2IJJA

Crystal structure analysis of cole1 rom mutant f14y
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
58
structure length
58
Chain Sequence
b'GTKQEKTALNMARYIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 27
structure length 58
sequence length 58
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijjA00
1PD3A 2IJJA 4DO2A 1B6QA 3K79A 1RPOA 2GHYA 2IJHA 1GTOA 1ROPA 2IJIA 1NKDA 1RPRA 1GMGA 1F4NA 2IJKA 1F4MA
chains in the Genus database with same CATH superfamily
3ZX6A 4U3JB 3RWRD 1K3EA 3R65A 2E75B 5BY1A 1H8HG 3E22B 3TXSA 1JOYA 5IYBO 1AI7A 4NYKA 3G71V 3QO8A 5LGNA 2YI9A 4DUZO 2M7WA 3L70H 1KP2A 5KHIA 1FJGO 3CPWU 2JEUA 4GKJO 3DSQA 4AQYO 1D2DA 4JZ2A 4CH5A 2QM7A 3CE2A 1E1RG 4JV5O 3C90A 1S76D 4JYYA 3ABUA 3S3WA 1F51A 2GHYA 1FXKA 1NTZH 4LF9O 1S5HC 1JFFB 4Q20A 1BQZA 3JSNA 1I5YA 2P22C 2CTQA 1SA0B 3KCYA 4JYBA 5ITZB 5EC2C 4AI8A 1SKVA 4DR5B 4PV1B 1IXBA 4ZI7A 4WCEV 4XDLA 4GZRB 1F4NA 3F7YC 4WBNA 1GKFA 2JK5C 1V54B 2ZXWC 5JWPA 2DMXA 4B3SO 4HYOA 1XUQA 2ZKOA 2EIJB 1R6TA 1OCCC 1TAEA 1U96A 3OUFA 5TISZ 5H6QA 4UCRA 2EBOA 2BE3A 2Q4PA 1VF6A 2N74A 3AK2A 1VF5B 4IIJB 4G2KA 4UCTA 4LFBO 5GTHZ 2P6JA 2ZNJA 4MVQA 4X62O 3BRCA 3APQA 4DV5O 2BOBC 3E8GA 3EHBB 2AZ2A 2G38A 4RO2A 1H8EG 3CJHA 3TK1A 2CGNA 2X6AA 4J11A 4RUFA 3E8BA 1X4TA 3E8FA 2JGUA 4P9OA 3CEIA 1LR1A 2XAHA 1UFIA 3K0DA 1IVSA 3FKSG 4TV8A 2OTJV 3OGIB 1P7GA 3BHPA 4FFKA 4PA7A 4UV8A 5A2QN 1N33B 1M90W 3FX7A 2XOKG 3FYEB 2WWWA 3DC6A 2ETNA 4I4TA 5IYDO 2ZR2A 4O4HB 5CBGA 2DYSC 1S72V 3K5OA 3WB2A 1Q6IA 3AG4C 2EZPA 5KX5B 3FB7C 4ICGA 3CXHF 1FXKC 2ZNIA 3AG1B 4TUYA 1B3QA 4GX2A 1H2LA 2WLHA 2OIGA 1EBOA 5CA1B 4GX0A 3W7TA 3ICXA 4DW1A 1OZ0A 4JTCB 1B04A 2AW9A 3I5DA 2DQ3A 3OR6C 3HPLC 3FB6C 1P49A 4YJ3B 4I9QA 4I7ZB 1NR1A 1WP8A 4UVCA 3ZRXA 3AG2C 1K5SA 5DEDA 1XMOO 2HJDA 4U7OA 4OX9B 4DXWA 5IWAB 2DJVA 4HBNA 4JZGA 4IYHA 1KYOF 3B8NA 3T1CA 3JD4A 1EN6A 1JA8A 2LGQA 1Q90D 5EYPA 3JATB 2NLJC 1Q82W 5L3GA 1VF6C 2CTWA 2XAGA 5JCOA 5CB4B 4I55A 2E3CA 4DV4O 2FMLA 1Q6UA 1L0NH 2LO1A 2ITDC 1SC5B 3ZHRA 4J7KA 4PDMA 3K0GA 4PHZA 1MZEA 5KLVH 1L0LH 4A5UB 1HNXO 2EIMB 1JQ0A 4I0XB 1IURA 2UXCB 4H33A 4CH4A 4TV9B 1AB3A 2QWNB 3OM3B 4JAAA 1NS1A 1Y76B 1MZFA 5J9PC 3JALB 2P67A 2RDCA 1OCOC 2WA4A 3T1YO 4FZ0A 3I55V 4JTAB 1OCZC 2HLDG 3ZCCA 4DK0A 3ASNB 4JI4O 3SJCC 5BMVB 5EZYA 3ZN1A 1PNKA 4R8CA 4BW9A 1WA8A 5B1AC 5H6RA 2XTAA 1YSCA 3SYCA 3J81N 3F5TA 1I94B 2Y4TA 3CRMA 3OMNB 3ASOC 2JIZG 2GUZA 3DC5A 4YJ2B 3RYCB 2F1MA 3OEEG 3J80N 1RSOB 2HVJC 1TUBB 2R9AA 5JH7B 3CX5F 3OE7G 4ZHQA 5IJ9B 1QLEB 1OCRB 4L8JA 1AJQA 1H2NA 3OT7A 1R73A 2WAMA 3ABKB 3B4SA 3HKDA 1XL4A 1WP7A 3D3QA 3T4DA 1HWYA 3FAVA 1JVMA 3CRQA 1E1QG 4FLZA 3QVNA 3TJTA 2WSSG 3ETQA 1KU9A 1XQ8A 5LMNB 1FPOA 4O2BB 5CBFA 1Q5OA 5JCOC 3LSSA 1KECA 2PYLA 3ZRWB 1D5AA 2CGOA 1P84F 1R6KA 2ILMA 1SQQH 1N33O 2Y69B 4YY3B 5IYZB 1PM9A 1BL8A 2X6BA 2JGDB 1JMKC 1XMQB 4GLXA 2IH3C 4DV0O 3E35A 3K58A 3CCMV 1NU1H 4B08A 1R3JC 2LP7A 2UUCO 5IYCO 1WN7A 2Q68A 3W7SA 3SYAA 4EB6A 5H9CA 1BHAA 2WLIA 3JARA 5FNVB 3RYIA 4FLTA 4MVMA 4EEQA 1A32A 2GSMB 4TSFG 2EINB 2UXBB 2BOCC 3L9DA 4DR1B 2UU9O 4OGQB 4BWAA 1KBHA 3B77A 5CMUA 5LP6A 2Q67A 2R70A 1V55C 2VWKA 1F23A 4WFGA 3T2MA 4B3TO 3WB0A 2PI4A 3IC7A 2PYJA 1W2BU 1TVKA 2ARHA 3WG7B 4R50A 2LFRA 5GONA 3KG2A 1BHBA 3O65A 5J2TB 1VQLV 1I5XA 2DW4A 1W0JG 4PI2A 1GO3F 1RM1C 1YTFB 1WPBA 4O4LB 3JSLA 3U10A 3LDDA 4GX5A 5KUKA 3OFNG 1S0VA 4JAVA 4LF8B 3HB3B 1XEQA 5AG2A 2HJFC 2ZD9A 2YXHA 4NB5A 3OEHG 2UXNA 4X64B 3RYHB 3VQVA 1COWG 1GN4A 1PNLA 4PDVA 3C3TA 5H2FZ 1GN2A 3K57A 5JQGB 4WFAV 1IZ3A 2Z0AA 3L72H 4J7JA 5B1NA 4GYCB 4JAUA 2ITCC 5LXTB 1PL0A 4X1YB 3HKBB 1AI4A 3H1LH 1GM8A 4FLUA 4FK5C 3L74H 3G6BA 1ORQC 4JF3A 3BEHA 3CP1A 3VQWA 4WFBV 2BTQB 4RQFA 4MVSA 2A7WA 4LNUA 4LFAB 2CDYA 3VBBA 2QDOA 4FFBB 1NH2B 2HHHO 2W0XA 3SPHA 1IXMA 3ABTA 3UQ8A 5DECA 1J95A 2VQFB 1N4CA 1GK9A 4H37A 2F23A 1PP9H 4PA3A 4F4LA 2XUMA 4B7KA 1AROP 1ZSPA 4KUMA 3FB8C 3JAKA 3LNNA 3WFVA 4LF5B 4GT1A 1HNWB 2EILB 4LH6A 5L3FA 1VEWA 3QF7A 1HNZO 1I0HA 4X65O 4LWSA 3CCRV 1VQ9V 1H2SB 4CH6A 4JI2O 1SQVH 5LP6C 1QU7A 5LBQA 2UXDO 1VQNV 2WLKA 2JS3A 1VQ7V 2MK3A 4J9YB 4QGPA 5KMGB 3CC7V 1EZJA 2RMKB 1CP9A 4K0KB 1GRJA 4DR7B 1SQBH 1DTOA 1M56B 1FYJA 2B1GA 5LMNO 4YIOA 1QR9A 2DYRC 4PA6A 3HKCB 2Y0PA 3UT5A 3B40A 4YHHB 4GKKO 2Z5UA 3TCUA 4LF4O 3PN1A 2P4KA 2CTRA 4B3RB 4LC1A 4F6RB 1SRYA 1SZTA 2VRZA 1YJWV 3JAWA 4DRXB 4WFEA 3MDSA 5DM6V 2Y48A 2VQEB 4U3JA 5FLXN 1XDCA 4XBFA 1XNQO 2IM9A 2PTMA 3E2EA 2F43G 4J7ZA 4CS3A 3E22A 1W0KG 5LA6A 4KXRA 3OUSA 2NN4A 1M4UA 2GDSA 1XOUA 4NTYA 2F95B 1U97A 1N36O 2UXBO 4X9QA 4DR1O 3F5WC 5EBMC 4JYAB 4MVOA 1AR1B 1BCCH 3BA9A 4DR6B 1XI1A 4CH3A 3U0ZA 1QHTA 4LF7B 5JJJB 4NR1A 1B06A 1GM9A 1XL6A 1XNRB 3ZMUA 2ZXWB 3W7UA 1VQ8V 3J7AU 3SPJA 1JFFA 4MT8A 3CCJV 1DF5A 3H01A 3JD3A 4JI6B 3GB7C 1NZ6A 1Q81W 1M57B 1TGOA 4TQFA 1SA0A 2F4VB 5LMUO 4UUJC 1H2GA 4D7TA 5EBWC 1N34B 3HR0A 1M93A 4DR4B 5ITZA 3CS5A 3X2QB 3B8MA 3K59A 4DV2B 1S5JA 1Y6XA 4JI1O 5B1BB 1ZLZA 3K08A 2LJ2A 3OAAG 3SPCA 3ZRVA 5B1OA 4P9PA 1I7FA 2D3OW 2CTPA 2KB1A 3BY6A 3ZHQA 1WNSA 4O4IB 1VQ5V 1IDSA 1P4RA 3VOUA 4TOIA 4J80A 4IIJA 1VMGA 3E8HA 1UJWB 2EZOA 2IJIA 3SJBC 2P4VA 2ZIMA 1HR0B 1EFRG 4LFAO 2DWDC 1FAFA 4MTXA 2XT9A 1IBKB 5J2UB 3AG4B 1VQOV 3RYFB 4UV9A 1JCHA 4UFZA 2VQFO 2OCCB 5CA3A 3LSUA 1TUEB 1BS3A 4KL1A 1KD1W 3G4SV 1K7DA 1LUWA 2CK3G 4ABMA 5A9GA 4MTFA 2B5UA 4NTWA 4JI3B 2LFSA 4CBCA 4DV1B 1O9GA 4UCVA 4O4HA 2A0LA 1Q7YW 1WLEA 2YICA 3THOA 4RUEA 2EJ7A 4IT5A 5KX5A 1XREA 1YCIA 1E79G 4YIPA 4WBNB 2Y0IA 3CCQV 3RFRA 1SQGA 1MG1A 4K0KO 5CA1A 3F7VC 5JJNB 3A8TA 2EIKB 5LHIA 2Y4UA 1SQXH 4MS2A 4FLWA 5CA0B 4YJ3A 5K1XA 4FPPA 1D5NA 2FL4A 3DXRB 3C3SA 3A0RA 3M7MX 4X1KB 3S3XA 1N32B 3ETEA 1BMFG 1V54C 3LDEA 5IDJA 2EIJC 5GTIZ 4X88A 4ZIBA 2VQEO 2YC0A 4OPAA 1VIBA 3JATA 2CUGA 3CMAV 4DR2B 4HAMA 3IC9A 1F7YA 1PV0A 2QSAA 5CB4A 2E5LB 3K03A 1OCOB 1Q6HA 2E76B 2FYUH 4F6EA 4XDJA 2RQ6A 2LQTA 1G4YB 1EN4A 1F4MA 4J42A 3D3IA 4I0XA 4O2AB 2KKWA 4E2LA 1Y74B 4J10A 4DV3B 4JYAO 4H0LB 2Q69A 4X1IB 4TV9A 2P06A 4DR6O 3KZIZ 4TQDA 3K9SA 2QGNA 4K3AA 4LF7O 1Y76A 3ZIAG 3JALA 3NR7A 1KKCA 1XNRO 4LFCB 2VWJA 2GTAA 1JJ2U 4U3FH 4JI6O 1G1XB 3M8AA 5BMVA 4BIZA 1DGSA 1N34O 1AP6A 2PF4E 4DV2O 2ADPA 1R1BA 3DGEA 1H38A 4FJCC 1RFYA 1KMIZ 3LDCA 1MMMA 5DN6G 1K8AW 2CH7B 1W59A 3AG1C 4ASUG 4YJ2A 3M99B 2PZSA 4R6ZA 2ZM6B 3P30A 2YI8A 1RSOA 1TUBA 5KA6A 5IJ0B 2KG7B 5IJ9A 2QKSA 3UM7A 4GUNA 4EFEA 2UUBB 2DOSA 3CRRA 4AILC 4P30A 4DR5O 2JS5A 2QKCA 2ZQMA 3TGUH 3BCCH 1ZL8A 1HR0O 4N21A 3JCZA 4JI8B 3BPZA 3AK1A 1IBKO 1FFXB 3N27A 3Q4HB 1K33A 1HP8A 3ABMB 3ZRWA 2LW7A 3ML0A 2RJZA 3WB1A 1N0NA 1GN3A 1RP3B 4JI0B 3W7XA 4JI3O 5IYZA 2JGDA 5IT9N 2EIMC 2DN9A 2OTLV 1G6UA 2Q8VA 1YEWA 1VQMV 2MW2B 1BE3H 2N04A 3K79A 1V55B 1FD9A 1US6A 5EC1C 1K4DC 3T1HB 1LUVA 3CD6V 3SR2C 2K1EA 4IHJB 2NNUA 1SQPH 4I5SA 3OD4A 1Q43A 5FNVA 2GV9A 1Q8IA 1K9MW 2WLJA 2QR4A 4CC5A 5BXZA 4LF6B 4NTXA 3ASNC 1EZVH 1SERA 1S3JA 2WLLA 4ZOLB 3ABLB 3B09A 3OTOB 5LYJB 4Z2WA 3BABA 2ZIOA 3BVOA 4IL6Z 1WJZA 4XDKA 3CMEV 4DV7B 1YJNV 2Q0AA 1GM7A 3EFFK 5J2TA 5FPOA 4NXNB 1LNQA 1H2KA 1QLEC 4O4LA 1OCRC 3CSXA 3H1HH 1IBMB 1IBLB 4DV6B 5IE9A 5KA5A 1CPYA 3E89A 2X0LA 1MABG 3ABKC 4CS2A 4UB8Z 2RNBA 3AEIA 3RYHA 1DF4A 1R3IC 4OX9O 3TETA 5IWAO 4W4LA 5JQGA 2XAQA 3EXAA 4WF9V 5LXTA 2XHBA 4X1YA 1V9PA 4LCUC 2D2CB 3JASB 3CRAA 2QWPB 4EB6B 3JCUZ 2AZ0A 4FVMA 1KB9F 1Z5WA 4QIWF 3RVYA 4AQYB 2Q0OC 4BW5A 4R7CA 4FFBA 4JGSA 2UXCO 3SGIA 4JV5B 2DWEC 3LNMB 5CBHA 1M5IA 3P3NA 2Q6AA 3MD0A 3ETDA 3UCSC 3AG3B 4FLXA 4LBEC 2CAZC 2NR5A 4I50B 4X66B 4DK1A 2EINC 2XAFA 2YXLA 3CWBH 1QBZA 4X20B 3N2KB 1R6NA 1PL4A 2W0FC 1MSDA 3IAYA 4CZZA 3MAQA 4TWKA 4O4JA 5BR8B 1PNMA 1I94O 5KMGA 3WG7C 4G28B 1PKXA 1K97A 2C2AA 3OMIB 1NBMG 3N2GB 3JD1A 5KAFZ 1M9NA 2BCCH 3SYOA 1YJ9V 3H1IH 3JYCA 3A0HZ 3HKCA 3RGBA 3R66A 3K06A 4LFBB 1I08A 2Q7HA 2O57A 4X62B 2F93B 4F6RA 3BAAA 1H2MA 4K8XA 4DV5B 3K5MA 2QE7G 2L6LA 1NJIW 4JI0O 4DRXA 1WB8A 5CN0A 1FKAO 5IY5C 3OW2U 4HNAB 4DO2A 1WPXA 2UXXA 3QG5A 4FM0A 5FL7G 2A79B 2JJ2G 4QPKA 1YZBA 3HKEB 5LOVB 4JYCA 4HZ3A 1KKDA 1FXHA 4D6TH 1MSWD 3SPIA 1GH6A 3CRCA 4YY3O 1ZTEA 4E4EA 4LWSB 1XMQO 1QQCA 2YIDA 1MOFA 4H44B 1THZA 4JASA 3ZMTA 1PD3A 3D8CA 2ZT9B 3OTOO 3JD0A 4PA9A 2OYQA 2GTSA 1K92A 4W4KA 1SF9A 4RAIA 4AHCA 2L35A 2A3QA 2BSKB 2R9RB 2EILC 3ZBHA 1FXVA 2Z3YA 2V1DA 4IYIA 1AILA 1QLNA 5C8YB 3STZC 5KHGA 1IBLO 3CCSV 1HW7A 1XMOB 2VS0A 3G80A 4C7UA 2WLMA 5EK0A 4JI7B 3CCLV 3ZRSA 2Q9LA 5JVDB 1ROPA 5F2VO 1O9HA 4O4IA 1SESA 1OCCB 1N8RW 3SJQC 1M56C 3A0BZ 2X7RB 5B3SC 2YEVB 2F66C 2PI5A 1OV9A 4DV4B 3IJ4A 5LA6B 1XILA 2PY5A 4LF8O 2YIBA 4MTGA 1XHXA 3BFRA 1OJHA 4I9WA 1HNXB 4X64O 1YF2A 3VQYA 1WB7A 3CCUV 4OXSA 2XASA 1P7BA 1YIJV 5J2UA 2LW1A 3RYFA 5HFLA 5E1AC 3RBZA 2H8PC 1ENVA 4QJFB 1YDXA 2EJRA 5KHKA 4PJ0Z 3T1YB 3IGAC 2KSDA 1VP7A 4NXMB 4FLYA 4JI4B 1YTFD 4X66O 5KHJA 3UO3A 1VQKV 2B1IA 2DYSB 2QJ1A 3L75H 1Y66A 4J41A 5LL6Y 4NKGB 3EVKA 5D5QA 3RT3C 1RPRA 3ZEDA 5H5NA 1FXKB 1ZUQA 4BR6A 4DYLA 2ZINA 1K34A 5BR8O 2E74B 4LF5O 3QTCA 1HNWO 2Q73A 3ZMZA 1NTMH 1M57C 1ZWIC 3JD2A 2PGGA 3ZHTA 4BIUA 2RCVA 1L8DA 5CA0A 1AJNA 3CXCU 3X2QC 4ZI7B 3P3PA 2WLNA 3AG2B 3SDLA 5B1BC 4H13B 2QM8A 2XNDG 3DTUB 3DXRA 2FB5A 2Q7GA 4X1KA 1QVFU 4KHPB 4ZBMA 5LGUA 1SQFA 3SJAC 4GCZA 3WU2Z 1NH2D 4DR7O 2HR3A 4JI5B 4UCOA 3ZHUA 4PI0A 4K8ZA 4UVAA 4PD4F 3CC4V 4JTDB 4LH7A 5K1PA 4YHHO 4J9ZB 4B3RO 2A9HA 1X59A 4DR3B 2M6YA 2P90A 3E86A 1AJPA 2HFEC 2QM4A 2KQXA 4DV0B 4O2AA 5L3BA 1Y74A 3CJHB 4X1IA 4N23A 1MNGA 2UUCB 1AR4A 2GBOA 1GTOA 1NVPB 2OCCC 1NTKH 5E79Z 3CCEV 2DQ0A 4TV8B 3E83A 4X89A 2IW5A 2BTOA 1QNMA 1ZAUA 3SYQA 1Y4MA 3QO7A 1OCZB 4WFHA 4B3MB 4I4TB 2QTSA 2UU9B 1B6QA 1YI2V 1L1FA 2ZE6A 3ZMVA 5B1AB 5BZBA 1YHQV 2RN9A 4B3TB 5KAIZ 2AHZA 2W6IG 2DE0X 1CXZB 3ASOB 4TUYB 3H9VA 2CH7A 1S77D 4JI7O 1SS3A 1GMGA 4NVPA 2ZE5A 1WAZA 1CEZA 3P32A 1AP5A 4IGGA 5B5EZ 2HVKC 5IJ0A 2P7TC 2KG7A 2OCHA 2F4VO 2EIKC 3IFXA 4DR4O 3AG7A 4YXWG 3TXQA 3G6EV 1K4CC 3ZN0A 3RYCA 2AXTZ 1XHZA 1QR8A 4FM2A 5EYPB 1VQPV 5JH7A 2JDIG 1FFXA 1AI6A 3BA8A 4OPHA 2WA3A 3Q4HA 3FD9A 4I55B 1RPOA 3NXSA 3MHHC 2JRIA 1SETA 4X8AA 2UUAB 2ZE8A 4DUYB 4NXMO 3L73H 2HHHB 4MTOA 2QWRB 4WFFA 2IBZH 1UPGA 4B7EA 1Y67A 1JPXA 3ZHSA 4O2BA 1URFA 3KKYA 3K5LA 4G27B 2ZDIA 3B2EE 2R72A 4IHJA 3GVMA 2IJKA 4TT3G 5FPRA 2YS8A 1DLBA 1HNZB 3ZMSA 3K9AA 4X65B 2N05A 5EZYB 4FM1A 5L3EA 4DV1O 2P5OA 1SZXA 1WA8B 2YDEA 2YIBD 4FMTA 2H3OA 4JI2B 2QWOB 5LHHA 4ZKIA 2UXDB 3RVZA 1XBLA 1BZKA 4ZOLA 2OWOA 5LYJA 3MHSC 4BAYA 3UO2A 1NI8A 4UXNA 3OMAB 2GUZB 1ZL8B 4KHPO 1JR9A 1EN5A 1AVMA 1RM1B 4ZHQB 4JI5O 1DK1A 1PPJH 2YIAA 5HFMA 1VARA 4GKKB 2R9IA 4LF4B 3OR7C 4DW0A 3CCVV 2A06H 2HEPA 3CYOA 4Z1VA 2YSUB 3HKDB 1NR7A 3D36A 4DR3O 3FFQA 2FTKA 3FAVB 1BSMA 3AK3A 5GW7A 4FZ1A 1JX9A 1N32O 3SYPA 3ZHVA 5B66Z 1XNQB 3LUTB 2JJ1G 2Q5ZA 3G67A 1KC8W 3FB5C 1KQSU 5L3DA 3O9OA 1BT8A 4DR2O 4JPRA 1J5EB 3JASA 2ODMA 3ABMC 2E5LO 2ZR3A 4KP4A 3JAMN 4EFBA 1AR5A 1NKDA 1R3LC 1QCEA 1N36B 4B3MO 4PDRA 1Z2GA 4PELA 1FS0G 2QA4V 5D5PA 4DV3O 2H94A 4FLVA 2WLLB 2IJJA 2JVDA 4LP8A 3HKBA 3K3WA 3FYIB 1EM1A 3L71H 2ZDIC 1VF7A 1N0JA 2QKAA 2WLIB 2V4DA 3JARB 5EIBC 4DUZB 2AGAA 3RYIB 1FJGB 4LFCO 2LGWA 3H1KH 2BTQA 4GKJB 4I50A 4MVZA 2Y69C 1NT2B 1S5LZ 4MW3A 5LMUB 2FKXA 3OGCC 5KHHA 2JEXA 4MW8A 1NVPD 4GX1A 1KUQA 4X20A 1KP3A 3N2KA 2EX3A 4JI1B 1MA1A 5LP6B 3STLC 4QNHB 3RW0A 3ABLC 2ZCEA 1TVKB 1OHHG 4L87A 1G8MA 5GONB 4LF9B 4P2ZA 5KUMA 2HP8A 3ZS8C 2B9ZA 4PA4A 1IX9A 5IY5B 3N2GA 2OIEA 3QO5A 2ZM6O 3KCXA 2YUAA 2DYRB 5EBLC 1K73W 2UUBO 2K9PA 2X6CA 4LR3A 2CE4A 2ADQB 2V7QG 4UVBA 3W7WA 1ZX3A 4RWUA 4QE7A 1K5QA 3D36C 4B3SB 4MVUA 2UUAO 3ZJZA 2Q7EA 1NQTA 4DUYO 3T4ZA 1VQ4V 3I56V 1BGYH 5L3CA 4JI8O 4HNAA 1M1KW 4UB6Z 2IH1C 3K5NA 3K04A 3U11A 3SPGA 2ZE7A 5LHGA 1YITV 1YVWA 4Z1MG 2AHYA 3HKEA 4MVRA 4PDLA 3H1JH 5LOVA 3PJSK 1HDJA 3QNEA 1YXBA 1QVGU 2WPDG 4LNUB 3VQXA 3GWKC 4MSWC 4CC6A 2OT5A 5JJEB 4QE9A 2IU3A 1FFTB 1GAXA 2ATKC 2QWQB 1TA8A 3APOA 4QPJA 5LGTA 4KFMA 3ETGA 3CB2A 1BQ0A 4O4JB 3JAKB 3T1HO 3AG3C 4CS4A 3UKMA 3RN4A 4BIOA 2BSKA 2QEXV 2QTOA 4Q6GA 2HKOA 2IJHA 5B3SB 3LSQA 4LF6O 4EKWA 1Q3EA 2HG5C 5C8YA 3OTFA 3GWOA 3CC2V 4FIPC 1Q86W 4D7SA 1R3KC 4DV7O 4UCUA 1GN6A 2IU0A 4K35A 1AI5A 2PUSA 5JVDA 1VQ6V 4NXNO 2W6JG 4UCSA 3A2FA 2YEVA 3CHXA 2EULA 5C93A 3UT5B 1JJOA 1IBMO 4DV6O 1T5EA 5EIBD 4RQEA 1J5EO 4U7NA 3JAWB 2XAJA 1Z5VA 2YXYA
chains in the Genus database with same CATH topology
4JAUA 3ZRWA 2ITCC 2P90A 1PL0A 3E86A 1AJPA 2HFEC 1AI4A 1GM8A 3ML0A 1K3EA 4FK5C 1ORQC 4JF3A 3R65A 5L3BA 1H8HG 3BEHA 3W7XA 3CP1A 4WFBV 4N23A 1JOYA 2EIMC 5IYBO 2OTLV 4RQFA 1AI7A 3G71V 4MVSA 1GTOA 3QO8A 5LGNA 1VQMV 1NVPB 3VBBA 2OCCC 2M7WA 3K79A 1KP2A 1V55B 2DQ0A 3CCEV 3E83A 4X89A 1NH2B 3CPWU 3SPHA 2IW5A 2JEUA 5EC1C 1K4DC 1IXMA 3ABTA 3SYQA 1J95A 1Y4MA 3QO7A 1OCZB 2QM7A 3CD6V 1GK9A 4H37A 2K1EA 4WFHA 2NNUA 4I5SA 4PA3A 4F4LA 1B6QA 1E1RG 1AROP 1YI2V 4KUMA 1L1FA 3FB8C 3WFVA 1S76D 1K9MW 3ZMVA 5B1AB 2WLJA 3ABUA 1F51A 2GHYA 5BZBA 4GT1A 1YHQV 3ASNC 1FXKA 2EILB 5L3FA 1SERA 2AHZA 1S5HC 2W6IG 1S3JA 4Q20A 3ASOB 2WLLA 3ABLB 1I5YA 1S77D 3CCRV 1VQ9V 4XDKA 1GMGA 3CMEV 4JYBA 1YJNV 5LBQA 1CEZA 1VQNV 2WLKA 3P32A 5EC2C 1GM7A 1VQ7V 2MK3A 2HVKC 3EFFK 2P7TC 4J9YB 4WCEV 4XDLA 1LNQA 2EIKC 1EZJA 3CC7V 3IFXA 1F4NA 1CP9A 3F7YC 1DTOA 1QLEC 4YXWG 1OCRC 1GKFA 2JK5C 1M56B 1V54B 2ZXWC 5KA5A 1CPYA 4HYOA 3G6EV 2B1GA 1K4CC 1QR9A 2DYRC 2EIJB 4PA6A 3E89A 2X0LA 1MABG 1OCCC 3ABKC 3OUFA 3ZN0A 5H6QA 2EBOA 2Z5UA 3TCUA 3AEIA 1QR8A 1DF4A 1R3IC 4LC1A 3TETA 1SRYA 1VQPV 4G2KA 2JDIG 1SZTA 1AI6A 1YJWV 1RPOA 2P6JA 2XAQA 4WFEA 4MVQA 5DM6V 4WF9V 3NXSA 2Y48A 4LCUC 3MHHC 2BOBC 1SETA 4X8AA 4XBFA 3E8GA 3EHBB 3E2EA 2F43G 4RO2A 1H8EG 4QIWF 1W0KG 4MTOA 3TK1A 2X6AA 3OUSA 3RVYA 4RUFA 3E8BA 3E8FA 4P9OA 4WFFA 4BW5A 2XAHA 3K0DA 4R7CA 4JGSA 3FKSG 1JPXA 2OTJV 2DWEC 3LNMB 4PA7A 4UV8A 5CBHA 4G27B 2ZDIA 3F5WC 5EBMC 2Q6AA 2XOKG 3FYEB 2WWWA 4MVOA 1AR1B 1M90W 3MD0A 3ETDA 2IJKA 4TT3G 5IYDO 3AG3B 2ZR2A 1DLBA 5CBGA 3ZMSA 2DYSC 1S72V 3K9AA 1GM9A 1XL6A 3AG4C 2EZPA 4LBEC 3ZMUA 5L3EA 2ZXWB 3FB7C 3W7UA 1VQ8V 2EINC 2XAFA 4FMTA 3SPJA 4MT8A 5LHHA 1DF5A 4ZKIA 3CCJV 3H01A 3JD3A 3RVZA 1FXKC 3GB7C 3AG1B 1Q81W 1QBZA 1R6NA 3MHSC 1M57B 4GX2A 2W0FC 2WLHA 4BAYA 1EBOA 4UXNA 3OMAB 4UUJC 1H2GA 4GX0A 5EBWC 3W7TA 4CZZA 1OZ0A 3X2QB 3B8MA 4JTCB 4TWKA 3OR6C 2DQ3A 5B1BB 1PNMA 3WG7C 1RM1B 3HPLC 3K08A 4G28B 3FB6C 1PKXA 1K97A 3OAAG 3SPCA 3ZRVA 2C2AA 5B1OA 3OMIB 4P9PA 1NBMG 1NR1A 3JD1A 2D3OW 4UVCA 5HFMA 3ZRXA 1M9NA 3AG2C 2R9IA 2KB1A 3BY6A 1K5SA 3OR7C 3SYOA 3CCVV 1YJ9V 3JYCA 4U7OA 3CYOA 2YSUB 4DXWA 1VQ5V 3K06A 1NR7A 3D36A 1P4RA 3B8NA 3VOUA 3T1CA 3JD4A 2FTKA 5GW7A 1JX9A 2NLJC 3E8HA 3SYPA 5L3GA 1Q82W 1UJWB 2EZOA 2XAGA 2QE7G 3LUTB 2JJ1G 1NJIW 1KC8W 2IJIA 3FB5C 5CN0A 1KQSU 5L3DA 5IY5C 3OW2U 1EFRG 4DO2A 1WPXA 2ITDC 4JPRA 2DWDC 2UXXA 3ABMC 4PDMA 3K0GA 5FL7G 2A79B 2ZR3A 4MTXA 4KP4A 2JJ2G 3AG4B 4QPKA 2EIMB 1VQOV 1JQ0A 1NKDA 4UV9A 1R3LC 1QCEA 1JCHA 4H33A 4JYCA 4HZ3A 2OCCB 5CA3A 4PDRA 1TUEB 4PELA 3OM3B 1FS0G 1KKDA 1FXHA 2QA4V 1KD1W 3G4SV 1K7DA 1MSWD 3SPIA 5J9PC 2H94A 2CK3G 2WLLB 1MOFA 2IJJA 2P67A 4MTFA 2B5UA 1OCOC 4LP8A 3K3WA 1THZA 3FYIB 4JASA 3ZMTA 2LFSA 4CBCA 1PD3A 2ZDIC 3I55V 4JTAB 1OCZC 2WLIB 2HLDG 3ZCCA 2A0LA 3JD0A 1Q7YW 1WLEA 3ASNB 4PA9A 4RUEA 1K92A 3ZN1A 4RAIA 1PNKA 4R8CA 4MVZA 2Y69C 4MW3A 5B1AC 1E79G 5H6RA 1YSCA 3SYCA 3OGCC 2R9RB 2EILC 2JEXA 4MW8A 3CCQV 4GX1A 1NVPD 1KP3A 1FXVA 2Z3YA 3STLC 2V1DA 4QNHB 1MG1A 3RW0A 3OMNB 3ASOC 2JIZG 3ABLC 1QLNA 3STZC 3F7VC 3OEEG 1OHHG 4L87A 3CCSV 1G8MA 2EIKB 4P2ZA 5KUMA 5LHIA 4MS2A 2HVJC 3OE7G 4PA4A 1QLEB 2WLMA 1OCRB 5EK0A 4FPPA 5IY5B 3CCLV 3ZRSA 1AJQA 3QO5A 1ROPA 2DYRB 3A0RA 1R73A 1SESA 2WAMA 5EBLC 1K73W 1OCCB 3ABKB 1N8RW 3SJQC 1M56C 2X7RB 1BMFG 1V54C 3ETEA 5B3SC 2YEVB 2X6CA 1XL4A 3LDEA 2PI5A 3T4DA 5IDJA 1HWYA 2EIJC 2V7QG 4UVBA 4X88A 3W7WA 1JVMA 1E1QG 4QE7A 1K5QA 4MTGA 2WSSG 4MVUA 3CMAV 4HAMA 3ZJZA 1NQTA 3T4ZA 3K03A 1VQ4V 3I56V 1OCOB 4I9WA 5CBFA 5L3CA 3LSSA 1KECA 3ZRWB 1M1KW 4XDJA 2IH1C 3K04A 3CCUV 1G4YB 4OXSA 1F4MA 2XASA 1P7BA 3SPGA 5LHGA 1YIJV 3D3IA 1R6KA 1YITV 4Z1MG 2AHYA 5HFLA 4E2LA 2Y69B 5E1AC 4MVRA 4PDLA 2H8PC 2Q69A 3RBZA 1BL8A 2X6BA 1ENVA 3PJSK 3QNEA 4QJFB 1QVGU 2WPDG 2EJRA 2IH3C 3E35A 4MSWC 3CCMV 3IGAC 1R3JC 2LP7A 2OT5A 3ZIAG 4QE9A 2IU3A 1FFTB 5IYCO 1YTFD 2Q68A 2ATKC 3W7SA 1VQKV 4QPJA 5LGTA 4KFMA 1JJ2U 3ETGA 3SYAA 2B1IA 5H9CA 2DYSB 1BHAA 2WLIA 1Y66A 4MVMA 3AG3C 2GSMB 4TSFG 2EINB 4BIZA 2BOCC 3UKMA 1RPRA 1FXKB 2QEXV 2QTOA 3B77A 2HKOA 2IJHA 1K34A 3DGEA 5CMUA 1H38A 5B3SB 4FJCC 3LSQA 3LDCA 2Q67A 5DN6G 1K8AW 1V55C 4EKWA 2HG5C 1F23A 4WFGA 3AG1C 3ZMZA 4ASUG 3T2MA 1M57C 3IC7A 2PI4A 3M99B 1W2BU 1ZWIC 3GWOA 3JD2A 3WG7B 4R50A 4R6ZA 2LFRA 3CC2V 4FIPC 4BIUA 3KG2A 3P30A 1BHBA 5KA6A 1Q86W 1R3KC 1AJNA 2QKSA 3UM7A 3X2QC 3CXCU 1VQLV 1I5XA 2DW4A 2WLNA 3AG2B 5B1BC 1W0JG 1GO3F 1RM1C 2QM8A 2IU0A 2XNDG 1AI5A 3DTUB 4P30A 1YTFB 1QVFU 1VQ6V 3LDDA 4GX5A 4ZBMA 5KUKA 5LGUA 3OFNG 1S0VA 4JAVA 4GCZA 2W6JG 3HB3B 1NH2D 2YEVA 2ZQMA 2HR3A 2HJFC 2ZD9A 5C93A 3OEHG 4N21A 4RQEA 2UXNA 3JCZA 1COWG 4UVAA 1PNLA 4U7NA 4PDVA 3CC4V 4JTDB 4WFAV 1K33A 2XAJA 5B1NA 4J9ZB 3ABMB 2A9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PD3 A;  2IJJ A;  4DO2 A;  1B6Q A;  3K79 A;  1RPO A;  2GHY A;  2IJH A;  1GTO A;  1ROP A;  2IJI A;  1NKD A;  1RPR A;  1GMG A;  1F4N A;  2IJK A;  1F4M A; 
#chains in the Genus database with same CATH topology
 3ZX6 A;  4U3J B;  3RWR D;  1K3E A;  3R65 A;  2E75 B;  5BY1 A;  1H8H G;  3E22 B;  3TXS A;  1JOY A;  5IYB O;  1AI7 A;  4NYK A;  3G71 V;  3QO8 A;  5LGN A;  2YI9 A;  4DUZ O;  2M7W A;  3L70 H;  1KP2 A;  5KHI A;  1FJG O;  3CPW U;  2JEU A;  4GKJ O;  3DSQ A;  4AQY O;  1D2D A;  4JZ2 A;  4CH5 A;  2QM7 A;  3CE2 A;  1E1R G;  4JV5 O;  3C90 A;  1S76 D;  4JYY A;  3ABU A;  3S3W A;  1F51 A;  2GHY A;  1FXK A;  1NTZ H;  4LF9 O;  1S5H C;  1JFF B;  4Q20 A;  1BQZ A;  3JSN A;  1I5Y A;  2P22 C;  2CTQ A;  1SA0 B;  3KCY A;  4JYB A;  5ITZ B;  5EC2 C;  4AI8 A;  1SKV A;  4DR5 B;  4PV1 B;  1IXB A;  4ZI7 A;  4WCE V;  4XDL A;  4GZR B;  1F4N A;  3F7Y C;  4WBN A;  1GKF A;  2JK5 C;  1V54 B;  2ZXW C;  5JWP A;  2DMX A;  4B3S O;  4HYO A;  1XUQ A;  2ZKO A;  2EIJ B;  1R6T A;  1OCC C;  1TAE A;  1U96 A;  3OUF A;  5TIS Z;  5H6Q A;  4UCR A;  2EBO A;  2BE3 A;  2Q4P A;  1VF6 A;  2N74 A;  3AK2 A;  1VF5 B;  4IIJ B;  4G2K A;  4UCT A;  4LFB O;  5GTH Z;  2P6J A;  2ZNJ A;  4MVQ A;  4X62 O;  3BRC A;  3APQ A;  4DV5 O;  2BOB C;  3E8G A;  3EHB B;  2AZ2 A;  2G38 A;  4RO2 A;  1H8E G;  3CJH A;  3TK1 A;  2CGN A;  2X6A A;  4J11 A;  4RUF A;  3E8B A;  1X4T A;  3E8F A;  2JGU A;  4P9O A;  3CEI A;  1LR1 A;  2XAH A;  1UFI A;  3K0D A;  1IVS A;  3FKS G;  4TV8 A;  2OTJ V;  3OGI B;  1P7G A;  3BHP A;  4FFK A;  4PA7 A;  4UV8 A;  5A2Q N;  1N33 B;  1M90 W;  3FX7 A;  2XOK G;  3FYE B;  2WWW A;  3DC6 A;  2ETN A;  4I4T A;  5IYD O;  2ZR2 A;  4O4H B;  5CBG A;  2DYS C;  1S72 V;  3K5O A;  3WB2 A;  1Q6I A;  3AG4 C;  2EZP A;  5KX5 B;  3FB7 C;  4ICG A;  3CXH F;  1FXK C;  2ZNI A;  3AG1 B;  4TUY A;  1B3Q A;  4GX2 A;  1H2L A;  2WLH A;  2OIG A;  1EBO A;  5CA1 B;  4GX0 A;  3W7T A;  3ICX A;  4DW1 A;  1OZ0 A;  4JTC B;  1B04 A;  2AW9 A;  3I5D A;  2DQ3 A;  3OR6 C;  3HPL C;  3FB6 C;  1P49 A;  4YJ3 B;  4I9Q A;  4I7Z B;  1NR1 A;  1WP8 A;  4UVC A;  3ZRX A;  3AG2 C;  1K5S A;  5DED A;  1XMO O;  2HJD A;  4U7O A;  4OX9 B;  4DXW A;  5IWA B;  2DJV A;  4HBN A;  4JZG A;  4IYH A;  1KYO F;  3B8N A;  3T1C A;  3JD4 A;  1EN6 A;  1JA8 A;  2LGQ A;  1Q90 D;  5EYP A;  3JAT B;  2NLJ C;  1Q82 W;  5L3G A;  1VF6 C;  2CTW A;  2XAG A;  5JCO A;  5CB4 B;  4I55 A;  2E3C A;  4DV4 O;  2FML A;  1Q6U A;  1L0N H;  2LO1 A;  2ITD C;  1SC5 B;  3ZHR A;  4J7K A;  4PDM A;  3K0G A;  4PHZ A;  1MZE A;  5KLV H;  1L0L H;  4A5U B;  1HNX O;  2EIM B;  1JQ0 A;  4I0X B;  1IUR A;  2UXC B;  4H33 A;  4CH4 A;  4TV9 B;  1AB3 A;  2QWN B;  3OM3 B;  4JAA A;  1NS1 A;  1Y76 B;  1MZF A;  5J9P C;  3JAL B;  2P67 A;  2RDC A;  1OCO C;  2WA4 A;  3T1Y O;  4FZ0 A;  3I55 V;  4JTA B;  1OCZ C;  2HLD G;  3ZCC A;  4DK0 A;  3ASN B;  4JI4 O;  3SJC C;  5BMV B;  5EZY A;  3ZN1 A;  1PNK A;  4R8C A;  4BW9 A;  1WA8 A;  5B1A C;  5H6R A;  2XTA A;  1YSC A;  3SYC A;  3J81 N;  3F5T A;  1I94 B;  2Y4T A;  3CRM A;  3OMN B;  3ASO C;  2JIZ G;  2GUZ A;  3DC5 A;  4YJ2 B;  3RYC B;  2F1M A;  3OEE G;  3J80 N;  1RSO B;  2HVJ C;  1TUB B;  2R9A A;  5JH7 B;  3CX5 F;  3OE7 G;  4ZHQ A;  5IJ9 B;  1QLE B;  1OCR B;  4L8J A;  1AJQ A;  1H2N A;  3OT7 A;  1R73 A;  2WAM A;  3ABK B;  3B4S A;  3HKD A;  1XL4 A;  1WP7 A;  3D3Q A;  3T4D A;  1HWY A;  3FAV A;  1JVM A;  3CRQ A;  1E1Q G;  4FLZ A;  3QVN A;  3TJT A;  2WSS G;  3ETQ A;  1KU9 A;  1XQ8 A;  5LMN B;  1FPO A;  4O2B B;  5CBF A;  1Q5O A;  5JCO C;  3LSS A;  1KEC A;  2PYL A;  3ZRW B;  1D5A A;  2CGO A;  1P84 F;  1R6K A;  2ILM A;  1SQQ H;  1N33 O;  2Y69 B;  4YY3 B;  5IYZ B;  1PM9 A;  1BL8 A;  2X6B A;  2JGD B;  1JMK C;  1XMQ B;  4GLX A;  2IH3 C;  4DV0 O;  3E35 A;  3K58 A;  3CCM V;  1NU1 H;  4B08 A;  1R3J C;  2LP7 A;  2UUC O;  5IYC O;  1WN7 A;  2Q68 A;  3W7S A;  3SYA A;  4EB6 A;  5H9C A;  1BHA A;  2WLI A;  3JAR A;  5FNV B;  3RYI A;  4FLT A;  4MVM A;  4EEQ A;  1A32 A;  2GSM B;  4TSF G;  2EIN B;  2UXB B;  2BOC C;  3L9D A;  4DR1 B;  2UU9 O;  4OGQ B;  4BWA A;  1KBH A;  3B77 A;  5CMU A;  5LP6 A;  2Q67 A;  2R70 A;  1V55 C;  2VWK A;  1F23 A;  4WFG A;  3T2M A;  4B3T O;  3WB0 A;  2PI4 A;  3IC7 A;  2PYJ A;  1W2B U;  1TVK A;  2ARH A;  3WG7 B;  4R50 A;  2LFR A;  5GON A;  3KG2 A;  1BHB A;  3O65 A;  5J2T B;  1VQL V;  1I5X A;  2DW4 A;  1W0J G;  4PI2 A;  1GO3 F;  1RM1 C;  1YTF B;  1WPB A;  4O4L B;  3JSL A;  3U10 A;  3LDD A;  4GX5 A;  5KUK A;  3OFN G;  1S0V A;  4JAV A;  4LF8 B;  3HB3 B;  1XEQ A;  5AG2 A;  2HJF C;  2ZD9 A;  2YXH A;  4NB5 A;  3OEH G;  2UXN A;  4X64 B;  3RYH B;  3VQV A;  1COW G;  1GN4 A;  1PNL A;  4PDV A;  3C3T A;  5H2F Z;  1GN2 A;  3K57 A;  5JQG B;  4WFA V;  1IZ3 A;  2Z0A A;  3L72 H;  4J7J A;  5B1N A;  4GYC B;  4JAU A;  2ITC C;  5LXT B;  1PL0 A;  4X1Y B;  3HKB B;  1AI4 A;  3H1L H;  1GM8 A;  4FLU A;  4FK5 C;  3L74 H;  3G6B A;  1ORQ C;  4JF3 A;  3BEH A;  3CP1 A;  3VQW A;  4WFB V;  2BTQ B;  4RQF A;  4MVS A;  2A7W A;  4LNU A;  4LFA B;  2CDY A;  3VBB A;  2QDO A;  4FFB B;  1NH2 B;  2HHH O;  2W0X A;  3SPH A;  1IXM A;  3ABT A;  3UQ8 A;  5DEC A;  1J95 A;  2VQF B;  1N4C A;  1GK9 A;  4H37 A;  2F23 A;  1PP9 H;  4PA3 A;  4F4L A;  2XUM A;  4B7K A;  1ARO P;  1ZSP A;  4KUM A;  3FB8 C;  3JAK A;  3LNN A;  3WFV A;  4LF5 B;  4GT1 A;  1HNW B;  2EIL B;  4LH6 A;  5L3F A;  1VEW A;  3QF7 A;  1HNZ O;  1I0H A;  4X65 O;  4LWS A;  3CCR V;  1VQ9 V;  1H2S B;  4CH6 A;  4JI2 O;  1SQV H;  5LP6 C;  1QU7 A;  5LBQ A;  2UXD O;  1VQN V;  2WLK A;  2JS3 A;  1VQ7 V;  2MK3 A;  4J9Y B;  4QGP A;  5KMG B;  3CC7 V;  1EZJ A;  2RMK B;  1CP9 A;  4K0K B;  1GRJ A;  4DR7 B;  1SQB H;  1DTO A;  1M56 B;  1FYJ A;  2B1G A;  5LMN O;  4YIO A;  1QR9 A;  2DYR C;  4PA6 A;  3HKC B;  2Y0P A;  3UT5 A;  3B40 A;  4YHH B;  4GKK O;  2Z5U A;  3TCU A;  4LF4 O;  3PN1 A;  2P4K A;  2CTR A;  4B3R B;  4LC1 A;  4F6R B;  1SRY A;  1SZT A;  2VRZ A;  1YJW V;  3JAW A;  4DRX B;  4WFE A;  3MDS A;  5DM6 V;  2Y48 A;  2VQE B;  4U3J A;  5FLX N;  1XDC A;  4XBF A;  1XNQ O;  2IM9 A;  2PTM A;  3E2E A;  2F43 G;  4J7Z A;  4CS3 A;  3E22 A;  1W0K G;  5LA6 A;  4KXR A;  3OUS A;  2NN4 A;  1M4U A;  2GDS A;  1XOU A;  4NTY A;  2F95 B;  1U97 A;  1N36 O;  2UXB O;  4X9Q A;  4DR1 O;  3F5W C;  5EBM C;  4JYA B;  4MVO A;  1AR1 B;  1BCC H;  3BA9 A;  4DR6 B;  1XI1 A;  4CH3 A;  3U0Z A;  1QHT A;  4LF7 B;  5JJJ B;  4NR1 A;  1B06 A;  1GM9 A;  1XL6 A;  1XNR B;  3ZMU A;  2ZXW B;  3W7U A;  1VQ8 V;  3J7A U;  3SPJ A;  1JFF A;  4MT8 A;  3CCJ V;  1DF5 A;  3H01 A;  3JD3 A;  4JI6 B;  3GB7 C;  1NZ6 A;  1Q81 W;  1M57 B;  1TGO A;  4TQF A;  1SA0 A;  2F4V B;  5LMU O;  4UUJ C;  1H2G A;  4D7T A;  5EBW C;  1N34 B;  3HR0 A;  1M93 A;  4DR4 B;  5ITZ A;  3CS5 A;  3X2Q B;  3B8M A;  3K59 A;  4DV2 B;  1S5J A;  1Y6X A;  4JI1 O;  5B1B B;  1ZLZ A;  3K08 A;  2LJ2 A;  3OAA G;  3SPC A;  3ZRV A;  5B1O A;  4P9P A;  1I7F A;  2D3O W;  2CTP A;  2KB1 A;  3BY6 A;  3ZHQ A;  1WNS A;  4O4I B;  1VQ5 V;  1IDS A;  1P4R A;  3VOU A;  4TOI A;  4J80 A;  4IIJ A;  1VMG A;  3E8H A;  1UJW B;  2EZO A;  2IJI A;  3SJB C;  2P4V A;  2ZIM A;  1HR0 B;  1EFR G;  4LFA O;  2DWD C;  1FAF A;  4MTX A;  2XT9 A;  1IBK B;  5J2U B;  3AG4 B;  1VQO V;  3RYF B;  4UV9 A;  1JCH A;  4UFZ A;  2VQF O;  2OCC B;  5CA3 A;  3LSU A;  1TUE B;  1BS3 A;  4KL1 A;  1KD1 W;  3G4S V;  1K7D A;  1LUW A;  2CK3 G;  4ABM A;  5A9G A;  4MTF A;  2B5U A;  4NTW A;  4JI3 B;  2LFS A;  4CBC A;  4DV1 B;  1O9G A;  4UCV A;  4O4H A;  2A0L A;  1Q7Y W;  1WLE A;  2YIC A;  3THO A;  4RUE A;  2EJ7 A;  4IT5 A;  5KX5 A;  1XRE A;  1YCI A;  1E79 G;  4YIP A;  4WBN B;  2Y0I A;  3CCQ V;  3RFR A;  1SQG A;  1MG1 A;  4K0K O;  5CA1 A;  3F7V C;  5JJN B;  3A8T A;  2EIK B;  5LHI A;  2Y4U A;  1SQX H;  4MS2 A;  4FLW A;  5CA0 B;  4YJ3 A;  5K1X A;  4FPP A;  1D5N A;  2FL4 A;  3DXR B;  3C3S A;  3A0R A;  3M7M X;  4X1K B;  3S3X A;  1N32 B;  3ETE A;  1BMF G;  1V54 C;  3LDE A;  5IDJ A;  2EIJ C;  5GTI Z;  4X88 A;  4ZIB A;  2VQE O;  2YC0 A;  4OPA A;  1VIB A;  3JAT A;  2CUG A;  3CMA V;  4DR2 B;  4HAM A;  3IC9 A;  1F7Y A;  1PV0 A;  2QSA A;  5CB4 A;  2E5L B;  3K03 A;  1OCO B;  1Q6H A;  2E76 B;  2FYU H;  4F6E A;  4XDJ A;  2RQ6 A;  2LQT A;  1G4Y B;  1EN4 A;  1F4M A;  4J42 A;  3D3I A;  4I0X A;  4O2A B;  2KKW A;  4E2L A;  1Y74 B;  4J10 A;  4DV3 B;  4JYA O;  4H0L B;  2Q69 A;  4X1I B;  4TV9 A;  2P06 A;  4DR6 O;  3KZI Z;  4TQD A;  3K9S A;  2QGN A;  4K3A A;  4LF7 O;  1Y76 A;  3ZIA G;  3JAL A;  3NR7 A;  1KKC A;  1XNR O;  4LFC B;  2VWJ A;  2GTA A;  1JJ2 U;  4U3F H;  4JI6 O;  1G1X B;  3M8A A;  5BMV A;  4BIZ A;  1DGS A;  1N34 O;  1AP6 A;  2PF4 E;  4DV2 O;  2ADP A;  1R1B A;  3DGE A;  1H38 A;  4FJC C;  1RFY A;  1KMI Z;  3LDC A;  1MMM A;  5DN6 G;  1K8A W;  2CH7 B;  1W59 A;  3AG1 C;  4ASU G;  4YJ2 A;  3M99 B;  2PZS A;  4R6Z A;  2ZM6 B;  3P30 A;  2YI8 A;  1RSO A;  1TUB A;  5KA6 A;  5IJ0 B;  2KG7 B;  5IJ9 A;  2QKS A;  3UM7 A;  4GUN A;  4EFE A;  2UUB B;  2DOS A;  3CRR A;  4AIL C;  4P30 A;  4DR5 O;  2JS5 A;  2QKC A;  2ZQM A;  3TGU H;  3BCC H;  1ZL8 A;  1HR0 O;  4N21 A;  3JCZ A;  4JI8 B;  3BPZ A;  3AK1 A;  1IBK O;  1FFX B;  3N27 A;  3Q4H B;  1K33 A;  1HP8 A;  3ABM B;  3ZRW A;  2LW7 A;  3ML0 A;  2RJZ A;  3WB1 A;  1N0N A;  1GN3 A;  1RP3 B;  4JI0 B;  3W7X A;  4JI3 O;  5IYZ A;  2JGD A;  5IT9 N;  2EIM C;  2DN9 A;  2OTL V;  1G6U A;  2Q8V A;  1YEW A;  1VQM V;  2MW2 B;  1BE3 H;  2N04 A;  3K79 A;  1V55 B;  1FD9 A;  1US6 A;  5EC1 C;  1K4D C;  3T1H B;  1LUV A;  3CD6 V;  3SR2 C;  2K1E A;  4IHJ B;  2NNU A;  1SQP H;  4I5S A;  3OD4 A;  1Q43 A;  5FNV A;  2GV9 A;  1Q8I A;  1K9M W;  2WLJ A;  2QR4 A;  4CC5 A;  5BXZ A;  4LF6 B;  4NTX A;  3ASN C;  1EZV H;  1SER A;  1S3J A;  2WLL A;  4ZOL B;  3ABL B;  3B09 A;  3OTO B;  5LYJ B;  4Z2W A;  3BAB A;  2ZIO A;  3BVO A;  4IL6 Z;  1WJZ A;  4XDK A;  3CME V;  4DV7 B;  1YJN V;  2Q0A A;  1GM7 A;  3EFF K;  5J2T A;  5FPO A;  4NXN B;  1LNQ A;  1H2K A;  1QLE C;  4O4L A;  1OCR C;  3CSX A;  3H1H H;  1IBM B;  1IBL B;  4DV6 B;  5IE9 A;  5KA5 A;  1CPY A;  3E89 A;  2X0L A;  1MAB G;  3ABK C;  4CS2 A;  4UB8 Z;  2RNB A;  3AEI A;  3RYH A;  1DF4 A;  1R3I C;  4OX9 O;  3TET A;  5IWA O;  4W4L A;  5JQG A;  2XAQ A;  3EXA A;  4WF9 V;  5LXT A;  2XHB A;  4X1Y A;  1V9P A;  4LCU C;  2D2C B;  3JAS B;  3CRA A;  2QWP B;  4EB6 B;  3JCU Z;  2AZ0 A;  4FVM A;  1KB9 F;  1Z5W A;  4QIW F;  3RVY A;  4AQY B;  2Q0O C;  4BW5 A;  4R7C A;  4FFB A;  4JGS A;  2UXC O;  3SGI A;  4JV5 B;  2DWE C;  3LNM B;  5CBH A;  1M5I A;  3P3N A;  2Q6A A;  3MD0 A;  3ETD A;  3UCS C;  3AG3 B;  4FLX A;  4LBE C;  2CAZ C;  2NR5 A;  4I50 B;  4X66 B;  4DK1 A;  2EIN C;  2XAF A;  2YXL A;  3CWB H;  1QBZ A;  4X20 B;  3N2K B;  1R6N A;  1PL4 A;  2W0F C;  1MSD A;  3IAY A;  4CZZ A;  3MAQ A;  4TWK A;  4O4J A;  5BR8 B;  1PNM A;  1I94 O;  5KMG A;  3WG7 C;  4G28 B;  1PKX A;  1K97 A;  2C2A A;  3OMI B;  1NBM G;  3N2G B;  3JD1 A;  5KAF Z;  1M9N A;  2BCC H;  3SYO A;  1YJ9 V;  3H1I H;  3JYC A;  3A0H Z;  3HKC A;  3RGB A;  3R66 A;  3K06 A;  4LFB B;  1I08 A;  2Q7H A;  2O57 A;  4X62 B;  2F93 B;  4F6R A;  3BAA A;  1H2M A;  4K8X A;  4DV5 B;  3K5M A;  2QE7 G;  2L6L A;  1NJI W;  4JI0 O;  4DRX A;  1WB8 A;  5CN0 A;  1FKA O;  5IY5 C;  3OW2 U;  4HNA B;  4DO2 A;  1WPX A;  2UXX A;  3QG5 A;  4FM0 A;  5FL7 G;  2A79 B;  2JJ2 G;  4QPK A;  1YZB A;  3HKE B;  5LOV B;  4JYC A;  4HZ3 A;  1KKD A;  1FXH A;  4D6T H;  1MSW D;  3SPI A;  1GH6 A;  3CRC A;  4YY3 O;  1ZTE A;  4E4E A;  4LWS B;  1XMQ O;  1QQC A;  2YID A;  1MOF A;  4H44 B;  1THZ A;  4JAS A;  3ZMT A;  1PD3 A;  3D8C A;  2ZT9 B;  3OTO O;  3JD0 A;  4PA9 A;  2OYQ A;  2GTS A;  1K92 A;  4W4K A;  1SF9 A;  4RAI A;  4AHC A;  2L35 A;  2A3Q A;  2BSK B;  2R9R B;  2EIL C;  3ZBH A;  1FXV A;  2Z3Y A;  2V1D A;  4IYI A;  1AIL A;  1QLN A;  5C8Y B;  3STZ C;  5KHG A;  1IBL O;  3CCS V;  1HW7 A;  1XMO B;  2VS0 A;  3G80 A;  4C7U A;  2WLM A;  5EK0 A;  4JI7 B;  3CCL V;  3ZRS A;  2Q9L A;  5JVD B;  1ROP A;  5F2V O;  1O9H A;  4O4I A;  1SES A;  1OCC B;  1N8R W;  3SJQ C;  1M56 C;  3A0B Z;  2X7R B;  5B3S C;  2YEV B;  2F66 C;  2PI5 A;  1OV9 A;  4DV4 B;  3IJ4 A;  5LA6 B;  1XIL A;  2PY5 A;  4LF8 O;  2YIB A;  4MTG A;  1XHX A;  3BFR A;  1OJH A;  4I9W A;  1HNX B;  4X64 O;  1YF2 A;  3VQY A;  1WB7 A;  3CCU V;  4OXS A;  2XAS A;  1P7B A;  1YIJ V;  5J2U A;  2LW1 A;  3RYF A;  5HFL A;  5E1A C;  3RBZ A;  2H8P C;  1ENV A;  4QJF B;  1YDX A;  2EJR A;  5KHK A;  4PJ0 Z;  3T1Y B;  3IGA C;  2KSD A;  1VP7 A;  4NXM B;  4FLY A;  4JI4 B;  1YTF D;  4X66 O;  5KHJ A;  3UO3 A;  1VQK V;  2B1I A;  2DYS B;  2QJ1 A;  3L75 H;  1Y66 A;  4J41 A;  5LL6 Y;  4NKG B;  3EVK A;  5D5Q A;  3RT3 C;  1RPR A;  3ZED A;  5H5N A;  1FXK B;  1ZUQ A;  4BR6 A;  4DYL A;  2ZIN A;  1K34 A;  5BR8 O;  2E74 B;  4LF5 O;  3QTC A;  1HNW O;  2Q73 A;  3ZMZ A;  1NTM H;  1M57 C;  1ZWI C;  3JD2 A;  2PGG A;  3ZHT A;  4BIU A;  2RCV A;  1L8D A;  5CA0 A;  1AJN A;  3CXC U;  3X2Q C;  4ZI7 B;  3P3P A;  2WLN A;  3AG2 B;  3SDL A;  5B1B C;  4H13 B;  2QM8 A;  2XND G;  3DTU B;  3DXR A;  2FB5 A;  2Q7G A;  4X1K A;  1QVF U;  4KHP B;  4ZBM A;  5LGU A;  1SQF A;  3SJA C;  4GCZ A;  3WU2 Z;  1NH2 D;  4DR7 O;  2HR3 A;  4JI5 B;  4UCO A;  3ZHU A;  4PI0 A;  4K8Z A;  4UVA A;  4PD4 F;  3CC4 V;  4JTD B;  4LH7 A;  5K1P A;  4YHH O;  4J9Z B;  4B3R O;  2A9H A;  1X59 A;  4DR3 B;  2M6Y A;  2P90 A;  3E86 A;  1AJP A;  2HFE C;  2QM4 A;  2KQX A;  4DV0 B;  4O2A A;  5L3B A;  1Y74 A;  3CJH B;  4X1I A;  4N23 A;  1MNG A;  2UUC B;  1AR4 A;  2GBO A;  1GTO A;  1NVP B;  2OCC C;  1NTK H;  5E79 Z;  3CCE V;  2DQ0 A;  4TV8 B;  3E83 A;  4X89 A;  2IW5 A;  2BTO A;  1QNM A;  1ZAU A;  3SYQ A;  1Y4M A;  3QO7 A;  1OCZ B;  4WFH A;  4B3M B;  4I4T B;  2QTS A;  2UU9 B;  1B6Q A;  1YI2 V;  1L1F A;  2ZE6 A;  3ZMV A;  5B1A B;  5BZB A;  1YHQ V;  2RN9 A;  4B3T B;  5KAI Z;  2AHZ A;  2W6I G;  2DE0 X;  1CXZ B;  3ASO B;  4TUY B;  3H9V A;  2CH7 A;  1S77 D;  4JI7 O;  1SS3 A;  1GMG A;  4NVP A;  2ZE5 A;  1WAZ A;  1CEZ A;  3P32 A;  1AP5 A;  4IGG A;  5B5E Z;  2HVK C;  5IJ0 A;  2P7T C;  2KG7 A;  2OCH A;  2F4V O;  2EIK C;  3IFX A;  4DR4 O;  3AG7 A;  4YXW G;  3TXQ A;  3G6E V;  1K4C C;  3ZN0 A;  3RYC A;  2AXT Z;  1XHZ A;  1QR8 A;  4FM2 A;  5EYP B;  1VQP V;  5JH7 A;  2JDI G;  1FFX A;  1AI6 A;  3BA8 A;  4OPH A;  2WA3 A;  3Q4H A;  3FD9 A;  4I55 B;  1RPO A;  3NXS A;  3MHH C;  2JRI A;  1SET A;  4X8A A;  2UUA B;  2ZE8 A;  4DUY B;  4NXM O;  3L73 H;  2HHH B;  4MTO A;  2QWR B;  4WFF A;  2IBZ H;  1UPG A;  4B7E A;  1Y67 A;  1JPX A;  3ZHS A;  4O2B A;  1URF A;  3KKY A;  3K5L A;  4G27 B;  2ZDI A;  3B2E E;  2R72 A;  4IHJ A;  3GVM A;  2IJK A;  4TT3 G;  5FPR A;  2YS8 A;  1DLB A;  1HNZ B;  3ZMS A;  3K9A A;  4X65 B;  2N05 A;  5EZY B;  4FM1 A;  5L3E A;  4DV1 O;  2P5O A;  1SZX A;  1WA8 B;  2YDE A;  2YIB D;  4FMT A;  2H3O A;  4JI2 B;  2QWO B;  5LHH A;  4ZKI A;  2UXD B;  3RVZ A;  1XBL A;  1BZK A;  4ZOL A;  2OWO A;  5LYJ A;  3MHS C;  4BAY A;  3UO2 A;  1NI8 A;  4UXN A;  3OMA B;  2GUZ B;  1ZL8 B;  4KHP O;  1JR9 A;  1EN5 A;  1AVM A;  1RM1 B;  4ZHQ B;  4JI5 O;  1DK1 A;  1PPJ H;  2YIA A;  5HFM A;  1VAR A;  4GKK B;  2R9I A;  4LF4 B;  3OR7 C;  4DW0 A;  3CCV V;  2A06 H;  2HEP A;  3CYO A;  4Z1V A;  2YSU B;  3HKD B;  1NR7 A;  3D36 A;  4DR3 O;  3FFQ A;  2FTK A;  3FAV B;  1BSM A;  3AK3 A;  5GW7 A;  4FZ1 A;  1JX9 A;  1N32 O;  3SYP A;  3ZHV A;  5B66 Z;  1XNQ B;  3LUT B;  2JJ1 G;  2Q5Z A;  3G67 A;  1KC8 W;  3FB5 C;  1KQS U;  5L3D A;  3O9O A;  1BT8 A;  4DR2 O;  4JPR A;  1J5E B;  3JAS A;  2ODM A;  3ABM C;  2E5L O;  2ZR3 A;  4KP4 A;  3JAM N;  4EFB A;  1AR5 A;  1NKD A;  1R3L C;  1QCE A;  1N36 B;  4B3M O;  4PDR A;  1Z2G A;  4PEL A;  1FS0 G;  2QA4 V;  5D5P A;  4DV3 O;  2H94 A;  4FLV A;  2WLL B;  2IJJ A;  2JVD A;  4LP8 A;  3HKB A;  3K3W A;  3FYI B;  1EM1 A;  3L71 H;  2ZDI C;  1VF7 A;  1N0J A;  2QKA A;  2WLI B;  2V4D A;  3JAR B;  5EIB C;  4DUZ B;  2AGA A;  3RYI B;  1FJG B;  4LFC O;  2LGW A;  3H1K H;  2BTQ A;  4GKJ B;  4I50 A;  4MVZ A;  2Y69 C;  1NT2 B;  1S5L Z;  4MW3 A;  5LMU B;  2FKX A;  3OGC C;  5KHH A;  2JEX A;  4MW8 A;  1NVP D;  4GX1 A;  1KUQ A;  4X20 A;  1KP3 A;  3N2K A;  2EX3 A;  4JI1 B;  1MA1 A;  5LP6 B;  3STL C;  4QNH B;  3RW0 A;  3ABL C;  2ZCE A;  1TVK B;  1OHH G;  4L87 A;  1G8M A;  5GON B;  4LF9 B;  4P2Z A;  5KUM A;  2HP8 A;  3ZS8 C;  2B9Z A;  4PA4 A;  1IX9 A;  5IY5 B;  3N2G A;  2OIE A;  3QO5 A;  2ZM6 O;  3KCX A;  2YUA A;  2DYR B;  5EBL C;  1K73 W;  2UUB O;  2K9P A;  2X6C A;  4LR3 A;  2CE4 A;  2ADQ B;  2V7Q G;  4UVB A;  3W7W A;  1ZX3 A;  4RWU A;  4QE7 A;  1K5Q A;  3D36 C;  4B3S B;  4MVU A;  2UUA O;  3ZJZ A;  2Q7E A;  1NQT A;  4DUY O;  3T4Z A;  1VQ4 V;  3I56 V;  1BGY H;  5L3C A;  4JI8 O;  4HNA A;  1M1K W;  4UB6 Z;  2IH1 C;  3K5N A;  3K04 A;  3U11 A;  3SPG A;  2ZE7 A;  5LHG A;  1YIT V;  1YVW A;  4Z1M G;  2AHY A;  3HKE A;  4MVR A;  4PDL A;  3H1J H;  5LOV A;  3PJS K;  1HDJ A;  3QNE A;  1YXB A;  1QVG U;  2WPD G;  4LNU B;  3VQX A;  3GWK C;  4MSW C;  4CC6 A;  2OT5 A;  5JJE B;  4QE9 A;  2IU3 A;  1FFT B;  1GAX A;  2ATK C;  2QWQ B;  1TA8 A;  3APO A;  4QPJ A;  5LGT A;  4KFM A;  3ETG A;  3CB2 A;  1BQ0 A;  4O4J B;  3JAK B;  3T1H O;  3AG3 C;  4CS4 A;  3UKM A;  3RN4 A;  4BIO A;  2BSK A;  2QEX V;  2QTO A;  4Q6G A;  2HKO A;  2IJH A;  5B3S B;  3LSQ A;  4LF6 O;  4EKW A;  1Q3E A;  2HG5 C;  5C8Y A;  3OTF A;  3GWO A;  3CC2 V;  4FIP C;  1Q86 W;  4D7S A;  1R3K C;  4DV7 O;  4UCU A;  1GN6 A;  2IU0 A;  4K35 A;  1AI5 A;  2PUS A;  5JVD A;  1VQ6 V;  4NXN O;  2W6J G;  4UCS A;  3A2F A;  2YEV A;  3CHX A;  2EUL A;  5C93 A;  3UT5 B;  1JJO A;  1IBM O;  4DV6 O;  1T5E A;  5EIB D;  4RQE A;  1J5E O;  4U7N A;  3JAW B;  2XAJ A;  1Z5V A;  2YXY A; 
#chains in the Genus database with same CATH homology
 4JAU A;  3ZRW A;  2ITC C;  2P90 A;  1PL0 A;  3E86 A;  1AJP A;  2HFE C;  1AI4 A;  1GM8 A;  3ML0 A;  1K3E A;  4FK5 C;  1ORQ C;  4JF3 A;  3R65 A;  5L3B A;  1H8H G;  3BEH A;  3W7X A;  3CP1 A;  4WFB V;  4N23 A;  1JOY A;  2EIM C;  5IYB O;  2OTL V;  4RQF A;  1AI7 A;  3G71 V;  4MVS A;  1GTO A;  3QO8 A;  5LGN A;  1VQM V;  1NVP B;  3VBB A;  2OCC C;  2M7W A;  3K79 A;  1KP2 A;  1V55 B;  2DQ0 A;  3CCE V;  3E83 A;  4X89 A;  1NH2 B;  3CPW U;  3SPH A;  2IW5 A;  2JEU A;  5EC1 C;  1K4D C;  1IXM A;  3ABT A;  3SYQ A;  1J95 A;  1Y4M A;  3QO7 A;  1OCZ B;  2QM7 A;  3CD6 V;  1GK9 A;  4H37 A;  2K1E A;  4WFH A;  2NNU A;  4I5S A;  4PA3 A;  4F4L A;  1B6Q A;  1E1R G;  1ARO P;  1YI2 V;  4KUM A;  1L1F A;  3FB8 C;  3WFV A;  1S76 D;  1K9M W;  3ZMV A;  5B1A B;  2WLJ A;  3ABU A;  1F51 A;  2GHY A;  5BZB A;  4GT1 A;  1YHQ V;  3ASN C;  1FXK A;  2EIL B;  5L3F A;  1SER A;  2AHZ A;  1S5H C;  2W6I G;  1S3J A;  4Q20 A;  3ASO B;  2WLL A;  3ABL B;  1I5Y A;  1S77 D;  3CCR V;  1VQ9 V;  4XDK A;  1GMG A;  3CME V;  4JYB A;  1YJN V;  5LBQ A;  1CEZ A;  1VQN V;  2WLK A;  3P32 A;  5EC2 C;  1GM7 A;  1VQ7 V;  2MK3 A;  2HVK C;  3EFF K;  2P7T C;  4J9Y B;  4WCE V;  4XDL A;  1LNQ A;  2EIK C;  1EZJ A;  3CC7 V;  3IFX A;  1F4N A;  1CP9 A;  3F7Y C;  1DTO A;  1QLE C;  4YXW G;  1OCR C;  1GKF A;  2JK5 C;  1M56 B;  1V54 B;  2ZXW C;  5KA5 A;  1CPY A;  4HYO A;  3G6E V;  2B1G A;  1K4C C;  1QR9 A;  2DYR C;  2EIJ B;  4PA6 A;  3E89 A;  2X0L A;  1MAB G;  1OCC C;  3ABK C;  3OUF A;  3ZN0 A;  5H6Q A;  2EBO A;  2Z5U A;  3TCU A;  3AEI A;  1QR8 A;  1DF4 A;  1R3I C;  4LC1 A;  3TET A;  1SRY A;  1VQP V;  4G2K A;  2JDI G;  1SZT A;  1AI6 A;  1YJW V;  1RPO A;  2P6J A;  2XAQ A;  4WFE A;  4MVQ A;  5DM6 V;  4WF9 V;  3NXS A;  2Y48 A;  4LCU C;  3MHH C;  2BOB C;  1SET A;  4X8A A;  4XBF A;  3E8G A;  3EHB B;  3E2E A;  2F43 G;  4RO2 A;  1H8E G;  4QIW F;  1W0K G;  4MTO A;  3TK1 A;  2X6A A;  3OUS A;  3RVY A;  4RUF A;  3E8B A;  3E8F A;  4P9O A;  4WFF A;  4BW5 A;  2XAH A;  3K0D A;  4R7C A;  4JGS A;  3FKS G;  1JPX A;  2OTJ V;  2DWE C;  3LNM B;  4PA7 A;  4UV8 A;  5CBH A;  4G27 B;  2ZDI A;  3F5W C;  5EBM C;  2Q6A A;  2XOK G;  3FYE B;  2WWW A;  4MVO A;  1AR1 B;  1M90 W;  3MD0 A;  3ETD A;  2IJK A;  4TT3 G;  5IYD O;  3AG3 B;  2ZR2 A;  1DLB A;  5CBG A;  3ZMS A;  2DYS C;  1S72 V;  3K9A A;  1GM9 A;  1XL6 A;  3AG4 C;  2EZP A;  4LBE C;  3ZMU A;  5L3E A;  2ZXW B;  3FB7 C;  3W7U A;  1VQ8 V;  2EIN C;  2XAF A;  4FMT A;  3SPJ A;  4MT8 A;  5LHH A;  1DF5 A;  4ZKI A;  3CCJ V;  3H01 A;  3JD3 A;  3RVZ A;  1FXK C;  3GB7 C;  3AG1 B;  1Q81 W;  1QBZ A;  1R6N A;  3MHS C;  1M57 B;  4GX2 A;  2W0F C;  2WLH A;  4BAY A;  1EBO A;  4UXN A;  3OMA B;  4UUJ C;  1H2G A;  4GX0 A;  5EBW C;  3W7T A;  4CZZ A;  1OZ0 A;  3X2Q B;  3B8M A;  4JTC B;  4TWK A;  3OR6 C;  2DQ3 A;  5B1B B;  1PNM A;  3WG7 C;  1RM1 B;  3HPL C;  3K08 A;  4G28 B;  3FB6 C;  1PKX A;  1K97 A;  3OAA G;  3SPC A;  3ZRV A;  2C2A A;  5B1O A;  3OMI B;  4P9P A;  1NBM G;  1NR1 A;  3JD1 A;  2D3O W;  4UVC A;  5HFM A;  3ZRX A;  1M9N A;  3AG2 C;  2R9I A;  2KB1 A;  3BY6 A;  1K5S A;  3OR7 C;  3SYO A;  3CCV V;  1YJ9 V;  3JYC A;  4U7O A;  3CYO A;  2YSU B;  4DXW A;  1VQ5 V;  3K06 A;  1NR7 A;  3D36 A;  1P4R A;  3B8N A;  3VOU A;  3T1C A;  3JD4 A;  2FTK A;  5GW7 A;  1JX9 A;  2NLJ C;  3E8H A;  3SYP A;  5L3G A;  1Q82 W;  1UJW B;  2EZO A;  2XAG A;  2QE7 G;  3LUT B;  2JJ1 G;  1NJI W;  1KC8 W;  2IJI A;  3FB5 C;  5CN0 A;  1KQS U;  5L3D A;  5IY5 C;  3OW2 U;  1EFR G;  4DO2 A;  1WPX A;  2ITD C;  4JPR A;  2DWD C;  2UXX A;  3ABM C;  4PDM A;  3K0G A;  5FL7 G;  2A79 B;  2ZR3 A;  4MTX A;  4KP4 A;  2JJ2 G;  3AG4 B;  4QPK A;  2EIM B;  1VQO V;  1JQ0 A;  1NKD A;  4UV9 A;  1R3L C;  1QCE A;  1JCH A;  4H33 A;  4JYC A;  4HZ3 A;  2OCC B;  5CA3 A;  4PDR A;  1TUE B;  4PEL A;  3OM3 B;  1FS0 G;  1KKD A;  1FXH A;  2QA4 V;  1KD1 W;  3G4S V;  1K7D A;  1MSW D;  3SPI A;  5J9P C;  2H94 A;  2CK3 G;  2WLL B;  1MOF A;  2IJJ A;  2P67 A;  4MTF A;  2B5U A;  1OCO C;  4LP8 A;  3K3W A;  1THZ A;  3FYI B;  4JAS A;  3ZMT A;  2LFS A;  4CBC A;  1PD3 A;  2ZDI C;  3I55 V;  4JTA B;  1OCZ C;  2WLI B;  2HLD G;  3ZCC A;  2A0L A;  3JD0 A;  1Q7Y W;  1WLE A;  3ASN B;  4PA9 A;  4RUE A;  1K92 A;  3ZN1 A;  4RAI A;  1PNK A;  4R8C A;  4MVZ A;  2Y69 C;  4MW3 A;  5B1A C;  1E79 G;  5H6R A;  1YSC A;  3SYC A;  3OGC C;  2R9R B;  2EIL C;  2JEX A;  4MW8 A;  3CCQ V;  4GX1 A;  1NVP D;  1KP3 A;  1FXV A;  2Z3Y A;  3STL C;  2V1D A;  4QNH B;  1MG1 A;  3RW0 A;  3OMN B;  3ASO C;  2JIZ G;  3ABL C;  1QLN A;  3STZ C;  3F7V C;  3OEE G;  1OHH G;  4L87 A;  3CCS V;  1G8M A;  2EIK B;  4P2Z A;  5KUM A;  5LHI A;  4MS2 A;  2HVJ C;  3OE7 G;  4PA4 A;  1QLE B;  2WLM A;  1OCR B;  5EK0 A;  4FPP A;  5IY5 B;  3CCL V;  3ZRS A;  1AJQ A;  3QO5 A;  1ROP A;  2DYR B;  3A0R A;  1R73 A;  1SES A;  2WAM A;  5EBL C;  1K73 W;  1OCC B;  3ABK B;  1N8R W;  3SJQ C;  1M56 C;  2X7R B;  1BMF G;  1V54 C;  3ETE A;  5B3S C;  2YEV B;  2X6C A;  1XL4 A;  3LDE A;  2PI5 A;  3T4D A;  5IDJ A;  1HWY A;  2EIJ C;  2V7Q G;  4UVB A;  4X88 A;  3W7W A;  1JVM A;  1E1Q G;  4QE7 A;  1K5Q A;  4MTG A;  2WSS G;  4MVU A;  3CMA V;  4HAM A;  3ZJZ A;  1NQT A;  3T4Z A;  3K03 A;  1VQ4 V;  3I56 V;  1OCO B;  4I9W A;  5CBF A;  5L3C A;  3LSS A;  1KEC A;  3ZRW B;  1M1K W;  4XDJ A;  2IH1 C;  3K04 A;  3CCU V;  1G4Y B;  4OXS A;  1F4M A;  2XAS A;  1P7B A;  3SPG A;  5LHG A;  1YIJ V;  3D3I A;  1R6K A;  1YIT V;  4Z1M G;  2AHY A;  5HFL A;  4E2L A;  2Y69 B;  5E1A C;  4MVR A;  4PDL A;  2H8P C;  2Q69 A;  3RBZ A;  1BL8 A;  2X6B A;  1ENV A;  3PJS K;  3QNE A;  4QJF B;  1QVG U;  2WPD G;  2EJR A;  2IH3 C;  3E35 A;  4MSW C;  3CCM V;  3IGA C;  1R3J C;  2LP7 A;  2OT5 A;  3ZIA G;  4QE9 A;  2IU3 A;  1FFT B;  5IYC O;  1YTF D;  2Q68 A;  2ATK C;  3W7S A;  1VQK V;  4QPJ A;  5LGT A;  4KFM A;  1JJ2 U;  3ETG A;  3SYA A;  2B1I A;  5H9C A;  2DYS B;  1BHA A;  2WLI A;  1Y66 A;  4MVM A;  3AG3 C;  2GSM B;  4TSF G;  2EIN B;  4BIZ A;  2BOC C;  3UKM A;  1RPR A;  1FXK B;  2QEX V;  2QTO A;  3B77 A;  2HKO A;  2IJH A;  1K34 A;  3DGE A;  5CMU A;  1H38 A;  5B3S B;  4FJC C;  3LSQ A;  3LDC A;  2Q67 A;  5DN6 G;  1K8A W;  1V55 C;  4EKW A;  2HG5 C;  1F23 A;  4WFG A;  3AG1 C;  3ZMZ A;  4ASU G;  3T2M A;  1M57 C;  3IC7 A;  2PI4 A;  3M99 B;  1W2B U;  1ZWI C;  3GWO A;  3JD2 A;  3WG7 B;  4R50 A;  4R6Z A;  2LFR A;  3CC2 V;  4FIP C;  4BIU A;  3KG2 A;  3P30 A;  1BHB A;  5KA6 A;  1Q86 W;  1R3K C;  1AJN A;  2QKS A;  3UM7 A;  3X2Q C;  3CXC U;  1VQL V;  1I5X A;  2DW4 A;  2WLN A;  3AG2 B;  5B1B C;  1W0J G;  1GO3 F;  1RM1 C;  2QM8 A;  2IU0 A;  2XND G;  1AI5 A;  3DTU B;  4P30 A;  1YTF B;  1QVF U;  1VQ6 V;  3LDD A;  4GX5 A;  4ZBM A;  5KUK A;  5LGU A;  3OFN G;  1S0V A;  4JAV A;  4GCZ A;  2W6J G;  3HB3 B;  1NH2 D;  2YEV A;  2ZQM A;  2HR3 A;  2HJF C;  2ZD9 A;  5C93 A;  3OEH G;  4N21 A;  4RQE A;  2UXN A;  3JCZ A;  1COW G;  4UVA A;  1PNL A;  4U7N A;  4PDV A;  3CC4 V;  4JTD B;  4WFA V;  1K33 A;  2XAJ A;  5B1N A;  4J9Z B;  3ABM B;  2A9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...