66A 1NI8A 2FL4A 1UJWB 4CS4A 1YI2V 1ROPA 4PDMA 4D6TH 1VF6A 3SJCC 4UUJC 1S5JA 3CMAV 4LWSB 4GKJO 4PI2A 2EJ7A 1D2DA 4MW8A 1DGSA 4TV9B 1WLEA 5CMUA 3E35A 4K8ZA 4DV4O 4FLZA 4QE9A 1E1QG 3UQ8A 2WLJA 2W6JG 1F4NA 4Q6GA 3FYIB 1X59A 1BL8A 1JA8A 5LP6C 5IYCO 4K35A 1IDSA 4YY3B 2FKXA 2DN9A 2HEPA 1J95A 1VQMV 1G8MA 2IW5A 1YZBA 1KKCA 2YIDA 1NTZH 1GK9A 2A3QA 4LFAO 1EN6A 3K57A 3THOA 2AGAA 1H2MA 2EJRA 2Z0AA 3G67A 4FFKA 4LNUA 4DUYB 1SQBH 3ZX6A 2ZQMA 4I5SA 4I0XA 3CCSV 2ZDIA 2YXYA 2XHBA 2GUZA 2EINC 2IJIA 4X62O 5IY5B 1Y66A 4UCOA 5LP6B 3LNNA 2EIKB 5JJEB 1XI1A 4DR7B 3T1YB 4ZOLA 4DR1O 4U7OA 4X66O 3QO5A 4OXSA 3ABKB 4JI0B 3HR0A 5LA6B 5BR8O 2CK3G 3CRRA 2Q67A 5B1NA 1K9MW 2CAZC 1YEWA 5ITZA 5EYPB 1WPBA 1CXZB 3JATA 4MVUA 3CWBH 3LDDA 1MG1A 4WFAV 2PY5A 3A0BZ 3RYHB 3QG5A 4WFGA 2ZIMA 4BR6A 3L73H 3Q4HB 4I55B 2IH1C 3W7UA 4F4LA 1RFYA 2HR3A 3IFXA 2OTLV 4CH5A 1FJGO 4DR4B 1F7YA 1XBLA 2UU9O 4JV5B 2JS3A 2HVKC 2LP7A 4FLUA 2ADQB 1Y76A 2QJ1A 1DLBA 4RWUA 3CP1A 1AP6A 3SJAC 3S3XA 2Q7GA 4IHJB 3RFRA 4X1KB 3EVKA 1HNXB 1AJPA 2QSAA 3T4ZA 1BCCH 4GT1A 2EZOA 4X1YA 1B6QA 1AR4A 3LSUA 3SJQC 1T5EA 5IYDO 1S3JA 4TUYB 5GW7A 5LP6A 3CCVV 5BZBA
chains in the Genus database with same CATH topology
1SZTA 4JPRA 3D36A 4JYBA 3I56V 3K79A 3LDEA 1QVGU 2HFEC 4PDLA 2C2AA 5IY5C 1NVPB 2XOKG 3DTUB 1R3LC 2B1GA 3SPIA 3ZRWB 1QVFU 1HWYA 2V7QG 2ZD9A 4P9OA 2EIKC 3B77A 3X2QB 3E83A 4QPKA 3FB5C 1CP9A 3AG3B 4UVAA 1VQPV 1RPOA 1K5QA 3FB8C 3K06A 3OEEG 4XDJA 3G71V 3SPHA 1K8AW 3E8GA 3ZN1A 4R7CA 3ABKC 1VQOV 5CBFA 5J9PC 3K0GA 2X6BA 1THZA 4MSWC 4Q20A 4JASA 2XAGA 3OGCC 2Q6AA 4U7NA 2QTOA 1YJNV 1YJWV 3ZCCA 2WLIB 3AG2C 3ZIAG 1S72V 2A0LA 4G2KA 1GO3F 2YEVA 4GX5A 2OCCB 4TT3G 1GTOA 1K5SA 1SERA 3OMIB 1FXVA 1NR7A 3K08A 2OT5A 2X0LA 3F7VC 3OR7C 4MS2A 2Q69A 4JTAB 2LFSA 1CPYA 2NLJC 1KD1W 3JD3A 3STLC 3T1CA 3CCJV 5B3SB 3K3WA 3W7SA 3G4SV 3OAAG 1H8EG 4Z1MG 1K97A 1M56B 1GM8A 1GM9A 4X88A 5EBMC 2Q68A 5L3DA 3UM7A 3HPLC 1QLEB 1OCZC 1VQ5V 4X89A 5B1BC 3E86A 5DN6G 4HZ3A 2M7WA 3WG7B 1K92A 4R50A 5L3EA 4PDVA 1AROP 2ZR2A 4QNHB 1VQ9V 2B5UA 1IXMA 3WFVA 3ABMC 4ZKIA 1DTOA 1SETA 4GX2A 1SRYA 5B1AB 4BAYA 3I55V 2DYRB 4WCEV 3SPJA 3OE7G 1JQ0A 1Y4MA 1YJ9V 1NKDA 2A9HA 4MTFA 3RW0A 5CA3A 4G28B 1K73W 1JOYA 3QO7A 1M57B 2DW4A 4N23A 3ETGA 1OCCC 4J9YB 1PNMA 2QKSA 4TSFG 2IJJA 4RUFA 2AHYA 4BW5A 1W0KG 3ETEA 2XAHA 1QLNA 1AI7A 1S77D 2DQ3A 3ML0A 1QCEA 2EIMB 1V54B 2MK3A 4H37A 1JCHA 4RUEA 3TK1A 3X2QC 2ITDC 3CCUV 3E8BA 3ZJZA 3AG3C 4QJFB 3T2MA 1YIJV 1Q7YW 2JK5C 4JF3A 4UVCA 3P30A 3OR6C 3CC7V 4LC1A 3ZMVA 5IYBO 1RPRA 3ASNB 1KC8W 3ZMSA 4N21A 3MD0A 1ENVA 1FFTB 4RQEA 3K03A 3CCEV 1LNQA 3H01A 4JYCA 1MABG 3BEHA 4PA6A 3FB7C 1SESA 5LHHA 2JEUA 2WLKA 2WPDG 2GHYA 2JEXA 3M99B 3EFFK 4PA7A 1OCOB 3JD2A 1JX9A 1RM1B 2GSMB 1P4RA 4FIPC 3AG4B 2HLDG 1DF4A 4R6ZA 4LCUC 1W2BU 3K0DA 1H38A 2UXXA 2QEXV 4XDKA 3ZRSA 4MVOA 3ABLB 5B3SC 1FS0G 1F51A 1R3IC 3LUTB 4QE7A 2WLLA 2IJHA 1M56C 2X6CA 1I5XA 3CPWU 1PD3A 2IU3A 5CBHA 3SYQA 4R8CA 1QLEC 2JJ1G 1QR9A 1CEZA 1KQSU 4HAMA 5LHIA 4PA3A 5LHGA 1KKDA 3WG7C 2EZPA 3ZMTA 4PA9A 1NVPD 3E2EA 2JDIG 5L3GA 4WFFA 1Q81W 4MVZA 2IJKA 3A0RA 1MOFA 2XNDG 4KUMA 3OMNB 1KP3A 3JD4A 1Q86W 2V1DA 5LGTA 5B1AC 3W7WA 1NBMG 3F7YC 3ABUA 2DYRC 1KECA 3CCLV 1GM7A 2IH3C 2OTJV 3IC7A 3ZRVA 1OHHG 1JPXA 3SYCA 1EFRG 1GMGA 1K4CC 1M57C 1ZWIC 1N8RW 2WSSG 2XAJA 3CYOA 3NXSA 5L3CA 1R6NA 3CMEV 2DWDC 4JTCB 3QO8A 2D3OW 3AG1B 3FKSG 4MVSA 1I5YA 2ZXWB 2HJFC 4JAVA 1FXKB 4JGSA 5L3BA 5H6QA 2EIMC 1V54C 3LDCA 5LGUA 2AHZA 5B1OA 3CCRV 1AI6A 1PL0A 3K04A 1H8HG 2ZDIC 2ITCC 4EKWA 2EILB 2F43G 5KUKA 1VQ7V 1YSCA 2HVJC 1NH2B 1AJQA 3KG2A 1S0VA 1BHAA 3OMAB 4H33A 3SYPA 2Y69B 3ASNC 3EHBB 4TWKA 1BHBA 4QPJA 2K1EA 1W0JG 4PDRA 3CCMV 3JD0A 3OM3B 5HFLA 3ZRWA 1XL6A 1R3KC 3RVYA 2FTKA 2PI5A 1OCOC 1RM1C 1VQKV 3ZMUA 5EC2C 4J9ZB 2W6IG 3FYEB 3AG4C 5EBWC 2EINB 1COWG 3JCZA 3CC4V 2YEVB 3LNMB 2DQ0A 1P7BA 2IU0A 3B8NA 1NH2D 1R3JC 3ABLC 3SYAA 3G6EV 4MT8A 3K9AA 4E2LA 2QM7A 4G27B 3BY6A 3R65A 3LSSA 4HYOA 5FL7G 2WLIA 1PNLA 2WWWA 1VQ8V 2ZR3A 2Y48A 1XL4A 3JYCA 3OUSA 4XBFA 1K34A 4MTGA 3CC2V 3JD1A 4BIUA 1NJIW 4LBEC 2XAQA 4YXWG 1G4YB 2WAMA 4GX0A 3MHHC 2WLNA 2QE7G 1MSWD 1NR1A 2EIJB 2X6AA 1Q82W 3OW2U 4PA4A 4MW3A 2H94A 4CBCA 2EBOA 2XASA 4PELA 4FJCC 4XDLA 5EC1C 2H8PC 1E1RG 5IDJA 1UJWB 3CXCU 2HKOA 1YI2V 2P7TC 1AI5A 1ROPA 2Z3YA 4PDMA 4DXWA 3ASOB 1VQ4V 4UUJC 5H6RA 3RBZA 3CMAV 5KA6A 1NQTA 3GWOA 2P67A 4MW8A 2NNUA 4WF9V 1WLEA 3CD6V 5CMUA 1YITV 3E35A 1AJNA 4P2ZA 1E1QG 4QE9A 2HG5C 2WLJA 3QNEA 2W6JG 1F4NA 1S76D 4GX1A 3AG1C 1OCRB 1V55B 2ZXWC 3FYIB 1FXKC 1BL8A 1S5HC 4UVBA 2ATKC 2XAFA 5IYCO 5LGNA 3UKMA 4MVRA 4KFMA 3SPCA 4CZZA 3P32A 5HFMA 1M1KW 4UXNA 2EILC 2QM8A 2QA4V 3T4DA 3W7TA 1ORQC 2Y69C 2W0FC 2KB1A 1J95A 1VQMV 1G8MA 2IW5A 4P30A 4WFEA 1GK9A 4L87A 3OFNG 2DYSB 3PJSK 2EJRA 4QIWF 4ZBMA 3TCUA 3ZMZA 4FMTA 5H9CA 2ZQMA 4I5SA 4FPPA 3W7XA 3CCSV 2WLMA 2ZDIA 3AEIA 2EINC 1GKFA 2YSUB 2IJIA 5IY5B 3ABTA 3TETA 1Y66A 3STZC 1YTFB 4WFHA 4WFBV 2EIKB 1VQLV 1QR8A 3OEHG 4MVMA 3E8HA 5KA5A 4U7OA 3MHSC 2JIZG 5LBQA 3RVZA 3QO5A 1R73A 1L1FA 4OXSA 4BIZA 3ABKB 4UV9A 1H2GA 1K33A 4FK5C 2R9IA 2X7RB 3GB7C 3VBBA 2CK3G 2Q67A 2WLLB 3AG2B 5B1NA 2A79B 3DGEA 2EIJC 1VQNV 1K9MW 1YHQV 1R6KA 4RQFA 1BMFG 4KP4A 5CBGA 4GCZA 1YTFD 3CCQV 4MVUA 1PNKA 3E89A 3FB6C 3LDDA 1MG1A 4LP8A 5BZBA 4MVQA 5L3FA 4WFAV 5EK0A 1WPXA 1AI4A 4JTDB 2UXNA 2B1IA 1KP2A 5E1AC 4WFGA 1QBZA 3LSQA 5EBLC 1PKXA 1FXHA 2BOBC 2IH1C 3ASOC 3E8FA 1DF5A 4MTXA 4F4LA 3W7UA 1EBOA 4DO2A 3IGAC 2LFRA 2P6JA 2JJ2G 1F4MA 2HR3A 3IFXA 3SPGA 1TUEB 2OTLV 3SYOA 4P9PA 3ETDA 1E79G 3D3IA 4UV8A 1OZ0A 1K3EA 3OUFA 1OCZB 1OCRC 1V55C 2HVKC 2LP7A 5B1BB 2WLHA 3HB3B 2BOCC 1AR1B 4ASUG 2DWEC 1DLBA 2R9RB 3ZN0A 3CP1A 2PI4A 5C93A 3B8MA 2P90A 3VOUA 3ABMB 1EZJA 3F5WC 1AJPA 2Z5UA 1JVMA 3ZRXA 1M9NA 3T4ZA 1JJ2U 1K4DC 4GT1A 5DM6V 2EZOA 1VQ6V 1B6QA 5KUMA 2DYSC 3SJQC 1F23A 4X8AA 4I9WA 5IYDO 1S3JA 4JAUA 2OCCC 5CN0A 4RAIA 1K7DA 5GW7A 1FXKA 3CCVV 1M90W 4MTOA 1OCCB 4RO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPR A;  2IJK A;  2IJH A;  4DO2 A;  1GTO A;  1GMG A;  2GHY A;  1NKD A;  1PD3 A;  2IJI A;  1F4N A;  1F4M A;  1RPO A;  3K79 A;  1B6Q A;  1ROP A;  2IJJ A; 
#chains in the Genus database with same CATH topology
 3P3N A;  2W0X A;  2JS5 A;  2HFE C;  1R1B A;  1YVW A;  1R3L C;  3SPI A;  1QVF U;  5IWA B;  1YF2 A;  1PL4 A;  5DEC A;  3B77 A;  4L8J A;  4KL1 A;  2CTP A;  1WA8 A;  2RNB A;  3OEE G;  5FNV A;  1WNS A;  4DUZ B;  3KCY A;  3E8G A;  3OGI B;  3J80 N;  4B3T B;  1THZ A;  4MSW C;  4JAS A;  4B3M B;  2XAG A;  2QTO A;  2CGO A;  3ZCC A;  2WLI B;  1XEQ A;  3AG2 C;  3E22 A;  4G2K A;  4GX5 A;  2F4V B;  2OCH A;  1ZL8 A;  1N36 B;  2E5L B;  1SER A;  1L0L H;  5D5P A;  1NR7 A;  2OT5 A;  1BQ0 A;  2X0L A;  3OR7 C;  2Q69 A;  2R72 A;  3VQY A;  4W4L A;  4U3J A;  4GKK B;  3CCJ V;  3K3W A;  3OAA G;  3UCS C;  1AR5 A;  1M56 B;  1GM9 A;  5EBM C;  4J10 A;  3BHP A;  1OCZ C;  5IYZ B;  4PJ0 Z;  5B1B C;  1H2N A;  2ZNJ A;  1IBK B;  5DN6 G;  4HZ3 A;  4IYH A;  3WG7 B;  2BTO A;  1RSO B;  2LQT A;  1P49 A;  3FD9 A;  1VQ9 V;  2RMK B;  5KHG A;  2E75 B;  3ABM C;  5BXZ A;  5KX5 B;  1SET A;  2EX3 A;  5B1A B;  3ZHS A;  1HR0 O;  1N33 B;  4O2B B;  2UUA O;  4X20 A;  1KMI Z;  2ZE5 A;  4YJ2 A;  1Y4M A;  4I50 B;  5CA3 A;  1TUB A;  4NTY A;  5LYJ A;  4J9Y B;  3JAS B;  4BWA A;  4F6R A;  2QKS A;  2Y4U A;  4FLX A;  1N4C A;  1MZE A;  1W0K G;  1AI7 A;  2ILM A;  1S77 D;  2DQ3 A;  2R70 A;  1KC8 W;  3TK1 A;  3G6B A;  3AG3 C;  4JI6 B;  1Q7Y W;  2JK5 C;  4LF8 O;  4X65 B;  3ZMS A;  3N2K A;  1NZ6 A;  1NT2 B;  1ENV A;  1WN7 A;  3K03 A;  3CCE V;  1LNQ A;  1VEW A;  1UPG A;  5JH7 A;  1JR9 A;  2JEX A;  2Q0O C;  3EFF K;  5EZY A;  1RP3 B;  5H2F Z;  4R6Z A;  1W2B U;  2QEX V;  3OTF A;  4MVO A;  4FM0 A;  4GKJ B;  1Z5V A;  3FFQ A;  4OX9 O;  2G38 A;  1N34 O;  1HP8 A;  2WLL A;  2BTQ B;  3CPW U;  4DV4 B;  1QLE C;  2JJ1 G;  4X64 O;  5LMU B;  1XMO O;  2EZP A;  3UT5 A;  3ZMT A;  2ARH A;  4MVZ A;  1I94 O;  2IJK A;  1WP8 A;  1KP3 A;  1Q86 W;  1BQZ A;  3W7W A;  2DYR C;  1KEC A;  4LFA B;  3CCL V;  3ZRV A;  3SYC A;  1ZWI C;  1M57 C;  2KKW A;  3T1Y O;  2WSS G;  4H13 B;  5L3C A;  4X62 B;  5KMG B;  4NVP A;  3QO8 A;  2D3O W;  3L71 H;  4MVS A;  1N0N A;  2YI8 A;  4JGS A;  1KUQ A;  2Q9L A;  3LDC A;  5LGU A;  2AHZ A;  5B1O A;  3J7A U;  3CCR V;  3K04 A;  4DR1 B;  2O57 A;  2BSK B;  2EIL B;  4X66 B;  4F6E A;  4FZ0 A;  2GV9 A;  3SYP A;  2YUA A;  5FPO A;  1ZLZ A;  5JJN B;  2AXT Z;  1SQF A;  5BR8 B;  4FM1 A;  2VS0 A;  2K1E A;  1W0J G;  3N2G A;  1VF7 A;  1FFX B;  2VQE O;  3ETQ A;  2F95 B;  2FTK A;  5LOV A;  1OCO C;  1M5I A;  1VQK V;  2FML A;  4YJ3 B;  3OD4 A;  4HNA A;  3AG4 C;  4JZG A;  5DED A;  2VQF O;  2CH7 B;  3ABL C;  3G6E V;  4MT8 A;  4DYL A;  3LSS A;  4HYO A;  4LFC O;  2ETN A;  1SS3 A;  4UCT A;  4O2A B;  1FJG B;  1EM1 A;  1Q90 D;  4Z1V A;  2UU9 B;  3JD1 A;  4BIU A;  1JMK C;  1NJI W;  4J7Z A;  1XHZ A;  4YXW G;  2WAM A;  2QM4 A;  2WLN A;  3SR2 C;  3CXH F;  2EIJ B;  4TQF A;  2MW2 B;  4O4I B;  1IZ3 A;  2H8P C;  1E1R G;  5IDJ A;  2Q5Z A;  2RN9 A;  5H6R A;  3GWO A;  5CB4 A;  3HKD B;  3CD6 V;  2JVD A;  4I4T A;  4LF4 O;  3QNE A;  4GX1 A;  1OCR B;  2ZXW C;  1FXK C;  4B3M O;  1S5H C;  2XAF A;  4DV5 O;  5LGN A;  4MVR A;  4KFM A;  3SPC A;  2F4V O;  4DR6 O;  3D36 C;  1N36 O;  2D2C B;  1M1K W;  2E76 B;  4LF9 O;  3C3T A;  2QA4 V;  2Y69 C;  2YS8 A;  4JI4 O;  3GVM A;  4P30 A;  4WFE A;  4WBN A;  4ZI7 A;  3HKE B;  3OFN G;  3O65 A;  3UO3 A;  4GYC B;  3TCU A;  2UUB O;  4NTW A;  4DK0 A;  3AEI A;  2XT9 A;  5J2T A;  2YSU B;  1SC5 B;  4JI7 B;  5J2U B;  4TOI A;  3H1L H;  3STZ C;  1YTF B;  1XIL A;  4O4H A;  2P4K A;  4ZHQ B;  1QNM A;  1XUQ A;  1QR8 A;  5A9G A;  5FLX N;  2JIZ G;  5KLV H;  3CJH A;  1Y74 A;  4HBN A;  1BT8 A;  2R9I A;  2IBZ H;  3VBB A;  4O4J B;  1R6K A;  1YHQ V;  1BMF G;  4KP4 A;  1YTF D;  3E89 A;  3FB6 C;  4DV2 O;  2A7W A;  1HR0 B;  1AI4 A;  3IJ4 A;  2UXN A;  4X9Q A;  2B1I A;  2UUA B;  2YDE A;  5E1A C;  2QR4 A;  1QBZ A;  1U96 A;  3BPZ A;  5EBL C;  4EEQ A;  2BOB C;  3P3P A;  3S3W A;  5KAF Z;  1EBO A;  3IGA C;  2P6J A;  1F4M A;  5JQG A;  1TUE B;  5IJ9 B;  1KU9 A;  4UV8 A;  1OZ0 A;  1K3E A;  3QVN A;  3OUF A;  3H1I H;  3PN1 A;  2WLH A;  2QDO A;  2BOC C;  4ASU G;  3ZN0 A;  4LF8 B;  2PI4 A;  3WB0 A;  5C93 A;  5JVD B;  1SQP H;  1IVS A;  3F5W C;  2Z5U A;  1JVM A;  1Q6U A;  3ZRX A;  3JCU Z;  5DM6 V;  2K9P A;  1VQ6 V;  2HJD A;  4I9W A;  4DV7 O;  5CN0 A;  1FXK A;  4MTO A;  1TVK B;  3ZHR A;  3D36 A;  2KG7 B;  2N04 A;  4CC6 A;  2C2A A;  5IY5 C;  1VF5 B;  3A2F A;  1NVP B;  5LMU O;  1MZF A;  2B1G A;  4DV1 B;  2ZE8 A;  4OPA A;  4TQD A;  2V7Q G;  4P9O A;  3VQW A;  4OX9 B;  4AIL C;  2EIK C;  1N34 B;  4LF5 O;  4QPK A;  1CP9 A;  4UVA A;  3FB8 C;  3K06 A;  4I9Q A;  4Z2W A;  3SPH A;  1J5E O;  4R7C A;  3ABK C;  4X64 B;  5J9P C;  2X6B A;  1XMO B;  4TV8 A;  2Q73 A;  4U7N A;  1GO3 F;  1FPO A;  1I94 B;  4BW9 A;  1WAZ A;  5H5N A;  3OMI B;  1AIL A;  3K08 A;  1XNR O;  3F7V C;  1NU1 H;  4JTA B;  1AB3 A;  2LFS A;  1CPY A;  3JAW B;  2L35 A;  1KD1 W;  3JD3 A;  2P06 A;  2QGN A;  3RYF B;  4Z1M G;  5LMN O;  4DV6 O;  4LR3 A;  3UM7 A;  3ZHV A;  2ZCE A;  3D8C A;  3JAM N;  1ZSP A;  2PYJ A;  3SDL A;  2M7W A;  5L3E A;  2JRI A;  3RGB A;  4PDV A;  2ZR2 A;  4QNH B;  4LWS A;  1IXM A;  2KQX A;  4TV9 A;  4ZKI A;  1I7F A;  1DTO A;  4GX2 A;  4IGG A;  4EB6 B;  1XDC A;  1Z2G A;  5GTH Z;  3DC5 A;  3I5D A;  4O4L B;  2AZ2 A;  4G28 B;  2VQE B;  1JOY A;  2DW4 A;  4N23 A;  1SQX H;  2LJ2 A;  1PNM A;  4JI5 O;  3FX7 A;  1Q8I A;  5KHI A;  2AHY A;  2ZM6 O;  4DR2 O;  1QLN A;  2VQF B;  3SGI A;  1TAE A;  3B09 A;  4NXN O;  3ML0 A;  4FFB B;  2EIM B;  1V54 B;  3BAB A;  4H37 A;  1JCH A;  3CCU V;  2ITD C;  3E8B A;  4LFC B;  4QJF B;  3T2M A;  4EFB A;  2JGD B;  2YXL A;  1M93 A;  3P30 A;  3OR6 C;  3CC7 V;  1XNQ O;  3A8T A;  5BMV B;  5IYB O;  1RPR A;  1JJO A;  2V4D A;  4CS2 A;  3JSN A;  4YIO A;  1MAB G;  5AG2 A;  1Y67 A;  1SES A;  4FVM A;  4PV1 B;  2WLK A;  4PA7 A;  3EXA A;  2GSM B;  1P4R A;  1Z5W A;  2GBO A;  1H38 A;  4B3R O;  4XDK A;  5CA0 B;  3RT3 C;  5LA6 A;  1FS0 G;  3VQV A;  2IJH A;  2KSD A;  3CRA A;  1M56 C;  2ZKO A;  2IU3 A;  3SYQ A;  4LF4 B;  5EYP A;  1B06 A;  2ZE6 A;  4HAM A;  4DV5 B;  4C7U A;  3RYH A;  3WG7 C;  4DR6 B;  3Q4H A;  4I55 A;  5L3G A;  5GTI Z;  1Q81 W;  4DK1 A;  4LF9 B;  1ZUQ A;  1MOF A;  1PPJ H;  4KUM A;  3OMN B;  4JI4 B;  2V1D A;  1GN4 A;  5B1A C;  4JI7 O;  2E3C A;  3F7Y C;  1P7G A;  3RYI B;  3CB2 A;  2CE4 A;  3H1J H;  1OHH G;  1EFR G;  1K4C C;  3ZHT A;  1N8R W;  1LUV A;  2UUB B;  4CH6 A;  2LW7 A;  3BCC H;  4LFB O;  1M4U A;  2DWD C;  4FLY A;  3AG1 B;  3FKS G;  1I5Y A;  5IJ0 B;  4IHJ A;  4X1K A;  5H6Q A;  5D5Q A;  4OPH A;  1XRE A;  1AI6 A;  1D5A A;  1PL0 A;  1H8H G;  4CH3 A;  1Y6X A;  1VQ7 V;  1S0V A;  4TUY A;  1BHA A;  1SF9 A;  3CSX A;  2FB5 A;  1D5N A;  4QPJ A;  3CE2 A;  3JAR B;  2RJZ A;  3CEI A;  1XL6 A;  2N74 A;  2YIA A;  1SQQ H;  4DV2 B;  4A5U B;  1HDJ A;  3ZMU A;  5EC2 C;  4J9Z B;  3FYE B;  2UUC O;  1COW G;  3JCZ A;  2QWO B;  3CC4 V;  2YEV B;  1NS1 A;  2Q7E A;  2IU0 A;  3B8N A;  1KBH A;  5LXT B;  4E2L A;  2QWN B;  4DR5 O;  2WLI A;  3CS5 A;  1G1X B;  2WWW A;  1XL4 A;  3JYC A;  4MTG A;  3RN4 A;  3CC2 V;  3L70 H;  2F66 C;  1G4Y B;  2F23 A;  1AVM A;  2AW9 A;  1SQV H;  4JI3 O;  4DRX B;  2H94 A;  1MA1 A;  3U0Z A;  4PEL A;  4FJC C;  4B3S O;  3CX5 F;  1Q43 A;  2CDY A;  2P7T C;  1AI5 A;  2Z3Y A;  5KHH A;  4DXW A;  4DV1 O;  4DV7 B;  3ASO B;  5IYZ A;  1NQT A;  5C8Y B;  4OGQ B;  2QTS A;  2NNU A;  1BSM A;  4WF9 V;  2NR5 A;  1AJN A;  4UB6 Z;  1RSO A;  4P2Z A;  2HG5 C;  2ZNI A;  1S76 D;  4JI8 O;  4K3A A;  1V55 B;  3HKB B;  3WB2 A;  5KX5 A;  4LF7 O;  2VWJ A;  4O2B A;  4UFZ A;  4LF5 B;  3UKM A;  2E74 B;  3P32 A;  2CGN A;  4UXN A;  4I50 A;  2EIL C;  5K1X A;  1J5E B;  1S5L Z;  2NN4 A;  3B4S A;  4AI8 A;  3T4D A;  3CRQ A;  3W7T A;  1ORQ C;  2W0F C;  3JAS A;  4KXR A;  2B9Z A;  2DYS B;  2UXC O;  1PV0 A;  4QIW F;  4ZBM A;  3ZMZ A;  1G6U A;  4FMT A;  3DXR B;  3W7X A;  1XNR B;  1V9P A;  2WLM A;  2AZ0 A;  2HP8 A;  1WB8 A;  3ABT A;  1EN4 A;  3TET A;  4WFH A;  3FAV B;  3K5N A;  4K0K O;  4GUN A;  2YC0 A;  2ZIN A;  5LMN B;  2P22 C;  4DV6 B;  5KA5 A;  3MHS C;  3RVZ A;  3KKY A;  1R73 A;  4BIZ A;  4UV9 A;  3RYC B;  1GRJ A;  3GB7 C;  2DOS A;  3DGE A;  2EIJ C;  1VQN V;  4RQF A;  1US6 A;  5CBG A;  1KB9 F;  4GCZ A;  3B40 A;  3CCQ V;  4LP8 A;  4MVQ A;  5EK0 A;  1WPX A;  2BTQ A;  4JTD B;  2RDC A;  1KP2 A;  4AQY O;  4J11 A;  4GLX A;  1FXH A;  1VMG A;  1SA0 B;  3E8F A;  1PM9 A;  1YCI A;  2IM9 A;  4JI5 B;  2M6Y A;  3ETD A;  1E79 G;  3D3I A;  4ZIB A;  2ZM6 B;  4DR2 B;  2YIB D;  1LUW A;  1OCR C;  4NXN B;  3HB3 B;  1QQC A;  3WU2 Z;  3U11 A;  4CH4 A;  4IIJ B;  1XNQ B;  1XMQ O;  3B8M A;  3VOU A;  2DMX A;  3JAL B;  1EZJ A;  4X1I B;  1M9N A;  3ZHQ A;  3K5O A;  1B3Q A;  2UXB O;  2Y0I A;  3UO2 A;  5KMG A;  1F23 A;  3RWR D;  2OCC C;  4RAI A;  1M90 W;  1OCC B;  1SZT A;  4JZ2 A;  4JPR A;  2BSK A;  4JYB A;  3I56 V;  1JFF B;  3LDE A;  4NB5 A;  4PDL A;  4B3R B;  2XOK G;  3ZRW B;  1HWY A;  1XQ8 A;  3X2Q B;  3E83 A;  3FB5 C;  5GON B;  1VQP V;  1RPO A;  1K5Q A;  3AG7 A;  3QTC A;  1K8A W;  4LF6 B;  1FFX A;  3ZN1 A;  2YIB A;  2N05 A;  1VQO V;  1O9G A;  1OJH A;  3K0G A;  4Q20 A;  1FYJ A;  1VP7 A;  4YJ3 A;  3OGC C;  3OTO O;  1YJN V;  1YJW V;  2A0L A;  1L8D A;  2OCC B;  4TT3 G;  1GTO A;  2CH7 A;  1GN2 A;  3HKC B;  5JJJ B;  1VAR A;  2ODM A;  3BRC A;  1IBM O;  4O2A A;  2VWK A;  1ZTE A;  4YHH O;  3JAK B;  2NLJ C;  3CRM A;  3STL C;  5B3S B;  1H8E G;  1N32 O;  1H2K A;  1K97 A;  4X88 A;  1GM8 A;  1GH6 A;  1GN6 A;  5L3D A;  4LFB B;  1A32 A;  4O4I A;  1VQ5 V;  4FLT A;  3E86 A;  3DC6 A;  5B66 Z;  1K92 A;  4R50 A;  3K5L A;  1ARO P;  2GDS A;  3B2E E;  2B5U A;  3HKD A;  4BAY A;  1WP7 A;  3SPJ A;  1JQ0 A;  1NKD A;  2LO1 A;  1K73 W;  3ETG A;  1I0H A;  2IJJ A;  1MNG A;  5JCO C;  2UUC B;  3L9D A;  2P4V A;  4DR3 O;  4H0L B;  2LGW A;  2A06 H;  1LR1 A;  4LNU B;  1ZX3 A;  4H44 B;  3ZJZ A;  4I0X B;  4DR5 B;  1YIJ V;  1Q6H A;  3HKE A;  4JF3 A;  2GUZ B;  2VRZ A;  4LC1 A;  3VQX A;  3ASN B;  4DV3 O;  1GN3 A;  4N21 A;  3MD0 A;  4ZOL B;  5J2U A;  3BEH A;  3SJB C;  3FB7 C;  4JI3 B;  5LHH A;  4ZHQ A;  2GHY A;  3T1H O;  3M99 B;  4B3S B;  1JX9 A;  1RM1 B;  1SKV A;  1DF4 A;  4LCU C;  3K0D A;  3L72 H;  1SZX A;  5ITZ B;  3ZRS A;  3H1K H;  2FYU H;  4J41 A;  3JAT B;  1R3I C;  3LUT B;  1BGY H;  4QE7 A;  2F1M A;  2X6C A;  4O4J A;  4JI2 O;  1PD3 A;  4JI8 B;  3ZBH A;  1QR9 A;  1KQS U;  4LF7 B;  4PA3 A;  5LHG A;  1Q3E A;  2BCC H;  3G80 A;  4W4K A;  1NVP D;  2JDI G;  1O9H A;  3U10 A;  3A0R A;  2XND G;  1WB7 A;  5LGT A;  4PI0 A;  5IJ9 A;  1NBM G;  1Y76 B;  3ABU A;  1GM7 A;  3H9V A;  4FLW A;  2IH3 C;  2UXC B;  4E4E A;  1JPX A;  1GMG A;  1L0N H;  4I7Z B;  2PTM A;  3CYO A;  4YIP A;  4UCU A;  1R6N A;  4X1Y B;  4JTC B;  3C90 A;  2DE0 X;  5JVD A;  5BY1 A;  2LGQ A;  5L3B A;  4K0K B;  2EIM C;  1V54 C;  1MMM A;  2Y0P A;  4EKW A;  2UXD O;  2HVJ C;  1BE3 H;  1AJQ A;  3OMA B;  4H33 A;  4B7K A;  3IAY A;  1TVK A;  1DK1 A;  3EHB B;  5JCO A;  2KG7 A;  1WA8 B;  3BAA A;  3JSL A;  5FNV B;  5HFL A;  4CC5 A;  4JYA O;  4NKG B;  2PI5 A;  3C3S A;  4PD4 F;  3AK3 A;  2W6I G;  4AQY B;  5EBW C;  2EIN B;  3E22 B;  3LNM B;  2DQ0 A;  3L74 H;  3O9O A;  1ZL8 B;  1R3J C;  3D3Q A;  3SYA A;  4CS3 A;  2QWQ B;  3K9A A;  2QM7 A;  4G27 B;  3BY6 A;  4ICG A;  1BZK A;  2Y48 A;  3OUS A;  1SQG A;  5EIB C;  3K5M A;  4U3J B;  4LBE C;  2XAQ A;  1QHT A;  3ZS8 C;  4FM2 A;  1IXB A;  2QE7 G;  1MSW D;  1NR1 A;  4PHZ A;  4UCR A;  1I08 A;  1EZV H;  2YI9 A;  1PP9 H;  4K8X A;  3JAW A;  1URF A;  4B7E A;  1Q82 W;  5LL6 Y;  3J81 N;  5KHK A;  1XMQ B;  4CBC A;  4XDL A;  5EC1 C;  3K58 A;  3RYF A;  3CXC U;  2HKO A;  4QGP A;  2UXB B;  1FD9 A;  1VQ4 V;  3RBZ A;  3TJT A;  5KA6 A;  1Q6I A;  2P67 A;  3BA8 A;  4DV0 B;  4JAA A;  1YIT V;  1XHX A;  2OIG A;  4LF6 O;  4X20 B;  4YJ2 B;  2YIC A;  1X4T A;  3AG1 C;  2PZS A;  2OYQ A;  1TUB B;  4BIO A;  4UVB A;  1YDX A;  5LYJ B;  2ATK C;  4U3F H;  4F6R B;  4EB6 A;  4CZZ A;  1IBL O;  5HFM A;  2ADP A;  2QM8 A;  4O4L A;  2YXH A;  2CUG A;  4FZ1 A;  3K59 A;  2KB1 A;  3APQ A;  2ZE7 A;  3OTO B;  4UCS A;  4KHP O;  4L87 A;  5EIB D;  1U97 A;  3APO A;  3PJS K;  4IT5 A;  4FFB A;  2PF4 E;  5H9C A;  3N2K B;  4FPP A;  1IBM B;  2JGD A;  1GKF A;  4YHH B;  5E79 Z;  5BMV A;  5JH7 B;  4WFB V;  1OV9 A;  1VQL V;  5EZY B;  4J42 A;  2RQ6 A;  3OEH G;  1N32 B;  4MVM A;  3E8H A;  3TXQ A;  2EUL A;  5LBQ A;  1L1F A;  3TXS A;  4LH6 A;  1H2G A;  1K33 A;  5IT9 N;  4FK5 C;  2X7R B;  2WLL B;  5FPR A;  3AG2 B;  4NR1 A;  2A79 B;  2L6L A;  4JI1 O;  4UCV A;  5CA0 A;  1PNK A;  5L3F A;  1NTM H;  3UT5 B;  4J7J A;  1HNZ O;  3LSQ A;  1PKX A;  5JWP A;  4MTX A;  3ASO C;  1DF5 A;  4DO2 A;  2HHH O;  2LFR A;  2JJ2 G;  3SPG A;  3SYO A;  4P9P A;  4DR3 B;  1OCZ B;  1V55 C;  2R9A A;  5B1B B;  4NXM O;  2QKC A;  1AR1 B;  2DWE C;  2R9R B;  3RYI A;  1HNW O;  2P90 A;  4DV3 B;  2RCV A;  3ABM B;  5TIS Z;  3CHX A;  1JJ2 U;  1K4D C;  5IE9 A;  5KUM A;  2DYS C;  4X8A A;  4JAU A;  3MAQ A;  5IJ0 A;  1H2S B;  1K7D A;  3T1H B;  1Q5O A;  4RO2 A;  2JGU A;  2OIE A;  1VIB A;  3K79 A;  3N2G B;  1QVG U;  2QWP B;  3DTU B;  3TGU H;  2CTR A;  2QWR B;  2ZD9 A;  5CA1 B;  5LOV B;  3M8A A;  2PGG A;  4IYI A;  3AG3 B;  3JAR A;  2PYL A;  4D7S A;  4XDJ A;  4HNA B;  3G71 V;  4YY3 O;  4JI2 B;  2Q7H A;  2Q4P A;  1XOU A;  3ZHU A;  5CBF A;  3M7M X;  3A0H Z;  2Q6A A;  3ZIA G;  1S72 V;  2YEV A;  1K5S A;  3CRC A;  5LXT A;  4DUY O;  1FXV A;  3AK2 A;  4LH7 A;  4MS2 A;  3T1C A;  3W7S A;  3G4S V;  4DR7 O;  5K1P A;  2Q68 A;  3HPL C;  1QLE B;  4DRX A;  1UFI A;  4JI0 O;  4X89 A;  2Y4T A;  5CB4 B;  1QU7 A;  2XTA A;  2XUM A;  2ZT9 B;  2GTS A;  2UXD B;  4I4T B;  5C8Y A;  3WFV A;  2Q8V A;  1SRY A;  5KHJ A;  3I55 V;  2DYR B;  4WCE V;  1HW7 A;  3OE7 G;  4B08 A;  1B04 A;  1YJ9 V;  2A9H A;  4MTF A;  3RW0 A;  2LW1 A;  2CTQ A;  3QO7 A;  1M57 B;  3HKB A;  4JYA B;  1OCC C;  5CA1 A;  4WBN B;  4TSF G;  2DJV A;  4RUF A;  4ZI7 B;  3ZED A;  4BW5 A;  1R6T A;  3ETE A;  3ICX A;  2XAH A;  4DR4 O;  3BA9 A;  3F5T A;  4JV5 O;  1QCE A;  2MK3 A;  4RUE A;  3X2Q C;  5J2T B;  4UVC A;  3IC9 A;  3GWK C;  1W59 A;  3ZMV A;  4O4H B;  3DXR A;  1TGO A;  1HNX O;  1FFT B;  1GAX A;  4RQE A;  3H01 A;  4JYC A;  4PA6 A;  3K9S A;  4NYK A;  3FAV A;  3CJH B;  2JEU A;  4DV0 O;  2WPD G;  3OT7 A;  1Y74 B;  1OCO B;  3JD2 A;  3L75 H;  4FIP C;  3AG4 B;  2HLD G;  1TA8 A;  1WJZ A;  2UXX A;  4JYY A;  4ABM A;  4J7K A;  3ABL B;  3RYC A;  5IWA O;  5B5E Z;  5B3S C;  1IX9 A;  1F51 A;  1P84 F;  2QKA A;  2CTW A;  1FKA O;  1I5X A;  4DUZ O;  5CBH A;  4R8C A;  1VF6 C;  1CEZ A;  3NR7 A;  4B3T O;  1FAF A;  5LHI A;  1H2L A;  1KKD A;  5JQG B;  1IBL B;  4PA9 A;  3E2E A;  4NTX A;  1SA0 A;  1YXB A;  4WFF A;  3BVO A;  2E5L O;  4DW0 A;  3JD4 A;  4FLV A;  1BS3 A;  4DW1 A;  4KHP B;  1MSD A;  4GZR B;  2OTJ V;  3IC7 A;  4GKK O;  1KYO F;  4IL6 Z;  4EFE A;  3BFR A;  1N0J A;  2XAJ A;  3AK1 A;  3NXS A;  4IIJ A;  3CME V;  3KZI Z;  2WA4 A;  2ZXW B;  2HJF C;  4JAV A;  1FXK B;  3JAL A;  1IBK O;  3QF7 A;  4X1I A;  2ZDI C;  2ITC C;  2F43 G;  5KUK A;  1YSC A;  1AP5 A;  1NH2 B;  3KG2 A;  2Y69 B;  3ASN C;  4D7T A;  4TWK A;  1BHB A;  1N33 O;  1JFF A;  4PDR A;  1IUR A;  3CCM V;  3H1H H;  3JD0 A;  4JI1 B;  3OM3 B;  3WB1 A;  3ZRW A;  1R3K C;  3RVY A;  3N27 A;  2H3O A;  5GON A;  1RM1 C;  1ZAU A;  4TV8 B;  1HNZ B;  1EN5 A;  1P7B A;  1NH2 D;  4UB8 Z;  2HHH B;  2GTA A;  2WA3 A;  3R65 A;  2Q0A A;  5FL7 G;  5KAI Z;  3DSQ A;  4JI6 O;  1PNL A;  1VQ8 V;  2PUS A;  3KCX A;  2ZR3 A;  4XBF A;  1K34 A;  3HKC A;  3MDS A;  2F93 B;  4X65 O;  4NXM B;  4GX0 A;  3MHH C;  1NTK H;  4J80 A;  5F2V O;  1HNW B;  2BE3 A;  2OWO A;  2X6A A;  4AHC A;  3JAK A;  3OW2 U;  4PA4 A;  5A2Q N;  4MW3 A;  2EBO A;  2ZIO A;  2XAS A;  2P5O A;  3R66 A;  1NI8 A;  2FL4 A;  1UJW B;  4CS4 A;  1YI2 V;  1ROP A;  4PDM A;  4D6T H;  1VF6 A;  3SJC C;  4UUJ C;  1S5J A;  3CMA V;  4LWS B;  4GKJ O;  4PI2 A;  2EJ7 A;  1D2D A;  4MW8 A;  1DGS A;  4TV9 B;  1WLE A;  5CMU A;  3E35 A;  4K8Z A;  4DV4 O;  4FLZ A;  4QE9 A;  1E1Q G;  3UQ8 A;  2WLJ A;  2W6J G;  1F4N A;  4Q6G A;  3FYI B;  1X59 A;  1BL8 A;  1JA8 A;  5LP6 C;  5IYC O;  4K35 A;  1IDS A;  4YY3 B;  2FKX A;  2DN9 A;  2HEP A;  1J95 A;  1VQM V;  1G8M A;  2IW5 A;  1YZB A;  1KKC A;  2YID A;  1NTZ H;  1GK9 A;  2A3Q A;  4LFA O;  1EN6 A;  3K57 A;  3THO A;  2AGA A;  1H2M A;  2EJR A;  2Z0A A;  3G67 A;  4FFK A;  4LNU A;  4DUY B;  1SQB H;  3ZX6 A;  2ZQM A;  4I5S A;  4I0X A;  3CCS V;  2ZDI A;  2YXY A;  2XHB A;  2GUZ A;  2EIN C;  2IJI A;  4X62 O;  5IY5 B;  1Y66 A;  4UCO A;  5LP6 B;  3LNN A;  2EIK B;  5JJE B;  1XI1 A;  4DR7 B;  3T1Y B;  4ZOL A;  4DR1 O;  4U7O A;  4X66 O;  3QO5 A;  4OXS A;  3ABK B;  4JI0 B;  3HR0 A;  5LA6 B;  5BR8 O;  2CK3 G;  3CRR A;  2Q67 A;  5B1N A;  1K9M W;  2CAZ C;  1YEW A;  5ITZ A;  5EYP B;  1WPB A;  1CXZ B;  3JAT A;  4MVU A;  3CWB H;  3LDD A;  1MG1 A;  4WFA V;  2PY5 A;  3A0B Z;  3RYH B;  3QG5 A;  4WFG A;  2ZIM A;  4BR6 A;  3L73 H;  3Q4H B;  4I55 B;  2IH1 C;  3W7U A;  4F4L A;  1RFY A;  2HR3 A;  3IFX A;  2OTL V;  4CH5 A;  1FJG O;  4DR4 B;  1F7Y A;  1XBL A;  2UU9 O;  4JV5 B;  2JS3 A;  2HVK C;  2LP7 A;  4FLU A;  2ADQ B;  1Y76 A;  2QJ1 A;  1DLB A;  4RWU A;  3CP1 A;  1AP6 A;  3SJA C;  3S3X A;  2Q7G A;  4IHJ B;  3RFR A;  4X1K B;  3EVK A;  1HNX B;  1AJP A;  2QSA A;  3T4Z A;  1BCC H;  4GT1 A;  2EZO A;  4X1Y A;  1B6Q A;  1AR4 A;  3LSU A;  3SJQ C;  1T5E A;  5IYD O;  1S3J A;  4TUY B;  5GW7 A;  5LP6 A;  3CCV V;  5BZB A; 
#chains in the Genus database with same CATH homology
 1SZT A;  4JPR A;  3D36 A;  4JYB A;  3I56 V;  3K79 A;  3LDE A;  1QVG U;  2HFE C;  4PDL A;  2C2A A;  5IY5 C;  1NVP B;  2XOK G;  3DTU B;  1R3L C;  2B1G A;  3SPI A;  3ZRW B;  1QVF U;  1HWY A;  2V7Q G;  2ZD9 A;  4P9O A;  2EIK C;  3B77 A;  3X2Q B;  3E83 A;  4QPK A;  3FB5 C;  1CP9 A;  3AG3 B;  4UVA A;  1VQP V;  1RPO A;  1K5Q A;  3FB8 C;  3K06 A;  3OEE G;  4XDJ A;  3G71 V;  3SPH A;  1K8A W;  3E8G A;  3ZN1 A;  4R7C A;  3ABK C;  1VQO V;  5CBF A;  5J9P C;  3K0G A;  2X6B A;  1THZ A;  4MSW C;  4Q20 A;  4JAS A;  2XAG A;  3OGC C;  2Q6A A;  4U7N A;  2QTO A;  1YJN V;  1YJW V;  3ZCC A;  2WLI B;  3AG2 C;  3ZIA G;  1S72 V;  2A0L A;  4G2K A;  1GO3 F;  2YEV A;  4GX5 A;  2OCC B;  4TT3 G;  1GTO A;  1K5S A;  1SER A;  3OMI B;  1FXV A;  1NR7 A;  3K08 A;  2OT5 A;  2X0L A;  3F7V C;  3OR7 C;  4MS2 A;  2Q69 A;  4JTA B;  2LFS A;  1CPY A;  2NLJ C;  1KD1 W;  3JD3 A;  3STL C;  3T1C A;  3CCJ V;  5B3S B;  3K3W A;  3W7S A;  3G4S V;  3OAA G;  1H8E G;  4Z1M G;  1K97 A;  1M56 B;  1GM8 A;  1GM9 A;  4X88 A;  5EBM C;  2Q68 A;  5L3D A;  3UM7 A;  3HPL C;  1QLE B;  1OCZ C;  1VQ5 V;  4X89 A;  5B1B C;  3E86 A;  5DN6 G;  4HZ3 A;  2M7W A;  3WG7 B;  1K92 A;  4R50 A;  5L3E A;  4PDV A;  1ARO P;  2ZR2 A;  4QNH B;  1VQ9 V;  2B5U A;  1IXM A;  3WFV A;  3ABM C;  4ZKI A;  1DTO A;  1SET A;  4GX2 A;  1SRY A;  5B1A B;  4BAY A;  3I55 V;  2DYR B;  4WCE V;  3SPJ A;  3OE7 G;  1JQ0 A;  1Y4M A;  1YJ9 V;  1NKD A;  2A9H A;  4MTF A;  3RW0 A;  5CA3 A;  4G28 B;  1K73 W;  1JOY A;  3QO7 A;  1M57 B;  2DW4 A;  4N23 A;  3ETG A;  1OCC C;  4J9Y B;  1PNM A;  2QKS A;  4TSF G;  2IJJ A;  4RUF A;  2AHY A;  4BW5 A;  1W0K G;  3ETE A;  2XAH A;  1QLN A;  1AI7 A;  1S77 D;  2DQ3 A;  3ML0 A;  1QCE A;  2EIM B;  1V54 B;  2MK3 A;  4H37 A;  1JCH A;  4RUE A;  3TK1 A;  3X2Q C;  2ITD C;  3CCU V;  3E8B A;  3ZJZ A;  3AG3 C;  4QJF B;  3T2M A;  1YIJ V;  1Q7Y W;  2JK5 C;  4JF3 A;  4UVC A;  3P30 A;  3OR6 C;  3CC7 V;  4LC1 A;  3ZMV A;  5IYB O;  1RPR A;  3ASN B;  1KC8 W;  3ZMS A;  4N21 A;  3MD0 A;  1ENV A;  1FFT B;  4RQE A;  3K03 A;  3CCE V;  1LNQ A;  3H01 A;  4JYC A;  1MAB G;  3BEH A;  4PA6 A;  3FB7 C;  1SES A;  5LHH A;  2JEU A;  2WLK A;  2WPD G;  2GHY A;  2JEX A;  3M99 B;  3EFF K;  4PA7 A;  1OCO B;  3JD2 A;  1JX9 A;  1RM1 B;  2GSM B;  1P4R A;  4FIP C;  3AG4 B;  2HLD G;  1DF4 A;  4R6Z A;  4LCU C;  1W2B U;  3K0D A;  1H38 A;  2UXX A;  2QEX V;  4XDK A;  3ZRS A;  4MVO A;  3ABL B;  5B3S C;  1FS0 G;  1F51 A;  1R3I C;  3LUT B;  4QE7 A;  2WLL A;  2IJH A;  1M56 C;  2X6C A;  1I5X A;  3CPW U;  1PD3 A;  2IU3 A;  5CBH A;  3SYQ A;  4R8C A;  1QLE C;  2JJ1 G;  1QR9 A;  1CEZ A;  1KQS U;  4HAM A;  5LHI A;  4PA3 A;  5LHG A;  1KKD A;  3WG7 C;  2EZP A;  3ZMT A;  4PA9 A;  1NVP D;  3E2E A;  2JDI G;  5L3G A;  4WFF A;  1Q81 W;  4MVZ A;  2IJK A;  3A0R A;  1MOF A;  2XND G;  4KUM A;  3OMN B;  1KP3 A;  3JD4 A;  1Q86 W;  2V1D A;  5LGT A;  5B1A C;  3W7W A;  1NBM G;  3F7Y C;  3ABU A;  2DYR C;  1KEC A;  3CCL V;  1GM7 A;  2IH3 C;  2OTJ V;  3IC7 A;  3ZRV A;  1OHH G;  1JPX A;  3SYC A;  1EFR G;  1GMG A;  1K4C C;  1M57 C;  1ZWI C;  1N8R W;  2WSS G;  2XAJ A;  3CYO A;  3NXS A;  5L3C A;  1R6N A;  3CME V;  2DWD C;  4JTC B;  3QO8 A;  2D3O W;  3AG1 B;  3FKS G;  4MVS A;  1I5Y A;  2ZXW B;  2HJF C;  4JAV A;  1FXK B;  4JGS A;  5L3B A;  5H6Q A;  2EIM C;  1V54 C;  3LDC A;  5LGU A;  2AHZ A;  5B1O A;  3CCR V;  1AI6 A;  1PL0 A;  3K04 A;  1H8H G;  2ZDI C;  2ITC C;  4EKW A;  2EIL B;  2F43 G;  5KUK A;  1VQ7 V;  1YSC A;  2HVJ C;  1NH2 B;  1AJQ A;  3KG2 A;  1S0V A;  1BHA A;  3OMA B;  4H33 A;  3SYP A;  2Y69 B;  3ASN C;  3EHB B;  4TWK A;  1BHB A;  4QPJ A;  2K1E A;  1W0J G;  4PDR A;  3CCM V;  3JD0 A;  3OM3 B;  5HFL A;  3ZRW A;  1XL6 A;  1R3K C;  3RVY A;  2FTK A;  2PI5 A;  1OCO C;  1RM1 C;  1VQK V;  3ZMU A;  5EC2 C;  4J9Z B;  2W6I G;  3FYE B;  3AG4 C;  5EBW C;  2EIN B;  1COW G;  3JCZ A;  3CC4 V;  2YEV B;  3LNM B;  2DQ0 A;  1P7B A;  2IU0 A;  3B8N A;  1NH2 D;  1R3J C;  3ABL C;  3SYA A;  3G6E V;  4MT8 A;  3K9A A;  4E2L A;  2QM7 A;  4G27 B;  3BY6 A;  3R65 A;  3LSS A;  4HYO A;  5FL7 G;  2WLI A;  1PNL A;  2WWW A;  1VQ8 V;  2ZR3 A;  2Y48 A;  1XL4 A;  3JYC A;  3OUS A;  4XBF A;  1K34 A;  4MTG A;  3CC2 V;  3JD1 A;  4BIU A;  1NJI W;  4LBE C;  2XAQ A;  4YXW G;  1G4Y B;  2WAM A;  4GX0 A;  3MHH C;  2WLN A;  2QE7 G;  1MSW D;  1NR1 A;  2EIJ B;  2X6A A;  1Q82 W;  3OW2 U;  4PA4 A;  4MW3 A;  2H94 A;  4CBC A;  2EBO A;  2XAS A;  4PEL A;  4FJC C;  4XDL A;  5EC1 C;  2H8P C;  1E1R G;  5IDJ A;  1UJW B;  3CXC U;  2HKO A;  1YI2 V;  2P7T C;  1AI5 A;  1ROP A;  2Z3Y A;  4PDM A;  4DXW A;  3ASO B;  1VQ4 V;  4UUJ C;  5H6R A;  3RBZ A;  3CMA V;  5KA6 A;  1NQT A;  3GWO A;  2P67 A;  4MW8 A;  2NNU A;  4WF9 V;  1WLE A;  3CD6 V;  5CMU A;  1YIT V;  3E35 A;  1AJN A;  4P2Z A;  1E1Q G;  4QE9 A;  2HG5 C;  2WLJ A;  3QNE A;  2W6J G;  1F4N A;  1S76 D;  4GX1 A;  3AG1 C;  1OCR B;  1V55 B;  2ZXW C;  3FYI B;  1FXK C;  1BL8 A;  1S5H C;  4UVB A;  2ATK C;  2XAF A;  5IYC O;  5LGN A;  3UKM A;  4MVR A;  4KFM A;  3SPC A;  4CZZ A;  3P32 A;  5HFM A;  1M1K W;  4UXN A;  2EIL C;  2QM8 A;  2QA4 V;  3T4D A;  3W7T A;  1ORQ C;  2Y69 C;  2W0F C;  2KB1 A;  1J95 A;  1VQM V;  1G8M A;  2IW5 A;  4P30 A;  4WFE A;  1GK9 A;  4L87 A;  3OFN G;  2DYS B;  3PJS K;  2EJR A;  4QIW F;  4ZBM A;  3TCU A;  3ZMZ A;  4FMT A;  5H9C A;  2ZQM A;  4I5S A;  4FPP A;  3W7X A;  3CCS V;  2WLM A;  2ZDI A;  3AEI A;  2EIN C;  1GKF A;  2YSU B;  2IJI A;  5IY5 B;  3ABT A;  3TET A;  1Y66 A;  3STZ C;  1YTF B;  4WFH A;  4WFB V;  2EIK B;  1VQL V;  1QR8 A;  3OEH G;  4MVM A;  3E8H A;  5KA5 A;  4U7O A;  3MHS C;  2JIZ G;  5LBQ A;  3RVZ A;  3QO5 A;  1R73 A;  1L1F A;  4OXS A;  4BIZ A;  3ABK B;  4UV9 A;  1H2G A;  1K33 A;  4FK5 C;  2R9I A;  2X7R B;  3GB7 C;  3VBB A;  2CK3 G;  2Q67 A;  2WLL B;  3AG2 B;  5B1N A;  2A79 B;  3DGE A;  2EIJ C;  1VQN V;  1K9M W;  1YHQ V;  1R6K A;  4RQF A;  1BMF G;  4KP4 A;  5CBG A;  4GCZ A;  1YTF D;  3CCQ V;  4MVU A;  1PNK A;  3E89 A;  3FB6 C;  3LDD A;  1MG1 A;  4LP8 A;  5BZB A;  4MVQ A;  5L3F A;  4WFA V;  5EK0 A;  1WPX A;  1AI4 A;  4JTD B;  2UXN A;  2B1I A;  1KP2 A;  5E1A C;  4WFG A;  1QBZ A;  3LSQ A;  5EBL C;  1PKX A;  1FXH A;  2BOB C;  2IH1 C;  3ASO C;  3E8F A;  1DF5 A;  4MTX A;  4F4L A;  3W7U A;  1EBO A;  4DO2 A;  3IGA C;  2LFR A;  2P6J A;  2JJ2 G;  1F4M A;  2HR3 A;  3IFX A;  3SPG A;  1TUE B;  2OTL V;  3SYO A;  4P9P A;  3ETD A;  1E79 G;  3D3I A;  4UV8 A;  1OZ0 A;  1K3E A;  3OUF A;  1OCZ B;  1OCR C;  1V55 C;  2HVK C;  2LP7 A;  5B1B B;  2WLH A;  3HB3 B;  2BOC C;  1AR1 B;  4ASU G;  2DWE C;  1DLB A;  2R9R B;  3ZN0 A;  3CP1 A;  2PI4 A;  5C93 A;  3B8M A;  2P90 A;  3VOU A;  3ABM B;  1EZJ A;  3F5W C;  1AJP A;  2Z5U A;  1JVM A;  3ZRX A;  1M9N A;  3T4Z A;  1JJ2 U;  1K4D C;  4GT1 A;  5DM6 V;  2EZO A;  1VQ6 V;  1B6Q A;  5KUM A;  2DYS C;  3SJQ C;  1F23 A;  4X8A A;  4I9W A;  5IYD O;  1S3J A;  4JAU A;  2OCC C;  5CN0 A;  4RAI A;  1K7D A;  5GW7 A;  1FXK A;  3CCV V;  1M90 W;  4MTO A;  1OCC B;  4RO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...