2IJJA

Crystal structure analysis of cole1 rom mutant f14y
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
58
structure length
58
Chain Sequence
GTKQEKTALNMARYIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Regulatory protein rop
total genus 27
structure length 58
sequence length 58
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijjA00
2GHYA 1ROPA 1GTOA 1RPOA 2IJIA 2IJJA 1F4NA 1B6QA 1F4MA 1NKDA 1PD3A 1RPRA 2IJKA 2IJHA 3K79A 1GMGA 4DO2A
chains in the Genus database with same CATH superfamily
3CC4V 3QF7A 4DUZO 4DV1O 1H8HG 5GONA 4UCVA 2CTWA 1YEWA 5JWPA 3ZRWB 3H1JH 2IU3A 3S3WA 4B3RB 2BE3A 2E76B 1QLEB 4G2KA 1M9NA 2ITCC 5KAIZ 2QE7G 5JVDB 4X66B 1NR7A 1JFFA 1FKAO 3H01A 4RAIA 4KHPO 1EBOA 4LF4O 2NLJC 4EFEA 5EIBC 2UXDO 2RJZA 1QLEC 2QA4V 4MVOA 4Q20A 5GW7A 1MOFA 2LGWA 1MSWD 4ZBMA 4GX2A 3ETQA 2W6JG 1NTKH 4FFKA 1OCRC 4K35A 5B3SB 4CS2A 2PI4A 4WFEA 4BIUA 1OCZC 2UXCO 1G4YB 1HNXO 5A9GA 3LNNA 2ADPA 2ZE6A 1M1KW 1PV0A 3SR2C 2FKXA 1RP3B 5B1BB 2JS3A 2BOCC 2ZXWB 2JJ2G 4EFBA 4LF8B 4DK0A 1KECA 4QJFB 2XAJA 2RDCA 3E8GA 4FVMA 3ZX6A 5TISZ 3TXQA 1TVKA 4JYBA 2N04A 2X6CA 5B5EZ 4FLZA 5EK0A 3M7MX 4IIJA 1M57C 5LHIA 3CYOA 1RSOA 3ZHQA 3SYAA 2XASA 4XBFA 2MW2B 5L3BA 5CN0A 3IGAC 1VQ8V 5A2QN 1U97A 3VQWA 3KCYA 5C8YA 5KA6A 4JI8O 1SS3A 4FPPA 3JAMN 4P9PA 4W4KA 1AI4A 1WLEA 1NTZH 4Z1VA 5GTHZ 1Q6UA 1JJOA 3RYHA 4R7CA 4DYLA 4DK1A 1HNXB 1T5EA 1YXBA 3DGEA 2Q68A 2V7QG 2CGOA 4JTAB 1M5IA 2Q8VA 5L3DA 5IJ0A 5IDJA 2QWPB 3CWBH 2GV9A 5LA6A 4IL6Z 4E4EA 4CZZA 1KD1W 3HPLC 3P3PA 3FD9A 1XDCA 3P3NA 4OXSA 2F4VO 2XAFA 4DV7B 3BRCA 3CCLV 5IWAB 3FB6C 1S5HC 4PA9A 3CCMV 3X2QC 4DR3B 4KUMA 2XAGA 1FXKA 3ZHTA 4YJ3B 4F4LA 1WPXA 5LP6B 2JGDA 1EM1A 3JASB 4TSFG 1FJGO 5J9PC 1EN5A 3E8FA 4LC1A 3ETDA 2PZSA 4H33A 4DR4B 2B9ZA 1MMMA 5EZYB 5LP6C 5LGNA 2ZM6B 4CH6A 2Q7EA 1MG1A 4WFFA 2YEVA 1J5EO 1EZJA 4DV1B 3AG2B 4BW9A 1XMOO 2DQ0A 4YIOA 1OHHG 3CJHB 4MVUA 1ZX3A 1XBLA 3UO2A 5IY5B 1WN7A 3J81N 2UXXA 3THOA 4FFBB 1LUVA 3AG2C 1WNSA 4J7KA 3ZBHA 4TV8A 1VQMV 4D7SA 3D8CA 1AI5A 4BIZA 2PUSA 5LBQA 2P6JA 3OW2U 3H1LH 3K58A 1JFFB 2F23A 2DWEC 1VQ4V 1KUQA 4DV3B 4CH5A 3T2MA 4B3MB 3SPCA 1IBKO 3JALA 1F4NA 3K9SA 3E8BA 1GN6A 1KU9A 5J2TA 1KC8W 3RYFA 2IJIA 4TUYB 4K0KB 2DOSA 3HKEB 2JEXA 2HP8A 2YXHA 3I55V 4DV6O 4JF3A 2P5OA 1GAXA 5KLVH 4IGGA 3JCZA 1GO3F 2P06A 4EB6A 4WFHA 1BL8A 2PI5A 2IJKA 1RFYA 3FKSG 3ZN0A 1N33B 1MZFA 3MAQA 3MHHC 2GBOA 2LQTA 3ZMTA 3FYEB 1IBMB 4ICGA 2XTAA 1IDSA 4TQFA 3JD1A 1IXMA 4JI6O 4FLUA 4F6EA 2R9RB 2GDSA 4NR1A 2Q69A 1M93A 1XEQA 2D3OW 1EN6A 2BOBC 3RYIB 1SESA 2IH1C 3BHPA 5EBMC 3IC9A 1XL4A 2L35A 3RW0A 2XAHA 3SYOA 4QE7A 5KX5B 1F51A 5KUMA 4KP4A 4DV0O 3ABKC 3CB2A 3J80N 3BVOA 1VF5B 5FNVB 3FB7C 3K5OA 2DN9A 2W0XA 4PDLA 4PA3A 3SPGA 4J9YB 3BAAA 4DR7O 4JI4O 5D5PA 5LGTA 3ETEA 4UV9A 4X1IA 3A0RA 5E79Z 1DK1A 1JMKC 2UXNA 2E5LO 1Z5VA 2Y69B 3IAYA 3RWRD 2ODMA 3JAKA 1GN4A 3ZHVA 4DR1O 1Q5OA 5B3SC 2FMLA 4CS3A 4BAYA 4QNHB 1XUQA 1ZL8B 2DMXA 4LF7B 2WLNA 1E1QG 3GVMA 1L0NH 1Y74B 1EFRG 1DGSA 4LH7A 1B06A 1H8EG 1S5LZ 4CC5A 1K3EA 1IBKB 1YI2V 1QR9A 1PKXA 3E35A 1JQ0A 1HW7A 4PI2A 1HR0O 1M4UA 3TXSA 3E22B 2PYLA 2HFEC 2HLDG 4RQEA 4JI2B 1ZWIC 4DV3O 4LFAB 1TVKB 2A06H 5DECA 5EC2C 2DYSB 1HNWO 2JIZG 2Q0OC 1AR1B 4JI3B 1BHBA 1Y4MA 2M6YA 3AG4C 5LMNB 2XHBA 5B66Z 1SQVH 3JASA 3SYPA 3N2GA 4TWKA 2RMKB 4DV5O 1YZBA 4G28B 3NXSA 4K3AA 1FXKB 2YIAA 3ABLB 3K79A 4RWUA 3LDEA 1L8DA 2AHZA 1NVPB 2B1IA 1EZVH 4Z2WA 1XMOB 1FXHA 4JI2O 1QVFU 3RYCA 1GM9A 5LA6B 4GKJO 4Z1MG 4UXNA 3JSNA 4AI8A 1XNRO 1JA8A 2EIJC 5FPOA 3RYIA 5JQGB 4R50A 3DTUB 1VMGA 4FLVA 4PV1B 1B3QA 1VQOV 5JJEB 1BQZA 3HB3B 4B08A 1OZ0A 1XNQO 2WA4A 4DW1A 2FB5A 1FJGB 4LF6O 2UU9B 1K34A 3JATB 2W0FC 3CP1A 5JH7A 1M56B 1F4MA 3W7WA 2OTLV 3RT3C 4KL1A 4JZ2A 2H8PC 5HFMA 1VQNV 1N34B 3HKDA 4DV7O 2ETNA 2A7WA 3RVYA 4DR7B 5LMUB 3WB0A 3JCUZ 4FM1A 3VOUA 4JV5B 2FL4A 2ZD9A 2QTSA 1XILA 3A0HZ 1I5YA 4QPKA 1OCRB 4AQYB 1WB8A 2QDOA 5J2UB 2NN4A 4PJ0Z 2BTQA 3FX7A 5ITZB 3PJSK 1JX9A 4DR5O 2EULA 1Q82W 1G8MA 2BSKA 4FFBA 4NXMO 5LYJB 2JGUA 1I08A 1X59A 1O9GA 4WFGA 4TQDA 4PA7A 1NJIW 4JI5O 1ROPA 1IBMO 3SPHA 3O65A 3K3WA 5LHHA 2EIKC 3JATA 4HBNA 3B4SA 3TK1A 2ZR3A 2IM9A 4JYAO 3D36C 3HKDB 4L8JA 1XHXA 2WLKA 2WLLB 3CRMA 3LSSA 3K0GA 4DV6B 4UB6Z 3CRQA 4XDKA 2P67A 3T1CA 2WLLA 1HNZB 1NBMG 4JYYA 4OX9B 2A79B 4JI7O 1O9HA 4GKKB 2V4DA 4K0KO 1YJNV 2C2AA 4JAAA 1WJZA 5IJ9A 2ZDIC 3AK2A 1SERA 2K9PA 1HWYA 3B09A 3K59A 2K1EA 4GKKO 1E79G 2WWWA 3VBBA 3T1YB 3FYIB 1BT8A 1KQSU 4IT5A 1Y74A 2X6BA 2D2CB 3AEIA 3N27A 4JGSA 2HHHB 2JK5C 2B5UA 2PGGA 1YSCA 2HHHO 1UFIA 4O4LB 4CBCA 1QR8A 3F5TA 2QR4A 4TT3G 1PNLA 4YHHO 3K5LA 3GB7C 2Q73A 1NTMH 1US6A 3OR7C 4YXWG 3FAVB 2KG7A 2CUGA 2H94A 3SYCA 3ZRWA 5CBGA 1IBLO 4MVZA 1GMGA 1KP2A 1GTOA 1AI7A 1GKFA 1Q6HA 4I9WA 1LNQA 3ICXA 2WPDG 4FLWA 4TV8B 1SQXH 1WA8B 2KB1A 1AP5A 2M7WA 1PP9H 1J5EB 1JOYA 1FFXB 2UXDB 4NB5A 4DR2O 3W7XA 2JGDB 2ZM6O 4LH6A 4LFCB 2YXYA 1QHTA 4X66O 4HNAA 1N34O 2WLJA 1AI6A 4PD4F 4J7JA 1M90W 1OCOC 2N74A 4DV4O 4NXMB 3E86A 4B3RO 5EC1C 3DC6A 2BSKB 4LF6B 5BXZA 5LOVB 2G38A 1H2SB 3OUFA 5FLXN 4MTOA 1TUBB 2QWQB 1S72V 3LNMB 1N8RW 3ASOB 3OR6C 4MVQA 4FM0A 4JV5O 3BA8A 2OIEA 5B1OA 4B7KA 3T1HO 4CH3A 2ZR2A 2JVDA 3ML0A 3ZRSA 2EJ7A 3B8NA 1XNRB 4MTXA 1VF7A 4UCTA 1SETA 4UVCA 1XQ8A 5KHIA 2UUBO 2RNBA 3KZIZ 4GUNA 1QLNA 3CRAA 2HKOA 3CPWU 1IURA 2X7RB 2Y0PA 1SKVA 2Q0AA 2B1GA 2E75B 1RM1C 1FFTB 4NTYA 2Q7GA 3BABA 5CMUA 4P9OA 4X88A 5LMNO 3JALB 2HJDA 4TOIA 2V1DA 3CX5F 4JAUA 3T4ZA 3JD3A 2MK3A 1AROP 3C3TA 4LFBB 4IIJB 1AJNA 4MTGA 2KKWA 4LFBO 2QSAA 1HR0B 2EILC 1F23A 2CE4A 1JPXA 3JAKB 4JI1B 2R9IA 1RPOA 1GM8A 3ZHUA 4MVRA 5DEDA 4MW3A 4FIPC 2QKSA 4K8XA 1JJ2U 3ZEDA 1K5QA 3B40A 1XL6A 2QTOA 3SJQC 4JI3O 1E1RG 3STLC 1VQ7V 4DR1B 4YJ2B 2ITDC 3ABMC 2LFSA 5DM6V 2E5LB 4U3JA 3B2EE 3K57A 2A9HA 3E2EA 4J7ZA 1ZAUA 3OAAG 3S3XA 3OT7A 5L3GA 4X62B 4UCRA 3T1HB 4DV2O 3CC2V 1VEWA 3D36A 4DUYB 3OD4A 4X1YA 4DR6O 2Q5ZA 4G27B 1FXVA 4RUFA 5IJ9B 3OTOB 3PN1A 3N2KA 5IYZB 3L72H 1UPGA 2EX3A 2IJHA 4BIOA 1VIBA 3G71V 5IJ0B 3CJHA 3F7VC 3K0DA 3MD0A 3OGIB 5FL7G 2P4KA 1N36B 5EYPB 4KHPB 5LXTA 2AZ2A 1KBHA 2ZE5A 3ASNC 2ZNJA 1XI1A 4LF9B 4R6ZA 4DW0A 3U11A 1K92A 3DXRA 3ZMVA 5CA0B 1BZKA 5H6RA 4I55B 2XT9A 3AG3B 3AK3A 1N0JA 4P30A 3U10A 1N33O 1Y66A 1YHQV 3OM3B 1X4TA 1WA8A 4I5SA 4DV0B 1OCCB 5K1XA 4U3FH 3OTOO 3CCSV 5JVDA 1PD3A 1SRYA 1YTFD 2GUZA 4OPAA 1BQ0A 3A8TA 5KHKA 2X0LA 4DV2B 1AR4A 1IX9A 3ZRVA 4RO2A 1JR9A 1TGOA 2FYUH 3E8HA 1K5SA 2EBOA 3QVNA 1M56C 4QE9A 4JI6B 4UCUA 4HZ3A 3UO3A 1XMQB 4A5UB 2EINC 5GONB 2EIMC 1MZEA 1NKDA 2IW5A 3AG3C 1F7YA 4PDVA 1CXZB 4ABMA 5LGUA 4I50A 4JYCA 3UCSC 4JI0B 4RQFA 2YIDA 4B3SB 4O4JA 2YXLA 2XOKG 1W0KG 3IC7A 5KA5A 4WBNA 2DW4A 3BPZA 2HJFC 3EXAA 2ARHA 3SJAC 4HYOA 1VF6A 1MSDA 3ZCCA 2AW9A 1RPRA 5CA3A 4BR6A 1CPYA 2PY5A 1YITV 4LWSA 3SDLA 5B1BC 4I0XB 2QEXV 1L1FA 1QBZA 2EZPA 5HFLA 3FB8C 1D2DA 2ZIOA 3SPIA 3WFVA 5KX5A 4PDRA 2NR5A 2IJJA 1SA0B 2IU0A 1IVSA 4P2ZA 1KMIZ 4EEQA 5DN6G 2VRZA 3BCCH 5CA1B 4DR5B 1Z5WA 2UUBB 2ZIMA 1PM9A 2YC0A 3ETGA 4QPJA 5L3FA 1Y67A 3UKMA 2NNUA 2ZNIA 2IBZH 5BR8B 3HKBA 3E22A 3E89A 2PTMA 4LR3A 5EBWC 3UT5A 4PELA 1Y76B 4CS4A 4FLYA 1S0VA 5LHGA 2R72A 4DR4O 1OCZB 1ZUQA 4O4HA 4MT8A 3JAWB 5L3CA 3I56V 3WB1A 2KQXA 4J80A 5KAFZ 3OMAB 3AK1A 3ZMSA 3L70H 4GX0A 4ZI7B 1VQ5V 2F95B 4UCSA 2UU9O 2RN9A 2AHYA 1SQBH 2CTRA 2XUMA 5LL6Y 3K03A 2F4VB 1YCIA 4QGPA 2ZINA 4I0XA 1Q90D 2CTQA 4X89A 4X1IB 3L9DA 5BR8O 5KHGA 2AXTZ 1VP7A 5J2TB 3ZJZA 5CBHA 2OCCC 4X20A 5H2FZ 2DJVA 3LSQA 5CB4B 4NTXA 2Z0AA 1A32A 1R3JC 4X64B 1H38A 4OGQB 3CS5A 4L87A 4GCZA 4IYIA 2CDYA 3Q4HA 1U96A 4EKWA 4JPRA 3ZRXA 3TCUA 1FD9A 1K97A 3HKCA 1S3JA 4YHHB 5BMVA 4DRXB 4YJ2A 4I9QA 1Y6XA 3HKCB 3OGCC 3OMNB 1RSOB 5JQGA 4U7OA 1HNWB 2QM7A 1H2LA 3R66A 3LDDA 3VQVA 2JS5A 4JAVA 3AG4B 3T1YO 1THZA 1P4RA 3E83A 4PI0A 1AP6A 1K7DA 1R6KA 2Q7HA 3A0BZ 3TGUH 2HG5C 5JJNB 2DE0X 2VS0A 2DWDC 1HNZO 2F1MA 2YEVB 5LYJA 3RYFB 3UQ8A 1EN4A 5B1AB 3VQXA 5BY1A 4LF8O 1V55B 3L74H 3X2QB 1SQFA 1PL0A 3KKYA 2VWJA 1K4CC 1KKDA 2QWNB 4UV8A 2GTAA 3SJBC 4MVMA 1PPJH 1N32O 3C90A 3FAVA 1P7GA 5EYPA 4BWAA 2F66C 1K8AW 4O2AB 2Y0IA 3TETA 4J11A 1VQKV 2YUAA 3K9AA 1V54B 2OTJV 3QNEA 2E3CA 5KHHA 3EHBB 2WLIA 2GUZB 3ASNB 5LP6A 1VQPV 3NR7A 2WSSG 3K08A 1SQQH 4AQYO 1R6TA 4XDLA 2LGQA 4JZGA 1UJWB 4PA6A 2DYRC 4X9QA 4GZRB 3D3IA 2OT5A 4KXRA 5JJJB 3L73H 1FXKC 1WAZA 4GX1A 2WAMA 1KKCA 4GYCB 4H0LB 4U7NA 5C93A 2JEUA 2KSDA 5JCOA 4NTWA 2RQ6A 3SPJA 4E2LA 1YJWV 3RYHB 1R1BA 2BTQB 5ITZA 2QGNA 2PF4E 4PA4A 5CB4A 4O4HB 5KHJA 1R6NA 4AILC 5IYDO 3CXHF 1WB7A 1YDXA 2EIKB 3SYQA 4DR6B 3CHXA 3CRCA 2EJRA 1NH2D 2UUCB 1AVMA 3W7TA 2EIMB 1NS1A 4MW8A 5GTIZ 1TUEB 1NT2B 4DRXA 3SGIA 3SJCC 3QG5A 3ABUA 4Q6GA 4B3MO 2JJ1G 1SQPH 1V54C 2OCHA 3DXRB 1FAFA 4LF5O 2UUAO 3IFXA 2LO1A 3GWKC 1COWG 2Y69C 4NXNO 4D6TH 3ZMZA 3KG2A 5FNVA 2Z3YA 3OUSA 2Y4TA 3CEIA 4NXNB 4DV5B 4ZHQB 2EINB 1BSMA 1P7BA 1BMFG 1R3LC 4LF5B 2GTSA 1ZLZA 1G1XB 1GM7A 2F93B 2VQEB 3RBZA 1MABG 4FLXA 1KYOF 2QJ1A 1NH2B 4LFAO 4GT1A 3AG1B 4MSWC 3VQYA 1Q43A 1GRJA 1H2MA 3N2GB 1FS0G 1SF9A 1SQGA 3OEHG 1JCHA 4NKGB 3G6EV 4R8CA 1ZSPA 4GLXA 4O4JB 1IXBA 3G67A 4H37A 4F6RA 4LBEC 3ZHSA 5H5NA 4LF7O 1GH6A 1I94B 4CC6A 4PDMA 5CA1A 1NVPD 1H2GA 1R73A 3H1HH 1H2NA 4FM2A 3QO8A 3CMAV 5IYBO 2LW7A 1GN3A 2CH7B 4LF9O 1Q6IA 3C3SA 3CCUV 3RN4A 5K1PA 5IWAO 4O4IA 2YIBA 1FPOA 5JCOC 1N4CA 1CEZA 3FB5C 1I5XA 1MA1A 1QQCA 4LNUA 4DUYO 4X65B 1K4DC 4X62O 2UXBO 4XDJA 4UVAA 5L3EA 3ASOC 1R3KC 2HVJC 1N32B 4KFMA 2F43G 3BY6A 3CC7V 2CK3G 2LFRA 4FJCC 2R70A 3OFNG 2X6AA 2OCCB 3LDCA 1QCEA 3Q4HB 3A2FA 1TUBA 4JI8B 2JDIG 3ZMUA 5B1AC 4UB8Z 2Q6AA 3WB2A 2ZCEA 4O4IB 3K5MA 2JRIA 3JYCA 3APQA 2ZE7A 4FZ1A 1YIJV 4FMTA 2YICA 4JI1O 4NVPA 4DXWA 4ZOLB 4YIPA 5H9CA 1XREA 3B8MA 3D3QA 2YS8A 3FFQA 3K06A 4YJ3A 4YY3B 4ZI7A 5KMGA 1QU7A 5E1AC 2VQFO 1L0LH 2VWKA 4BW5A 2P7TC 4UCOA 3ABKB 5H6QA 4DO2A 3TJTA 2EILB 2Q9LA 3G4SV 4MTFA 1H2KA 4TUYA 1GK9A 1Q7YW 3EFFK 4X1YB 3BA9A 3BEHA 2UUAB 2UXCB 2A3QA 1AJQA 3CXCU 1DF4A 2QKCA 2YIBD 3H9VA 3CSXA 1WPBA 2E74B 3CCQV 4JI7B 4C7UA 4U3JB 3HKBB 5IY5C 4O2BB 3ABLC 2PYJA 3JSLA 5LXTB 1RM1B 1J95A 2HVKC 2XNDG 2QWOB 4H44B 1BE3H 1V9PA 1HP8A 4J42A 4O2AA 5KMGB 1AB3A 5IE9A 4JYAB 4I55A 2QM8A 1MNGA 2R9AA 2N05A 2ZE8A 4OPHA 1TA8A 1P49A 2EZOA 2LW1A 2Y48A 4UVBA 3B77A 2ZKOA 1SZTA 3UM7A 2ADQB 2WLHA 3QTCA 3U0ZA 4DV4B 2WA3A 4B3TO 1P84F 4LNUB 1Q86W 3KCXA 4B7EA 4TV9A 1G6UA 5IYCO 4N21A 4GX5A 2AGAA 4LP8A 4B3TB 1W0JG 1JVMA 1Q3EA 2P4VA 1GN2A 3CE2A 4LFCO 4QIWF 3ZN1A 4W4LA 4DR3O 1LUWA 4DR2B 1NU1H 3JARA 5EZYA 1NQTA 2Q67A 1ORQC 3JD0A 1V55C 2XAQA 2CH7A 4FLTA 1W59A 3LSUA 1VQLV 3M99B 1S77D 4O4LA 3ZS8C 2W6IG 4LCUC 1OCCC 2KG7B 1IBLB 2OYQA 3CRRA 3JD2A 1I0HA 1BGYH 3H1IH 4AHCA 4I50B 1VARA 3G6BA 2CTPA 2EIJB 1B04A 3DSQA 5F2VO 1AR5A 1DTOA 4WFAV 1BCCH 1PNKA 5JH7B 3IJ4A 4LWSB 2OIGA 1VF6C 2BCCH 2WLIB 2YI8A 2CGNA 4J9ZB 1AILA 3CCRV 2GSMB 1M57B 4UFZA 2OWOA 1K33A 1KP3A 3LUTB 2LJ2A 3QO7A 2P90A 3RFRA 3O9OA 5CBFA 3I5DA 2DYRB 3CCVV 1QVGU 1S76D 4J10A 4CH4A 4GKJB 1SA0A 5D5QA 2VQFB 2RCVA 1OV9A 3L71H 2ZXWC 1I7FA 4YY3O 4ZHQA 4ASUG 3RYCB 1DLBA 3K5NA 2BTOA 3T4DA 3HR0A 4OX9O 3F5WC 1R3IC 4JI0O 3JAWA 1OJHA 3W7SA 1K73W 5BZBA 1SZXA 3ABMB 3N2KB 5IYZA 3W7UA 2YSUB 1URFA 5AG2A 4X1KA 1XMQO 3AG1C 2ILMA 3P30A 1DF5A 4JI5B 1OCOB 4X1KB 1YVWA 5EIBD 3UT5B 3EVKA 1Y76A 1YJ9V 3K04A 4X64O 2Q4PA 2Y4UA 4WCEV 3RGBA 2UXBB 2WLMA 1QNMA 3J7AU 5IT9N 4X65O 2AZ0A 4J41A 3F7YC 4FZ0A 4I4TB 1VQ9V 2LP7A 1Q8IA 3HKEA 1N0NA 1NI8A 4ZIBA 4WF9V 4H13B 2Z5UA 3G80A 2DQ3A 4I4TA 4ZOLA 4IHJB 5LMUO 3ZIAG 3OEEG 1HDJA 4D7TA 1FYJA 2H3OA 3R65A 4LF4B 3CCEV 2QM4A 1N36O 4JTCB 2P22C 1WP7A 4JI4B 4JTDB 1ZTEA 3MDSA 3OMIB 2ZDIA 5FPRA 1W2BU 1BHAA 1XNQB 1AJPA 1NR1A 1LR1A 5J2UA 1I94O 3P32A 4WBNB 3ABTA 4MVSA 3CCJV 1D5AA 1ZL8A 1WP8A 1KB9F 1XOUA 3AG7A 2L6LA 4JASA 2HEPA 4DUZB 4WFBV 3MHSC 3BFRA 1BS3A 3M8AA 4MS2A 3STZC 3JARB 2IH3C 3DC5A 4IHJA 2A0LA 2QWRB 2ZT9B 1VQ6V 1YTFB 3JD4A 1K9MW 1NZ6A 1S5JA 1TAEA 1IZ3A 3QO5A 1D5NA 3ZHRA 4I7ZB 2GHYA 4PHZA 4X8AA 3L75H 2ATKC 3OTFA 4HAMA 5CA0A 3CD6V 2YI9A 1CP9A 5EBLC 2CAZC 4K8ZA 2VQEO 4RUEA 3WU2Z 4F6RB 3APOA 3GWOA 4X20B 2O57A 4FK5C 4O2BA 2FTKA 2UUCO 1B6QA 3OE7G 1Q81W 3CMEV 2ZQMA 2DYSC 4B3SO 3H1KH 3RVZA 1YF2A 1XHZA 4N23A 5BMVB 3WG7B 2QKAA 1PL4A 4NYKA 4HNAB 1Z2GA 1SC5B 4ZKIA 5B1NA 5LOVA 1ENVA 5C8YB 2YDEA 1FFXA 2HR3A 5KUKA 1PNMA 3WG7C 4EB6B 4TV9B 4UUJC 4IYHA
chains in the Genus database with same CATH topology
2EINC 1FXKB 3CC4V 2EIMC 4UVAA 4XDJA 5L3EA 3ABLB 1NKDA 2IW5A 3K79A 3ASOC 3LDEA 2AHZA 1R3KC 1NVPB 1H8HG 3AG3C 2B1IA 4PDVA 2HVJC 1FXHA 4KFMA 2F43G 3BY6A 1QVFU 5LGUA 1GM9A 4JYCA 4RQFA 3CC7V 3ZRWB 2CK3G 2IU3A 4Z1MG 2LFRA 4FJCC 4UXNA 3OFNG 2X6AA 2XOKG 2EIJC 2OCCB 3LDCA 4R50A 3DTUB 1QCEA 1W0KG 1QLEB 2JDIG 3IC7A 4G2KA 1M9NA 3ZMUA 5KA5A 5B1AC 2DW4A 1VQOV 2ITCC 3HB3B 2Q6AA 2HJFC 2QE7G 3JYCA 1NR7A 1OZ0A 3H01A 4RAIA 4HYOA 4FMTA 1EBOA 1YIJV 2NLJC 3ZCCA 4DXWA 1RPRA 1K34A 1QLEC 5CA3A 2W0FC 2QA4V 1CPYA 3CP1A 1YITV 5H9CA 4MVOA 1M56B 4Q20A 3B8MA 5GW7A 1F4MA 1MOFA 3K06A 3W7WA 2OTLV 1MSWD 5B1BC 4ZBMA 2H8PC 5HFMA 1VQNV 2QEXV 4GX2A 1L1FA 5E1AC 1QBZA 2EZPA 5HFLA 2W6JG 3RVYA 3FB8C 3SPIA 4BW5A 1OCRC 2P7TC 5B3SB 2PI4A 3WFVA 3ABKB 5H6QA 4WFEA 3VOUA 4PDRA 4DO2A 4BIUA 1OCZC 2IJJA 2ZD9A 2EILB 2IU0A 3G4SV 4P2ZA 1I5YA 1G4YB 1OCRB 4QPKA 5DN6G 4MTFA 1GK9A 3PJSK 1M1KW 1Q7YW 1JX9A 3EFFK 3ETGA 4QPJA 1Q82W 5B1BB 1G8MA 5L3FA 3UKMA 3BEHA 2NNUA 2BOCC 2ZXWB 1AJQA 3CXCU 1DF4A 2JJ2G 4WFGA 4QJFB 1KECA 3E89A 3CCQV 5EBWC 2XAJA 4PELA 3E8GA 1S0VA 4PA7A 5LHGA 1NJIW 4JYBA 1OCZB 5IY5C 1ROPA 4MT8A 2X6CA 3ABLC 3SPHA 3K3WA 5EK0A 5LHHA 2EIKC 5L3CA 1RM1B 3I56V 1J95A 1M57C 5LHIA 3CYOA 2HVKC 3SYAA 3OMAB 3TK1A 2XNDG 2XASA 2ZR3A 4XBFA 3ZMSA 4GX0A 5L3BA 5CN0A 1VQ5V 3IGAC 2QM8A 2WLKA 2WLLB 3LSSA 3K0GA 2AHYA 1VQ8V 2EZOA 2Y48A 4UVBA 4XDKA 2P67A 3B77A 3T1CA 1SZTA 3K03A 2WLLA 3UM7A 1NBMG 2WLHA 2A79B 5KA6A 1YJNV 2C2AA 4X89A 2ZDIC 1SERA 1Q86W 4FPPA 1HWYA 4P9PA 5IYCO 2K1EA 4N21A 4GX5A 1E79G 4LP8A 1AI4A 1W0JG 1WLEA 1JVMA 2WWWA 3VBBA 3FYIB 1KQSU 4QIWF 3ZN1A 3ZJZA 5CBHA 2OCCC 3LSQA 2X6BA 4R7CA 3AEIA 4JGSA 1R3JC 2JK5C 2B5UA 3DGEA 1YSCA 2Q68A 2V7QG 1H38A 4CBCA 1NQTA 2Q67A 1ORQC 1QR8A 3JD0A 1V55C 4L87A 2XAQA 4JTAB 4TT3G 4GCZA 1VQLV 3M99B 1S77D 1PNLA 5L3DA 2W6IG 4EKWA 4LCUC 4JPRA 3ZRXA 3TCUA 1OCCC 1K97A 1S3JA 5IDJA 3GB7C 3JD2A 3OR7C 4YXWG 3SYCA 2H94A 3OGCC 3ZRWA 3OMNB 5CBGA 2EIJB 4CZZA 1KD1W 3HPLC 1DTOA 4MVZA 1GMGA 4WFAV 4U7OA 1KP2A 4OXSA 1GTOA 2XAFA 1AI7A 1GKFA 2QM7A 4I9WA 3CCLV 3LDDA 1PNKA 1S5HC 3FB6C 1LNQA 4PA9A 3X2QC 3CCMV 2WPDG 4KUMA 2XAGA 2WLIB 1FXKA 2M7WA 3AG4B 2KB1A 4JAVA 1THZA 4F4LA 3CCRV 1WPXA 4J9ZB 1P4RA 1M57B 2GSMB 3E83A 1K33A 1JOYA 1K7DA 1KP3A 1R6KA 4TSFG 3LUTB 3QO7A 2P90A 3W7XA 2HG5C 5J9PC 3E8FA 5CBFA 4LC1A 2DYRB 3CCVV 1QVGU 3ETDA 4H33A 2DWDC 1S76D 2YEVB 5LGNA 2ZXWC 5B1AB 2WLJA 1MG1A 1V55B 4WFFA 4ASUG 1AI6A 2YEVA 3X2QB 1M90W 1DLBA 1OCOC 1PL0A 3T4DA 1K4CC 1KKDA 1EZJA 3E86A 5EC1C 3F5WC 1R3IC 4UV8A 3AG2B 3W7SA 1K73W 3OUFA 4MVMA 5BZBA 4MTOA 2DQ0A 1OHHG 1S72V 3LNMB 3ABMB 4MVUA 1N8RW 3W7UA 1K8AW 3ASOB 3OR6C 4MVQA 5IY5B 2YSUB 3TETA 5B1OA 1VQKV 2ZR2A 2UXXA 3ML0A 3K9AA 3ZRSA 3AG2C 3AG1C 3B8NA 1V54B 2OTJV 3QNEA 4MTXA 3P30A 3EHBB 1DF5A 2WLIA 1OCOB 1VQMV 1SETA 3ASNB 4UVCA 1AI5A 4BIZA 1VQPV 2WSSG 5LBQA 1QLNA 2P6JA 3K08A 3OW2U 1YJ9V 3K04A 2HKOA 4XDLA 3CPWU 2DWEC 2X7RB 1UJWB 4PA6A 1VQ4V 2DYRC 4WCEV 2WLMA 3D3IA 2B1GA 2OT5A 3T2MA 1RM1C 1FFTB 3SPCA 1FXKC 4GX1A 3F7YC 2WAMA 5CMUA 4P9OA 4U7NA 4X88A 1VQ9V 1F4NA 5C93A 2LP7A 2JEUA 3E8BA 3SPJA 4E2LA 4WF9V 1YJWV 2Z5UA 1KC8W 2IJIA 2DQ3A 2V1DA 3ZIAG 3OEEG 4JAUA 4PA4A 3T4ZA 3JD3A 2MK3A 1AROP 2JEXA 1R6NA 3R65A 3I55V 3CCEV 1AJNA 5IYDO 4JTCB 4JF3A 4MTGA 3JCZA 2EIKB 1GO3F 3SYQA 4JTDB 2EILC 4WFHA 1BL8A 1F23A 2EJRA 1NH2D 2PI5A 2IJKA 3FKSG 1JPXA 3ZN0A 3OMIB 2EIMB 3W7TA 4MW8A 2ZDIA 3MHHC 1TUEB 1W2BU 2R9IA 1RPOA 1GM8A 3ZMTA 1BHAA 3FYEB 1AJPA 1NR1A 3JD1A 1IXMA 4MVRA 3ABUA 3P32A 2R9RB 4MW3A 4FIPC 2QKSA 2JJ1G 1JJ2U 3ABTA 4MVSA 1K5QA 1V54C 3CCJV 2Q69A 1XL6A 2QTOA 3SJQC 2D3OW 2BOBC 1E1RG 3IFXA 1SESA 2IH1C 3STLC 4JASA 1VQ7V 5EBMC 1XL4A 1COWG 3RW0A 2XAHA 3SYOA 2ITDC 2Y69C 3ABMC 4QE7A 4WFBV 3ZMZA 3KG2A 2Z3YA 2LFSA 3MHSC 3OUSA 5DM6V 1F51A 5KUMA 4KP4A 3ABKC 2EINB 2A9HA 4MS2A 3STZC 1P7BA 3E2EA 1BMFG 1R3LC 3OAAG 3FB7C 2IH3C 2A0LA 5L3GA 1GM7A 4PDLA 4PA3A 3CC2V 3D36A 4J9YB 3SPGA 3RBZA 1MABG 1VQ6V 1YTFB 5LGTA 3ETEA 4G27B 1FXVA 4RUFA 4UV9A 3JD4A 1NH2B 1K9MW 4GT1A 3A0RA 2UXNA 3AG1B 4MSWC 3QO5A 2Y69B 2IJHA 1FS0G 3G71V 2GHYA 5B3SC 3K0DA 3F7VC 3MD0A 4X8AA 2ATKC 3OEHG 1JCHA 3G6EV 4R8CA 5FL7G 4BAYA 4HAMA 4H37A 3ASNC 4LBEC 3CD6V 1CP9A 4R6ZA 5EBLC 4QNHB 4PDMA 1K92A 3ZMVA 4RUEA 2WLNA 1NVPD 5H6RA 1E1QG 1H2GA 1R73A 3GWOA 1EFRG 3AG3B 1H8EG 4P30A 4FK5C 1Y66A 2FTKA 1B6QA 1YHQV 3OE7G 1K3EA 3OM3B 3QO8A 3CMAV 1YI2V 1QR9A 5IYBO 3CMEV 2ZQMA 2DYSC 1PKXA 3E35A 1JQ0A 4I5SA 1Q81W 3CCUV 1OCCB 3RVZA 2HFEC 2HLDG 4RQEA 1ZWIC 3CCSV 5EC2C 1PD3A 2DYSB 4N23A 3WG7B 2JIZG 1SRYA 1YTFD 1AR1B 1BHBA 1Y4MA 1CEZA 2X0LA 4ZKIA 3FB5C 3ZRVA 3AG4C 5B1NA 1I5XA 4RO2A 1ENVA 3E8HA 1K5SA 2EBOA 1M56C 4QE9A 4HZ3A 2HR3A 5KUKA 1PNMA 3SYPA 4TWKA 4G28B 3WG7C 3NXSA 1K4DC 4UUJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GHY A;  1ROP A;  1GTO A;  1RPO A;  2IJI A;  2IJJ A;  1F4N A;  1B6Q A;  1F4M A;  1NKD A;  1PD3 A;  1RPR A;  2IJK A;  2IJH A;  3K79 A;  1GMG A;  4DO2 A; 
#chains in the Genus database with same CATH topology
 3CC4 V;  3QF7 A;  4DUZ O;  4DV1 O;  1H8H G;  5GON A;  4UCV A;  2CTW A;  1YEW A;  5JWP A;  3ZRW B;  3H1J H;  2IU3 A;  3S3W A;  4B3R B;  2BE3 A;  2E76 B;  1QLE B;  4G2K A;  1M9N A;  2ITC C;  5KAI Z;  2QE7 G;  5JVD B;  4X66 B;  1NR7 A;  1JFF A;  1FKA O;  3H01 A;  4RAI A;  4KHP O;  1EBO A;  4LF4 O;  2NLJ C;  4EFE A;  5EIB C;  2UXD O;  2RJZ A;  1QLE C;  2QA4 V;  4MVO A;  4Q20 A;  5GW7 A;  1MOF A;  2LGW A;  1MSW D;  4ZBM A;  4GX2 A;  3ETQ A;  2W6J G;  1NTK H;  4FFK A;  1OCR C;  4K35 A;  5B3S B;  4CS2 A;  2PI4 A;  4WFE A;  4BIU A;  1OCZ C;  2UXC O;  1G4Y B;  1HNX O;  5A9G A;  3LNN A;  2ADP A;  2ZE6 A;  1M1K W;  1PV0 A;  3SR2 C;  2FKX A;  1RP3 B;  5B1B B;  2JS3 A;  2BOC C;  2ZXW B;  2JJ2 G;  4EFB A;  4LF8 B;  4DK0 A;  1KEC A;  4QJF B;  2XAJ A;  2RDC A;  3E8G A;  4FVM A;  3ZX6 A;  5TIS Z;  3TXQ A;  1TVK A;  4JYB A;  2N04 A;  2X6C A;  5B5E Z;  4FLZ A;  5EK0 A;  3M7M X;  4IIJ A;  1M57 C;  5LHI A;  3CYO A;  1RSO A;  3ZHQ A;  3SYA A;  2XAS A;  4XBF A;  2MW2 B;  5L3B A;  5CN0 A;  3IGA C;  1VQ8 V;  5A2Q N;  1U97 A;  3VQW A;  3KCY A;  5C8Y A;  5KA6 A;  4JI8 O;  1SS3 A;  4FPP A;  3JAM N;  4P9P A;  4W4K A;  1AI4 A;  1WLE A;  1NTZ H;  4Z1V A;  5GTH Z;  1Q6U A;  1JJO A;  3RYH A;  4R7C A;  4DYL A;  4DK1 A;  1HNX B;  1T5E A;  1YXB A;  3DGE A;  2Q68 A;  2V7Q G;  2CGO A;  4JTA B;  1M5I A;  2Q8V A;  5L3D A;  5IJ0 A;  5IDJ A;  2QWP B;  3CWB H;  2GV9 A;  5LA6 A;  4IL6 Z;  4E4E A;  4CZZ A;  1KD1 W;  3HPL C;  3P3P A;  3FD9 A;  1XDC A;  3P3N A;  4OXS A;  2F4V O;  2XAF A;  4DV7 B;  3BRC A;  3CCL V;  5IWA B;  3FB6 C;  1S5H C;  4PA9 A;  3CCM V;  3X2Q C;  4DR3 B;  4KUM A;  2XAG A;  1FXK A;  3ZHT A;  4YJ3 B;  4F4L A;  1WPX A;  5LP6 B;  2JGD A;  1EM1 A;  3JAS B;  4TSF G;  1FJG O;  5J9P C;  1EN5 A;  3E8F A;  4LC1 A;  3ETD A;  2PZS A;  4H33 A;  4DR4 B;  2B9Z A;  1MMM A;  5EZY B;  5LP6 C;  5LGN A;  2ZM6 B;  4CH6 A;  2Q7E A;  1MG1 A;  4WFF A;  2YEV A;  1J5E O;  1EZJ A;  4DV1 B;  3AG2 B;  4BW9 A;  1XMO O;  2DQ0 A;  4YIO A;  1OHH G;  3CJH B;  4MVU A;  1ZX3 A;  1XBL A;  3UO2 A;  5IY5 B;  1WN7 A;  3J81 N;  2UXX A;  3THO A;  4FFB B;  1LUV A;  3AG2 C;  1WNS A;  4J7K A;  3ZBH A;  4TV8 A;  1VQM V;  4D7S A;  3D8C A;  1AI5 A;  4BIZ A;  2PUS A;  5LBQ A;  2P6J A;  3OW2 U;  3H1L H;  3K58 A;  1JFF B;  2F23 A;  2DWE C;  1VQ4 V;  1KUQ A;  4DV3 B;  4CH5 A;  3T2M A;  4B3M B;  3SPC A;  1IBK O;  3JAL A;  1F4N A;  3K9S A;  3E8B A;  1GN6 A;  1KU9 A;  5J2T A;  1KC8 W;  3RYF A;  2IJI A;  4TUY B;  4K0K B;  2DOS A;  3HKE B;  2JEX A;  2HP8 A;  2YXH A;  3I55 V;  4DV6 O;  4JF3 A;  2P5O A;  1GAX A;  5KLV H;  4IGG A;  3JCZ A;  1GO3 F;  2P06 A;  4EB6 A;  4WFH A;  1BL8 A;  2PI5 A;  2IJK A;  1RFY A;  3FKS G;  3ZN0 A;  1N33 B;  1MZF A;  3MAQ A;  3MHH C;  2GBO A;  2LQT A;  3ZMT A;  3FYE B;  1IBM B;  4ICG A;  2XTA A;  1IDS A;  4TQF A;  3JD1 A;  1IXM A;  4JI6 O;  4FLU A;  4F6E A;  2R9R B;  2GDS A;  4NR1 A;  2Q69 A;  1M93 A;  1XEQ A;  2D3O W;  1EN6 A;  2BOB C;  3RYI B;  1SES A;  2IH1 C;  3BHP A;  5EBM C;  3IC9 A;  1XL4 A;  2L35 A;  3RW0 A;  2XAH A;  3SYO A;  4QE7 A;  5KX5 B;  1F51 A;  5KUM A;  4KP4 A;  4DV0 O;  3ABK C;  3CB2 A;  3J80 N;  3BVO A;  1VF5 B;  5FNV B;  3FB7 C;  3K5O A;  2DN9 A;  2W0X A;  4PDL A;  4PA3 A;  3SPG A;  4J9Y B;  3BAA A;  4DR7 O;  4JI4 O;  5D5P A;  5LGT A;  3ETE A;  4UV9 A;  4X1I A;  3A0R A;  5E79 Z;  1DK1 A;  1JMK C;  2UXN A;  2E5L O;  1Z5V A;  2Y69 B;  3IAY A;  3RWR D;  2ODM A;  3JAK A;  1GN4 A;  3ZHV A;  4DR1 O;  1Q5O A;  5B3S C;  2FML A;  4CS3 A;  4BAY A;  4QNH B;  1XUQ A;  1ZL8 B;  2DMX A;  4LF7 B;  2WLN A;  1E1Q G;  3GVM A;  1L0N H;  1Y74 B;  1EFR G;  1DGS A;  4LH7 A;  1B06 A;  1H8E G;  1S5L Z;  4CC5 A;  1K3E A;  1IBK B;  1YI2 V;  1QR9 A;  1PKX A;  3E35 A;  1JQ0 A;  1HW7 A;  4PI2 A;  1HR0 O;  1M4U A;  3TXS A;  3E22 B;  2PYL A;  2HFE C;  2HLD G;  4RQE A;  4JI2 B;  1ZWI C;  4DV3 O;  4LFA B;  1TVK B;  2A06 H;  5DEC A;  5EC2 C;  2DYS B;  1HNW O;  2JIZ G;  2Q0O C;  1AR1 B;  4JI3 B;  1BHB A;  1Y4M A;  2M6Y A;  3AG4 C;  5LMN B;  2XHB A;  5B66 Z;  1SQV H;  3JAS A;  3SYP A;  3N2G A;  4TWK A;  2RMK B;  4DV5 O;  1YZB A;  4G28 B;  3NXS A;  4K3A A;  1FXK B;  2YIA A;  3ABL B;  3K79 A;  4RWU A;  3LDE A;  1L8D A;  2AHZ A;  1NVP B;  2B1I A;  1EZV H;  4Z2W A;  1XMO B;  1FXH A;  4JI2 O;  1QVF U;  3RYC A;  1GM9 A;  5LA6 B;  4GKJ O;  4Z1M G;  4UXN A;  3JSN A;  4AI8 A;  1XNR O;  1JA8 A;  2EIJ C;  5FPO A;  3RYI A;  5JQG B;  4R50 A;  3DTU B;  1VMG A;  4FLV A;  4PV1 B;  1B3Q A;  1VQO V;  5JJE B;  1BQZ A;  3HB3 B;  4B08 A;  1OZ0 A;  1XNQ O;  2WA4 A;  4DW1 A;  2FB5 A;  1FJG B;  4LF6 O;  2UU9 B;  1K34 A;  3JAT B;  2W0F C;  3CP1 A;  5JH7 A;  1M56 B;  1F4M A;  3W7W A;  2OTL V;  3RT3 C;  4KL1 A;  4JZ2 A;  2H8P C;  5HFM A;  1VQN V;  1N34 B;  3HKD A;  4DV7 O;  2ETN A;  2A7W A;  3RVY A;  4DR7 B;  5LMU B;  3WB0 A;  3JCU Z;  4FM1 A;  3VOU A;  4JV5 B;  2FL4 A;  2ZD9 A;  2QTS A;  1XIL A;  3A0H Z;  1I5Y A;  4QPK A;  1OCR B;  4AQY B;  1WB8 A;  2QDO A;  5J2U B;  2NN4 A;  4PJ0 Z;  2BTQ A;  3FX7 A;  5ITZ B;  3PJS K;  1JX9 A;  4DR5 O;  2EUL A;  1Q82 W;  1G8M A;  2BSK A;  4FFB A;  4NXM O;  5LYJ B;  2JGU A;  1I08 A;  1X59 A;  1O9G A;  4WFG A;  4TQD A;  4PA7 A;  1NJI W;  4JI5 O;  1ROP A;  1IBM O;  3SPH A;  3O65 A;  3K3W A;  5LHH A;  2EIK C;  3JAT A;  4HBN A;  3B4S A;  3TK1 A;  2ZR3 A;  2IM9 A;  4JYA O;  3D36 C;  3HKD B;  4L8J A;  1XHX A;  2WLK A;  2WLL B;  3CRM A;  3LSS A;  3K0G A;  4DV6 B;  4UB6 Z;  3CRQ A;  4XDK A;  2P67 A;  3T1C A;  2WLL A;  1HNZ B;  1NBM G;  4JYY A;  4OX9 B;  2A79 B;  4JI7 O;  1O9H A;  4GKK B;  2V4D A;  4K0K O;  1YJN V;  2C2A A;  4JAA A;  1WJZ A;  5IJ9 A;  2ZDI C;  3AK2 A;  1SER A;  2K9P A;  1HWY A;  3B09 A;  3K59 A;  2K1E A;  4GKK O;  1E79 G;  2WWW A;  3VBB A;  3T1Y B;  3FYI B;  1BT8 A;  1KQS U;  4IT5 A;  1Y74 A;  2X6B A;  2D2C B;  3AEI A;  3N27 A;  4JGS A;  2HHH B;  2JK5 C;  2B5U A;  2PGG A;  1YSC A;  2HHH O;  1UFI A;  4O4L B;  4CBC A;  1QR8 A;  3F5T A;  2QR4 A;  4TT3 G;  1PNL A;  4YHH O;  3K5L A;  3GB7 C;  2Q73 A;  1NTM H;  1US6 A;  3OR7 C;  4YXW G;  3FAV B;  2KG7 A;  2CUG A;  2H94 A;  3SYC A;  3ZRW A;  5CBG A;  1IBL O;  4MVZ A;  1GMG A;  1KP2 A;  1GTO A;  1AI7 A;  1GKF A;  1Q6H A;  4I9W A;  1LNQ A;  3ICX A;  2WPD G;  4FLW A;  4TV8 B;  1SQX H;  1WA8 B;  2KB1 A;  1AP5 A;  2M7W A;  1PP9 H;  1J5E B;  1JOY A;  1FFX B;  2UXD B;  4NB5 A;  4DR2 O;  3W7X A;  2JGD B;  2ZM6 O;  4LH6 A;  4LFC B;  2YXY A;  1QHT A;  4X66 O;  4HNA A;  1N34 O;  2WLJ A;  1AI6 A;  4PD4 F;  4J7J A;  1M90 W;  1OCO C;  2N74 A;  4DV4 O;  4NXM B;  3E86 A;  4B3R O;  5EC1 C;  3DC6 A;  2BSK B;  4LF6 B;  5BXZ A;  5LOV B;  2G38 A;  1H2S B;  3OUF A;  5FLX N;  4MTO A;  1TUB B;  2QWQ B;  1S72 V;  3LNM B;  1N8R W;  3ASO B;  3OR6 C;  4MVQ A;  4FM0 A;  4JV5 O;  3BA8 A;  2OIE A;  5B1O A;  4B7K A;  3T1H O;  4CH3 A;  2ZR2 A;  2JVD A;  3ML0 A;  3ZRS A;  2EJ7 A;  3B8N A;  1XNR B;  4MTX A;  1VF7 A;  4UCT A;  1SET A;  4UVC A;  1XQ8 A;  5KHI A;  2UUB O;  2RNB A;  3KZI Z;  4GUN A;  1QLN A;  3CRA A;  2HKO A;  3CPW U;  1IUR A;  2X7R B;  2Y0P A;  1SKV A;  2Q0A A;  2B1G A;  2E75 B;  1RM1 C;  1FFT B;  4NTY A;  2Q7G A;  3BAB A;  5CMU A;  4P9O A;  4X88 A;  5LMN O;  3JAL B;  2HJD A;  4TOI A;  2V1D A;  3CX5 F;  4JAU A;  3T4Z A;  3JD3 A;  2MK3 A;  1ARO P;  3C3T A;  4LFB B;  4IIJ B;  1AJN A;  4MTG A;  2KKW A;  4LFB O;  2QSA A;  1HR0 B;  2EIL C;  1F23 A;  2CE4 A;  1JPX A;  3JAK B;  4JI1 B;  2R9I A;  1RPO A;  1GM8 A;  3ZHU A;  4MVR A;  5DED A;  4MW3 A;  4FIP C;  2QKS A;  4K8X A;  1JJ2 U;  3ZED A;  1K5Q A;  3B40 A;  1XL6 A;  2QTO A;  3SJQ C;  4JI3 O;  1E1R G;  3STL C;  1VQ7 V;  4DR1 B;  4YJ2 B;  2ITD C;  3ABM C;  2LFS A;  5DM6 V;  2E5L B;  4U3J A;  3B2E E;  3K57 A;  2A9H A;  3E2E A;  4J7Z A;  1ZAU A;  3OAA G;  3S3X A;  3OT7 A;  5L3G A;  4X62 B;  4UCR A;  3T1H B;  4DV2 O;  3CC2 V;  1VEW A;  3D36 A;  4DUY B;  3OD4 A;  4X1Y A;  4DR6 O;  2Q5Z A;  4G27 B;  1FXV A;  4RUF A;  5IJ9 B;  3OTO B;  3PN1 A;  3N2K A;  5IYZ B;  3L72 H;  1UPG A;  2EX3 A;  2IJH A;  4BIO A;  1VIB A;  3G71 V;  5IJ0 B;  3CJH A;  3F7V C;  3K0D A;  3MD0 A;  3OGI B;  5FL7 G;  2P4K A;  1N36 B;  5EYP B;  4KHP B;  5LXT A;  2AZ2 A;  1KBH A;  2ZE5 A;  3ASN C;  2ZNJ A;  1XI1 A;  4LF9 B;  4R6Z A;  4DW0 A;  3U11 A;  1K92 A;  3DXR A;  3ZMV A;  5CA0 B;  1BZK A;  5H6R A;  4I55 B;  2XT9 A;  3AG3 B;  3AK3 A;  1N0J A;  4P30 A;  3U10 A;  1N33 O;  1Y66 A;  1YHQ V;  3OM3 B;  1X4T A;  1WA8 A;  4I5S A;  4DV0 B;  1OCC B;  5K1X A;  4U3F H;  3OTO O;  3CCS V;  5JVD A;  1PD3 A;  1SRY A;  1YTF D;  2GUZ A;  4OPA A;  1BQ0 A;  3A8T A;  5KHK A;  2X0L A;  4DV2 B;  1AR4 A;  1IX9 A;  3ZRV A;  4RO2 A;  1JR9 A;  1TGO A;  2FYU H;  3E8H A;  1K5S A;  2EBO A;  3QVN A;  1M56 C;  4QE9 A;  4JI6 B;  4UCU A;  4HZ3 A;  3UO3 A;  1XMQ B;  4A5U B;  2EIN C;  5GON B;  2EIM C;  1MZE A;  1NKD A;  2IW5 A;  3AG3 C;  1F7Y A;  4PDV A;  1CXZ B;  4ABM A;  5LGU A;  4I50 A;  4JYC A;  3UCS C;  4JI0 B;  4RQF A;  2YID A;  4B3S B;  4O4J A;  2YXL A;  2XOK G;  1W0K G;  3IC7 A;  5KA5 A;  4WBN A;  2DW4 A;  3BPZ A;  2HJF C;  3EXA A;  2ARH A;  3SJA C;  4HYO A;  1VF6 A;  1MSD A;  3ZCC A;  2AW9 A;  1RPR A;  5CA3 A;  4BR6 A;  1CPY A;  2PY5 A;  1YIT V;  4LWS A;  3SDL A;  5B1B C;  4I0X B;  2QEX V;  1L1F A;  1QBZ A;  2EZP A;  5HFL A;  3FB8 C;  1D2D A;  2ZIO A;  3SPI A;  3WFV A;  5KX5 A;  4PDR A;  2NR5 A;  2IJJ A;  1SA0 B;  2IU0 A;  1IVS A;  4P2Z A;  1KMI Z;  4EEQ A;  5DN6 G;  2VRZ A;  3BCC H;  5CA1 B;  4DR5 B;  1Z5W A;  2UUB B;  2ZIM A;  1PM9 A;  2YC0 A;  3ETG A;  4QPJ A;  5L3F A;  1Y67 A;  3UKM A;  2NNU A;  2ZNI A;  2IBZ H;  5BR8 B;  3HKB A;  3E22 A;  3E89 A;  2PTM A;  4LR3 A;  5EBW C;  3UT5 A;  4PEL A;  1Y76 B;  4CS4 A;  4FLY A;  1S0V A;  5LHG A;  2R72 A;  4DR4 O;  1OCZ B;  1ZUQ A;  4O4H A;  4MT8 A;  3JAW B;  5L3C A;  3I56 V;  3WB1 A;  2KQX A;  4J80 A;  5KAF Z;  3OMA B;  3AK1 A;  3ZMS A;  3L70 H;  4GX0 A;  4ZI7 B;  1VQ5 V;  2F95 B;  4UCS A;  2UU9 O;  2RN9 A;  2AHY A;  1SQB H;  2CTR A;  2XUM A;  5LL6 Y;  3K03 A;  2F4V B;  1YCI A;  4QGP A;  2ZIN A;  4I0X A;  1Q90 D;  2CTQ A;  4X89 A;  4X1I B;  3L9D A;  5BR8 O;  5KHG A;  2AXT Z;  1VP7 A;  5J2T B;  3ZJZ A;  5CBH A;  2OCC C;  4X20 A;  5H2F Z;  2DJV A;  3LSQ A;  5CB4 B;  4NTX A;  2Z0A A;  1A32 A;  1R3J C;  4X64 B;  1H38 A;  4OGQ B;  3CS5 A;  4L87 A;  4GCZ A;  4IYI A;  2CDY A;  3Q4H A;  1U96 A;  4EKW A;  4JPR A;  3ZRX A;  3TCU A;  1FD9 A;  1K97 A;  3HKC A;  1S3J A;  4YHH B;  5BMV A;  4DRX B;  4YJ2 A;  4I9Q A;  1Y6X A;  3HKC B;  3OGC C;  3OMN B;  1RSO B;  5JQG A;  4U7O A;  1HNW B;  2QM7 A;  1H2L A;  3R66 A;  3LDD A;  3VQV A;  2JS5 A;  4JAV A;  3AG4 B;  3T1Y O;  1THZ A;  1P4R A;  3E83 A;  4PI0 A;  1AP6 A;  1K7D A;  1R6K A;  2Q7H A;  3A0B Z;  3TGU H;  2HG5 C;  5JJN B;  2DE0 X;  2VS0 A;  2DWD C;  1HNZ O;  2F1M A;  2YEV B;  5LYJ A;  3RYF B;  3UQ8 A;  1EN4 A;  5B1A B;  3VQX A;  5BY1 A;  4LF8 O;  1V55 B;  3L74 H;  3X2Q B;  1SQF A;  1PL0 A;  3KKY A;  2VWJ A;  1K4C C;  1KKD A;  2QWN B;  4UV8 A;  2GTA A;  3SJB C;  4MVM A;  1PPJ H;  1N32 O;  3C90 A;  3FAV A;  1P7G A;  5EYP A;  4BWA A;  2F66 C;  1K8A W;  4O2A B;  2Y0I A;  3TET A;  4J11 A;  1VQK V;  2YUA A;  3K9A A;  1V54 B;  2OTJ V;  3QNE A;  2E3C A;  5KHH A;  3EHB B;  2WLI A;  2GUZ B;  3ASN B;  5LP6 A;  1VQP V;  3NR7 A;  2WSS G;  3K08 A;  1SQQ H;  4AQY O;  1R6T A;  4XDL A;  2LGQ A;  4JZG A;  1UJW B;  4PA6 A;  2DYR C;  4X9Q A;  4GZR B;  3D3I A;  2OT5 A;  4KXR A;  5JJJ B;  3L73 H;  1FXK C;  1WAZ A;  4GX1 A;  2WAM A;  1KKC A;  4GYC B;  4H0L B;  4U7N A;  5C93 A;  2JEU A;  2KSD A;  5JCO A;  4NTW A;  2RQ6 A;  3SPJ A;  4E2L A;  1YJW V;  3RYH B;  1R1B A;  2BTQ B;  5ITZ A;  2QGN A;  2PF4 E;  4PA4 A;  5CB4 A;  4O4H B;  5KHJ A;  1R6N A;  4AIL C;  5IYD O;  3CXH F;  1WB7 A;  1YDX A;  2EIK B;  3SYQ A;  4DR6 B;  3CHX A;  3CRC A;  2EJR A;  1NH2 D;  2UUC B;  1AVM A;  3W7T A;  2EIM B;  1NS1 A;  4MW8 A;  5GTI Z;  1TUE B;  1NT2 B;  4DRX A;  3SGI A;  3SJC C;  3QG5 A;  3ABU A;  4Q6G A;  4B3M O;  2JJ1 G;  1SQP H;  1V54 C;  2OCH A;  3DXR B;  1FAF A;  4LF5 O;  2UUA O;  3IFX A;  2LO1 A;  3GWK C;  1COW G;  2Y69 C;  4NXN O;  4D6T H;  3ZMZ A;  3KG2 A;  5FNV A;  2Z3Y A;  3OUS A;  2Y4T A;  3CEI A;  4NXN B;  4DV5 B;  4ZHQ B;  2EIN B;  1BSM A;  1P7B A;  1BMF G;  1R3L C;  4LF5 B;  2GTS A;  1ZLZ A;  1G1X B;  1GM7 A;  2F93 B;  2VQE B;  3RBZ A;  1MAB G;  4FLX A;  1KYO F;  2QJ1 A;  1NH2 B;  4LFA O;  4GT1 A;  3AG1 B;  4MSW C;  3VQY A;  1Q43 A;  1GRJ A;  1H2M A;  3N2G B;  1FS0 G;  1SF9 A;  1SQG A;  3OEH G;  1JCH A;  4NKG B;  3G6E V;  4R8C A;  1ZSP A;  4GLX A;  4O4J B;  1IXB A;  3G67 A;  4H37 A;  4F6R A;  4LBE C;  3ZHS A;  5H5N A;  4LF7 O;  1GH6 A;  1I94 B;  4CC6 A;  4PDM A;  5CA1 A;  1NVP D;  1H2G A;  1R73 A;  3H1H H;  1H2N A;  4FM2 A;  3QO8 A;  3CMA V;  5IYB O;  2LW7 A;  1GN3 A;  2CH7 B;  4LF9 O;  1Q6I A;  3C3S A;  3CCU V;  3RN4 A;  5K1P A;  5IWA O;  4O4I A;  2YIB A;  1FPO A;  5JCO C;  1N4C A;  1CEZ A;  3FB5 C;  1I5X A;  1MA1 A;  1QQC A;  4LNU A;  4DUY O;  4X65 B;  1K4D C;  4X62 O;  2UXB O;  4XDJ A;  4UVA A;  5L3E A;  3ASO C;  1R3K C;  2HVJ C;  1N32 B;  4KFM A;  2F43 G;  3BY6 A;  3CC7 V;  2CK3 G;  2LFR A;  4FJC C;  2R70 A;  3OFN G;  2X6A A;  2OCC B;  3LDC A;  1QCE A;  3Q4H B;  3A2F A;  1TUB A;  4JI8 B;  2JDI G;  3ZMU A;  5B1A C;  4UB8 Z;  2Q6A A;  3WB2 A;  2ZCE A;  4O4I B;  3K5M A;  2JRI A;  3JYC A;  3APQ A;  2ZE7 A;  4FZ1 A;  1YIJ V;  4FMT A;  2YIC A;  4JI1 O;  4NVP A;  4DXW A;  4ZOL B;  4YIP A;  5H9C A;  1XRE A;  3B8M A;  3D3Q A;  2YS8 A;  3FFQ A;  3K06 A;  4YJ3 A;  4YY3 B;  4ZI7 A;  5KMG A;  1QU7 A;  5E1A C;  2VQF O;  1L0L H;  2VWK A;  4BW5 A;  2P7T C;  4UCO A;  3ABK B;  5H6Q A;  4DO2 A;  3TJT A;  2EIL B;  2Q9L A;  3G4S V;  4MTF A;  1H2K A;  4TUY A;  1GK9 A;  1Q7Y W;  3EFF K;  4X1Y B;  3BA9 A;  3BEH A;  2UUA B;  2UXC B;  2A3Q A;  1AJQ A;  3CXC U;  1DF4 A;  2QKC A;  2YIB D;  3H9V A;  3CSX A;  1WPB A;  2E74 B;  3CCQ V;  4JI7 B;  4C7U A;  4U3J B;  3HKB B;  5IY5 C;  4O2B B;  3ABL C;  2PYJ A;  3JSL A;  5LXT B;  1RM1 B;  1J95 A;  2HVK C;  2XND G;  2QWO B;  4H44 B;  1BE3 H;  1V9P A;  1HP8 A;  4J42 A;  4O2A A;  5KMG B;  1AB3 A;  5IE9 A;  4JYA B;  4I55 A;  2QM8 A;  1MNG A;  2R9A A;  2N05 A;  2ZE8 A;  4OPH A;  1TA8 A;  1P49 A;  2EZO A;  2LW1 A;  2Y48 A;  4UVB A;  3B77 A;  2ZKO A;  1SZT A;  3UM7 A;  2ADQ B;  2WLH A;  3QTC A;  3U0Z A;  4DV4 B;  2WA3 A;  4B3T O;  1P84 F;  4LNU B;  1Q86 W;  3KCX A;  4B7E A;  4TV9 A;  1G6U A;  5IYC O;  4N21 A;  4GX5 A;  2AGA A;  4LP8 A;  4B3T B;  1W0J G;  1JVM A;  1Q3E A;  2P4V A;  1GN2 A;  3CE2 A;  4LFC O;  4QIW F;  3ZN1 A;  4W4L A;  4DR3 O;  1LUW A;  4DR2 B;  1NU1 H;  3JAR A;  5EZY A;  1NQT A;  2Q67 A;  1ORQ C;  3JD0 A;  1V55 C;  2XAQ A;  2CH7 A;  4FLT A;  1W59 A;  3LSU A;  1VQL V;  3M99 B;  1S77 D;  4O4L A;  3ZS8 C;  2W6I G;  4LCU C;  1OCC C;  2KG7 B;  1IBL B;  2OYQ A;  3CRR A;  3JD2 A;  1I0H A;  1BGY H;  3H1I H;  4AHC A;  4I50 B;  1VAR A;  3G6B A;  2CTP A;  2EIJ B;  1B04 A;  3DSQ A;  5F2V O;  1AR5 A;  1DTO A;  4WFA V;  1BCC H;  1PNK A;  5JH7 B;  3IJ4 A;  4LWS B;  2OIG A;  1VF6 C;  2BCC H;  2WLI B;  2YI8 A;  2CGN A;  4J9Z B;  1AIL A;  3CCR V;  2GSM B;  1M57 B;  4UFZ A;  2OWO A;  1K33 A;  1KP3 A;  3LUT B;  2LJ2 A;  3QO7 A;  2P90 A;  3RFR A;  3O9O A;  5CBF A;  3I5D A;  2DYR B;  3CCV V;  1QVG U;  1S76 D;  4J10 A;  4CH4 A;  4GKJ B;  1SA0 A;  5D5Q A;  2VQF B;  2RCV A;  1OV9 A;  3L71 H;  2ZXW C;  1I7F A;  4YY3 O;  4ZHQ A;  4ASU G;  3RYC B;  1DLB A;  3K5N A;  2BTO A;  3T4D A;  3HR0 A;  4OX9 O;  3F5W C;  1R3I C;  4JI0 O;  3JAW A;  1OJH A;  3W7S A;  1K73 W;  5BZB A;  1SZX A;  3ABM B;  3N2K B;  5IYZ A;  3W7U A;  2YSU B;  1URF A;  5AG2 A;  4X1K A;  1XMQ O;  3AG1 C;  2ILM A;  3P30 A;  1DF5 A;  4JI5 B;  1OCO B;  4X1K B;  1YVW A;  5EIB D;  3UT5 B;  3EVK A;  1Y76 A;  1YJ9 V;  3K04 A;  4X64 O;  2Q4P A;  2Y4U A;  4WCE V;  3RGB A;  2UXB B;  2WLM A;  1QNM A;  3J7A U;  5IT9 N;  4X65 O;  2AZ0 A;  4J41 A;  3F7Y C;  4FZ0 A;  4I4T B;  1VQ9 V;  2LP7 A;  1Q8I A;  3HKE A;  1N0N A;  1NI8 A;  4ZIB A;  4WF9 V;  4H13 B;  2Z5U A;  3G80 A;  2DQ3 A;  4I4T A;  4ZOL A;  4IHJ B;  5LMU O;  3ZIA G;  3OEE G;  1HDJ A;  4D7T A;  1FYJ A;  2H3O A;  3R65 A;  4LF4 B;  3CCE V;  2QM4 A;  1N36 O;  4JTC B;  2P22 C;  1WP7 A;  4JI4 B;  4JTD B;  1ZTE A;  3MDS A;  3OMI B;  2ZDI A;  5FPR A;  1W2B U;  1BHA A;  1XNQ B;  1AJP A;  1NR1 A;  1LR1 A;  5J2U A;  1I94 O;  3P32 A;  4WBN B;  3ABT A;  4MVS A;  3CCJ V;  1D5A A;  1ZL8 A;  1WP8 A;  1KB9 F;  1XOU A;  3AG7 A;  2L6L A;  4JAS A;  2HEP A;  4DUZ B;  4WFB V;  3MHS C;  3BFR A;  1BS3 A;  3M8A A;  4MS2 A;  3STZ C;  3JAR B;  2IH3 C;  3DC5 A;  4IHJ A;  2A0L A;  2QWR B;  2ZT9 B;  1VQ6 V;  1YTF B;  3JD4 A;  1K9M W;  1NZ6 A;  1S5J A;  1TAE A;  1IZ3 A;  3QO5 A;  1D5N A;  3ZHR A;  4I7Z B;  2GHY A;  4PHZ A;  4X8A A;  3L75 H;  2ATK C;  3OTF A;  4HAM A;  5CA0 A;  3CD6 V;  2YI9 A;  1CP9 A;  5EBL C;  2CAZ C;  4K8Z A;  2VQE O;  4RUE A;  3WU2 Z;  4F6R B;  3APO A;  3GWO A;  4X20 B;  2O57 A;  4FK5 C;  4O2B A;  2FTK A;  2UUC O;  1B6Q A;  3OE7 G;  1Q81 W;  3CME V;  2ZQM A;  2DYS C;  4B3S O;  3H1K H;  3RVZ A;  1YF2 A;  1XHZ A;  4N23 A;  5BMV B;  3WG7 B;  2QKA A;  1PL4 A;  4NYK A;  4HNA B;  1Z2G A;  1SC5 B;  4ZKI A;  5B1N A;  5LOV A;  1ENV A;  5C8Y B;  2YDE A;  1FFX A;  2HR3 A;  5KUK A;  1PNM A;  3WG7 C;  4EB6 B;  4TV9 B;  4UUJ C;  4IYH A; 
#chains in the Genus database with same CATH homology
 2EIN C;  1FXK B;  3CC4 V;  2EIM C;  4UVA A;  4XDJ A;  5L3E A;  3ABL B;  1NKD A;  2IW5 A;  3K79 A;  3ASO C;  3LDE A;  2AHZ A;  1R3K C;  1NVP B;  1H8H G;  3AG3 C;  2B1I A;  4PDV A;  2HVJ C;  1FXH A;  4KFM A;  2F43 G;  3BY6 A;  1QVF U;  5LGU A;  1GM9 A;  4JYC A;  4RQF A;  3CC7 V;  3ZRW B;  2CK3 G;  2IU3 A;  4Z1M G;  2LFR A;  4FJC C;  4UXN A;  3OFN G;  2X6A A;  2XOK G;  2EIJ C;  2OCC B;  3LDC A;  4R50 A;  3DTU B;  1QCE A;  1W0K G;  1QLE B;  2JDI G;  3IC7 A;  4G2K A;  1M9N A;  3ZMU A;  5KA5 A;  5B1A C;  2DW4 A;  1VQO V;  2ITC C;  3HB3 B;  2Q6A A;  2HJF C;  2QE7 G;  3JYC A;  1NR7 A;  1OZ0 A;  3H01 A;  4RAI A;  4HYO A;  4FMT A;  1EBO A;  1YIJ V;  2NLJ C;  3ZCC A;  4DXW A;  1RPR A;  1K34 A;  1QLE C;  5CA3 A;  2W0F C;  2QA4 V;  1CPY A;  3CP1 A;  1YIT V;  5H9C A;  4MVO A;  1M56 B;  4Q20 A;  3B8M A;  5GW7 A;  1F4M A;  1MOF A;  3K06 A;  3W7W A;  2OTL V;  1MSW D;  5B1B C;  4ZBM A;  2H8P C;  5HFM A;  1VQN V;  2QEX V;  4GX2 A;  1L1F A;  5E1A C;  1QBZ A;  2EZP A;  5HFL A;  2W6J G;  3RVY A;  3FB8 C;  3SPI A;  4BW5 A;  1OCR C;  2P7T C;  5B3S B;  2PI4 A;  3WFV A;  3ABK B;  5H6Q A;  4WFE A;  3VOU A;  4PDR A;  4DO2 A;  4BIU A;  1OCZ C;  2IJJ A;  2ZD9 A;  2EIL B;  2IU0 A;  3G4S V;  4P2Z A;  1I5Y A;  1G4Y B;  1OCR B;  4QPK A;  5DN6 G;  4MTF A;  1GK9 A;  3PJS K;  1M1K W;  1Q7Y W;  1JX9 A;  3EFF K;  3ETG A;  4QPJ A;  1Q82 W;  5B1B B;  1G8M A;  5L3F A;  3UKM A;  3BEH A;  2NNU A;  2BOC C;  2ZXW B;  1AJQ A;  3CXC U;  1DF4 A;  2JJ2 G;  4WFG A;  4QJF B;  1KEC A;  3E89 A;  3CCQ V;  5EBW C;  2XAJ A;  4PEL A;  3E8G A;  1S0V A;  4PA7 A;  5LHG A;  1NJI W;  4JYB A;  1OCZ B;  5IY5 C;  1ROP A;  4MT8 A;  2X6C A;  3ABL C;  3SPH A;  3K3W A;  5EK0 A;  5LHH A;  2EIK C;  5L3C A;  1RM1 B;  3I56 V;  1J95 A;  1M57 C;  5LHI A;  3CYO A;  2HVK C;  3SYA A;  3OMA B;  3TK1 A;  2XND G;  2XAS A;  2ZR3 A;  4XBF A;  3ZMS A;  4GX0 A;  5L3B A;  5CN0 A;  1VQ5 V;  3IGA C;  2QM8 A;  2WLK A;  2WLL B;  3LSS A;  3K0G A;  2AHY A;  1VQ8 V;  2EZO A;  2Y48 A;  4UVB A;  4XDK A;  2P67 A;  3B77 A;  3T1C A;  1SZT A;  3K03 A;  2WLL A;  3UM7 A;  1NBM G;  2WLH A;  2A79 B;  5KA6 A;  1YJN V;  2C2A A;  4X89 A;  2ZDI C;  1SER A;  1Q86 W;  4FPP A;  1HWY A;  4P9P A;  5IYC O;  2K1E A;  4N21 A;  4GX5 A;  1E79 G;  4LP8 A;  1AI4 A;  1W0J G;  1WLE A;  1JVM A;  2WWW A;  3VBB A;  3FYI B;  1KQS U;  4QIW F;  3ZN1 A;  3ZJZ A;  5CBH A;  2OCC C;  3LSQ A;  2X6B A;  4R7C A;  3AEI A;  4JGS A;  1R3J C;  2JK5 C;  2B5U A;  3DGE A;  1YSC A;  2Q68 A;  2V7Q G;  1H38 A;  4CBC A;  1NQT A;  2Q67 A;  1ORQ C;  1QR8 A;  3JD0 A;  1V55 C;  4L87 A;  2XAQ A;  4JTA B;  4TT3 G;  4GCZ A;  1VQL V;  3M99 B;  1S77 D;  1PNL A;  5L3D A;  2W6I G;  4EKW A;  4LCU C;  4JPR A;  3ZRX A;  3TCU A;  1OCC C;  1K97 A;  1S3J A;  5IDJ A;  3GB7 C;  3JD2 A;  3OR7 C;  4YXW G;  3SYC A;  2H94 A;  3OGC C;  3ZRW A;  3OMN B;  5CBG A;  2EIJ B;  4CZZ A;  1KD1 W;  3HPL C;  1DTO A;  4MVZ A;  1GMG A;  4WFA V;  4U7O A;  1KP2 A;  4OXS A;  1GTO A;  2XAF A;  1AI7 A;  1GKF A;  2QM7 A;  4I9W A;  3CCL V;  3LDD A;  1PNK A;  1S5H C;  3FB6 C;  1LNQ A;  4PA9 A;  3X2Q C;  3CCM V;  2WPD G;  4KUM A;  2XAG A;  2WLI B;  1FXK A;  2M7W A;  3AG4 B;  2KB1 A;  4JAV A;  1THZ A;  4F4L A;  3CCR V;  1WPX A;  4J9Z B;  1P4R A;  1M57 B;  2GSM B;  3E83 A;  1K33 A;  1JOY A;  1K7D A;  1KP3 A;  1R6K A;  4TSF G;  3LUT B;  3QO7 A;  2P90 A;  3W7X A;  2HG5 C;  5J9P C;  3E8F A;  5CBF A;  4LC1 A;  2DYR B;  3CCV V;  1QVG U;  3ETD A;  4H33 A;  2DWD C;  1S76 D;  2YEV B;  5LGN A;  2ZXW C;  5B1A B;  2WLJ A;  1MG1 A;  1V55 B;  4WFF A;  4ASU G;  1AI6 A;  2YEV A;  3X2Q B;  1M90 W;  1DLB A;  1OCO C;  1PL0 A;  3T4D A;  1K4C C;  1KKD A;  1EZJ A;  3E86 A;  5EC1 C;  3F5W C;  1R3I C;  4UV8 A;  3AG2 B;  3W7S A;  1K73 W;  3OUF A;  4MVM A;  5BZB A;  4MTO A;  2DQ0 A;  1OHH G;  1S72 V;  3LNM B;  3ABM B;  4MVU A;  1N8R W;  3W7U A;  1K8A W;  3ASO B;  3OR6 C;  4MVQ A;  5IY5 B;  2YSU B;  3TET A;  5B1O A;  1VQK V;  2ZR2 A;  2UXX A;  3ML0 A;  3K9A A;  3ZRS A;  3AG2 C;  3AG1 C;  3B8N A;  1V54 B;  2OTJ V;  3QNE A;  4MTX A;  3P30 A;  3EHB B;  1DF5 A;  2WLI A;  1OCO B;  1VQM V;  1SET A;  3ASN B;  4UVC A;  1AI5 A;  4BIZ A;  1VQP V;  2WSS G;  5LBQ A;  1QLN A;  2P6J A;  3K08 A;  3OW2 U;  1YJ9 V;  3K04 A;  2HKO A;  4XDL A;  3CPW U;  2DWE C;  2X7R B;  1UJW B;  4PA6 A;  1VQ4 V;  2DYR C;  4WCE V;  2WLM A;  3D3I A;  2B1G A;  2OT5 A;  3T2M A;  1RM1 C;  1FFT B;  3SPC A;  1FXK C;  4GX1 A;  3F7Y C;  2WAM A;  5CMU A;  4P9O A;  4U7N A;  4X88 A;  1VQ9 V;  1F4N A;  5C93 A;  2LP7 A;  2JEU A;  3E8B A;  3SPJ A;  4E2L A;  4WF9 V;  1YJW V;  2Z5U A;  1KC8 W;  2IJI A;  2DQ3 A;  2V1D A;  3ZIA G;  3OEE G;  4JAU A;  4PA4 A;  3T4Z A;  3JD3 A;  2MK3 A;  1ARO P;  2JEX A;  1R6N A;  3R65 A;  3I55 V;  3CCE V;  1AJN A;  5IYD O;  4JTC B;  4JF3 A;  4MTG A;  3JCZ A;  2EIK B;  1GO3 F;  3SYQ A;  4JTD B;  2EIL C;  4WFH A;  1BL8 A;  1F23 A;  2EJR A;  1NH2 D;  2PI5 A;  2IJK A;  3FKS G;  1JPX A;  3ZN0 A;  3OMI B;  2EIM B;  3W7T A;  4MW8 A;  2ZDI A;  3MHH C;  1TUE B;  1W2B U;  2R9I A;  1RPO A;  1GM8 A;  3ZMT A;  1BHA A;  3FYE B;  1AJP A;  1NR1 A;  3JD1 A;  1IXM A;  4MVR A;  3ABU A;  3P32 A;  2R9R B;  4MW3 A;  4FIP C;  2QKS A;  2JJ1 G;  1JJ2 U;  3ABT A;  4MVS A;  1K5Q A;  1V54 C;  3CCJ V;  2Q69 A;  1XL6 A;  2QTO A;  3SJQ C;  2D3O W;  2BOB C;  1E1R G;  3IFX A;  1SES A;  2IH1 C;  3STL C;  4JAS A;  1VQ7 V;  5EBM C;  1XL4 A;  1COW G;  3RW0 A;  2XAH A;  3SYO A;  2ITD C;  2Y69 C;  3ABM C;  4QE7 A;  4WFB V;  3ZMZ A;  3KG2 A;  2Z3Y A;  2LFS A;  3MHS C;  3OUS A;  5DM6 V;  1F51 A;  5KUM A;  4KP4 A;  3ABK C;  2EIN B;  2A9H A;  4MS2 A;  3STZ C;  1P7B A;  3E2E A;  1BMF G;  1R3L C;  3OAA G;  3FB7 C;  2IH3 C;  2A0L A;  5L3G A;  1GM7 A;  4PDL A;  4PA3 A;  3CC2 V;  3D36 A;  4J9Y B;  3SPG A;  3RBZ A;  1MAB G;  1VQ6 V;  1YTF B;  5LGT A;  3ETE A;  4G27 B;  1FXV A;  4RUF A;  4UV9 A;  3JD4 A;  1NH2 B;  1K9M W;  4GT1 A;  3A0R A;  2UXN A;  3AG1 B;  4MSW C;  3QO5 A;  2Y69 B;  2IJH A;  1FS0 G;  3G71 V;  2GHY A;  5B3S C;  3K0D A;  3F7V C;  3MD0 A;  4X8A A;  2ATK C;  3OEH G;  1JCH A;  3G6E V;  4R8C A;  5FL7 G;  4BAY A;  4HAM A;  4H37 A;  3ASN C;  4LBE C;  3CD6 V;  1CP9 A;  4R6Z A;  5EBL C;  4QNH B;  4PDM A;  1K92 A;  3ZMV A;  4RUE A;  2WLN A;  1NVP D;  5H6R A;  1E1Q G;  1H2G A;  1R73 A;  3GWO A;  1EFR G;  3AG3 B;  1H8E G;  4P30 A;  4FK5 C;  1Y66 A;  2FTK A;  1B6Q A;  1YHQ V;  3OE7 G;  1K3E A;  3OM3 B;  3QO8 A;  3CMA V;  1YI2 V;  1QR9 A;  5IYB O;  3CME V;  2ZQM A;  2DYS C;  1PKX A;  3E35 A;  1JQ0 A;  4I5S A;  1Q81 W;  3CCU V;  1OCC B;  3RVZ A;  2HFE C;  2HLD G;  4RQE A;  1ZWI C;  3CCS V;  5EC2 C;  1PD3 A;  2DYS B;  4N23 A;  3WG7 B;  2JIZ G;  1SRY A;  1YTF D;  1AR1 B;  1BHB A;  1Y4M A;  1CEZ A;  2X0L A;  4ZKI A;  3FB5 C;  3ZRV A;  3AG4 C;  5B1N A;  1I5X A;  4RO2 A;  1ENV A;  3E8H A;  1K5S A;  2EBO A;  1M56 C;  4QE9 A;  4HZ3 A;  2HR3 A;  5KUK A;  1PNM A;  3SYP A;  4TWK A;  4G28 B;  3WG7 C;  3NXS A;  1K4D C;  4UUJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...