2IJYA

Nmr structure ensemble for the reduced dsba disulphide oxidoreductase from vibrio cholerae
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
181
structure length
181
Chain Sequence
AQFKEGEHYQVLKTPASSSPVVSEFFSFYCPHCNTFEPIIAQLKQQLPEGAKFQKNHVSFMGGNMGQAMSKAYATMIALEVEDKMVPVMFNRIHTLRKPPKDEQELRQIFLDEGIDAAKFDAAYNGFAVDSMVRRFDKQFQDSGLTGVPAVVVNNRYLVQGQSAKSLDEYFDLVNYLLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the Flexibility of the DsbA Oxidoreductase from Vibrio cholerae-a (15)N - (1)H Heteronuclear NMR Relaxation Analysis of Oxidized and Reduced Forms of DsbA.
pubmed doi rcsb
molecule keywords Thiol:disulfide interchange protein dsbA
molecule tags Oxidoreductase
source organism Vibrio cholerae
total genus 50
structure length 181
sequence length 181
ec nomenclature ec 1.8.4.2: Protein-disulfide reductase (glutathione).
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ijyA00
1SL1B 2H1GA 1TJDA 5DCHA 1YEXA 1SK2A 2LEGA 4JZQA 3DRNA 3HVXA 3Q74A 1BYEA 1SENA 4MH3A 2QKEA 2I4AA 2FHEA 4XHMA 5AN1A 1AC1A 5JCGA 2R6KA 4ZBAA 2IIYA 1RW1A 1EGOA 1OC9B 1M9BA 3WGEA 2HLSA 4XRAA 2M46A 1MEKA 3LG6A 4I6XA 1OAZA 4N10A 4WXTA 1O6JA 3W6GA 3CRUA 2VCQA 2O7KA 4NV2A 2LJAA 1SU9A 4NPBA 1GRXA 1HNBA 4ML1A 1K0BA 3EWLA 10GSA 2I9HA 4IP1A 3ERGA 3TJGA 5KN1A 1SK0A 2VL3A 2EIRA 3MWHA 2HZEA 1EOGA 1WJKA 4ZBDA 2AV4A 2H6XA 1PX7A 3KM6A 4KB3A 4I8BA 1AQXA 3LYKA 2VCWA 3DD3A 3IC4A 1WOUA 1OE8A 2JL4A 3F3RA 1EGRA 3GL3A 3ED3A 3HJOA 3TKSE 3FR9A 2CZ3A 1EZKA 2H0GA 1J9BA 1PA3A 2YV7A 3I6AA 5IMFA 9GSSA 4QQ7A 5ECMB 1F3AA 2B1LA 1NW2A 5IQYA 2V32A 4BL7A 5F0GA 1GSDA 2FD3A 2XBIA 2DJKA 4HQSA 3IBHA 2YOIA 1MD4A 2LJRA 1JLWA 4LL4B 1R7HA 2R37A 3HDCA 4RQRA 3QAWA 17GSA 3F3QA 4MJAA 4IBPA 4BVYA 3F4SA 4YQUA 1X5CA 2L6DA 2IFQA 1V40A 3GKNA 3IR4A 3PR8A 2K9FA 4H86A 2PERA 3ZZXA 3U6VA 4J2FA 2IMKA 2OJLA 4FO5A 2IJYA 4PURA 2NVLA 3J7Yk 2GZPA 5HR0A 3EMPA 4JR6A 3HZ8A 4V1Ap 2YJHA 4OFMA 3VI7A 5E4WA 3VURA 1N2AA 4XS4B 4YH2A 3LEFA 3GX8A 5INYA 2LS5A 4NV5A 1E2YA 1TRUA 1MDKA 2DIZA 3LXZA 5EVOA 2GS3A 5D8IA 4I5QA 3ZITA 5F8BA 5HFKA 4HS1A 4F0CA 1XWCA 1SJIA 1TRSA 6GSSA 2HZFA 2DJ3A 3HYPA 3BOAA 4IELA 3TB2A 4ZL8A 3CMIA 2RM6A 4HJMA 1PRXA 3FK8A 2FCHA 4E8HA 2PMTA 4TR3A 1ZOFA 4V2MA 2DJ1A 5DAKB 1T1VA 2FUG2 4TN8A 1YJ6A 1GNEA 4K0NA 4J57E 1B9YC 6GSYA 1QMVA 3F6DA 1F6MC 1TW9A 4IKHA 1VF3A 3TJFA 1YZXA 4X43A 2QC7A 3TJBA 4DSSA 1JHBA 1XPVA 5D9TA 4POKA 5IM9A 5D9WA 2YWOA 1M9AA 3IHQA 1XFLA 2L4CA 3F9UA 4KGIA 3EURA 3JCML 4TR1B 1M2DA 3BBYA 1EV9A 4JR4A 3TRPA 4CHSA 3BJ5A 1OC8A 4IGJA 2VUPA 1OC9A 4CW9A 2F3MA 4HUAA 2CV4A 4MPFA 1E6BA 1FHEA 3L9SA 3UAPA 2FA4A 2JZSA 1BJXA 2VL2C 4P3YB 4FIWA 4GCIA 2F8AA 5B6MA 3E3EA 3TJJA 4N0ZA 2RUEA 2VAFA 4MABA 4HOJA 5JWOB 3TRQA 1A8YA 3IOSA 4Q5QA 5F05A 3VPTA 1SJ6A 1S3AA 1F3BA 4TR0A 1HNCA 3F63A 4JE1A 4MA9A 3M9JA 2VCZA 1ML6A 3FY7A 2PUKC 1JLVA 3A3TA 4WF5A 4NXIA 2LQOA 5ECLB 3ZIJA 1PD21 4KAEA 2QGVA 1FAAA 4N0VA 4E8EA 3CSJA 2B6MA 1M2BA 5AIXA 3DVWA 2VM1A 4J56E 1GTBA 5HFIA 4NAXA 5IMZA 2GT5A 3KMNA 4KDYA 2AUVA 3G9BA 1XOBA 3ZFBA 3CYNA 5LD0A 2XPDA 2C80A 1UC7A 1Z3EA 3DEXA 1G7OA 3P2AA 2E7PA 4ILFA 2F8FA 2GLRA 1Y25A 5A5KA 3EINA 3K8NA 1ZGNA 1ILOA 12GSA 1WMJA 5B8BA 4ML6A 4MJBA 1BX9A 2C4JA 3L9UA 2FWGA 5B7CA 4IQAA 3MDKA 3VWVA 3AY8A 3IAM2 2H0IA 1Z7PA 1B4PA 13GSA 3IV4A 2BTOT 5A4UA 4KA0A 4N30A 1GUHA 3ZLPA 3GX0A 5HR2A 2C8UA 1GTIA 4K6XA 4PX1A 4EKZA 1K0OA 1GNWA 5FT3A 2GZZA 3FZ5A 3M9KA 4EE0A 3TKQA 1TU7A 2CA8A 1GLPA 4EO3A 4XS4A 2B3SA 20GSA 2YANA 1R5PA 3HKRA 2GSQA 1VF2A 1K0NA 4BWSA 4IQ1A 2WB9A 1O85A 5IMVA 4MDCA 3HVVA 5CP1A 1B4QA 1EP8A 3ERFA 2HNLA 4ULXA 2PPTA 1QFNA 4L5OA 2MMOA 2MMNA 3C1SA 2LKUA 1VF1A 4L0WA 2HFDA 1SKWB 4MPGA 4MMMA 1VRSD 5DAKA 2E0QA 1T00A 1YY7A 1MDIA 2CVDA 1O8WA 3CRTA 1SYXA 1DSBA 3UARA 1HQOA 1A8LA 2CX4A 2H30A 5F06A 4HZ2A 1XVQA 2MMZA 2NTOA 5CRWA 3APSA 1OE7A 1NHYA 2K6VA 4TW5A 3UBLA 2IMFA 3LFLA 2LNSA 2N5AA 3MSZA 2OE0A 1T4YA 3D22A 1K0AA 4EDYA 3WT2A 1Z5YE 4TR1A 2LJKA 3FRCA 3BCIA 2OADA 1AAZA 2NPBA 1FB6A 2JSZA 2PN8A 1U3AA 4HI7A 2OE1A 4BPYA 4GF0A 4WF4A 4L8EA 4RI7A 3FR6A 1SKRB 4XS6A 5CRHA 2DC5A 3J7Yb 1F9MA 4F9ZA 5IMAA 1V9WA 1TOFA 2Z9SA 1H75A 2VLTA 4YQVA 2YWNA 2AB6A 3HCZA 1Z6NA 2A2SA 1GLQA 2WZ9A 1BG5A 1ABAA 4MLYA 3UBKA 4V1Ag 3GA4A 3C7MA 4ZB8A 1GSEA 3QCPA 1V58A 2DSAA 2H8LA 8GSSA 5ECPB 3HZ4A 2KLXA 3ZYWA 4XS1A 2RIIA 1ON4A 5ENUA 2B7KA 4K7NA 3D5JA 3FW2A 1EEJA 4K7OA 4L5LA 3RPPA 4K1FA 1O81A 1KEBA 2CT6A 2O87A 4PGTA 5ECKB 1QK8A 3APQA 1TU8A 3I9V2 4RUVA 1WPIA 3GKMA 5J4UA 1SL0B 3G7YA 3LGCA 2FLSA 1XVWA 1T3BA 1M0UA 3UL3A 1G6WA 1HNAA 3LYPA 1XW6A 3CBUA 3KZQA 5F07A 1PSQA 3TOTA 2B5XA 1PL2A 2ZNMA 4MF7A 5CRGA 3WT1A 1EOHA 2HT9A 4OCFA 4AF2A 4XIHA 4POLA 2XPEA 1KTEA 4NWYA 3F6FA 1ZYQB 1PX6A 3HA9A 4DVCA 1X9MB 1SJZA 4F0BA 4PUAA 2R5GA 2R4VA 1J0FA 3A2VA 1HYUA 1VGLA 4V2LA 4K2DA 5ELAA 3QAGA 2GSRA 3EYTA 5FHIA 1R5AA 2L4QA 3M1GA 4TR4A 2RM5A 4EDZA 1O8XA 3KP9A 5G2ZA 4XCSA 1WIKA 1M99A 4IW9A 1JZWA 2H1BA 1GH2A 1XXUA 6GSVA 1XCCA 4EC0A 3ZFLA 2LNTA 2DLXA 2P31A 2B1KA 3DKSA 5ECSA 1MTCA 1G0TA 3ZREA 2H71A 3ERWA 4N11A 1M7TA 3L0HA 3PINA 3PH9A 3IPZA 4CDOA 2CVBA 1GUKA 4DSRA 3OR5A 3QOUA 3SBCA 4GLTA 1V2AA 4PUFC 4F2IA 2M80A 1GTAA 5ECIB 3QPMA 1FVKA 1YKAA 2MBTA 1W4VA 2LRTA 4GSTA 2GSTA 2YPMA 3KGKA 1MD3A 2CQ9A 4KUNA 1QQ2A 2GZYA 4OMVA 1X5DA 1AW9A 4IJIA 5ECQB 2H75A 3H8QA 5ELGA 1OYJA 1DE1A 4ZBBA 2FA8A 4FYBA 4KNDA 5HFGA 3GH9A 3H4KA 4KCEA 3FHKA 5CRDA 2J9HA 2OKAA 4WKWA 3G7JA 4YAPA 4ZL7A 2GTUA 4QL9A 1UN2A 3A2XA 2GT6A 4KDUA 2PVOC 1K0CA 2JACA 5AISA 3O76A 1TXXA 2RLIA 5G30A 5GSTA 5KN3A 5IOWA 4QL7A 2VLUA 2IWTA 1S3DA 5GSSA 1A0FA 5GAPD 3ZL5A 5G5EA 2YWIA 2JZRA 1KBNA 3VPQA 1TK8B 2ALBA 2YZUA 4MF6A 5ECOB 3IA1A 3QMXA 5D96A 4X1UA 3ZVJA 5J9CA 3ZTLA 4KCAA 2IMIA 1WP0A 1ERVA 2JADA 1FO5A 3FEUA 1GSYA 1LBKA 2B7JA 4L0UA 1QGVA 3TJKA 5DJMA 4G9HA 1ERUA 4FYCA 3F8UA 1AUCA 1GSFA 2ZCTA 3RBTA 2HSYA 4K0GA 1TTZA 2CAIA 2OACA 1OVNA 1OKDA 3IRAA 3WGDA 2C0DA 4WEYA 2JU5A 3NIVA 2PBJA 5G31A 3VLNA 1YEPA 4KDXA 1PKZA 1SKSB 4MH2A 1TDIA 5IPGA 3GYKA 2F51A 3D21A 3M8NA 5IO0A 5H5QA 1V98A 2WGRA 4F03A 2OA7A 1NHOA 3V1WA 3GTUB 3TKSA 2GVPA 4ZB9A 4IHUA 3US3A 1SK1A 3GKKA 3I69A 2H72A 4IVFA 2V2GA 3H79A 3DGQA 4DEJA 3D4MA 4OO5A 1K3YA 4HDEA 4KW6A 3VFIA 3GL5A 3CTGA 4HQZA 3GHAA 2DJ2A 1YDKA 2NBSA 3RHBA 1UA5A 3VWUA 4ZIJA 5FWGA 5EL8A 1B9XC 3UJ1A 3WYWA 1BAYA 1R26A 2ON5A 3EU4A 2C0EA 2HXKA 2MMAA 1XWKA 1DBYA 4OCEA 4ECJA 2O8VB 1ZMAA 3PGTA 4G2EA 2CAQA 3ZMKA 2LTKA 4GWRA 3ZRDA 4PQ1A 1V57A 5B8AA 2VL9A 3DMLA 3NOFA 4PNGA 5IMCA 4JBBA 2H73A 3LSZA 1T7PB 2VIMA 1XOAA 4PQHA 3KMOA 1N8JA 4PXOA 3GN3A 2C3TA 4KH7A 2AHEA 1THOA 3GIXA 2M72A 2F9SA 2X64A 3RPNA 2N5BA 5COHA 5GAND 1AIUA 1WRYA 3IAS2 4RQXA 5AIVA 3LORA 1FOVA 2FGXA 19GSA 3CSHA 3G7IA 1A0RP 1CQHA 3LJRA 4MP4A 4BA7A 2GGTA 1S3CA 2L57A 4KSOA 4RI6A 3I43A 1GSUA 1JZDA 1PN9A 2A2RA 4ECCA 4Z7XA 2WRTA 2TIRA 1SL2B 1TI3A 3A2WA 2GSSA 3WD6A 2G2QA 1XWGA 4MCUA 6GSWA 6GSXA 1K3OA 2LV3A 3UMAA 3FKFA 1A23A 2WS2A 1RK4A 4TXOB 4Q5NA 5JCWA 1NSWA 4HJ2A 1ZL9A 3FYGA 1TP9A 3FZ4A 3HJPA 4O7HA 2DMLA 2HE3A 4LA1A 2WDUA 2VO4A 4NMUA 4LL1B 2HRFA 3O3TA 3SWLA 1EV4A 3GMFA 4POMA 2VD1A 4I2UA 4O32A 2H0HA 4EVMA 2TRCP 5D93A 3H93A 1ERWA 2ZUPA 1B48A 4GTUA 2OBKA 1LJRA 4ZXGA 1ST9A 5HR1A 4MJEA 2LQQA 1ZYEA 3GSSA 3TKPA 1GTUA 4GSNA 1AQVA 2XBQA 3N5OA 3KEBA 2L5LA 1B8XA 1THXA 2HSHA 5KN0A 5CNWA 3KXOA 1NM3A 3UEMA 14GSA 2H19A 4GXZA 1A24A 1FVJA 2WCIA 1GWCA 2XHFA 4GQFA 3D6IA 1QXHA 2H70A 1ZCPA 1ACVA 4PNFA 2GQLA 1T8EB 1Z7RA 5A4WA 1YKCA 3KIJA 3IK7A 2CZ2A 2H66A 1JZRA 2YCDA 3IDVA 1HD2A 4BWQA 2IN3A 1SD9A 3M0FA 3UIWA 3HHVA 1IYIA 3TRXA 5IO2A 2WJUA 3LXTA 4JU5A 1PGTA 2JSYA 1AXDA 1X9WB 1MDJA 2VCTA 3GTUA 6GSTA 1GULA 2BMXA 2N5FA 4NHWA 4IN0A 2KP2A 3TCOA 1GP1A 5EY6A 1XBSA 3UVTA 1TK0B 1KNGA 4ECIA 1A2LA 4F82A 1EP7A 4V2NA 2IL3A 1Y6EA 3RDWA 4EF0A 4WETA 5B6NA 5IPHA 2DMMA 1QUWA 3KH9A 3E9JB 3CTFA 5J3RA 5L71A 1U87A 3TDGA 3ME8A 3D4TA 2O89A 1XWAA 5DDLA 2P5RA 5ABRA 1I5GA 3HXSA 3MNGA 3DVXA 3BCKA 1URMA 2KOKA 3R2QA 1OKTA 2OE3A 5DQSA 5J41A 4MZCA 2I1UA 5D9VA 1M2AA 3LWAA 5GZZB 1XW9A 3E0UA 2G0FA 4D73B 4BVXA 2OBIA 5DCGA 1K3LA 3ZVJD 1TRVA 3VWXA 2QSIA 2RUFA 2HI7A 3GURA 2YWMA 3L9VA 2PVQA 2WFCA 5JWQB 1USBA 1YF1A 3GUSA 4I2TA 4PQIA 3KTBA 4I97A 22GSA 5IIZA 3A5WA 1ERTA 1SD8A 2KHPA 4TVEA 2B5YA 3O6TA 2V6OA 5HR3A 5EPFA 2GQMA 1PKWA 1DUGA 1GSQA 4POBA 3FZ9A 1O73A 4ID0A 3N9JA 3KH7A 4TXOA 1A2MA 1Z9HA 1JZOA 4IJ3A 3W8SA 2B5EA 4ZILA 2XC2A 3F4TA 2C0FA 2CVKA 1K0DA 18GSA 3ISOA 3GV1A 4GQCA 2X8CA 3L78A 2DBCA 5G5FA 4MF5A 4OFNA 3NZNA 4OD7A 1Q98A 2ES7A 3P90A 5ID2A 3QD9A 5C04A 3LQ7A 1LU4A 3H1NA 2FNOA 3P7XA 2E2MA 1U88A 1U3IA 1W89A 2L6CA 4HU9A 5DBQA 2VL2A 3GFKA 5IOXA 4LMWA 2FWEA 3DIEA 3Q19A 1FG4A 2KP1A 2ON7A 3IXRA 1F2EA 3KD0A 6GSUA 2HYXA 4LMVA 3CSIA 3MAKA 2YZHA 5DALB 4EUYA 3D0ZA 3FR3A 2PU9C 5AGYA 2L59A 3DYRA 1BQ7A 1RQMA 4MK3A 4ECBA 3C71A 4IS0A 4K7IA 3P8WA 4MZWA 1T4ZA 2K8VA 1EEMA 2FWFA 3GKXA 1I9DA 3WGXA 4ACSA 1WWJA 4KE3A 5G1LA 1J08A 2C1YA 2C3NA 2J23A 2YP6A 4TXVA 4TOPA 1U6TA 4AJ7A 4YAVA 5KN2A 2MZCA 4O92A 1ZZYA 3C8EA 3KCMA 3ZIVA 3EMXA 5CREA 3IE3A 4ISDA 3ZMLA 3U5RE 3GH6A 2FY6A 3F4RA 2IMDA 2MBSA 5JCUA 3TGZA 2AYTA 3W8JA 4EL1A 2V41A 3TKRA 4MJCA 3VWWA 5H5RA 4HZ4A 4G19A 3BD2A 5D73A 3FZAA 1K0MA 4GSSA 3M3MA 1YQ1A 2YV9A 1XIYA 2IMEA 5KEJA 2VCVA 2VM2A 4WR5A 4AJ8A 5J9BA 5C00A 3TOUA 4OFTA 1Q4JA 2I3YA 4GRFA 4HEA2 5DQYA 2MYGA 1F37A 2VOCA 1H4OA 4AGSA 2AJQB 3CXGA 4JEDA 5CYYA 2BJXA 4K8MA 4X0XA 5HQPA 3RHCA 1G6YA 1WE0A 1XWBA 1G7EA 2FWHA 1X9SB 1UVZA 5A4VA 4D73A 1IYHA 3DXBA 3HY2A 1FW1A 3C73A 3HJMA 2A4VA 2GDRA 5LNKe 2VD0A 1TI1A 4WR4A 2C0GA 2HZEB 5LCZA 1A2JA 2GQKA 3QFBC 1DE2A 2PGTA 2K18A 1PL1A 2LRNA 2L5OA 3QR6A 2X8GA 1XZOA 4K9ZA 1FB0A 2PWJA 4NHZA 2DIYA 5DVBA 2EIQA 2H01A 5J5NA 5CAXA 4HU7A 3GRXA 2VLVA 2R3XA 3F0IA 3RAZA 4MZBA 4FH8A 2H74A 3VK9A 4YQMA 4KSMA 3TKSC 2LRCA 4KX4A 3QFAC 2H6ZA 2HRNA 4EXJA 1AQWA 2V1MA 2REMA 1O7UA 2H6YA 4TRXA 2EIOA 5CO3A 2P0GA 1GL8A 2TRXA 3S9FA 2YJ7A 2IPAA 3QAVA 5IMDA 3KTLA 2H1AA 2D2ZA 1X0RA 1C72A 3L4NA 5D9XA 3HD5A 3IK9A 4WBRD 2IFQB 1TRWA 2KUCA 1VF4A 1PMTA 2E2GA 5G1KA 4JRRA 1CQGA 3HVSA 11GSA 3GSTA 5JWRB 4OWYA 4XRDA 16GSA 1GUMA 1YF0A 3C1RA 1X5EA 2YNXA 2H76A 3KJYA 2YN1A 5DALA 5ID2B 1XW5A 2X99A 4OO4A 2WULA 2R2JA 1GSSA 3DWVA 3APOA 5ECNB 5H5SA 1TKDB 3EU3A 5E59A 2O85A 2VCXA 4Q5RA 1JFUA 2LSTA 4ZL9A 2AAWA 4Q5FA 4ZB6A 4WBJA 3UOMA 3EE2A 3KP8A 2EC4A 1SYRA 2X8HA 2C3QA 2DJJA 3VI5A 3GNJA 5ECRB 4AJ6A 2JZTA 3TUEA 2CX3A 1Z6MA 4O5RA 1OC3A 3QDNA 4LLRA 4DSQA 1PQNA 3ME7A 2NDOA 2DJ0A 4XTSA 3EVIA 2P5QA 4IP6A 3EC3A 1EWXA 4TKYA 1TK5B 3Q18A 2H1DA 1R4WA 2I81A 2LUSA 5DJLA 3UVHA 2K8SA 7GSSA 1BEDA 3Q6OA 5ECHB 2V6KA 4FYUA 4DSSB 4G10A
chains in the Genus database with same CATH superfamily
1SL1B 5KOWA 2H1GA 1TJDA 5DCHA 1YEXA 1SK2A 2LEGA 4JZQA 3DRNA 3HVXA 3Q74A 1BYEA 1SENA 4MH3A 2QKEA 2I4AA 2FHEA 4XHMA 5AN1A 1AC1A 5JCGA 2R6KA 4ZBAA 2IIYA 1RW1A 1EGOA 1OC9B 1M9BA 3WGEA 2HLSA 2A4HA 4XRAA 2M46A 1MEKA 3LG6A 4I6XA 1OAZA 4N10A 4WXTA 1O6JA 3W6GA 3CRUA 2VCQA 2O7KA 4NV2A 2LJAA 1SU9A 4NPBA 1GRXA 1HNBA 2HSMA 4ML1A 1K0BA 3EWLA 10GSA 2I9HA 4IP1A 3ERGA 3TJGA 5KN1A 1S3RA 1SK0A 2VL3A 2EIRA 3MWHA 2HZEA 1EOGA 1WJKA 4ZBDA 2AV4A 2H6XA 1PX7A 3KM6A 4KB3A 4I8BA 1AQXA 3LYKA 2VCWA 3DD3A 3IC4A 1WOUA 3R3EA 1OE8A 2JL4A 3F3RA 1EGRA 3GL3A 3ED3A 3HJOA 3TKSE 3FR9A 2CZ3A 1EZKA 2H0GA 1J9BA 1PA3A 2YV7A 3I6AA 5IMFA 9GSSA 4QQ7A 5ECMB 1F3AA 2B1LA 1NW2A 5IQYA 2V32A 4BL7A 5F0GA 1GSDA 2FD3A 2XBIA 2DJKA 4HQSA 3IBHA 2YOIA 1MD4A 2LJRA 1JLWA 4LL4B 1R7HA 2R37A 3HDCA 4RQRA 3QAWA 17GSA 3F3QA 4MJAA 4IBPA 4BVYA 3F4SA 4YQUA 1X5CA 2L6DA 2IFQA 1V40A 3GKNA 3IR4A 3PR8A 2K9FA 4H86A 2UZ8A 2PERA 3ZZXA 3U6VA 4J2FA 2IMKA 2OJLA 4FO5A 2IJYA 4PURA 2NVLA 3J7Yk 2GZPA 5HR0A 3EMPA 4JR6A 3HZ8A 4V1Ap 2YJHA 4OFMA 3VI7A 5E4WA 3VURA 1N2AA 3A5IA 4XS4B 4YH2A 3LEFA 3GX8A 5INYA 2LS5A 4NV5A 1E2YA 1TRUA 1MDKA 2DIZA 3LXZA 5EVOA 2GS3A 5D8IA 4I5QA 3ZITA 5F8BA 5HFKA 4HS1A 4F0CA 1XWCA 1SJIA 1TRSA 6GSSA 4KF9A 2HZFA 2DJ3A 3HYPA 1ZYNA 3BOAA 4IELA 3TB2A 4ZL8A 2DKHA 3CMIA 2RM6A 4HJMA 1PRXA 3FK8A 2FCHA 4E8HA 2PMTA 4TR3A 1ZOFA 4V2MA 2DJ1A 5DAKB 1T1VA 2FUG2 4TN8A 1YJ6A 1GNEA 4K0NA 4J57E 1B9YC 6GSYA 1QMVA 3F6DA 1F6MC 1TW9A 4IKHA 1VF3A 3TJFA 1YZXA 4X43A 2QC7A 3TJBA 4DSSA 1JHBA 1XPVA 5D9TA 4POKA 5IM9A 5D9WA 2YWOA 1M9AA 3IHQA 1XFLA 2L4CA 3F9UA 5BRTA 4KGIA 3EURA 3JCML 4TR1B 1M2DA 3BBYA 1EV9A 4JR4A 3TRPA 4CHSA 3BJ5A 1OC8A 4IGJA 2VUPA 1OC9A 4CW9A 2F3MA 4HUAA 2CV4A 4MPFA 1E6BA 1FHEA 3L9SA 3UAPA 2FA4A 2JZSA 1BJXA 2VL2C 4P3YB 4FIWA 4GCIA 2F8AA 5B6MA 3E3EA 3TJJA 4N0ZA 2RUEA 2VAFA 4MABA 4HOJA 5JWOB 3TRQA 1A8YA 3IOSA 4Q5QA 5F05A 3VPTA 1SJ6A 1S3AA 1F3BA 4TR0A 1HNCA 3F63A 4JE1A 4MA9A 3M9JA 2VCZA 1ML6A 3FY7A 2PUKC 1JLVA 3A3TA 4WF5A 4NXIA 2LQOA 5ECLB 3ZIJA 1PD21 4KAEA 2DKIA 2QGVA 2QA2A 1FAAA 4N0VA 4E8EA 3CSJA 2B6MA 1M2BA 5AIXA 3DVWA 2VM1A 4J56E 1GTBA 5HFIA 4NAXA 5IMZA 2GT5A 3KMNA 4KDYA 2AUVA 3G9BA 1XOBA 3ZFBA 3CYNA 5LD0A 2XPDA 2C80A 1UC7A 1Z3EA 3DEXA 1G7OA 3IHGA 3P2AA 2E7PA 4ILFA 2F8FA 2GLRA 1Y25A 5A5KA 3EINA 3K8NA 1ZGNA 1ILOA 12GSA 1WMJA 5B8BA 4ML6A 4MJBA 1BX9A 2C4JA 3L9UA 2FWGA 5B7CA 4IQAA 3MDKA 4X4JA 3VWVA 3AY8A 3IAM2 2H0IA 1Z7PA 1B4PA 13GSA 3IV4A 2BTOT 5A4UA 4KA0A 4N30A 1GUHA 3ZLPA 3GX0A 5HR2A 2C8UA 1GTIA 4K6XA 4PX1A 4EKZA 1K0OA 1GNWA 5FT3A 2GZZA 3FZ5A 3M9KA 4EE0A 3TKQA 1TU7A 2CA8A 1GLPA 4FQUA 4EO3A 4XS4A 2B3SA 20GSA 2YANA 1R5PA 3HKRA 2GSQA 1VF2A 1K0NA 4BWSA 4IQ1A 2WB9A 1O85A 5IMVA 4MDCA 3HVVA 5CP1A 1B4QA 1EP8A 3ERFA 2HNLA 4ULXA 2PPTA 1QFNA 4L5OA 2MMOA 2MMNA 3C1SA 2LKUA 1VF1A 4L0WA 2HFDA 1SKWB 4MPGA 4MMMA 1VRSD 5DAKA 2E0QA 1T00A 1YY7A 2R0CA 1MDIA 2CVDA 1O8WA 3CRTA 1SYXA 1DSBA 3UARA 3MYDA 1HQOA 1A8LA 2CX4A 3MIXA 3LW9A 2H30A 5F06A 4HZ2A 1XVQA 2MMZA 2NTOA 5CRWA 3APSA 1OE7A 3HVNA 1NHYA 2K6VA 4TW5A 3UBLA 2IMFA 3LFLA 2R0PA 2LNSA 2N5AA 3MSZA 2OE0A 1T4YA 3D22A 1K0AA 4EDYA 3WT2A 1Z5YE 4TR1A 2LJKA 3FRCA 3BCIA 2OADA 1AAZA 2NPBA 1FB6A 2JSZA 2PN8A 1U3AA 4HI7A 2OE1A 4BPYA 4GF0A 4WF4A 4L8EA 4RI7A 3FR6A 4YKGA 1SKRB 4XS6A 5CRHA 1ZYPA 2DC5A 3J7Yb 1F9MA 4F9ZA 5IMAA 1V9WA 1TOFA 2Z9SA 1H75A 2VLTA 4YQVA 2YWNA 2AB6A 3HCZA 1Z6NA 2A2SA 1GLQA 2WZ9A 1BG5A 1ABAA 4MLYA 3UBKA 4Z2UA 4V1Ag 3GA4A 3C7MA 4ZB8A 1GSEA 3QCPA 1V58A 2DSAA 2H8LA 8GSSA 5ECPB 3HZ4A 2KLXA 3ZYWA 4XS1A 2RIIA 1ON4A 5ENUA 2B7KA 4K7NA 3D5JA 3FW2A 1M3JA 1EEJA 4K7OA 4L5LA 3RPPA 4K1FA 1O81A 1KEBA 2CT6A 3FMWA 2O87A 4PGTA 5ECKB 1QK8A 3APQA 1TU8A 3I9V2 4RUVA 1WPIA 3GKMA 5J4UA 1SL0B 4USSA 3G7YA 3LGCA 2FLSA 1XVWA 1T3BA 1M0UA 3UL3A 1G6WA 1HNAA 3LYPA 1XW6A 3CBUA 3KZQA 5F07A 1PSQA 3TOTA 2B5XA 1PL2A 2ZNMA 4MF7A 5CRGA 3WT1A 1EOHA 2HT9A 4OCFA 4AF2A 4XIHA 4POLA 2XPEA 1KTEA 4NWYA 4A5PA 3F6FA 1ZYQB 1PX6A 3HA9A 4DVCA 1X9MB 1SJZA 4F0BA 4PUAA 2R5GA 2R4VA 1J0FA 3A2VA 1HYUA 1VGLA 4V2LA 4K2DA 5ELAA 3QAGA 2GSRA 3EYTA 5FHIA 1R5AA 2L4QA 3M1GA 4TR4A 2RM5A 4EDZA 1O8XA 3KP9A 5G2ZA 4XCSA 1WIKA 1M99A 4IW9A 1JZWA 2H1BA 1GH2A 1XXUA 6GSVA 1XCCA 4EC0A 3ZFLA 2LNTA 2DLXA 2P31A 2B1KA 4K2XA 3DKSA 5ECSA 1MTCA 1G0TA 3ZREA 2H71A 3ERWA 4N11A 1M7TA 3L0HA 3PINA 3PH9A 3IPZA 4CDOA 2CVBA 4K5RA 1GUKA 4DSRA 3OR5A 4PTSA 3QOUA 3SBCA 4GLTA 1V2AA 4PUFC 4F2IA 2M80A 4EIQA 1GTAA 5ECIB 4K5SA 3QPMA 1FVKA 1YKAA 2MBTA 1W4VA 2LRTA 4GSTA 2GSTA 2YPMA 3KGKA 1MD3A 2CQ9A 4KUNA 4CY8A 1QQ2A 2GZYA 4OMVA 1X5DA 1AW9A 4IJIA 5ECQB 2H75A 3H8QA 5ELGA 1OYJA 1DE1A 4ZBBA 2FA8A 4FYBA 4KNDA 5HFGA 3GH9A 3H4KA 4KCEA 3FHKA 5CRDA 2J9HA 2OKAA 4WKWA 3G7JA 4YAPA 4ZL7A 2GTUA 4QL9A 1UN2A 3A2XA 2GT6A 4G0IA 4KDUA 2PVOC 1K0CA 2JACA 5AISA 3O76A 1TXXA 2RLIA 5G30A 5GSTA 5KN3A 5IOWA 4QL7A 2VLUA 2IWTA 1S3DA 5GSSA 1A0FA 4HSCX 5GAPD 3ZL5A 5G5EA 2YWIA 2JZRA 1KBNA 3VPQA 1TK8B 2ALBA 2YZUA 4MF6A 5ECOB 3IA1A 3QMXA 5D96A 4X1UA 3ZVJA 5J9CA 3ZTLA 4KCAA 2IMIA 1WP0A 1ERVA 2JADA 1FO5A 3FEUA 1GSYA 1LBKA 2B7JA 4L0UA 1QGVA 3TJKA 5DJMA 4G9HA 1ERUA 3IC8A 2R0GA 4FYCA 3F8UA 1PN0A 1AUCA 1GSFA 2ZCTA 3RBTA 2HSYA 4K0GA 1TTZA 2CAIA 2OACA 1OVNA 1OKDA 3IRAA 3WGDA 2C0DA 4WEYA 2JU5A 3NIVA 2PBJA 5G31A 3VLNA 1YEPA 4KDXA 1PKZA 1SKSB 4MH2A 1TDIA 5IPGA 3GYKA 2F51A 3D21A 3M8NA 5IO0A 5H5QA 1V98A 2WGRA 4F03A 2OA7A 1NHOA 3V1WA 3GTUB 3TKSA 2GVPA 4ZB9A 4IHUA 3US3A 1SK1A 3GKKA 3I69A 2H72A 4IVFA 2V2GA 3H79A 3DGQA 4DEJA 3D4MA 4OO5A 1K3YA 4HDEA 4KW6A 3VFIA 3GL5A 3CTGA 4HQZA 3GHAA 2DJ2A 1YDKA 2NBSA 3RHBA 1UA5A 3VWUA 4ZIJA 5FWGA 5EL8A 1B9XC 3UJ1A 3WYWA 1BAYA 1R26A 2ON5A 3EU4A 2C0EA 2HXKA 2MMAA 1XWKA 1DBYA 4OCEA 4ECJA 2O8VB 1ZMAA 3PGTA 4G2EA 5KOXA 2CAQA 3ZMKA 2LTKA 4GWRA 3ZRDA 4PQ1A 1V57A 5B8AA 2VL9A 3DMLA 1XG8A 3NOFA 4PNGA 5IMCA 4JBBA 2H73A 3LSZA 1T7PB 2VIMA 1XOAA 4PQHA 3KMOA 1N8JA 4PXOA 3GN3A 2C3TA 4KH7A 2AHEA 1THOA 4BIKA 3GIXA 2M72A 2F9SA 2X64A 3RPNA 2N5BA 5COHA 4BVXB 5GAND 1AIUA 1WRYA 3IAS2 4RQXA 5AIVA 3LORA 1FOVA 2FGXA 19GSA 3CSHA 3G7IA 1A0RP 1CQHA 3LJRA 4MP4A 4BA7A 2GGTA 1S3CA 2L57A 4KSOA 4RI6A 3I43A 1GSUA 1JZDA 1PN9A 2A2RA 4ECCA 4Z7XA 2WRTA 2TIRA 1SL2B 1TI3A 3A2WA 2GSSA 3WD6A 2G2QA 1XWGA 4MCUA 6GSWA 6GSXA 1K3OA 2LV3A 3UMAA 3FKFA 1A23A 2WS2A 1RK4A 4TXOB 4Q5NA 5JCWA 1NSWA 4HJ2A 1ZL9A 3FYGA 1TP9A 3FZ4A 3HJPA 4O7HA 2DMLA 2HE3A 4LA1A 2WDUA 2VO4A 4NMUA 4LL1B 2HRFA 3O3TA 3SWLA 1EV4A 3GMFA 4POMA 2VD1A 4I2UA 4O32A 2H0HA 4EVMA 2TRCP 3H93A 5D93A 1ERWA 2ZUPA 1B48A 4GTUA 2OBKA 1LJRA 4ZXGA 1ST9A 5HR1A 4MJEA 2LQQA 1ZYEA 3GSSA 3TKPA 1GTUA 4GSNA 1AQVA 2XBQA 3N5OA 3KEBA 2L5LA 1B8XA 1THXA 2HSHA 5KN0A 5CNWA 3KXOA 1NM3A 3UEMA 14GSA 2H19A 4GXZA 1A24A 1FVJA 2WCIA 1GWCA 2XHFA 4GQFA 3D6IA 1QXHA 2H70A 1ZCPA 1ACVA 4PNFA 2GQLA 1T8EB 2HRAA 1Z7RA 5A4WA 1YKCA 3KIJA 3IK7A 2CZ2A 2H66A 1JZRA 2YCDA 4G0KA 3IDVA 1HD2A 4BWQA 2IN3A 1SD9A 3M0FA 3UIWA 3HHVA 1IYIA 3TRXA 5IO2A 2WJUA 3LXTA 4JU5A 1PGTA 2JSYA 1AXDA 1X9WB 1MDJA 2VCTA 3GTUA 6GSTA 1GULA 2BMXA 2N5FA 4NHWA 4IN0A 2KP2A 3TCOA 2X4AA 1GP1A 5EY6A 1XBSA 3UVTA 1TK0B 1KNGA 4ECIA 1A2LA 4F82A 1EP7A 4V2NA 2IL3A 1Y6EA 3RDWA 1FOHA 4EF0A 4WETA 5B6NA 5IPHA 2DMMA 1QUWA 3KH9A 3E9JB 3CTFA 5J3RA 5L71A 1U87A 3TDGA 3ME8A 3D4TA 2O89A 1XWAA 5DDLA 2P5RA 5ABRA 1I5GA 3HXSA 3MNGA 3DVXA 3BCKA 1URMA 2KOKA 3R2QA 1OKTA 2OE3A 5DQSA 5J41A 4MNNA 4MZCA 5BMUA 2I1UA 5D9VA 1M2AA 3EPTA 3LWAA 5GZZB 4YKFA 2HRKA 1XW9A 3E0UA 2G0FA 4D73B 4BVXA 2OBIA 5DCGA 1K3LA 3ZVJD 1TRVA 3VWXA 4Z2RA 2QSIA 2RUFA 2HI7A 3GURA 2YWMA 3L9VA 2PVQA 2WFCA 5JWQB 1USBA 1YF1A 3GUSA 4I2TA 4PQIA 3KTBA 4I97A 22GSA 5IIZA 3A5WA 1ERTA 1SD8A 2KHPA 4ICYA 2B5YA 3O6TA 2V6OA 4TVEA 5HR3A 5EPFA 2GQMA 1PKWA 1DUGA 1GSQA 4POBA 3FZ9A 1O73A 4ID0A 3N9JA 3KH7A 4TXOA 1A2MA 1Z9HA 1JZOA 4IJ3A 3W8SA 2B5EA 4ZILA 2XC2A 3F4TA 2C0FA 2CVKA 1K0DA 18GSA 3ISOA 3GV1A 4GQCA 2X8CA 3L78A 2DBCA 5G5FA 4MF5A 4OFNA 3NZNA 4OD7A 1Q98A 2ES7A 3P90A 5ID2A 3QD9A 5C04A 3LQ7A 1LU4A 3H1NA 2FNOA 3P7XA 2E2MA 1U88A 1U3IA 1W89A 2L6CA 4HU9A 5DBQA 2VL2A 3GFKA 5IOXA 4LMWA 2FWEA 3DIEA 3Q19A 1FG4A 2KP1A 2ON7A 3IXRA 1F2EA 3KD0A 6GSUA 2HYXA 4LMVA 3CSIA 3MAKA 2YZHA 5DALB 4EUYA 3D0ZA 3FR3A 2PU9C 5AGYA 3CQFA 2L59A 3DYRA 1BQ7A 1RQMA 4MK3A 4ECBA 3C71A 4G0LA 4IS0A 4K7IA 3P8WA 4MZWA 1T4ZA 2K8VA 1EEMA 2FWFA 3GKXA 1I9DA 3WGXA 4ACSA 1WWJA 4KE3A 5G1LA 1J08A 2C1YA 2C3NA 2J23A 1PFOA 2YP6A 4TXVA 4TOPA 1U6TA 4AJ7A 4YAVA 5KN2A 2MZCA 4O92A 1ZZYA 3C8EA 3KCMA 3ZIVA 3EMXA 5CREA 3IE3A 4ISDA 3ZMLA 3U5RE 3GH6A 2FY6A 3F4RA 2IMDA 2MBSA 5JCUA 3TGZA 2AYTA 3W8JA 4EL1A 2V41A 3TKRA 4MJCA 3VWWA 5H5RA 4HZ4A 4G19A 2A2PA 3BD2A 5D73A 3FZAA 1K0MA 4GSSA 3M3MA 1YQ1A 2YV9A 1XIYA 2IMEA 5KEJA 2VCVA 2VM2A 4WR5A 4AJ8A 5J9BA 5C00A 3TOUA 4OFTA 1Q4JA 2I3YA 4GRFA 4HEA2 5DQYA 2MYGA 1F37A 2VOCA 1H4OA 4AGSA 2AJQB 3CXGA 4JEDA 5CYYA 2BJXA 4K8MA 4X0XA 5HQPA 3RHCA 1G6YA 1WE0A 1XWBA 1G7EA 2FWHA 1X9SB 1UVZA 5A4VA 4D73A 1IYHA 3DXBA 3HY2A 1FW1A 3C73A 3HJMA 2A4VA 2GDRA 5LNKe 2VD0A 1TI1A 4WR4A 2C0GA 2HZEB 5LCZA 1A2JA 2GQKA 3QFBC 1DE2A 2PGTA 4O5QA 2K18A 1PL1A 2QA1A 2LRNA 2L5OA 3QR6A 2X8GA 1XZOA 4K9ZA 1FB0A 2PWJA 4NHZA 2DIYA 5DVBA 2X49A 2EIQA 2H01A 5J5NA 5CAXA 4HU7A 3GRXA 2VLVA 2R3XA 3F0IA 3RAZA 4MZBA 4FH8A 2H74A 3VK9A 4YQMA 4KSMA 3TKSC 2LRCA 4KX4A 3QFAC 4BL7B 2H6ZA 2HRNA 4EXJA 1AQWA 2V1MA 2REMA 1O7UA 2H6YA 4TRXA 2EIOA 5CO3A 2P0GA 1GL8A 2TRXA 3S9FA 2YJ7A 2IPAA 3QAVA 5IMDA 3KTLA 2H1AA 2D2ZA 1X0RA 1C72A 3L4NA 3PPUA 5D9XA 3HD5A 3IK9A 4BVYB 4WBRD 2IFQB 1TRWA 2KUCA 1VF4A 1PMTA 2E2GA 1M3IA 5G1KA 4JRRA 1CQGA 3HVSA 11GSA 3GSTA 5JWRB 4OWYA 4EIPA 4XRDA 16GSA 1GUMA 1YF0A 3C1RA 4O5UA 1X5EA 2YNXA 2H76A 3KJYA 2YN1A 5DALA 5ID2B 1XW5A 2X99A 4OO4A 2WULA 2R2JA 1GSSA 3DWVA 3APOA 5ECNB 5H5SA 1TKDB 3EU3A 5E59A 2O85A 2VCXA 4Q5RA 1JFUA 2LSTA 4ZL9A 2AAWA 4Q5FA 4ZB6A 4WBJA 3UOMA 3EE2A 3KP8A 4CY6A 2EC4A 1SYRA 2X8HA 2C3QA 2DJJA 3VI5A 3GNJA 5ECRB 4AJ6A 2JZTA 3TUEA 2CX3A 1Z6MA 4O5RA 4Z2TA 1OC3A 3QDNA 4LLRA 4DSQA 1PQNA 3ME7A 2NDOA 2DJ0A 4XTSA 3EVIA 2P5QA 4IP6A 3EC3A 1EWXA 4TKYA 1TK5B 3Q18A 2H1DA 1R4WA 2I81A 2LUSA 5DJLA 3UVHA 2K8SA 7GSSA 1BEDA 3Q6OA 5ECHB 2V6KA 4FYUA 4DSSB 4G10A
chains in the Genus database with same CATH topology
1SL1B 5KOWA 2H1GA 1TJDA 5DCHA 1YEXA 1SK2A 2LEGA 4JZQA 3DRNA 3HVXA 3Q74A 1BYEA 1SENA 4MH3A 2QKEA 2I4AA 2FHEA 4XHMA 5AN1A 1AC1A 5JCGA 2R6KA 4ZBAA 2IIYA 1RW1A 1EGOA 1OC9B 1M9BA 3WGEA 2HLSA 2A4HA 4XRAA 2M46A 1MEKA 3LG6A 4I6XA 1OAZA 4N10A 4WXTA 1O6JA 3W6GA 3CRUA 2VCQA 2O7KA 4NV2A 2LJAA 1SU9A 4NPBA 1GRXA 1HNBA 2HSMA 4ML1A 1K0BA 3EWLA 10GSA 2I9HA 4IP1A 3ERGA 3TJGA 5KN1A 1SK0A 2VL3A 2EIRA 3MWHA 2HZEA 1EOGA 1WJKA 4ZBDA 2AV4A 2H6XA 1PX7A 3KM6A 4KB3A 4I8BA 1AQXA 3LYKA 2VCWA 3DD3A 3IC4A 1WOUA 3R3EA 1OE8A 2JL4A 3F3RA 1EGRA 3GL3A 3ED3A 3HJOA 3TKSE 3FR9A 2CZ3A 1EZKA 2H0GA 1J9BA 1PA3A 2YV7A 3I6AA 5IMFA 9GSSA 4QQ7A 5ECMB 1F3AA 2B1LA 1NW2A 5IQYA 2V32A 4BL7A 5F0GA 1GSDA 2FD3A 2XBIA 2DJKA 4HQSA 3IBHA 2YOIA 1MD4A 2LJRA 1JLWA 4LL4B 1R7HA 2R37A 3HDCA 4RQRA 3QAWA 17GSA 3F3QA 4MJAA 4IBPA 4BVYA 3F4SA 4YQUA 1X5CA 2L6DA 2IFQA 1V40A 3GKNA 3IR4A 3PR8A 2K9FA 4H86A 2UZ8A 2PERA 3ZZXA 3U6VA 4J2FA 2IMKA 2OJLA 4FO5A 2IJYA 4PURA 2NVLA 3J7Yk 2GZPA 5HR0A 3EMPA 4JR6A 3HZ8A 4V1Ap 2YJHA 4OFMA 3VI7A 5E4WA 3VURA 1N2AA 3A5IA 4XS4B 4YH2A 3LEFA 3GX8A 5INYA 2LS5A 4NV5A 1E2YA 1TRUA 1MDKA 2DIZA 3LXZA 5EVOA 2GS3A 5D8IA 4I5QA 3ZITA 5F8BA 5HFKA 4HS1A 4F0CA 1XWCA 1SJIA 1TRSA 6GSSA 4KF9A 2HZFA 2DJ3A 3HYPA 1ZYNA 3BOAA 4IELA 3TB2A 4ZL8A 2DKHA 3CMIA 2RM6A 4HJMA 1PRXA 3FK8A 2FCHA 4E8HA 2PMTA 4TR3A 1ZOFA 4V2MA 2DJ1A 5DAKB 1T1VA 2FUG2 4TN8A 1YJ6A 1GNEA 4K0NA 4J57E 1B9YC 6GSYA 1QMVA 3F6DA 1F6MC 1TW9A 4IKHA 1VF3A 3TJFA 1YZXA 4X43A 2QC7A 3TJBA 4DSSA 1JHBA 1XPVA 5D9TA 4POKA 5IM9A 5D9WA 2YWOA 1M9AA 3IHQA 1XFLA 2L4CA 3F9UA 5BRTA 4KGIA 3EURA 3JCML 4TR1B 1M2DA 3BBYA 1EV9A 4JR4A 3TRPA 4CHSA 3BJ5A 1OC8A 4IGJA 2VUPA 1OC9A 4CW9A 2F3MA 4HUAA 2CV4A 4MPFA 1E6BA 1FHEA 3L9SA 3UAPA 2FA4A 2JZSA 1BJXA 2VL2C 4P3YB 4FIWA 4GCIA 2F8AA 5B6MA 3E3EA 3TJJA 4N0ZA 2RUEA 2VAFA 4MABA 4HOJA 5JWOB 3TRQA 1A8YA 3IOSA 4Q5QA 5F05A 3VPTA 1SJ6A 1S3AA 1F3BA 4TR0A 1HNCA 3F63A 4JE1A 4MA9A 3M9JA 2VCZA 1ML6A 3FY7A 2PUKC 1JLVA 3A3TA 4WF5A 4NXIA 2LQOA 5ECLB 3ZIJA 1PD21 4KAEA 2DKIA 2QGVA 2QA2A 1FAAA 4N0VA 4E8EA 3CSJA 2B6MA 1M2BA 5AIXA 3DVWA 2VM1A 4J56E 1GTBA 5HFIA 4NAXA 5IMZA 2GT5A 3KMNA 4KDYA 2AUVA 3G9BA 1XOBA 3ZFBA 3CYNA 5LD0A 2XPDA 2C80A 1UC7A 1Z3EA 3DEXA 1G7OA 3IHGA 3P2AA 2E7PA 4ILFA 2F8FA 2GLRA 1Y25A 5A5KA 3EINA 3K8NA 1ZGNA 1ILOA 12GSA 1WMJA 5B8BA 4ML6A 4MJBA 1BX9A 2C4JA 3L9UA 2FWGA 5B7CA 4IQAA 3MDKA 4X4JA 3VWVA 3AY8A 3IAM2 2H0IA 1Z7PA 1B4PA 13GSA 3IV4A 2BTOT 5A4UA 4KA0A 4N30A 1GUHA 3ZLPA 3GX0A 5HR2A 2C8UA 1GTIA 4K6XA 4PX1A 4EKZA 1K0OA 1GNWA 5FT3A 2GZZA 3FZ5A 3M9KA 4EE0A 3TKQA 1TU7A 2CA8A 1GLPA 4FQUA 4EO3A 4XS4A 2B3SA 20GSA 2YANA 1R5PA 3HKRA 2GSQA 1VF2A 1K0NA 4BWSA 4IQ1A 2WB9A 1O85A 5IMVA 4MDCA 3HVVA 5CP1A 1B4QA 1EP8A 3ERFA 2HNLA 4ULXA 2PPTA 1QFNA 4L5OA 2MMOA 2MMNA 3C1SA 2LKUA 1VF1A 4L0WA 2HFDA 1SKWB 4MPGA 4MMMA 1VRSD 5DAKA 2E0QA 1T00A 1YY7A 2R0CA 1MDIA 2CVDA 1O8WA 3CRTA 1SYXA 1DSBA 3UARA 3MYDA 1HQOA 1A8LA 2CX4A 3MIXA 3LW9A 2H30A 5F06A 4HZ2A 1XVQA 2MMZA 2NTOA 5CRWA 3APSA 1OE7A 1NHYA 2K6VA 4TW5A 3UBLA 2IMFA 3LFLA 2R0PA 2LNSA 2N5AA 3MSZA 2OE0A 1T4YA 3D22A 1K0AA 4EDYA 3WT2A 1Z5YE 4TR1A 2LJKA 3FRCA 3BCIA 2OADA 1AAZA 2NPBA 1FB6A 2JSZA 2PN8A 1U3AA 4HI7A 2OE1A 4BPYA 4GF0A 4WF4A 4L8EA 4RI7A 3FR6A 4YKGA 1SKRB 4XS6A 5CRHA 1ZYPA 2DC5A 3J7Yb 1F9MA 4F9ZA 5IMAA 1V9WA 1TOFA 2Z9SA 1H75A 2VLTA 4YQVA 2YWNA 2AB6A 3HCZA 1Z6NA 2A2SA 1GLQA 2WZ9A 1BG5A 1ABAA 4MLYA 3UBKA 4Z2UA 4V1Ag 3GA4A 3C7MA 4ZB8A 1GSEA 3QCPA 1V58A 2DSAA 2H8LA 8GSSA 5ECPB 3HZ4A 2KLXA 3ZYWA 4XS1A 2RIIA 1ON4A 5ENUA 2B7KA 4K7NA 3D5JA 3FW2A 1EEJA 4K7OA 4L5LA 3RPPA 4K1FA 1O81A 1KEBA 2CT6A 3FMWA 2O87A 4PGTA 5ECKB 1QK8A 3APQA 1TU8A 3I9V2 4RUVA 1WPIA 3GKMA 5J4UA 1SL0B 4USSA 3G7YA 3LGCA 2FLSA 1XVWA 1T3BA 1M0UA 3UL3A 1G6WA 1HNAA 3LYPA 1XW6A 3CBUA 3KZQA 5F07A 1PSQA 3TOTA 2B5XA 1PL2A 2ZNMA 4MF7A 5CRGA 3WT1A 1EOHA 2HT9A 4OCFA 4AF2A 4XIHA 4POLA 2XPEA 1KTEA 4NWYA 4A5PA 3F6FA 1ZYQB 1PX6A 3HA9A 4DVCA 1X9MB 1SJZA 4F0BA 4PUAA 2R5GA 2R4VA 1J0FA 3A2VA 1HYUA 1VGLA 4V2LA 4K2DA 5ELAA 3QAGA 2GSRA 3EYTA 5FHIA 1R5AA 2L4QA 3M1GA 4TR4A 2RM5A 4EDZA 1O8XA 3KP9A 5G2ZA 4XCSA 1WIKA 1M99A 4IW9A 1JZWA 2H1BA 1GH2A 1XXUA 6GSVA 1XCCA 4EC0A 3ZFLA 2LNTA 2DLXA 2P31A 2B1KA 4K2XA 3DKSA 5ECSA 1MTCA 1G0TA 3ZREA 2H71A 3ERWA 4N11A 1M7TA 3L0HA 3PINA 3PH9A 3IPZA 4CDOA 2CVBA 4K5RA 1GUKA 4DSRA 3OR5A 4PTSA 3QOUA 3SBCA 4GLTA 1V2AA 4PUFC 4F2IA 2M80A 4EIQA 1GTAA 5ECIB 4K5SA 3QPMA 1FVKA 1YKAA 2MBTA 1W4VA 2LRTA 4GSTA 2GSTA 2YPMA 3KGKA 1MD3A 2CQ9A 4KUNA 4CY8A 1QQ2A 2GZYA 4OMVA 1X5DA 1AW9A 4IJIA 5ECQB 2H75A 3H8QA 5ELGA 1OYJA 1DE1A 4ZBBA 2FA8A 4FYBA 4KNDA 5HFGA 3GH9A 3H4KA 4KCEA 3FHKA 5CRDA 2J9HA 2OKAA 4WKWA 3G7JA 4YAPA 4ZL7A 2GTUA 4QL9A 1UN2A 3A2XA 2GT6A 4G0IA 4KDUA 2PVOC 1K0CA 2JACA 5AISA 3O76A 1TXXA 2RLIA 5G30A 5GSTA 5KN3A 5IOWA 4QL7A 2VLUA 2IWTA 1S3DA 5GSSA 1A0FA 5GAPD 3ZL5A 5G5EA 2YWIA 2JZRA 1KBNA 3VPQA 1TK8B 2ALBA 2YZUA 4MF6A 5ECOB 3IA1A 3QMXA 5D96A 4X1UA 3ZVJA 5J9CA 3ZTLA 4KCAA 2IMIA 1WP0A 1ERVA 2JADA 1FO5A 3FEUA 1GSYA 1LBKA 2B7JA 4L0UA 1QGVA 3TJKA 5DJMA 4G9HA 1ERUA 3IC8A 2R0GA 4FYCA 3F8UA 1PN0A 1AUCA 1GSFA 2ZCTA 3RBTA 2HSYA 4K0GA 1TTZA 2CAIA 2OACA 1OVNA 1OKDA 3IRAA 3WGDA 2C0DA 4WEYA 2JU5A 3NIVA 2PBJA 5G31A 3VLNA 1YEPA 4KDXA 1PKZA 1SKSB 4MH2A 1TDIA 5IPGA 3GYKA 2F51A 3D21A 3M8NA 5IO0A 5H5QA 1V98A 2WGRA 4F03A 2OA7A 1NHOA 3V1WA 3GTUB 3TKSA 2GVPA 4ZB9A 4IHUA 3US3A 1SK1A 3GKKA 3I69A 2H72A 4IVFA 2V2GA 3H79A 3DGQA 4DEJA 3D4MA 4OO5A 1K3YA 4HDEA 4KW6A 3VFIA 3GL5A 3CTGA 4HQZA 3GHAA 2DJ2A 1YDKA 2NBSA 3RHBA 1UA5A 3VWUA 4ZIJA 5FWGA 5EL8A 1B9XC 3UJ1A 3WYWA 1BAYA 1R26A 2ON5A 3EU4A 2C0EA 2HXKA 2MMAA 1XWKA 1DBYA 4OCEA 4ECJA 2O8VB 1ZMAA 3PGTA 4G2EA 5KOXA 2CAQA 3ZMKA 2LTKA 4GWRA 3ZRDA 4PQ1A 1V57A 5B8AA 2VL9A 3DMLA 3NOFA 4PNGA 5IMCA 4JBBA 2H73A 3LSZA 1T7PB 2VIMA 1XOAA 4PQHA 3KMOA 1N8JA 4PXOA 3GN3A 2C3TA 4KH7A 2AHEA 1THOA 3GIXA 2M72A 2F9SA 2X64A 3RPNA 2N5BA 5COHA 4BVXB 5GAND 1AIUA 1WRYA 3IAS2 4RQXA 5AIVA 3LORA 1FOVA 2FGXA 19GSA 3CSHA 3G7IA 1A0RP 1CQHA 3LJRA 4MP4A 4BA7A 2GGTA 1S3CA 2L57A 4KSOA 4RI6A 3I43A 1GSUA 1JZDA 1PN9A 2A2RA 4ECCA 4Z7XA 2WRTA 2TIRA 1SL2B 1TI3A 3A2WA 2GSSA 3WD6A 2G2QA 1XWGA 4MCUA 6GSWA 6GSXA 1K3OA 2LV3A 3UMAA 3FKFA 1A23A 2WS2A 1RK4A 4TXOB 4Q5NA 5JCWA 1NSWA 4HJ2A 1ZL9A 3FYGA 1TP9A 3FZ4A 3HJPA 4O7HA 2DMLA 2HE3A 4LA1A 2WDUA 2VO4A 4NMUA 4LL1B 2HRFA 3O3TA 3SWLA 1EV4A 3GMFA 4POMA 2VD1A 4I2UA 4O32A 2H0HA 4EVMA 2TRCP 3H93A 5D93A 1ERWA 2ZUPA 1B48A 4GTUA 2OBKA 1LJRA 4ZXGA 1ST9A 5HR1A 4MJEA 2LQQA 1ZYEA 3GSSA 3TKPA 1GTUA 4GSNA 1AQVA 2XBQA 3N5OA 3KEBA 2L5LA 1B8XA 1THXA 2HSHA 5KN0A 5CNWA 3KXOA 1NM3A 3UEMA 14GSA 2H19A 4GXZA 1A24A 1FVJA 2WCIA 1GWCA 2XHFA 4GQFA 3D6IA 1QXHA 2H70A 1ZCPA 1ACVA 4PNFA 2GQLA 1T8EB 2HRAA 1Z7RA 5A4WA 1YKCA 3KIJA 3IK7A 2CZ2A 2H66A 1JZRA 2YCDA 4G0KA 3IDVA 1HD2A 4BWQA 2IN3A 1SD9A 3M0FA 3UIWA 3HHVA 1IYIA 3TRXA 5IO2A 2WJUA 3LXTA 4JU5A 1PGTA 2JSYA 1AXDA 1X9WB 1MDJA 2VCTA 3GTUA 6GSTA 1GULA 2BMXA 2N5FA 4NHWA 4IN0A 2KP2A 3TCOA 2X4AA 1GP1A 5EY6A 1XBSA 3UVTA 1TK0B 1KNGA 4ECIA 1A2LA 4F82A 1EP7A 4V2NA 2IL3A 1Y6EA 3RDWA 1FOHA 4EF0A 4WETA 5B6NA 5IPHA 2DMMA 1QUWA 3KH9A 3E9JB 3CTFA 5J3RA 5L71A 1U87A 3TDGA 3ME8A 3D4TA 2O89A 1XWAA 5DDLA 2P5RA 5ABRA 1I5GA 3HXSA 3MNGA 3DVXA 3BCKA 1URMA 2KOKA 3R2QA 1OKTA 2OE3A 5DQSA 5J41A 4MNNA 4MZCA 5BMUA 2I1UA 5D9VA 1M2AA 3EPTA 3LWAA 5GZZB 4YKFA 2HRKA 1XW9A 3E0UA 2G0FA 4D73B 4BVXA 2OBIA 5DCGA 1K3LA 3ZVJD 1TRVA 3VWXA 4Z2RA 2QSIA 2RUFA 2HI7A 3GURA 2YWMA 3L9VA 2PVQA 2WFCA 5JWQB 1USBA 1YF1A 3GUSA 4I2TA 4PQIA 3KTBA 4I97A 22GSA 5IIZA 3A5WA 1ERTA 1SD8A 2KHPA 4ICYA 2B5YA 3O6TA 2V6OA 4TVEA 5HR3A 5EPFA 2GQMA 1PKWA 1DUGA 1GSQA 4POBA 3FZ9A 1O73A 4ID0A 3N9JA 3KH7A 4TXOA 1A2MA 1Z9HA 1JZOA 4IJ3A 3W8SA 2B5EA 4ZILA 2XC2A 3F4TA 2C0FA 2CVKA 1K0DA 18GSA 3ISOA 3GV1A 4GQCA 2X8CA 3L78A 2DBCA 5G5FA 4MF5A 4OFNA 3NZNA 4OD7A 1Q98A 2ES7A 3P90A 5ID2A 3QD9A 5C04A 3LQ7A 1LU4A 3H1NA 2FNOA 3P7XA 2E2MA 1U88A 1U3IA 1W89A 2L6CA 4HU9A 5DBQA 2VL2A 3GFKA 5IOXA 4LMWA 2FWEA 3DIEA 3Q19A 1FG4A 2KP1A 2ON7A 3IXRA 1F2EA 3KD0A 6GSUA 2HYXA 4LMVA 3CSIA 3MAKA 2YZHA 5DALB 4EUYA 3D0ZA 3FR3A 2PU9C 5AGYA 2L59A 3DYRA 1BQ7A 1RQMA 4MK3A 4ECBA 3C71A 4G0LA 4IS0A 4K7IA 3P8WA 4MZWA 1T4ZA 2K8VA 1EEMA 2FWFA 3GKXA 1I9DA 3WGXA 4ACSA 1WWJA 4KE3A 5G1LA 1J08A 2C1YA 2C3NA 2J23A 2YP6A 4TXVA 4TOPA 1U6TA 4AJ7A 4YAVA 5KN2A 2MZCA 4O92A 1ZZYA 3C8EA 3KCMA 3ZIVA 3EMXA 5CREA 3IE3A 4ISDA 3ZMLA 3U5RE 3GH6A 2FY6A 3F4RA 2IMDA 2MBSA 5JCUA 3TGZA 2AYTA 3W8JA 4EL1A 2V41A 3TKRA 4MJCA 3VWWA 5H5RA 4HZ4A 4G19A 2A2PA 3BD2A 5D73A 3FZAA 1K0MA 4GSSA 3M3MA 1YQ1A 2YV9A 1XIYA 2IMEA 5KEJA 2VCVA 2VM2A 4WR5A 4AJ8A 5J9BA 5C00A 3TOUA 4OFTA 1Q4JA 2I3YA 4GRFA 4HEA2 5DQYA 2MYGA 1F37A 2VOCA 1H4OA 4AGSA 2AJQB 3CXGA 4JEDA 5CYYA 2BJXA 4K8MA 4X0XA 5HQPA 3RHCA 1G6YA 1WE0A 1XWBA 1G7EA 2FWHA 1X9SB 1UVZA 5A4VA 4D73A 1IYHA 3DXBA 3HY2A 1FW1A 3C73A 3HJMA 2A4VA 2GDRA 5LNKe 2VD0A 1TI1A 4WR4A 2C0GA 2HZEB 5LCZA 1A2JA 2GQKA 3QFBC 1DE2A 2PGTA 4O5QA 2K18A 1PL1A 2QA1A 2LRNA 2L5OA 3QR6A 2X8GA 1XZOA 4K9ZA 1FB0A 2PWJA 4NHZA 2DIYA 5DVBA 2X49A 2EIQA 2H01A 5J5NA 5CAXA 4HU7A 3GRXA 2VLVA 2R3XA 3F0IA 3RAZA 4MZBA 4FH8A 2H74A 3VK9A 4YQMA 4KSMA 3TKSC 2LRCA 4KX4A 3QFAC 4BL7B 2H6ZA 2HRNA 4EXJA 1AQWA 2V1MA 2REMA 1O7UA 2H6YA 4TRXA 2EIOA 5CO3A 2P0GA 1GL8A 2TRXA 3S9FA 2YJ7A 2IPAA 3QAVA 5IMDA 3KTLA 2H1AA 2D2ZA 1X0RA 1C72A 3L4NA 3PPUA 5D9XA 3HD5A 3IK9A 4BVYB 4WBRD 2IFQB 1TRWA 2KUCA 1VF4A 1PMTA 2E2GA 5G1KA 4JRRA 1CQGA 3HVSA 11GSA 3GSTA 5JWRB 4OWYA 4EIPA 4XRDA 16GSA 1GUMA 1YF0A 3C1RA 4O5UA 1X5EA 2YNXA 2H76A 3KJYA 2YN1A 5DALA 5ID2B 1XW5A 2X99A 4OO4A 2WULA 2R2JA 1GSSA 3DWVA 3APOA 5ECNB 5H5SA 1TKDB 3EU3A 5E59A 2O85A 2VCXA 4Q5RA 1JFUA 2LSTA 4ZL9A 2AAWA 4Q5FA 4ZB6A 4WBJA 3UOMA 3EE2A 3KP8A 4CY6A 2EC4A 1SYRA 2X8HA 2C3QA 2DJJA 3VI5A 3GNJA 5ECRB 4AJ6A 2JZTA 3TUEA 2CX3A 1Z6MA 4O5RA 4Z2TA 1OC3A 3QDNA 4LLRA 4DSQA 1PQNA 3ME7A 2NDOA 2DJ0A 4XTSA 3EVIA 2P5QA 4IP6A 3EC3A 1EWXA 4TKYA 1TK5B 3Q18A 2H1DA 1R4WA 2I81A 2LUSA 5DJLA 3UVHA 2K8SA 7GSSA 1BEDA 3Q6OA 5ECHB 2V6KA 4FYUA 4DSSB 4G10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL1 B;  2H1G A;  1TJD A;  5DCH A;  1YEX A;  1SK2 A;  2LEG A;  4JZQ A;  3DRN A;  3HVX A;  3Q74 A;  1BYE A;  1SEN A;  4MH3 A;  2QKE A;  2I4A A;  2FHE A;  4XHM A;  5AN1 A;  1AC1 A;  5JCG A;  2R6K A;  4ZBA A;  2IIY A;  1RW1 A;  1EGO A;  1OC9 B;  1M9B A;  3WGE A;  2HLS A;  4XRA A;  2M46 A;  1MEK A;  3LG6 A;  4I6X A;  1OAZ A;  4N10 A;  4WXT A;  1O6J A;  3W6G A;  3CRU A;  2VCQ A;  2O7K A;  4NV2 A;  2LJA A;  1SU9 A;  4NPB A;  1GRX A;  1HNB A;  4ML1 A;  1K0B A;  3EWL A;  10GS A;  2I9H A;  4IP1 A;  3ERG A;  3TJG A;  5KN1 A;  1SK0 A;  2VL3 A;  2EIR A;  3MWH A;  2HZE A;  1EOG A;  1WJK A;  4ZBD A;  2AV4 A;  2H6X A;  1PX7 A;  3KM6 A;  4KB3 A;  4I8B A;  1AQX A;  3LYK A;  2VCW A;  3DD3 A;  3IC4 A;  1WOU A;  1OE8 A;  2JL4 A;  3F3R A;  1EGR A;  3GL3 A;  3ED3 A;  3HJO A;  3TKS E;  3FR9 A;  2CZ3 A;  1EZK A;  2H0G A;  1J9B A;  1PA3 A;  2YV7 A;  3I6A A;  5IMF A;  9GSS A;  4QQ7 A;  5ECM B;  1F3A A;  2B1L A;  1NW2 A;  5IQY A;  2V32 A;  4BL7 A;  5F0G A;  1GSD A;  2FD3 A;  2XBI A;  2DJK A;  4HQS A;  3IBH A;  2YOI A;  1MD4 A;  2LJR A;  1JLW A;  4LL4 B;  1R7H A;  2R37 A;  3HDC A;  4RQR A;  3QAW A;  17GS A;  3F3Q A;  4MJA A;  4IBP A;  4BVY A;  3F4S A;  4YQU A;  1X5C A;  2L6D A;  2IFQ A;  1V40 A;  3GKN A;  3IR4 A;  3PR8 A;  2K9F A;  4H86 A;  2PER A;  3ZZX A;  3U6V A;  4J2F A;  2IMK A;  2OJL A;  4FO5 A;  2IJY A;  4PUR A;  2NVL A;  3J7Y k;  2GZP A;  5HR0 A;  3EMP A;  4JR6 A;  3HZ8 A;  4V1A p;  2YJH A;  4OFM A;  3VI7 A;  5E4W A;  3VUR A;  1N2A A;  4XS4 B;  4YH2 A;  3LEF A;  3GX8 A;  5INY A;  2LS5 A;  4NV5 A;  1E2Y A;  1TRU A;  1MDK A;  2DIZ A;  3LXZ A;  5EVO A;  2GS3 A;  5D8I A;  4I5Q A;  3ZIT A;  5F8B A;  5HFK A;  4HS1 A;  4F0C A;  1XWC A;  1SJI A;  1TRS A;  6GSS A;  2HZF A;  2DJ3 A;  3HYP A;  3BOA A;  4IEL A;  3TB2 A;  4ZL8 A;  3CMI A;  2RM6 A;  4HJM A;  1PRX A;  3FK8 A;  2FCH A;  4E8H A;  2PMT A;  4TR3 A;  1ZOF A;  4V2M A;  2DJ1 A;  5DAK B;  1T1V A;  2FUG 2;  4TN8 A;  1YJ6 A;  1GNE A;  4K0N A;  4J57 E;  1B9Y C;  6GSY A;  1QMV A;  3F6D A;  1F6M C;  1TW9 A;  4IKH A;  1VF3 A;  3TJF A;  1YZX A;  4X43 A;  2QC7 A;  3TJB A;  4DSS A;  1JHB A;  1XPV A;  5D9T A;  4POK A;  5IM9 A;  5D9W A;  2YWO A;  1M9A A;  3IHQ A;  1XFL A;  2L4C A;  3F9U A;  4KGI A;  3EUR A;  3JCM L;  4TR1 B;  1M2D A;  3BBY A;  1EV9 A;  4JR4 A;  3TRP A;  4CHS A;  3BJ5 A;  1OC8 A;  4IGJ A;  2VUP A;  1OC9 A;  4CW9 A;  2F3M A;  4HUA A;  2CV4 A;  4MPF A;  1E6B A;  1FHE A;  3L9S A;  3UAP A;  2FA4 A;  2JZS A;  1BJX A;  2VL2 C;  4P3Y B;  4FIW A;  4GCI A;  2F8A A;  5B6M A;  3E3E A;  3TJJ A;  4N0Z A;  2RUE A;  2VAF A;  4MAB A;  4HOJ A;  5JWO B;  3TRQ A;  1A8Y A;  3IOS A;  4Q5Q A;  5F05 A;  3VPT A;  1SJ6 A;  1S3A A;  1F3B A;  4TR0 A;  1HNC A;  3F63 A;  4JE1 A;  4MA9 A;  3M9J A;  2VCZ A;  1ML6 A;  3FY7 A;  2PUK C;  1JLV A;  3A3T A;  4WF5 A;  4NXI A;  2LQO A;  5ECL B;  3ZIJ A;  1PD2 1;  4KAE A;  2QGV A;  1FAA A;  4N0V A;  4E8E A;  3CSJ A;  2B6M A;  1M2B A;  5AIX A;  3DVW A;  2VM1 A;  4J56 E;  1GTB A;  5HFI A;  4NAX A;  5IMZ A;  2GT5 A;  3KMN A;  4KDY A;  2AUV A;  3G9B A;  1XOB A;  3ZFB A;  3CYN A;  5LD0 A;  2XPD A;  2C80 A;  1UC7 A;  1Z3E A;  3DEX A;  1G7O A;  3P2A A;  2E7P A;  4ILF A;  2F8F A;  2GLR A;  1Y25 A;  5A5K A;  3EIN A;  3K8N A;  1ZGN A;  1ILO A;  12GS A;  1WMJ A;  5B8B A;  4ML6 A;  4MJB A;  1BX9 A;  2C4J A;  3L9U A;  2FWG A;  5B7C A;  4IQA A;  3MDK A;  3VWV A;  3AY8 A;  3IAM 2;  2H0I A;  1Z7P A;  1B4P A;  13GS A;  3IV4 A;  2BTO T;  5A4U A;  4KA0 A;  4N30 A;  1GUH A;  3ZLP A;  3GX0 A;  5HR2 A;  2C8U A;  1GTI A;  4K6X A;  4PX1 A;  4EKZ A;  1K0O A;  1GNW A;  5FT3 A;  2GZZ A;  3FZ5 A;  3M9K A;  4EE0 A;  3TKQ A;  1TU7 A;  2CA8 A;  1GLP A;  4EO3 A;  4XS4 A;  2B3S A;  20GS A;  2YAN A;  1R5P A;  3HKR A;  2GSQ A;  1VF2 A;  1K0N A;  4BWS A;  4IQ1 A;  2WB9 A;  1O85 A;  5IMV A;  4MDC A;  3HVV A;  5CP1 A;  1B4Q A;  1EP8 A;  3ERF A;  2HNL A;  4ULX A;  2PPT A;  1QFN A;  4L5O A;  2MMO A;  2MMN A;  3C1S A;  2LKU A;  1VF1 A;  4L0W A;  2HFD A;  1SKW B;  4MPG A;  4MMM A;  1VRS D;  5DAK A;  2E0Q A;  1T00 A;  1YY7 A;  1MDI A;  2CVD A;  1O8W A;  3CRT A;  1SYX A;  1DSB A;  3UAR A;  1HQO A;  1A8L A;  2CX4 A;  2H30 A;  5F06 A;  4HZ2 A;  1XVQ A;  2MMZ A;  2NTO A;  5CRW A;  3APS A;  1OE7 A;  1NHY A;  2K6V A;  4TW5 A;  3UBL A;  2IMF A;  3LFL A;  2LNS A;  2N5A A;  3MSZ A;  2OE0 A;  1T4Y A;  3D22 A;  1K0A A;  4EDY A;  3WT2 A;  1Z5Y E;  4TR1 A;  2LJK A;  3FRC A;  3BCI A;  2OAD A;  1AAZ A;  2NPB A;  1FB6 A;  2JSZ A;  2PN8 A;  1U3A A;  4HI7 A;  2OE1 A;  4BPY A;  4GF0 A;  4WF4 A;  4L8E A;  4RI7 A;  3FR6 A;  1SKR B;  4XS6 A;  5CRH A;  2DC5 A;  3J7Y b;  1F9M A;  4F9Z A;  5IMA A;  1V9W A;  1TOF A;  2Z9S A;  1H75 A;  2VLT A;  4YQV A;  2YWN A;  2AB6 A;  3HCZ A;  1Z6N A;  2A2S A;  1GLQ A;  2WZ9 A;  1BG5 A;  1ABA A;  4MLY A;  3UBK A;  4V1A g;  3GA4 A;  3C7M A;  4ZB8 A;  1GSE A;  3QCP A;  1V58 A;  2DSA A;  2H8L A;  8GSS A;  5ECP B;  3HZ4 A;  2KLX A;  3ZYW A;  4XS1 A;  2RII A;  1ON4 A;  5ENU A;  2B7K A;  4K7N A;  3D5J A;  3FW2 A;  1EEJ A;  4K7O A;  4L5L A;  3RPP A;  4K1F A;  1O81 A;  1KEB A;  2CT6 A;  2O87 A;  4PGT A;  5ECK B;  1QK8 A;  3APQ A;  1TU8 A;  3I9V 2;  4RUV A;  1WPI A;  3GKM A;  5J4U A;  1SL0 B;  3G7Y A;  3LGC A;  2FLS A;  1XVW A;  1T3B A;  1M0U A;  3UL3 A;  1G6W A;  1HNA A;  3LYP A;  1XW6 A;  3CBU A;  3KZQ A;  5F07 A;  1PSQ A;  3TOT A;  2B5X A;  1PL2 A;  2ZNM A;  4MF7 A;  5CRG A;  3WT1 A;  1EOH A;  2HT9 A;  4OCF A;  4AF2 A;  4XIH A;  4POL A;  2XPE A;  1KTE A;  4NWY A;  3F6F A;  1ZYQ B;  1PX6 A;  3HA9 A;  4DVC A;  1X9M B;  1SJZ A;  4F0B A;  4PUA A;  2R5G A;  2R4V A;  1J0F A;  3A2V A;  1HYU A;  1VGL A;  4V2L A;  4K2D A;  5ELA A;  3QAG A;  2GSR A;  3EYT A;  5FHI A;  1R5A A;  2L4Q A;  3M1G A;  4TR4 A;  2RM5 A;  4EDZ A;  1O8X A;  3KP9 A;  5G2Z A;  4XCS A;  1WIK A;  1M99 A;  4IW9 A;  1JZW A;  2H1B A;  1GH2 A;  1XXU A;  6GSV A;  1XCC A;  4EC0 A;  3ZFL A;  2LNT A;  2DLX A;  2P31 A;  2B1K A;  3DKS A;  5ECS A;  1MTC A;  1G0T A;  3ZRE A;  2H71 A;  3ERW A;  4N11 A;  1M7T A;  3L0H A;  3PIN A;  3PH9 A;  3IPZ A;  4CDO A;  2CVB A;  1GUK A;  4DSR A;  3OR5 A;  3QOU A;  3SBC A;  4GLT A;  1V2A A;  4PUF C;  4F2I A;  2M80 A;  1GTA A;  5ECI B;  3QPM A;  1FVK A;  1YKA A;  2MBT A;  1W4V A;  2LRT A;  4GST A;  2GST A;  2YPM A;  3KGK A;  1MD3 A;  2CQ9 A;  4KUN A;  1QQ2 A;  2GZY A;  4OMV A;  1X5D A;  1AW9 A;  4IJI A;  5ECQ B;  2H75 A;  3H8Q A;  5ELG A;  1OYJ A;  1DE1 A;  4ZBB A;  2FA8 A;  4FYB A;  4KND A;  5HFG A;  3GH9 A;  3H4K A;  4KCE A;  3FHK A;  5CRD A;  2J9H A;  2OKA A;  4WKW A;  3G7J A;  4YAP A;  4ZL7 A;  2GTU A;  4QL9 A;  1UN2 A;  3A2X A;  2GT6 A;  4KDU A;  2PVO C;  1K0C A;  2JAC A;  5AIS A;  3O76 A;  1TXX A;  2RLI A;  5G30 A;  5GST A;  5KN3 A;  5IOW A;  4QL7 A;  2VLU A;  2IWT A;  1S3D A;  5GSS A;  1A0F A;  5GAP D;  3ZL5 A;  5G5E A;  2YWI A;  2JZR A;  1KBN A;  3VPQ A;  1TK8 B;  2ALB A;  2YZU A;  4MF6 A;  5ECO B;  3IA1 A;  3QMX A;  5D96 A;  4X1U A;  3ZVJ A;  5J9C A;  3ZTL A;  4KCA A;  2IMI A;  1WP0 A;  1ERV A;  2JAD A;  1FO5 A;  3FEU A;  1GSY A;  1LBK A;  2B7J A;  4L0U A;  1QGV A;  3TJK A;  5DJM A;  4G9H A;  1ERU A;  4FYC A;  3F8U A;  1AUC A;  1GSF A;  2ZCT A;  3RBT A;  2HSY A;  4K0G A;  1TTZ A;  2CAI A;  2OAC A;  1OVN A;  1OKD A;  3IRA A;  3WGD A;  2C0D A;  4WEY A;  2JU5 A;  3NIV A;  2PBJ A;  5G31 A;  3VLN A;  1YEP A;  4KDX A;  1PKZ A;  1SKS B;  4MH2 A;  1TDI A;  5IPG A;  3GYK A;  2F51 A;  3D21 A;  3M8N A;  5IO0 A;  5H5Q A;  1V98 A;  2WGR A;  4F03 A;  2OA7 A;  1NHO A;  3V1W A;  3GTU B;  3TKS A;  2GVP A;  4ZB9 A;  4IHU A;  3US3 A;  1SK1 A;  3GKK A;  3I69 A;  2H72 A;  4IVF A;  2V2G A;  3H79 A;  3DGQ A;  4DEJ A;  3D4M A;  4OO5 A;  1K3Y A;  4HDE A;  4KW6 A;  3VFI A;  3GL5 A;  3CTG A;  4HQZ A;  3GHA A;  2DJ2 A;  1YDK A;  2NBS A;  3RHB A;  1UA5 A;  3VWU A;  4ZIJ A;  5FWG A;  5EL8 A;  1B9X C;  3UJ1 A;  3WYW A;  1BAY A;  1R26 A;  2ON5 A;  3EU4 A;  2C0E A;  2HXK A;  2MMA A;  1XWK A;  1DBY A;  4OCE A;  4ECJ A;  2O8V B;  1ZMA A;  3PGT A;  4G2E A;  2CAQ A;  3ZMK A;  2LTK A;  4GWR A;  3ZRD A;  4PQ1 A;  1V57 A;  5B8A A;  2VL9 A;  3DML A;  3NOF A;  4PNG A;  5IMC A;  4JBB A;  2H73 A;  3LSZ A;  1T7P B;  2VIM A;  1XOA A;  4PQH A;  3KMO A;  1N8J A;  4PXO A;  3GN3 A;  2C3T A;  4KH7 A;  2AHE A;  1THO A;  3GIX A;  2M72 A;  2F9S A;  2X64 A;  3RPN A;  2N5B A;  5COH A;  5GAN D;  1AIU A;  1WRY A;  3IAS 2;  4RQX A;  5AIV A;  3LOR A;  1FOV A;  2FGX A;  19GS A;  3CSH A;  3G7I A;  1A0R P;  1CQH A;  3LJR A;  4MP4 A;  4BA7 A;  2GGT A;  1S3C A;  2L57 A;  4KSO A;  4RI6 A;  3I43 A;  1GSU A;  1JZD A;  1PN9 A;  2A2R A;  4ECC A;  4Z7X A;  2WRT A;  2TIR A;  1SL2 B;  1TI3 A;  3A2W A;  2GSS A;  3WD6 A;  2G2Q A;  1XWG A;  4MCU A;  6GSW A;  6GSX A;  1K3O A;  2LV3 A;  3UMA A;  3FKF A;  1A23 A;  2WS2 A;  1RK4 A;  4TXO B;  4Q5N A;  5JCW A;  1NSW A;  4HJ2 A;  1ZL9 A;  3FYG A;  1TP9 A;  3FZ4 A;  3HJP A;  4O7H A;  2DML A;  2HE3 A;  4LA1 A;  2WDU A;  2VO4 A;  4NMU A;  4LL1 B;  2HRF A;  3O3T A;  3SWL A;  1EV4 A;  3GMF A;  4POM A;  2VD1 A;  4I2U A;  4O32 A;  2H0H A;  4EVM A;  2TRC P;  5D93 A;  3H93 A;  1ERW A;  2ZUP A;  1B48 A;  4GTU A;  2OBK A;  1LJR A;  4ZXG A;  1ST9 A;  5HR1 A;  4MJE A;  2LQQ A;  1ZYE A;  3GSS A;  3TKP A;  1GTU A;  4GSN A;  1AQV A;  2XBQ A;  3N5O A;  3KEB A;  2L5L A;  1B8X A;  1THX A;  2HSH A;  5KN0 A;  5CNW A;  3KXO A;  1NM3 A;  3UEM A;  14GS A;  2H19 A;  4GXZ A;  1A24 A;  1FVJ A;  2WCI A;  1GWC A;  2XHF A;  4GQF A;  3D6I A;  1QXH A;  2H70 A;  1ZCP A;  1ACV A;  4PNF A;  2GQL A;  1T8E B;  1Z7R A;  5A4W A;  1YKC A;  3KIJ A;  3IK7 A;  2CZ2 A;  2H66 A;  1JZR A;  2YCD A;  3IDV A;  1HD2 A;  4BWQ A;  2IN3 A;  1SD9 A;  3M0F A;  3UIW A;  3HHV A;  1IYI A;  3TRX A;  5IO2 A;  2WJU A;  3LXT A;  4JU5 A;  1PGT A;  2JSY A;  1AXD A;  1X9W B;  1MDJ A;  2VCT A;  3GTU A;  6GST A;  1GUL A;  2BMX A;  2N5F A;  4NHW A;  4IN0 A;  2KP2 A;  3TCO A;  1GP1 A;  5EY6 A;  1XBS A;  3UVT A;  1TK0 B;  1KNG A;  4ECI A;  1A2L A;  4F82 A;  1EP7 A;  4V2N A;  2IL3 A;  1Y6E A;  3RDW A;  4EF0 A;  4WET A;  5B6N A;  5IPH A;  2DMM A;  1QUW A;  3KH9 A;  3E9J B;  3CTF A;  5J3R A;  5L71 A;  1U87 A;  3TDG A;  3ME8 A;  3D4T A;  2O89 A;  1XWA A;  5DDL A;  2P5R A;  5ABR A;  1I5G A;  3HXS A;  3MNG A;  3DVX A;  3BCK A;  1URM A;  2KOK A;  3R2Q A;  1OKT A;  2OE3 A;  5DQS A;  5J41 A;  4MZC A;  2I1U A;  5D9V A;  1M2A A;  3LWA A;  5GZZ B;  1XW9 A;  3E0U A;  2G0F A;  4D73 B;  4BVX A;  2OBI A;  5DCG A;  1K3L A;  3ZVJ D;  1TRV A;  3VWX A;  2QSI A;  2RUF A;  2HI7 A;  3GUR A;  2YWM A;  3L9V A;  2PVQ A;  2WFC A;  5JWQ B;  1USB A;  1YF1 A;  3GUS A;  4I2T A;  4PQI A;  3KTB A;  4I97 A;  22GS A;  5IIZ A;  3A5W A;  1ERT A;  1SD8 A;  2KHP A;  4TVE A;  2B5Y A;  3O6T A;  2V6O A;  5HR3 A;  5EPF A;  2GQM A;  1PKW A;  1DUG A;  1GSQ A;  4POB A;  3FZ9 A;  1O73 A;  4ID0 A;  3N9J A;  3KH7 A;  4TXO A;  1A2M A;  1Z9H A;  1JZO A;  4IJ3 A;  3W8S A;  2B5E A;  4ZIL A;  2XC2 A;  3F4T A;  2C0F A;  2CVK A;  1K0D A;  18GS A;  3ISO A;  3GV1 A;  4GQC A;  2X8C A;  3L78 A;  2DBC A;  5G5F A;  4MF5 A;  4OFN A;  3NZN A;  4OD7 A;  1Q98 A;  2ES7 A;  3P90 A;  5ID2 A;  3QD9 A;  5C04 A;  3LQ7 A;  1LU4 A;  3H1N A;  2FNO A;  3P7X A;  2E2M A;  1U88 A;  1U3I A;  1W89 A;  2L6C A;  4HU9 A;  5DBQ A;  2VL2 A;  3GFK A;  5IOX A;  4LMW A;  2FWE A;  3DIE A;  3Q19 A;  1FG4 A;  2KP1 A;  2ON7 A;  3IXR A;  1F2E A;  3KD0 A;  6GSU A;  2HYX A;  4LMV A;  3CSI A;  3MAK A;  2YZH A;  5DAL B;  4EUY A;  3D0Z A;  3FR3 A;  2PU9 C;  5AGY A;  2L59 A;  3DYR A;  1BQ7 A;  1RQM A;  4MK3 A;  4ECB A;  3C71 A;  4IS0 A;  4K7I A;  3P8W A;  4MZW A;  1T4Z A;  2K8V A;  1EEM A;  2FWF A;  3GKX A;  1I9D A;  3WGX A;  4ACS A;  1WWJ A;  4KE3 A;  5G1L A;  1J08 A;  2C1Y A;  2C3N A;  2J23 A;  2YP6 A;  4TXV A;  4TOP A;  1U6T A;  4AJ7 A;  4YAV A;  5KN2 A;  2MZC A;  4O92 A;  1ZZY A;  3C8E A;  3KCM A;  3ZIV A;  3EMX A;  5CRE A;  3IE3 A;  4ISD A;  3ZML A;  3U5R E;  3GH6 A;  2FY6 A;  3F4R A;  2IMD A;  2MBS A;  5JCU A;  3TGZ A;  2AYT A;  3W8J A;  4EL1 A;  2V41 A;  3TKR A;  4MJC A;  3VWW A;  5H5R A;  4HZ4 A;  4G19 A;  3BD2 A;  5D73 A;  3FZA A;  1K0M A;  4GSS A;  3M3M A;  1YQ1 A;  2YV9 A;  1XIY A;  2IME A;  5KEJ A;  2VCV A;  2VM2 A;  4WR5 A;  4AJ8 A;  5J9B A;  5C00 A;  3TOU A;  4OFT A;  1Q4J A;  2I3Y A;  4GRF A;  4HEA 2;  5DQY A;  2MYG A;  1F37 A;  2VOC A;  1H4O A;  4AGS A;  2AJQ B;  3CXG A;  4JED A;  5CYY A;  2BJX A;  4K8M A;  4X0X A;  5HQP A;  3RHC A;  1G6Y A;  1WE0 A;  1XWB A;  1G7E A;  2FWH A;  1X9S B;  1UVZ A;  5A4V A;  4D73 A;  1IYH A;  3DXB A;  3HY2 A;  1FW1 A;  3C73 A;  3HJM A;  2A4V A;  2GDR A;  5LNK e;  2VD0 A;  1TI1 A;  4WR4 A;  2C0G A;  2HZE B;  5LCZ A;  1A2J A;  2GQK A;  3QFB C;  1DE2 A;  2PGT A;  2K18 A;  1PL1 A;  2LRN A;  2L5O A;  3QR6 A;  2X8G A;  1XZO A;  4K9Z A;  1FB0 A;  2PWJ A;  4NHZ A;  2DIY A;  5DVB A;  2EIQ A;  2H01 A;  5J5N A;  5CAX A;  4HU7 A;  3GRX A;  2VLV A;  2R3X A;  3F0I A;  3RAZ A;  4MZB A;  4FH8 A;  2H74 A;  3VK9 A;  4YQM A;  4KSM A;  3TKS C;  2LRC A;  4KX4 A;  3QFA C;  2H6Z A;  2HRN A;  4EXJ A;  1AQW A;  2V1M A;  2REM A;  1O7U A;  2H6Y A;  4TRX A;  2EIO A;  5CO3 A;  2P0G A;  1GL8 A;  2TRX A;  3S9F A;  2YJ7 A;  2IPA A;  3QAV A;  5IMD A;  3KTL A;  2H1A A;  2D2Z A;  1X0R A;  1C72 A;  3L4N A;  5D9X A;  3HD5 A;  3IK9 A;  4WBR D;  2IFQ B;  1TRW A;  2KUC A;  1VF4 A;  1PMT A;  2E2G A;  5G1K A;  4JRR A;  1CQG A;  3HVS A;  11GS A;  3GST A;  5JWR B;  4OWY A;  4XRD A;  16GS A;  1GUM A;  1YF0 A;  3C1R A;  1X5E A;  2YNX A;  2H76 A;  3KJY A;  2YN1 A;  5DAL A;  5ID2 B;  1XW5 A;  2X99 A;  4OO4 A;  2WUL A;  2R2J A;  1GSS A;  3DWV A;  3APO A;  5ECN B;  5H5S A;  1TKD B;  3EU3 A;  5E59 A;  2O85 A;  2VCX A;  4Q5R A;  1JFU A;  2LST A;  4ZL9 A;  2AAW A;  4Q5F A;  4ZB6 A;  4WBJ A;  3UOM A;  3EE2 A;  3KP8 A;  2EC4 A;  1SYR A;  2X8H A;  2C3Q A;  2DJJ A;  3VI5 A;  3GNJ A;  5ECR B;  4AJ6 A;  2JZT A;  3TUE A;  2CX3 A;  1Z6M A;  4O5R A;  1OC3 A;  3QDN A;  4LLR A;  4DSQ A;  1PQN A;  3ME7 A;  2NDO A;  2DJ0 A;  4XTS A;  3EVI A;  2P5Q A;  4IP6 A;  3EC3 A;  1EWX A;  4TKY A;  1TK5 B;  3Q18 A;  2H1D A;  1R4W A;  2I81 A;  2LUS A;  5DJL A;  3UVH A;  2K8S A;  7GSS A;  1BED A;  3Q6O A;  5ECH B;  2V6K A;  4FYU A;  4DSS B;  4G10 A; 
#chains in the Genus database with same CATH topology
 1SL1 B;  5KOW A;  2H1G A;  1TJD A;  5DCH A;  1YEX A;  1SK2 A;  2LEG A;  4JZQ A;  3DRN A;  3HVX A;  3Q74 A;  1BYE A;  1SEN A;  4MH3 A;  2QKE A;  2I4A A;  2FHE A;  4XHM A;  5AN1 A;  1AC1 A;  5JCG A;  2R6K A;  4ZBA A;  2IIY A;  1RW1 A;  1EGO A;  1OC9 B;  1M9B A;  3WGE A;  2HLS A;  2A4H A;  4XRA A;  2M46 A;  1MEK A;  3LG6 A;  4I6X A;  1OAZ A;  4N10 A;  4WXT A;  1O6J A;  3W6G A;  3CRU A;  2VCQ A;  2O7K A;  4NV2 A;  2LJA A;  1SU9 A;  4NPB A;  1GRX A;  1HNB A;  2HSM A;  4ML1 A;  1K0B A;  3EWL A;  10GS A;  2I9H A;  4IP1 A;  3ERG A;  3TJG A;  5KN1 A;  1S3R A;  1SK0 A;  2VL3 A;  2EIR A;  3MWH A;  2HZE A;  1EOG A;  1WJK A;  4ZBD A;  2AV4 A;  2H6X A;  1PX7 A;  3KM6 A;  4KB3 A;  4I8B A;  1AQX A;  3LYK A;  2VCW A;  3DD3 A;  3IC4 A;  1WOU A;  3R3E A;  1OE8 A;  2JL4 A;  3F3R A;  1EGR A;  3GL3 A;  3ED3 A;  3HJO A;  3TKS E;  3FR9 A;  2CZ3 A;  1EZK A;  2H0G A;  1J9B A;  1PA3 A;  2YV7 A;  3I6A A;  5IMF A;  9GSS A;  4QQ7 A;  5ECM B;  1F3A A;  2B1L A;  1NW2 A;  5IQY A;  2V32 A;  4BL7 A;  5F0G A;  1GSD A;  2FD3 A;  2XBI A;  2DJK A;  4HQS A;  3IBH A;  2YOI A;  1MD4 A;  2LJR A;  1JLW A;  4LL4 B;  1R7H A;  2R37 A;  3HDC A;  4RQR A;  3QAW A;  17GS A;  3F3Q A;  4MJA A;  4IBP A;  4BVY A;  3F4S A;  4YQU A;  1X5C A;  2L6D A;  2IFQ A;  1V40 A;  3GKN A;  3IR4 A;  3PR8 A;  2K9F A;  4H86 A;  2UZ8 A;  2PER A;  3ZZX A;  3U6V A;  4J2F A;  2IMK A;  2OJL A;  4FO5 A;  2IJY A;  4PUR A;  2NVL A;  3J7Y k;  2GZP A;  5HR0 A;  3EMP A;  4JR6 A;  3HZ8 A;  4V1A p;  2YJH A;  4OFM A;  3VI7 A;  5E4W A;  3VUR A;  1N2A A;  3A5I A;  4XS4 B;  4YH2 A;  3LEF A;  3GX8 A;  5INY A;  2LS5 A;  4NV5 A;  1E2Y A;  1TRU A;  1MDK A;  2DIZ A;  3LXZ A;  5EVO A;  2GS3 A;  5D8I A;  4I5Q A;  3ZIT A;  5F8B A;  5HFK A;  4HS1 A;  4F0C A;  1XWC A;  1SJI A;  1TRS A;  6GSS A;  4KF9 A;  2HZF A;  2DJ3 A;  3HYP A;  1ZYN A;  3BOA A;  4IEL A;  3TB2 A;  4ZL8 A;  2DKH A;  3CMI A;  2RM6 A;  4HJM A;  1PRX A;  3FK8 A;  2FCH A;  4E8H A;  2PMT A;  4TR3 A;  1ZOF A;  4V2M A;  2DJ1 A;  5DAK B;  1T1V A;  2FUG 2;  4TN8 A;  1YJ6 A;  1GNE A;  4K0N A;  4J57 E;  1B9Y C;  6GSY A;  1QMV A;  3F6D A;  1F6M C;  1TW9 A;  4IKH A;  1VF3 A;  3TJF A;  1YZX A;  4X43 A;  2QC7 A;  3TJB A;  4DSS A;  1JHB A;  1XPV A;  5D9T A;  4POK A;  5IM9 A;  5D9W A;  2YWO A;  1M9A A;  3IHQ A;  1XFL A;  2L4C A;  3F9U A;  5BRT A;  4KGI A;  3EUR A;  3JCM L;  4TR1 B;  1M2D A;  3BBY A;  1EV9 A;  4JR4 A;  3TRP A;  4CHS A;  3BJ5 A;  1OC8 A;  4IGJ A;  2VUP A;  1OC9 A;  4CW9 A;  2F3M A;  4HUA A;  2CV4 A;  4MPF A;  1E6B A;  1FHE A;  3L9S A;  3UAP A;  2FA4 A;  2JZS A;  1BJX A;  2VL2 C;  4P3Y B;  4FIW A;  4GCI A;  2F8A A;  5B6M A;  3E3E A;  3TJJ A;  4N0Z A;  2RUE A;  2VAF A;  4MAB A;  4HOJ A;  5JWO B;  3TRQ A;  1A8Y A;  3IOS A;  4Q5Q A;  5F05 A;  3VPT A;  1SJ6 A;  1S3A A;  1F3B A;  4TR0 A;  1HNC A;  3F63 A;  4JE1 A;  4MA9 A;  3M9J A;  2VCZ A;  1ML6 A;  3FY7 A;  2PUK C;  1JLV A;  3A3T A;  4WF5 A;  4NXI A;  2LQO A;  5ECL B;  3ZIJ A;  1PD2 1;  4KAE A;  2DKI A;  2QGV A;  2QA2 A;  1FAA A;  4N0V A;  4E8E A;  3CSJ A;  2B6M A;  1M2B A;  5AIX A;  3DVW A;  2VM1 A;  4J56 E;  1GTB A;  5HFI A;  4NAX A;  5IMZ A;  2GT5 A;  3KMN A;  4KDY A;  2AUV A;  3G9B A;  1XOB A;  3ZFB A;  3CYN A;  5LD0 A;  2XPD A;  2C80 A;  1UC7 A;  1Z3E A;  3DEX A;  1G7O A;  3IHG A;  3P2A A;  2E7P A;  4ILF A;  2F8F A;  2GLR A;  1Y25 A;  5A5K A;  3EIN A;  3K8N A;  1ZGN A;  1ILO A;  12GS A;  1WMJ A;  5B8B A;  4ML6 A;  4MJB A;  1BX9 A;  2C4J A;  3L9U A;  2FWG A;  5B7C A;  4IQA A;  3MDK A;  4X4J A;  3VWV A;  3AY8 A;  3IAM 2;  2H0I A;  1Z7P A;  1B4P A;  13GS A;  3IV4 A;  2BTO T;  5A4U A;  4KA0 A;  4N30 A;  1GUH A;  3ZLP A;  3GX0 A;  5HR2 A;  2C8U A;  1GTI A;  4K6X A;  4PX1 A;  4EKZ A;  1K0O A;  1GNW A;  5FT3 A;  2GZZ A;  3FZ5 A;  3M9K A;  4EE0 A;  3TKQ A;  1TU7 A;  2CA8 A;  1GLP A;  4FQU A;  4EO3 A;  4XS4 A;  2B3S A;  20GS A;  2YAN A;  1R5P A;  3HKR A;  2GSQ A;  1VF2 A;  1K0N A;  4BWS A;  4IQ1 A;  2WB9 A;  1O85 A;  5IMV A;  4MDC A;  3HVV A;  5CP1 A;  1B4Q A;  1EP8 A;  3ERF A;  2HNL A;  4ULX A;  2PPT A;  1QFN A;  4L5O A;  2MMO A;  2MMN A;  3C1S A;  2LKU A;  1VF1 A;  4L0W A;  2HFD A;  1SKW B;  4MPG A;  4MMM A;  1VRS D;  5DAK A;  2E0Q A;  1T00 A;  1YY7 A;  2R0C A;  1MDI A;  2CVD A;  1O8W A;  3CRT A;  1SYX A;  1DSB A;  3UAR A;  3MYD A;  1HQO A;  1A8L A;  2CX4 A;  3MIX A;  3LW9 A;  2H30 A;  5F06 A;  4HZ2 A;  1XVQ A;  2MMZ A;  2NTO A;  5CRW A;  3APS A;  1OE7 A;  3HVN A;  1NHY A;  2K6V A;  4TW5 A;  3UBL A;  2IMF A;  3LFL A;  2R0P A;  2LNS A;  2N5A A;  3MSZ A;  2OE0 A;  1T4Y A;  3D22 A;  1K0A A;  4EDY A;  3WT2 A;  1Z5Y E;  4TR1 A;  2LJK A;  3FRC A;  3BCI A;  2OAD A;  1AAZ A;  2NPB A;  1FB6 A;  2JSZ A;  2PN8 A;  1U3A A;  4HI7 A;  2OE1 A;  4BPY A;  4GF0 A;  4WF4 A;  4L8E A;  4RI7 A;  3FR6 A;  4YKG A;  1SKR B;  4XS6 A;  5CRH A;  1ZYP A;  2DC5 A;  3J7Y b;  1F9M A;  4F9Z A;  5IMA A;  1V9W A;  1TOF A;  2Z9S A;  1H75 A;  2VLT A;  4YQV A;  2YWN A;  2AB6 A;  3HCZ A;  1Z6N A;  2A2S A;  1GLQ A;  2WZ9 A;  1BG5 A;  1ABA A;  4MLY A;  3UBK A;  4Z2U A;  4V1A g;  3GA4 A;  3C7M A;  4ZB8 A;  1GSE A;  3QCP A;  1V58 A;  2DSA A;  2H8L A;  8GSS A;  5ECP B;  3HZ4 A;  2KLX A;  3ZYW A;  4XS1 A;  2RII A;  1ON4 A;  5ENU A;  2B7K A;  4K7N A;  3D5J A;  3FW2 A;  1M3J A;  1EEJ A;  4K7O A;  4L5L A;  3RPP A;  4K1F A;  1O81 A;  1KEB A;  2CT6 A;  3FMW A;  2O87 A;  4PGT A;  5ECK B;  1QK8 A;  3APQ A;  1TU8 A;  3I9V 2;  4RUV A;  1WPI A;  3GKM A;  5J4U A;  1SL0 B;  4USS A;  3G7Y A;  3LGC A;  2FLS A;  1XVW A;  1T3B A;  1M0U A;  3UL3 A;  1G6W A;  1HNA A;  3LYP A;  1XW6 A;  3CBU A;  3KZQ A;  5F07 A;  1PSQ A;  3TOT A;  2B5X A;  1PL2 A;  2ZNM A;  4MF7 A;  5CRG A;  3WT1 A;  1EOH A;  2HT9 A;  4OCF A;  4AF2 A;  4XIH A;  4POL A;  2XPE A;  1KTE A;  4NWY A;  4A5P A;  3F6F A;  1ZYQ B;  1PX6 A;  3HA9 A;  4DVC A;  1X9M B;  1SJZ A;  4F0B A;  4PUA A;  2R5G A;  2R4V A;  1J0F A;  3A2V A;  1HYU A;  1VGL A;  4V2L A;  4K2D A;  5ELA A;  3QAG A;  2GSR A;  3EYT A;  5FHI A;  1R5A A;  2L4Q A;  3M1G A;  4TR4 A;  2RM5 A;  4EDZ A;  1O8X A;  3KP9 A;  5G2Z A;  4XCS A;  1WIK A;  1M99 A;  4IW9 A;  1JZW A;  2H1B A;  1GH2 A;  1XXU A;  6GSV A;  1XCC A;  4EC0 A;  3ZFL A;  2LNT A;  2DLX A;  2P31 A;  2B1K A;  4K2X A;  3DKS A;  5ECS A;  1MTC A;  1G0T A;  3ZRE A;  2H71 A;  3ERW A;  4N11 A;  1M7T A;  3L0H A;  3PIN A;  3PH9 A;  3IPZ A;  4CDO A;  2CVB A;  4K5R A;  1GUK A;  4DSR A;  3OR5 A;  4PTS A;  3QOU A;  3SBC A;  4GLT A;  1V2A A;  4PUF C;  4F2I A;  2M80 A;  4EIQ A;  1GTA A;  5ECI B;  4K5S A;  3QPM A;  1FVK A;  1YKA A;  2MBT A;  1W4V A;  2LRT A;  4GST A;  2GST A;  2YPM A;  3KGK A;  1MD3 A;  2CQ9 A;  4KUN A;  4CY8 A;  1QQ2 A;  2GZY A;  4OMV A;  1X5D A;  1AW9 A;  4IJI A;  5ECQ B;  2H75 A;  3H8Q A;  5ELG A;  1OYJ A;  1DE1 A;  4ZBB A;  2FA8 A;  4FYB A;  4KND A;  5HFG A;  3GH9 A;  3H4K A;  4KCE A;  3FHK A;  5CRD A;  2J9H A;  2OKA A;  4WKW A;  3G7J A;  4YAP A;  4ZL7 A;  2GTU A;  4QL9 A;  1UN2 A;  3A2X A;  2GT6 A;  4G0I A;  4KDU A;  2PVO C;  1K0C A;  2JAC A;  5AIS A;  3O76 A;  1TXX A;  2RLI A;  5G30 A;  5GST A;  5KN3 A;  5IOW A;  4QL7 A;  2VLU A;  2IWT A;  1S3D A;  5GSS A;  1A0F A;  4HSC X;  5GAP D;  3ZL5 A;  5G5E A;  2YWI A;  2JZR A;  1KBN A;  3VPQ A;  1TK8 B;  2ALB A;  2YZU A;  4MF6 A;  5ECO B;  3IA1 A;  3QMX A;  5D96 A;  4X1U A;  3ZVJ A;  5J9C A;  3ZTL A;  4KCA A;  2IMI A;  1WP0 A;  1ERV A;  2JAD A;  1FO5 A;  3FEU A;  1GSY A;  1LBK A;  2B7J A;  4L0U A;  1QGV A;  3TJK A;  5DJM A;  4G9H A;  1ERU A;  3IC8 A;  2R0G A;  4FYC A;  3F8U A;  1PN0 A;  1AUC A;  1GSF A;  2ZCT A;  3RBT A;  2HSY A;  4K0G A;  1TTZ A;  2CAI A;  2OAC A;  1OVN A;  1OKD A;  3IRA A;  3WGD A;  2C0D A;  4WEY A;  2JU5 A;  3NIV A;  2PBJ A;  5G31 A;  3VLN A;  1YEP A;  4KDX A;  1PKZ A;  1SKS B;  4MH2 A;  1TDI A;  5IPG A;  3GYK A;  2F51 A;  3D21 A;  3M8N A;  5IO0 A;  5H5Q A;  1V98 A;  2WGR A;  4F03 A;  2OA7 A;  1NHO A;  3V1W A;  3GTU B;  3TKS A;  2GVP A;  4ZB9 A;  4IHU A;  3US3 A;  1SK1 A;  3GKK A;  3I69 A;  2H72 A;  4IVF A;  2V2G A;  3H79 A;  3DGQ A;  4DEJ A;  3D4M A;  4OO5 A;  1K3Y A;  4HDE A;  4KW6 A;  3VFI A;  3GL5 A;  3CTG A;  4HQZ A;  3GHA A;  2DJ2 A;  1YDK A;  2NBS A;  3RHB A;  1UA5 A;  3VWU A;  4ZIJ A;  5FWG A;  5EL8 A;  1B9X C;  3UJ1 A;  3WYW A;  1BAY A;  1R26 A;  2ON5 A;  3EU4 A;  2C0E A;  2HXK A;  2MMA A;  1XWK A;  1DBY A;  4OCE A;  4ECJ A;  2O8V B;  1ZMA A;  3PGT A;  4G2E A;  5KOX A;  2CAQ A;  3ZMK A;  2LTK A;  4GWR A;  3ZRD A;  4PQ1 A;  1V57 A;  5B8A A;  2VL9 A;  3DML A;  1XG8 A;  3NOF A;  4PNG A;  5IMC A;  4JBB A;  2H73 A;  3LSZ A;  1T7P B;  2VIM A;  1XOA A;  4PQH A;  3KMO A;  1N8J A;  4PXO A;  3GN3 A;  2C3T A;  4KH7 A;  2AHE A;  1THO A;  4BIK A;  3GIX A;  2M72 A;  2F9S A;  2X64 A;  3RPN A;  2N5B A;  5COH A;  4BVX B;  5GAN D;  1AIU A;  1WRY A;  3IAS 2;  4RQX A;  5AIV A;  3LOR A;  1FOV A;  2FGX A;  19GS A;  3CSH A;  3G7I A;  1A0R P;  1CQH A;  3LJR A;  4MP4 A;  4BA7 A;  2GGT A;  1S3C A;  2L57 A;  4KSO A;  4RI6 A;  3I43 A;  1GSU A;  1JZD A;  1PN9 A;  2A2R A;  4ECC A;  4Z7X A;  2WRT A;  2TIR A;  1SL2 B;  1TI3 A;  3A2W A;  2GSS A;  3WD6 A;  2G2Q A;  1XWG A;  4MCU A;  6GSW A;  6GSX A;  1K3O A;  2LV3 A;  3UMA A;  3FKF A;  1A23 A;  2WS2 A;  1RK4 A;  4TXO B;  4Q5N A;  5JCW A;  1NSW A;  4HJ2 A;  1ZL9 A;  3FYG A;  1TP9 A;  3FZ4 A;  3HJP A;  4O7H A;  2DML A;  2HE3 A;  4LA1 A;  2WDU A;  2VO4 A;  4NMU A;  4LL1 B;  2HRF A;  3O3T A;  3SWL A;  1EV4 A;  3GMF A;  4POM A;  2VD1 A;  4I2U A;  4O32 A;  2H0H A;  4EVM A;  2TRC P;  3H93 A;  5D93 A;  1ERW A;  2ZUP A;  1B48 A;  4GTU A;  2OBK A;  1LJR A;  4ZXG A;  1ST9 A;  5HR1 A;  4MJE A;  2LQQ A;  1ZYE A;  3GSS A;  3TKP A;  1GTU A;  4GSN A;  1AQV A;  2XBQ A;  3N5O A;  3KEB A;  2L5L A;  1B8X A;  1THX A;  2HSH A;  5KN0 A;  5CNW A;  3KXO A;  1NM3 A;  3UEM A;  14GS A;  2H19 A;  4GXZ A;  1A24 A;  1FVJ A;  2WCI A;  1GWC A;  2XHF A;  4GQF A;  3D6I A;  1QXH A;  2H70 A;  1ZCP A;  1ACV A;  4PNF A;  2GQL A;  1T8E B;  2HRA A;  1Z7R A;  5A4W A;  1YKC A;  3KIJ A;  3IK7 A;  2CZ2 A;  2H66 A;  1JZR A;  2YCD A;  4G0K A;  3IDV A;  1HD2 A;  4BWQ A;  2IN3 A;  1SD9 A;  3M0F A;  3UIW A;  3HHV A;  1IYI A;  3TRX A;  5IO2 A;  2WJU A;  3LXT A;  4JU5 A;  1PGT A;  2JSY A;  1AXD A;  1X9W B;  1MDJ A;  2VCT A;  3GTU A;  6GST A;  1GUL A;  2BMX A;  2N5F A;  4NHW A;  4IN0 A;  2KP2 A;  3TCO A;  2X4A A;  1GP1 A;  5EY6 A;  1XBS A;  3UVT A;  1TK0 B;  1KNG A;  4ECI A;  1A2L A;  4F82 A;  1EP7 A;  4V2N A;  2IL3 A;  1Y6E A;  3RDW A;  1FOH A;  4EF0 A;  4WET A;  5B6N A;  5IPH A;  2DMM A;  1QUW A;  3KH9 A;  3E9J B;  3CTF A;  5J3R A;  5L71 A;  1U87 A;  3TDG A;  3ME8 A;  3D4T A;  2O89 A;  1XWA A;  5DDL A;  2P5R A;  5ABR A;  1I5G A;  3HXS A;  3MNG A;  3DVX A;  3BCK A;  1URM A;  2KOK A;  3R2Q A;  1OKT A;  2OE3 A;  5DQS A;  5J41 A;  4MNN A;  4MZC A;  5BMU A;  2I1U A;  5D9V A;  1M2A A;  3EPT A;  3LWA A;  5GZZ B;  4YKF A;  2HRK A;  1XW9 A;  3E0U A;  2G0F A;  4D73 B;  4BVX A;  2OBI A;  5DCG A;  1K3L A;  3ZVJ D;  1TRV A;  3VWX A;  4Z2R A;  2QSI A;  2RUF A;  2HI7 A;  3GUR A;  2YWM A;  3L9V A;  2PVQ A;  2WFC A;  5JWQ B;  1USB A;  1YF1 A;  3GUS A;  4I2T A;  4PQI A;  3KTB A;  4I97 A;  22GS A;  5IIZ A;  3A5W A;  1ERT A;  1SD8 A;  2KHP A;  4ICY A;  2B5Y A;  3O6T A;  2V6O A;  4TVE A;  5HR3 A;  5EPF A;  2GQM A;  1PKW A;  1DUG A;  1GSQ A;  4POB A;  3FZ9 A;  1O73 A;  4ID0 A;  3N9J A;  3KH7 A;  4TXO A;  1A2M A;  1Z9H A;  1JZO A;  4IJ3 A;  3W8S A;  2B5E A;  4ZIL A;  2XC2 A;  3F4T A;  2C0F A;  2CVK A;  1K0D A;  18GS A;  3ISO A;  3GV1 A;  4GQC A;  2X8C A;  3L78 A;  2DBC A;  5G5F A;  4MF5 A;  4OFN A;  3NZN A;  4OD7 A;  1Q98 A;  2ES7 A;  3P90 A;  5ID2 A;  3QD9 A;  5C04 A;  3LQ7 A;  1LU4 A;  3H1N A;  2FNO A;  3P7X A;  2E2M A;  1U88 A;  1U3I A;  1W89 A;  2L6C A;  4HU9 A;  5DBQ A;  2VL2 A;  3GFK A;  5IOX A;  4LMW A;  2FWE A;  3DIE A;  3Q19 A;  1FG4 A;  2KP1 A;  2ON7 A;  3IXR A;  1F2E A;  3KD0 A;  6GSU A;  2HYX A;  4LMV A;  3CSI A;  3MAK A;  2YZH A;  5DAL B;  4EUY A;  3D0Z A;  3FR3 A;  2PU9 C;  5AGY A;  3CQF A;  2L59 A;  3DYR A;  1BQ7 A;  1RQM A;  4MK3 A;  4ECB A;  3C71 A;  4G0L A;  4IS0 A;  4K7I A;  3P8W A;  4MZW A;  1T4Z A;  2K8V A;  1EEM A;  2FWF A;  3GKX A;  1I9D A;  3WGX A;  4ACS A;  1WWJ A;  4KE3 A;  5G1L A;  1J08 A;  2C1Y A;  2C3N A;  2J23 A;  1PFO A;  2YP6 A;  4TXV A;  4TOP A;  1U6T A;  4AJ7 A;  4YAV A;  5KN2 A;  2MZC A;  4O92 A;  1ZZY A;  3C8E A;  3KCM A;  3ZIV A;  3EMX A;  5CRE A;  3IE3 A;  4ISD A;  3ZML A;  3U5R E;  3GH6 A;  2FY6 A;  3F4R A;  2IMD A;  2MBS A;  5JCU A;  3TGZ A;  2AYT A;  3W8J A;  4EL1 A;  2V41 A;  3TKR A;  4MJC A;  3VWW A;  5H5R A;  4HZ4 A;  4G19 A;  2A2P A;  3BD2 A;  5D73 A;  3FZA A;  1K0M A;  4GSS A;  3M3M A;  1YQ1 A;  2YV9 A;  1XIY A;  2IME A;  5KEJ A;  2VCV A;  2VM2 A;  4WR5 A;  4AJ8 A;  5J9B A;  5C00 A;  3TOU A;  4OFT A;  1Q4J A;  2I3Y A;  4GRF A;  4HEA 2;  5DQY A;  2MYG A;  1F37 A;  2VOC A;  1H4O A;  4AGS A;  2AJQ B;  3CXG A;  4JED A;  5CYY A;  2BJX A;  4K8M A;  4X0X A;  5HQP A;  3RHC A;  1G6Y A;  1WE0 A;  1XWB A;  1G7E A;  2FWH A;  1X9S B;  1UVZ A;  5A4V A;  4D73 A;  1IYH A;  3DXB A;  3HY2 A;  1FW1 A;  3C73 A;  3HJM A;  2A4V A;  2GDR A;  5LNK e;  2VD0 A;  1TI1 A;  4WR4 A;  2C0G A;  2HZE B;  5LCZ A;  1A2J A;  2GQK A;  3QFB C;  1DE2 A;  2PGT A;  4O5Q A;  2K18 A;  1PL1 A;  2QA1 A;  2LRN A;  2L5O A;  3QR6 A;  2X8G A;  1XZO A;  4K9Z A;  1FB0 A;  2PWJ A;  4NHZ A;  2DIY A;  5DVB A;  2X49 A;  2EIQ A;  2H01 A;  5J5N A;  5CAX A;  4HU7 A;  3GRX A;  2VLV A;  2R3X A;  3F0I A;  3RAZ A;  4MZB A;  4FH8 A;  2H74 A;  3VK9 A;  4YQM A;  4KSM A;  3TKS C;  2LRC A;  4KX4 A;  3QFA C;  4BL7 B;  2H6Z A;  2HRN A;  4EXJ A;  1AQW A;  2V1M A;  2REM A;  1O7U A;  2H6Y A;  4TRX A;  2EIO A;  5CO3 A;  2P0G A;  1GL8 A;  2TRX A;  3S9F A;  2YJ7 A;  2IPA A;  3QAV A;  5IMD A;  3KTL A;  2H1A A;  2D2Z A;  1X0R A;  1C72 A;  3L4N A;  3PPU A;  5D9X A;  3HD5 A;  3IK9 A;  4BVY B;  4WBR D;  2IFQ B;  1TRW A;  2KUC A;  1VF4 A;  1PMT A;  2E2G A;  1M3I A;  5G1K A;  4JRR A;  1CQG A;  3HVS A;  11GS A;  3GST A;  5JWR B;  4OWY A;  4EIP A;  4XRD A;  16GS A;  1GUM A;  1YF0 A;  3C1R A;  4O5U A;  1X5E A;  2YNX A;  2H76 A;  3KJY A;  2YN1 A;  5DAL A;  5ID2 B;  1XW5 A;  2X99 A;  4OO4 A;  2WUL A;  2R2J A;  1GSS A;  3DWV A;  3APO A;  5ECN B;  5H5S A;  1TKD B;  3EU3 A;  5E59 A;  2O85 A;  2VCX A;  4Q5R A;  1JFU A;  2LST A;  4ZL9 A;  2AAW A;  4Q5F A;  4ZB6 A;  4WBJ A;  3UOM A;  3EE2 A;  3KP8 A;  4CY6 A;  2EC4 A;  1SYR A;  2X8H A;  2C3Q A;  2DJJ A;  3VI5 A;  3GNJ A;  5ECR B;  4AJ6 A;  2JZT A;  3TUE A;  2CX3 A;  1Z6M A;  4O5R A;  4Z2T A;  1OC3 A;  3QDN A;  4LLR A;  4DSQ A;  1PQN A;  3ME7 A;  2NDO A;  2DJ0 A;  4XTS A;  3EVI A;  2P5Q A;  4IP6 A;  3EC3 A;  1EWX A;  4TKY A;  1TK5 B;  3Q18 A;  2H1D A;  1R4W A;  2I81 A;  2LUS A;  5DJL A;  3UVH A;  2K8S A;  7GSS A;  1BED A;  3Q6O A;  5ECH B;  2V6K A;  4FYU A;  4DSS B;  4G10 A; 
#chains in the Genus database with same CATH homology
 1SL1 B;  5KOW A;  2H1G A;  1TJD A;  5DCH A;  1YEX A;  1SK2 A;  2LEG A;  4JZQ A;  3DRN A;  3HVX A;  3Q74 A;  1BYE A;  1SEN A;  4MH3 A;  2QKE A;  2I4A A;  2FHE A;  4XHM A;  5AN1 A;  1AC1 A;  5JCG A;  2R6K A;  4ZBA A;  2IIY A;  1RW1 A;  1EGO A;  1OC9 B;  1M9B A;  3WGE A;  2HLS A;  2A4H A;  4XRA A;  2M46 A;  1MEK A;  3LG6 A;  4I6X A;  1OAZ A;  4N10 A;  4WXT A;  1O6J A;  3W6G A;  3CRU A;  2VCQ A;  2O7K A;  4NV2 A;  2LJA A;  1SU9 A;  4NPB A;  1GRX A;  1HNB A;  2HSM A;  4ML1 A;  1K0B A;  3EWL A;  10GS A;  2I9H A;  4IP1 A;  3ERG A;  3TJG A;  5KN1 A;  1SK0 A;  2VL3 A;  2EIR A;  3MWH A;  2HZE A;  1EOG A;  1WJK A;  4ZBD A;  2AV4 A;  2H6X A;  1PX7 A;  3KM6 A;  4KB3 A;  4I8B A;  1AQX A;  3LYK A;  2VCW A;  3DD3 A;  3IC4 A;  1WOU A;  3R3E A;  1OE8 A;  2JL4 A;  3F3R A;  1EGR A;  3GL3 A;  3ED3 A;  3HJO A;  3TKS E;  3FR9 A;  2CZ3 A;  1EZK A;  2H0G A;  1J9B A;  1PA3 A;  2YV7 A;  3I6A A;  5IMF A;  9GSS A;  4QQ7 A;  5ECM B;  1F3A A;  2B1L A;  1NW2 A;  5IQY A;  2V32 A;  4BL7 A;  5F0G A;  1GSD A;  2FD3 A;  2XBI A;  2DJK A;  4HQS A;  3IBH A;  2YOI A;  1MD4 A;  2LJR A;  1JLW A;  4LL4 B;  1R7H A;  2R37 A;  3HDC A;  4RQR A;  3QAW A;  17GS A;  3F3Q A;  4MJA A;  4IBP A;  4BVY A;  3F4S A;  4YQU A;  1X5C A;  2L6D A;  2IFQ A;  1V40 A;  3GKN A;  3IR4 A;  3PR8 A;  2K9F A;  4H86 A;  2UZ8 A;  2PER A;  3ZZX A;  3U6V A;  4J2F A;  2IMK A;  2OJL A;  4FO5 A;  2IJY A;  4PUR A;  2NVL A;  3J7Y k;  2GZP A;  5HR0 A;  3EMP A;  4JR6 A;  3HZ8 A;  4V1A p;  2YJH A;  4OFM A;  3VI7 A;  5E4W A;  3VUR A;  1N2A A;  3A5I A;  4XS4 B;  4YH2 A;  3LEF A;  3GX8 A;  5INY A;  2LS5 A;  4NV5 A;  1E2Y A;  1TRU A;  1MDK A;  2DIZ A;  3LXZ A;  5EVO A;  2GS3 A;  5D8I A;  4I5Q A;  3ZIT A;  5F8B A;  5HFK A;  4HS1 A;  4F0C A;  1XWC A;  1SJI A;  1TRS A;  6GSS A;  4KF9 A;  2HZF A;  2DJ3 A;  3HYP A;  1ZYN A;  3BOA A;  4IEL A;  3TB2 A;  4ZL8 A;  2DKH A;  3CMI A;  2RM6 A;  4HJM A;  1PRX A;  3FK8 A;  2FCH A;  4E8H A;  2PMT A;  4TR3 A;  1ZOF A;  4V2M A;  2DJ1 A;  5DAK B;  1T1V A;  2FUG 2;  4TN8 A;  1YJ6 A;  1GNE A;  4K0N A;  4J57 E;  1B9Y C;  6GSY A;  1QMV A;  3F6D A;  1F6M C;  1TW9 A;  4IKH A;  1VF3 A;  3TJF A;  1YZX A;  4X43 A;  2QC7 A;  3TJB A;  4DSS A;  1JHB A;  1XPV A;  5D9T A;  4POK A;  5IM9 A;  5D9W A;  2YWO A;  1M9A A;  3IHQ A;  1XFL A;  2L4C A;  3F9U A;  5BRT A;  4KGI A;  3EUR A;  3JCM L;  4TR1 B;  1M2D A;  3BBY A;  1EV9 A;  4JR4 A;  3TRP A;  4CHS A;  3BJ5 A;  1OC8 A;  4IGJ A;  2VUP A;  1OC9 A;  4CW9 A;  2F3M A;  4HUA A;  2CV4 A;  4MPF A;  1E6B A;  1FHE A;  3L9S A;  3UAP A;  2FA4 A;  2JZS A;  1BJX A;  2VL2 C;  4P3Y B;  4FIW A;  4GCI A;  2F8A A;  5B6M A;  3E3E A;  3TJJ A;  4N0Z A;  2RUE A;  2VAF A;  4MAB A;  4HOJ A;  5JWO B;  3TRQ A;  1A8Y A;  3IOS A;  4Q5Q A;  5F05 A;  3VPT A;  1SJ6 A;  1S3A A;  1F3B A;  4TR0 A;  1HNC A;  3F63 A;  4JE1 A;  4MA9 A;  3M9J A;  2VCZ A;  1ML6 A;  3FY7 A;  2PUK C;  1JLV A;  3A3T A;  4WF5 A;  4NXI A;  2LQO A;  5ECL B;  3ZIJ A;  1PD2 1;  4KAE A;  2DKI A;  2QGV A;  2QA2 A;  1FAA A;  4N0V A;  4E8E A;  3CSJ A;  2B6M A;  1M2B A;  5AIX A;  3DVW A;  2VM1 A;  4J56 E;  1GTB A;  5HFI A;  4NAX A;  5IMZ A;  2GT5 A;  3KMN A;  4KDY A;  2AUV A;  3G9B A;  1XOB A;  3ZFB A;  3CYN A;  5LD0 A;  2XPD A;  2C80 A;  1UC7 A;  1Z3E A;  3DEX A;  1G7O A;  3IHG A;  3P2A A;  2E7P A;  4ILF A;  2F8F A;  2GLR A;  1Y25 A;  5A5K A;  3EIN A;  3K8N A;  1ZGN A;  1ILO A;  12GS A;  1WMJ A;  5B8B A;  4ML6 A;  4MJB A;  1BX9 A;  2C4J A;  3L9U A;  2FWG A;  5B7C A;  4IQA A;  3MDK A;  4X4J A;  3VWV A;  3AY8 A;  3IAM 2;  2H0I A;  1Z7P A;  1B4P A;  13GS A;  3IV4 A;  2BTO T;  5A4U A;  4KA0 A;  4N30 A;  1GUH A;  3ZLP A;  3GX0 A;  5HR2 A;  2C8U A;  1GTI A;  4K6X A;  4PX1 A;  4EKZ A;  1K0O A;  1GNW A;  5FT3 A;  2GZZ A;  3FZ5 A;  3M9K A;  4EE0 A;  3TKQ A;  1TU7 A;  2CA8 A;  1GLP A;  4FQU A;  4EO3 A;  4XS4 A;  2B3S A;  20GS A;  2YAN A;  1R5P A;  3HKR A;  2GSQ A;  1VF2 A;  1K0N A;  4BWS A;  4IQ1 A;  2WB9 A;  1O85 A;  5IMV A;  4MDC A;  3HVV A;  5CP1 A;  1B4Q A;  1EP8 A;  3ERF A;  2HNL A;  4ULX A;  2PPT A;  1QFN A;  4L5O A;  2MMO A;  2MMN A;  3C1S A;  2LKU A;  1VF1 A;  4L0W A;  2HFD A;  1SKW B;  4MPG A;  4MMM A;  1VRS D;  5DAK A;  2E0Q A;  1T00 A;  1YY7 A;  2R0C A;  1MDI A;  2CVD A;  1O8W A;  3CRT A;  1SYX A;  1DSB A;  3UAR A;  3MYD A;  1HQO A;  1A8L A;  2CX4 A;  3MIX A;  3LW9 A;  2H30 A;  5F06 A;  4HZ2 A;  1XVQ A;  2MMZ A;  2NTO A;  5CRW A;  3APS A;  1OE7 A;  1NHY A;  2K6V A;  4TW5 A;  3UBL A;  2IMF A;  3LFL A;  2R0P A;  2LNS A;  2N5A A;  3MSZ A;  2OE0 A;  1T4Y A;  3D22 A;  1K0A A;  4EDY A;  3WT2 A;  1Z5Y E;  4TR1 A;  2LJK A;  3FRC A;  3BCI A;  2OAD A;  1AAZ A;  2NPB A;  1FB6 A;  2JSZ A;  2PN8 A;  1U3A A;  4HI7 A;  2OE1 A;  4BPY A;  4GF0 A;  4WF4 A;  4L8E A;  4RI7 A;  3FR6 A;  4YKG A;  1SKR B;  4XS6 A;  5CRH A;  1ZYP A;  2DC5 A;  3J7Y b;  1F9M A;  4F9Z A;  5IMA A;  1V9W A;  1TOF A;  2Z9S A;  1H75 A;  2VLT A;  4YQV A;  2YWN A;  2AB6 A;  3HCZ A;  1Z6N A;  2A2S A;  1GLQ A;  2WZ9 A;  1BG5 A;  1ABA A;  4MLY A;  3UBK A;  4Z2U A;  4V1A g;  3GA4 A;  3C7M A;  4ZB8 A;  1GSE A;  3QCP A;  1V58 A;  2DSA A;  2H8L A;  8GSS A;  5ECP B;  3HZ4 A;  2KLX A;  3ZYW A;  4XS1 A;  2RII A;  1ON4 A;  5ENU A;  2B7K A;  4K7N A;  3D5J A;  3FW2 A;  1EEJ A;  4K7O A;  4L5L A;  3RPP A;  4K1F A;  1O81 A;  1KEB A;  2CT6 A;  3FMW A;  2O87 A;  4PGT A;  5ECK B;  1QK8 A;  3APQ A;  1TU8 A;  3I9V 2;  4RUV A;  1WPI A;  3GKM A;  5J4U A;  1SL0 B;  4USS A;  3G7Y A;  3LGC A;  2FLS A;  1XVW A;  1T3B A;  1M0U A;  3UL3 A;  1G6W A;  1HNA A;  3LYP A;  1XW6 A;  3CBU A;  3KZQ A;  5F07 A;  1PSQ A;  3TOT A;  2B5X A;  1PL2 A;  2ZNM A;  4MF7 A;  5CRG A;  3WT1 A;  1EOH A;  2HT9 A;  4OCF A;  4AF2 A;  4XIH A;  4POL A;  2XPE A;  1KTE A;  4NWY A;  4A5P A;  3F6F A;  1ZYQ B;  1PX6 A;  3HA9 A;  4DVC A;  1X9M B;  1SJZ A;  4F0B A;  4PUA A;  2R5G A;  2R4V A;  1J0F A;  3A2V A;  1HYU A;  1VGL A;  4V2L A;  4K2D A;  5ELA A;  3QAG A;  2GSR A;  3EYT A;  5FHI A;  1R5A A;  2L4Q A;  3M1G A;  4TR4 A;  2RM5 A;  4EDZ A;  1O8X A;  3KP9 A;  5G2Z A;  4XCS A;  1WIK A;  1M99 A;  4IW9 A;  1JZW A;  2H1B A;  1GH2 A;  1XXU A;  6GSV A;  1XCC A;  4EC0 A;  3ZFL A;  2LNT A;  2DLX A;  2P31 A;  2B1K A;  4K2X A;  3DKS A;  5ECS A;  1MTC A;  1G0T A;  3ZRE A;  2H71 A;  3ERW A;  4N11 A;  1M7T A;  3L0H A;  3PIN A;  3PH9 A;  3IPZ A;  4CDO A;  2CVB A;  4K5R A;  1GUK A;  4DSR A;  3OR5 A;  4PTS A;  3QOU A;  3SBC A;  4GLT A;  1V2A A;  4PUF C;  4F2I A;  2M80 A;  4EIQ A;  1GTA A;  5ECI B;  4K5S A;  3QPM A;  1FVK A;  1YKA A;  2MBT A;  1W4V A;  2LRT A;  4GST A;  2GST A;  2YPM A;  3KGK A;  1MD3 A;  2CQ9 A;  4KUN A;  4CY8 A;  1QQ2 A;  2GZY A;  4OMV A;  1X5D A;  1AW9 A;  4IJI A;  5ECQ B;  2H75 A;  3H8Q A;  5ELG A;  1OYJ A;  1DE1 A;  4ZBB A;  2FA8 A;  4FYB A;  4KND A;  5HFG A;  3GH9 A;  3H4K A;  4KCE A;  3FHK A;  5CRD A;  2J9H A;  2OKA A;  4WKW A;  3G7J A;  4YAP A;  4ZL7 A;  2GTU A;  4QL9 A;  1UN2 A;  3A2X A;  2GT6 A;  4G0I A;  4KDU A;  2PVO C;  1K0C A;  2JAC A;  5AIS A;  3O76 A;  1TXX A;  2RLI A;  5G30 A;  5GST A;  5KN3 A;  5IOW A;  4QL7 A;  2VLU A;  2IWT A;  1S3D A;  5GSS A;  1A0F A;  5GAP D;  3ZL5 A;  5G5E A;  2YWI A;  2JZR A;  1KBN A;  3VPQ A;  1TK8 B;  2ALB A;  2YZU A;  4MF6 A;  5ECO B;  3IA1 A;  3QMX A;  5D96 A;  4X1U A;  3ZVJ A;  5J9C A;  3ZTL A;  4KCA A;  2IMI A;  1WP0 A;  1ERV A;  2JAD A;  1FO5 A;  3FEU A;  1GSY A;  1LBK A;  2B7J A;  4L0U A;  1QGV A;  3TJK A;  5DJM A;  4G9H A;  1ERU A;  3IC8 A;  2R0G A;  4FYC A;  3F8U A;  1PN0 A;  1AUC A;  1GSF A;  2ZCT A;  3RBT A;  2HSY A;  4K0G A;  1TTZ A;  2CAI A;  2OAC A;  1OVN A;  1OKD A;  3IRA A;  3WGD A;  2C0D A;  4WEY A;  2JU5 A;  3NIV A;  2PBJ A;  5G31 A;  3VLN A;  1YEP A;  4KDX A;  1PKZ A;  1SKS B;  4MH2 A;  1TDI A;  5IPG A;  3GYK A;  2F51 A;  3D21 A;  3M8N A;  5IO0 A;  5H5Q A;  1V98 A;  2WGR A;  4F03 A;  2OA7 A;  1NHO A;  3V1W A;  3GTU B;  3TKS A;  2GVP A;  4ZB9 A;  4IHU A;  3US3 A;  1SK1 A;  3GKK A;  3I69 A;  2H72 A;  4IVF A;  2V2G A;  3H79 A;  3DGQ A;  4DEJ A;  3D4M A;  4OO5 A;  1K3Y A;  4HDE A;  4KW6 A;  3VFI A;  3GL5 A;  3CTG A;  4HQZ A;  3GHA A;  2DJ2 A;  1YDK A;  2NBS A;  3RHB A;  1UA5 A;  3VWU A;  4ZIJ A;  5FWG A;  5EL8 A;  1B9X C;  3UJ1 A;  3WYW A;  1BAY A;  1R26 A;  2ON5 A;  3EU4 A;  2C0E A;  2HXK A;  2MMA A;  1XWK A;  1DBY A;  4OCE A;  4ECJ A;  2O8V B;  1ZMA A;  3PGT A;  4G2E A;  5KOX A;  2CAQ A;  3ZMK A;  2LTK A;  4GWR A;  3ZRD A;  4PQ1 A;  1V57 A;  5B8A A;  2VL9 A;  3DML A;  3NOF A;  4PNG A;  5IMC A;  4JBB A;  2H73 A;  3LSZ A;  1T7P B;  2VIM A;  1XOA A;  4PQH A;  3KMO A;  1N8J A;  4PXO A;  3GN3 A;  2C3T A;  4KH7 A;  2AHE A;  1THO A;  3GIX A;  2M72 A;  2F9S A;  2X64 A;  3RPN A;  2N5B A;  5COH A;  4BVX B;  5GAN D;  1AIU A;  1WRY A;  3IAS 2;  4RQX A;  5AIV A;  3LOR A;  1FOV A;  2FGX A;  19GS A;  3CSH A;  3G7I A;  1A0R P;  1CQH A;  3LJR A;  4MP4 A;  4BA7 A;  2GGT A;  1S3C A;  2L57 A;  4KSO A;  4RI6 A;  3I43 A;  1GSU A;  1JZD A;  1PN9 A;  2A2R A;  4ECC A;  4Z7X A;  2WRT A;  2TIR A;  1SL2 B;  1TI3 A;  3A2W A;  2GSS A;  3WD6 A;  2G2Q A;  1XWG A;  4MCU A;  6GSW A;  6GSX A;  1K3O A;  2LV3 A;  3UMA A;  3FKF A;  1A23 A;  2WS2 A;  1RK4 A;  4TXO B;  4Q5N A;  5JCW A;  1NSW A;  4HJ2 A;  1ZL9 A;  3FYG A;  1TP9 A;  3FZ4 A;  3HJP A;  4O7H A;  2DML A;  2HE3 A;  4LA1 A;  2WDU A;  2VO4 A;  4NMU A;  4LL1 B;  2HRF A;  3O3T A;  3SWL A;  1EV4 A;  3GMF A;  4POM A;  2VD1 A;  4I2U A;  4O32 A;  2H0H A;  4EVM A;  2TRC P;  3H93 A;  5D93 A;  1ERW A;  2ZUP A;  1B48 A;  4GTU A;  2OBK A;  1LJR A;  4ZXG A;  1ST9 A;  5HR1 A;  4MJE A;  2LQQ A;  1ZYE A;  3GSS A;  3TKP A;  1GTU A;  4GSN A;  1AQV A;  2XBQ A;  3N5O A;  3KEB A;  2L5L A;  1B8X A;  1THX A;  2HSH A;  5KN0 A;  5CNW A;  3KXO A;  1NM3 A;  3UEM A;  14GS A;  2H19 A;  4GXZ A;  1A24 A;  1FVJ A;  2WCI A;  1GWC A;  2XHF A;  4GQF A;  3D6I A;  1QXH A;  2H70 A;  1ZCP A;  1ACV A;  4PNF A;  2GQL A;  1T8E B;  2HRA A;  1Z7R A;  5A4W A;  1YKC A;  3KIJ A;  3IK7 A;  2CZ2 A;  2H66 A;  1JZR A;  2YCD A;  4G0K A;  3IDV A;  1HD2 A;  4BWQ A;  2IN3 A;  1SD9 A;  3M0F A;  3UIW A;  3HHV A;  1IYI A;  3TRX A;  5IO2 A;  2WJU A;  3LXT A;  4JU5 A;  1PGT A;  2JSY A;  1AXD A;  1X9W B;  1MDJ A;  2VCT A;  3GTU A;  6GST A;  1GUL A;  2BMX A;  2N5F A;  4NHW A;  4IN0 A;  2KP2 A;  3TCO A;  2X4A A;  1GP1 A;  5EY6 A;  1XBS A;  3UVT A;  1TK0 B;  1KNG A;  4ECI A;  1A2L A;  4F82 A;  1EP7 A;  4V2N A;  2IL3 A;  1Y6E A;  3RDW A;  1FOH A;  4EF0 A;  4WET A;  5B6N A;  5IPH A;  2DMM A;  1QUW A;  3KH9 A;  3E9J B;  3CTF A;  5J3R A;  5L71 A;  1U87 A;  3TDG A;  3ME8 A;  3D4T A;  2O89 A;  1XWA A;  5DDL A;  2P5R A;  5ABR A;  1I5G A;  3HXS A;  3MNG A;  3DVX A;  3BCK A;  1URM A;  2KOK A;  3R2Q A;  1OKT A;  2OE3 A;  5DQS A;  5J41 A;  4MNN A;  4MZC A;  5BMU A;  2I1U A;  5D9V A;  1M2A A;  3EPT A;  3LWA A;  5GZZ B;  4YKF A;  2HRK A;  1XW9 A;  3E0U A;  2G0F A;  4D73 B;  4BVX A;  2OBI A;  5DCG A;  1K3L A;  3ZVJ D;  1TRV A;  3VWX A;  4Z2R A;  2QSI A;  2RUF A;  2HI7 A;  3GUR A;  2YWM A;  3L9V A;  2PVQ A;  2WFC A;  5JWQ B;  1USB A;  1YF1 A;  3GUS A;  4I2T A;  4PQI A;  3KTB A;  4I97 A;  22GS A;  5IIZ A;  3A5W A;  1ERT A;  1SD8 A;  2KHP A;  4ICY A;  2B5Y A;  3O6T A;  2V6O A;  4TVE A;  5HR3 A;  5EPF A;  2GQM A;  1PKW A;  1DUG A;  1GSQ A;  4POB A;  3FZ9 A;  1O73 A;  4ID0 A;  3N9J A;  3KH7 A;  4TXO A;  1A2M A;  1Z9H A;  1JZO A;  4IJ3 A;  3W8S A;  2B5E A;  4ZIL A;  2XC2 A;  3F4T A;  2C0F A;  2CVK A;  1K0D A;  18GS A;  3ISO A;  3GV1 A;  4GQC A;  2X8C A;  3L78 A;  2DBC A;  5G5F A;  4MF5 A;  4OFN A;  3NZN A;  4OD7 A;  1Q98 A;  2ES7 A;  3P90 A;  5ID2 A;  3QD9 A;  5C04 A;  3LQ7 A;  1LU4 A;  3H1N A;  2FNO A;  3P7X A;  2E2M A;  1U88 A;  1U3I A;  1W89 A;  2L6C A;  4HU9 A;  5DBQ A;  2VL2 A;  3GFK A;  5IOX A;  4LMW A;  2FWE A;  3DIE A;  3Q19 A;  1FG4 A;  2KP1 A;  2ON7 A;  3IXR A;  1F2E A;  3KD0 A;  6GSU A;  2HYX A;  4LMV A;  3CSI A;  3MAK A;  2YZH A;  5DAL B;  4EUY A;  3D0Z A;  3FR3 A;  2PU9 C;  5AGY A;  2L59 A;  3DYR A;  1BQ7 A;  1RQM A;  4MK3 A;  4ECB A;  3C71 A;  4G0L A;  4IS0 A;  4K7I A;  3P8W A;  4MZW A;  1T4Z A;  2K8V A;  1EEM A;  2FWF A;  3GKX A;  1I9D A;  3WGX A;  4ACS A;  1WWJ A;  4KE3 A;  5G1L A;  1J08 A;  2C1Y A;  2C3N A;  2J23 A;  2YP6 A;  4TXV A;  4TOP A;  1U6T A;  4AJ7 A;  4YAV A;  5KN2 A;  2MZC A;  4O92 A;  1ZZY A;  3C8E A;  3KCM A;  3ZIV A;  3EMX A;  5CRE A;  3IE3 A;  4ISD A;  3ZML A;  3U5R E;  3GH6 A;  2FY6 A;  3F4R A;  2IMD A;  2MBS A;  5JCU A;  3TGZ A;  2AYT A;  3W8J A;  4EL1 A;  2V41 A;  3TKR A;  4MJC A;  3VWW A;  5H5R A;  4HZ4 A;  4G19 A;  2A2P A;  3BD2 A;  5D73 A;  3FZA A;  1K0M A;  4GSS A;  3M3M A;  1YQ1 A;  2YV9 A;  1XIY A;  2IME A;  5KEJ A;  2VCV A;  2VM2 A;  4WR5 A;  4AJ8 A;  5J9B A;  5C00 A;  3TOU A;  4OFT A;  1Q4J A;  2I3Y A;  4GRF A;  4HEA 2;  5DQY A;  2MYG A;  1F37 A;  2VOC A;  1H4O A;  4AGS A;  2AJQ B;  3CXG A;  4JED A;  5CYY A;  2BJX A;  4K8M A;  4X0X A;  5HQP A;  3RHC A;  1G6Y A;  1WE0 A;  1XWB A;  1G7E A;  2FWH A;  1X9S B;  1UVZ A;  5A4V A;  4D73 A;  1IYH A;  3DXB A;  3HY2 A;  1FW1 A;  3C73 A;  3HJM A;  2A4V A;  2GDR A;  5LNK e;  2VD0 A;  1TI1 A;  4WR4 A;  2C0G A;  2HZE B;  5LCZ A;  1A2J A;  2GQK A;  3QFB C;  1DE2 A;  2PGT A;  4O5Q A;  2K18 A;  1PL1 A;  2QA1 A;  2LRN A;  2L5O A;  3QR6 A;  2X8G A;  1XZO A;  4K9Z A;  1FB0 A;  2PWJ A;  4NHZ A;  2DIY A;  5DVB A;  2X49 A;  2EIQ A;  2H01 A;  5J5N A;  5CAX A;  4HU7 A;  3GRX A;  2VLV A;  2R3X A;  3F0I A;  3RAZ A;  4MZB A;  4FH8 A;  2H74 A;  3VK9 A;  4YQM A;  4KSM A;  3TKS C;  2LRC A;  4KX4 A;  3QFA C;  4BL7 B;  2H6Z A;  2HRN A;  4EXJ A;  1AQW A;  2V1M A;  2REM A;  1O7U A;  2H6Y A;  4TRX A;  2EIO A;  5CO3 A;  2P0G A;  1GL8 A;  2TRX A;  3S9F A;  2YJ7 A;  2IPA A;  3QAV A;  5IMD A;  3KTL A;  2H1A A;  2D2Z A;  1X0R A;  1C72 A;  3L4N A;  3PPU A;  5D9X A;  3HD5 A;  3IK9 A;  4BVY B;  4WBR D;  2IFQ B;  1TRW A;  2KUC A;  1VF4 A;  1PMT A;  2E2G A;  5G1K A;  4JRR A;  1CQG A;  3HVS A;  11GS A;  3GST A;  5JWR B;  4OWY A;  4EIP A;  4XRD A;  16GS A;  1GUM A;  1YF0 A;  3C1R A;  4O5U A;  1X5E A;  2YNX A;  2H76 A;  3KJY A;  2YN1 A;  5DAL A;  5ID2 B;  1XW5 A;  2X99 A;  4OO4 A;  2WUL A;  2R2J A;  1GSS A;  3DWV A;  3APO A;  5ECN B;  5H5S A;  1TKD B;  3EU3 A;  5E59 A;  2O85 A;  2VCX A;  4Q5R A;  1JFU A;  2LST A;  4ZL9 A;  2AAW A;  4Q5F A;  4ZB6 A;  4WBJ A;  3UOM A;  3EE2 A;  3KP8 A;  4CY6 A;  2EC4 A;  1SYR A;  2X8H A;  2C3Q A;  2DJJ A;  3VI5 A;  3GNJ A;  5ECR B;  4AJ6 A;  2JZT A;  3TUE A;  2CX3 A;  1Z6M A;  4O5R A;  4Z2T A;  1OC3 A;  3QDN A;  4LLR A;  4DSQ A;  1PQN A;  3ME7 A;  2NDO A;  2DJ0 A;  4XTS A;  3EVI A;  2P5Q A;  4IP6 A;  3EC3 A;  1EWX A;  4TKY A;  1TK5 B;  3Q18 A;  2H1D A;  1R4W A;  2I81 A;  2LUS A;  5DJL A;  3UVH A;  2K8S A;  7GSS A;  1BED A;  3Q6O A;  5ECH B;  2V6K A;  4FYU A;  4DSS B;  4G10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...