2IKQA

Crystal structure of mouse sts-1 pgm domain in complex with phosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
KRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTVIDHVYCSPSLRCVQTAHNILKGLQQDNHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPVSKLAISESYDTYINRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Suppressor of T-cell receptor signaling 1
publication title A Phosphatase Activity of Sts-1 Contributes to the Suppression of TCR Signaling
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein, immune system
total genus 77
structure length 262
sequence length 262
chains with identical sequence B, M
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2ikqA01
1DKMA 3D6AA 4HBZA 1SKBA 4D4KA 1QFXA 1T8PA 3LG2A 2I1VB 3EOZA 5CU7A 1V37A 1DKNA 3GP5A 2P6MA 2P79A 3R7AA 1RIIA 3K4PA 4FDTA 4ARUA 2HHJA 1C7ZA 1DKOA 3HJGA 3E9EA 3C7TA 4ODIA 3QPWA 2GFIA 3QPVA 1RPTA 3FDZB 2H4ZA 2P77A 2H52A 1C81A 1DKLA 3LNTA 1QHFA 4JOBA 2P9ZA 3O0TA 4GPZA 1TIPA 2YN2A 4D4LA 5AJYA 1H2FA 1E58A 3FJYA 3D4IA 1CVIA 2YN0A 3IT1A 3EZNA 2EKBA 3GP3A 1H2EA 2H0QA 3QPUA 2P2YA 5AJWA 2BIFA 3KKKA 1YJXA 2DWPA 3FDZA 3MBKA 3F3KA 5CDHA 2P9YA 1SKAA 4D4JA 1XQ9A 2WU0A 4IJ6A 4MA4A 2EKZA 4PZ9A 4D4MA 4PZAA 1V7QA 4AROA 2OWDA 1UJCA 5AJXA 2P2ZA 3IT2A 2P78A 2EOAA 5AJVB 3F2IA 3DCYA 4EMBA 3D8HA 1K6MA 2IKQA 1SK8A 2WNHA 3E9DA 3NTLA 3PGMA 1YFKA 4TSRA 5PGMA 4PGMA 1FBTA 1BIFA 3BIFA 4QIHA 4FDUA 2OWEA 3IT0A 2RFLA 3MXOA 2PA0A 2ENUA 4EO9A 2P75A 4GPIB 1RPAA 1QWOA 2P9FA 1FZTA 1ND6A 2ENWA 5HR5A 4ARSA 2F90A 2HPAA 2DWOA 3E9CA 5AJZA 2AXNA 1E59A 3K4QA 3ZHCA 4JODA 4E3WA 5HTKA 1UJBA 1BQ3A 1ND5A 3LL4A 1IHPA 5CX4A 3NFYA 4ARVA 2QNIA 1BQ4A 3OI7A 2P30A 3GW8A 4JOCA 1SK9A 1DKQA 5AK0A 3IT3A 1EBBA 4IJ5A 2A6PA 1C80A 3DB1A 1NT4A 2H4XA 1DKPA 2P6OA 2HIAA 2A9JA 2WNIA
chains in the Genus database with same CATH superfamily
1VCIA 1WEHA 5K8CA 2UV8A 4TTTS 3CZCA 4M8IA 1U2SA 2GJ9A 4LDAA 2WHRA 3CLKA 1PKXA 3NT2A 1RLIA 3D3EA 4IZHA 1FYFA 3D6JA 2NUPA 4Q4HB 2V6FA 3BGVA 3IMKA 3SKXA 4ZYTA 5JAOA 3QPAA 1EQAA 2RGBA 5BN3B 2ZBPA 3C3DA 1TM5E 2NSHA 4ZJPA 1Z0SA 4HVLA 5JECA 2QTZA 2HRDA 1E7RA 5C31A 2EFJA 3AKDA 4QBTA 1NVEA 1HKHA 1X8JA 3BWBA 4IHKA 1HPLA 4CKYA 4Z5XA 2V45A 3P9KA 1SHJA 4YAWA 1IY2A 5K05A 1YKFA 5LXTF 1PJ4A 1ZGJA 2X3FA 2BPOA 1L3IA 2F00A 4KXVA 1LWOA 3D3KA 3KP1A 4EHDA 5A6VA 1CNMA 1C0LA 1PT9A 1Y3AA 2VBFA 3L0PA 4AY5A 3PWKA 4CIDA 5HE9A 4F86A 1U1DA 1P4GA 1J1IA 4HH3C 3TQCA 1Q3HA 2VDUE 3LH5A 3TIGA 3UATA 1R4NA 3G2NA 2YTZA 1N2CE 1CIPA 3IQXA 4LC0A 1T15A 4DJJA 2BUBA 4FXOA 2I1WA 2J9XB 4RA9A 4H7HA 3UQYS 1JHDA 2I33A 4GMDA 4WUTA 2JLVA 4M36A 3LC1O 1XRPA 3JR7A 2WJWA 1A82A 4HGZA 1V6CA 1JTVA 3CF0A 2EWVA 2QY9A 1GCUA 1M1ZA 1KFJB 1KORA 2Q6TA 4EW3A 2PN1A 3RAFC 1RQXA 1IBRA 4XI9A 5K51A 3HFGA 5EJ9A 2Q3LA 4W5TA 1EFVB 2PBLA 2QORA 2QSJA 3FDXA 1Y4AE 5CDHA 1D04A 1OTXA 1L5FA 1OWMA 1CKEA 1QRRA 2EFGA 2H4FA 2WTAA 3CX4A 3EXHA 2HO4A 1MOQA 4O8ZA 3ZW7A 4ZCMA 1ODIA 2FLKA 1SVWA 3OTQA 4FCWA 3FSRA 4JT2A 2QQEA 1G2OA 3QLTA 4INJA 1JEAA 2WI8A 3MBIA 2HLPA 3TNFA 1L5RA 4KYUA 3K0BA 1P1CA 1TVMA 5AYVA 5DX8A 1KJ9A 1I14A 5K01A 1PWXA 3CLUD 3F5FA 4CM4B 4U2BA 2GN1A 5EP4A 3Q98A 1R0CA 3GT4A 4BB6A 3DDZX 4EKGA 2ZUSA 3IKTA 5C5EA 4FD3A 4MPDA 3F74A 4WAUA 4X7MA 5L9AA 1U2GA 4ILKA 5ILQA 3LQKA 3L1JA 2ENUA 4US2R 1AN0A 4AKGA 4EG3A 5HOQA 3LV8A 4IKEA 3QHAA 2B1QA 4G09A 2HIMA 2AMLA 4FNMA 4E94A 1G8AA 2OG1A 1UMKA 2X2OA 3IR6A 4IZIA 4ZVTA 1BGWA 1E59A 3RT9A 2BFEB 2ZJ2A 4P22A 4TM7A 1X1QA 4BN4A 5FEUA 1IAVA 2MDTA 1A7AA 3VKGA 1MN6A 3GGJA 2NZXA 3LUFA 4DLVA 5TQ0B 4X6UA 3RIGA 1XKLA 3IV9A 1RACA 4OU4A 5ICSA 3ZY6A 2BW0A 2DT5A 2ZYVX 4CG1A 1MABB 4LQ4A 3UC9A 3P4YA 2X41A 5DLPA 2ZQYA 3DZBA 4J7CA 2XDYA 2TMGA 2GK3A 4XIJA 3RVMA 1X1CA 1KA9H 1QIHA 2IY9A 2O1SA 3MIIA 3OE1A 3L02A 3OZDA 3GJQA 4PLYA 4AURA 1I2CA 3EOAI 3SBOA 1RAEA 1B6GA 2C4UA 1JDTA 5ERXA 1TEZA 4DA7A 1FYWA 4MTLA 1VHQA 4OQFA 4DM3A 2EYUA 3QEBZ 2O06A 4WL0A 4JSYA 2O8BA 1HNZB 4KIJA 1CDDA 1S0UA 3P0HA 1JDUA 5KSWB 2C97A 1XMJA 2RKBA 4F4FA 1KHTA 5HK9A 3BD9A 3S1LA 5G3ZA 4BNMA 3EXG2 1J5PA 4PQGA 5F5NA 2CXTA 3MWJA 1L8QA 1QR2A 3JQBA 4W4TA 2ZGVA 2VPZA 5ALGA 4FGJA 3L49A 5CA0A 1V7CA 2VXBA 3Q2OA 4WD3A 1PGQA 1NR1A 3QE3A 1U1CA 3ZCVA 1USWA 1YR2A 4Y2XA 3JWEA 1EM6A 3NHFA 1P9NA 1NNI1 2JCXA 5JT1A 2HA2A 4R31A 1H69A 1KEEB 4O29A 4E21A 3EZ7A 1FSGA 5JRJA 2VP4A 4LFCB 3A11A 1OLUB 4S0ZA 4DRXA 1CVIA 4LGYA 4DJ5X 1XTRA 4BJ3A 3OJWA 1MT0A 1RI4A 3OJCA 4JVMA 1AURA 2VYVD 2VSOA 5B55A 4WV3A 2DSTA 1YQXA 3ASZA 1FJ2A 4GU5A 3ZWBA 4I8DA 3CG4A 4F8JA 1A96A 2QLTA 3RC3A 4D4JA 1DJQA 2HPVA 2BZSA 4PZYA 4AKIA 2QX7A 4INZA 4CLHA 1D8AA 4DVJA 1GADO 2HJWA 1OJ7A 3IQDB 2B98A 1LC0A 1XTUA 2C5HA 1UEXC 3MINB 4RPJA 4E07A 5H4GA 3JS5A 5FYQA 1EQ2A 2FQXA 1PUIA 2NZWA 3DVQX 3I5AA 3NTLA 1PTJA 4IMIB 4D56A 4EW1A 1BIFA 4HWRA 1K92A 2V7UA 1LTKA 2Z5LA 1UBNA 2HBQA 3TG8A 4YT2A 1QIFA 4U2CA 1NP3A 1PGOA 2GBIA 4KNWA 4ZVNA 4JJAA 1TKBA 3GOHA 1DLIA 4DCMA 1H3NA 3OU2A 1SUSA 4KGDA 1BDHA 2PMCA 4M9UA 3T0IA 4FYIA 4UCQA 1XU7A 1Y80A 2GBFA 5ECWA 4B7AA 4E70A 1RQ7A 4NSNA 4RMGA 4UM7A 4Y6RA 4AN1A 3ENVA 3DG9A 2GJSA 1XK7A 2DWQA 3L84A 4Q6WA 2NSLA 1B43A 3DFKA 3UVEA 4TSKA 1TUGA 1N7IA 1E9FA 5ENDA 3QUQA 4HQNA 4YMSA 3RTDA 3O9ZA 3HVKA 3QX3A 2Y2VA 4FCTA 2G0AA 5IUNC 2ACVA 1W9HA 2G9ZA 3DWGA 4EG7A 4YCBA 4GL2A 3GFPA 1W85A 2Y4NA 1JDZA 3IDAA 3Q3HA 4ACBA 1ESDA 1G20E 1YH3A 3T7AA 3B1ZA 1GM5A 4JS0A 1UXGA 4IJ5A 3FVVA 1MRNA 2CXNA 3I04M 1YDWA 4MYUA 4ZEOA 2HZ7A 5JS6A 2OK8A 2Z56A 1K5DA 2I1QA 2R6AA 3GMIA 4YRLA 2XCLA 5DHUA 2FZCA 4QBIA 3T34A 1R74A 8OHMA 1CR2A 4OXNA 5BN5A 4X8OA 2WSIA 3RHTA 2ZTLA 2ZBGA 4E1AA 4D74A 1QO7A 4GYKA 1QFXA 3L77A 4GZ5A 2NMVA 2I1VB 3U3KA 1YK1A 1EVIA 3JRNA 1PK8A 4LXHA 2FPSA 1C4OA 4BO3A 5HQTA 1E94E 3TGLA 2PRKA 1BE0A 4RAQA 1VIVA 2NVUA 2YRXA 4X6YA 5J2UA 1XL1A 2C9OA 4EYEA 3U6BA 4BV9A 1FUEA 4EQ6B 1WXHA 3BGIA 3U7HB 1ZR2A 1CERA 4IXNA 1KYWA 1P2VA 1P5ZB 1YZFA 2PIDA 1SOUA 1W0KA 4X90A 4K9LA 1KJZA 4R1OA 4HB4A 4BQEA 2X0KA 5ARCA 2YCLA 2XXAA 1CYEA 2QMZA 4JJZA 1GZSA 1N6NA 3F47A 1MKYA 3B2QA 1NKTA 1JLMA 4P38A 4QXAA 2D59A 3RASA 3FDFA 3N86A 1D2GA 1JEYB 3NVKI 3OZBA 4QFCA 4ZOCA 4YJKA 3KJEA 4NJMA 4BLWA 3QKSA 3T5PA 1Y1TA 4AZTA 2CVFA 4I3FA 4EL5A 2F59A 1IXSB 2PD4A 3ABIA 3OCWA 5AUOB 3SPXA 3N2ZB 1C14A 1YOBA 2H5EA 1KYQA 4H18A 4HWPA 1PT6A 3ILHA 4KTTE 4RVHA 2VPYA 1KIMA 5DYYA 3T5BA 1JBQA 3DDCA 1P0FA 3LUAA 1A5BB 4PZDA 1I6LA 1Z2CA 1ZICA 4DMMA 3U60B 2A1TS 3II6X 2LBPA 3FTEA 1NXOA 3F3KA 3N9IA 4MLZA 2P9YA 4BMPB 2ZTSA 2NXCA 2YMLA 4A03A 2FE4A 3OQBA 3PA6A 3O84A 4NFLA 4IWXA 3E7DA 3UBMA 721PA 3EFHA 1XT6A 1PLKA 2CDBA 3CMCO 3IBGA 2GASA 3SIXA 1WTAA 4JI3B 2JCBA 4CU2A 1M76A 1QDLB 1VPWA 5CFPA 1DAIA 1OFTA 5EHIA 2DTXA 3OJXA 521PA 3WXBA 2J67A 1SD1A 2ZBQA 2JHPA 1RYHA 1A8UA 2LUOA 2V7QA 1U7WA 3PI7A 1TZBA 1CQPA 2ODBA 2V0NA 1QVAA 1VE1A 2ZJZA 3MLBA 3VDRA 2CF6A 1YZLA 4OV6B 3I1YA 2H4JA 4ZYXA 2ZJ4A 1KIFA 2ORYA 3MEQA 1XLWA 3OJFA 2WF6A 1PS8A 1L9KA 1PJRA 3OCVA 3GUYA 4O2BF 1BVRA 1U4OA 1RZRA 1SHZA 2XLBA 3DHYA 2V55B 4PRZA 3GEMA 2J4DA 1FFAA 3H7AA 4IINA 1U9CA 3VV2A 4RYDA 4AULA 4ZTUB 1YI1A 2G8NA 4NJOA 3WS7A 2JGDA 3FPGA 1TMOA 4OQQA 1BXGB 1NDUA 2O3TA 4ARVA 1A7UA 5BRAA 5EKTA 1NC3A 2Q28A 1TKCA 3AWDA 3C4VA 1T91A 3M7IA 1LTHR 4WESA 3QOXA 3SK0A 3SGLA 4AMGA 5ARBA 2FWBA 5KTRA 1SXHA 2K2QB 3DAHA 4ZVSA 3TM4A 3GLQA 3SF8B 1VLHA 2DULA 4C6HA 4QJ4A 5EPEA 3VNRA 4OQXA 2VG8A 2J5BA 3MCVA 4FC6A 1OB5A 4MW2A 4E6PA 3TO5A 3EEFA 3L18A 4A36A 2HL6A 4K40A 5JNVA 1FQJA 2POQX 4JC8A 2J4FA 4LOLA 3ZKWA 4GZLA 2O50A 4LHVA 1BC5A 3IR7A 3D6FA 5JV5A 3OUZA 5AH0A 1WOMA 1Q14A 2FFBA 5F2EA 4Z0HO 4LYEA 4M98A 3EW9A 3AFHA 3L8EA 3ZH2A 2QTTA 1P1HA 3HJGA 4I1RA 4JJ4A 2C5BA 2MSNA 4FGSA 1IY9A 5K8VA 1Y7IA 5FFFA 5I9SA 2W58A 3TZLA 4CLEA 3ZWYA 2B9EA 1QE3A 2C9BA 4Y2PA 2C1ZA 1KY3A 4J0FA 5KYWA 2HKIA 3SX2A 3REOA 3CA8A 3I73A 3BH7A 3GLVA 1SFRA 3MYRA 4GBMA 3RKSA 3TOZA 2FGKA 5DM70 2PIAA 2FUEA 3FTPA 4QFBA 1RWQA 1BDMA 1FXWF 1ZI8A 4N4AA 4E5SA 1H4QA 1AKVA 4JBWA 3KB6A 1BJRE 3R24A 1NFQA 3NWOA 2C29D 3QP9A 4IGFA 4MGYR 1K9VF 2WU8A 1HO3A 1TAUA 4P3KA 3QNUA 1B74A 3RW9A 4FW9A 3Q1LA 3UV3A 2XD4A 2VYQA 3R7WA 2PXHA 1RYEA 4WSOA 2UAGA 2PSEA 1NQ5A 2PUEA 3LLVA 4KOAA 2PY6A 2IX9A 3AIIA 4B73A 5JY1A 3MQFA 3PNMA 4TWAA 1HE3A 3KK0A 5GP1A 5CFMA 1GKYA 1UPTA 2X2PA 4JH0A 5IG2A 5JROA 3A6FA 3O4JA 1V4NA 3T8YA 2CL5A 5IT5A 4Z1MA 1EU1A 2FN4A 4LRXA 2Z98A 4JX8A 1LFAA 1X1DA 3DMDA 4MS1A 1TF5A 3SHTA 3A31A 4FN5A 3QFFA 3U3ZA 2N9UA 1M7GA 3VO8A 3PC2A 1FP7A 1WQ1R 2HBYA 2P2ZA 2WFAA 1I5OA 3FUTA 4G26A 4MCJA 4WN9A 4MA5A 2F2TA 3B38A 3DL7A 5EWJB 4BLPA 4IS3A 2OCAA 2W98A 1QU3A 2OBYA 3LE8A 3TLXA 1V3TA 4HYQA 4XVQA 2PFKA 3OT1B 1TA0A 4IEFB 4XLZA 4ZRMA 3J7AC 2X0EA 1Z8HA 1OZFA 5B2FA 5JHGB 3JARB 2GO7A 3O8DA 3FSEA 3Q7PA 121PA 4QLBA 7REQA 1NHWA 1R6BX 4G6ZA 4HAOA 4ZAGA 4BEJA 2ZJ0A 2BBSA 4PWYA 5JCXA 5JC1A 1TO1E 1UIRA 4L5AA 3U5ZB 2FFHA 2PNJA 4C2BA 1G21A 4XQ9A 2BEVA 3MJ4A 2QRNA 2JH9A 2WWRA 3JW8A 4GPIB 4I8IA 5K8UA 4G24A 2G9NA 2P9EA 2JAQA 4UAVA 1N32B 2F90A 1QGAA 2FEXA 3BD6A 4MK4A 1F1JA 4M1TA 4KLZA 1XZFA 1MQ8B 4MV5A 1H5NA 3EG5A 3ANYB 4Q34A 1XRRA 4UE6A 5I7VA 5T5QA 13PKA 1NKSA 3M1IA 3LF1A 1M9NA 1CZNA 1HE1C 1HYHA 2IPLA 3DOJA 3JQAA 4HFJA 4GQBA 1OCEA 2D0PB 2V1XA 3W06A 4TVBA 5IXYA 3WL3A 4DSNA 2A3NA 4EHNA 1UF9A 3F8WA 2FSUA 2R6FA 1QFMA 3IRVA 1A8IA 3VR5H 3MGKA 3VHQA 2DUUA 1XR3A 5F64A 4CL0A 3PR2B 4ENVA 1M5RA 1OFHA 1X8XA 1QLJA 2C59A 1WZUA 1CPYA 3E22A 4Y2VA 4C43A 4FB5A 1T24A 1A8SA 3L7LA 3LS2A 1XHEA 3LT5A 2EBFX 5D5QA 5M2QA 1IZ8A 2H92A 2ZWIA 1H3EA 1DZ3A 2A0KA 4MIEA 5KYXB 1Z7WA 3QELB 4FNAA 1W5TA 4QUEA 1A27A 3I4FA 4HOYA 1NJ1A 4WBXC 5CJJA 4XLLA 5ITSA 2OFWA 2HA4A 2P5YA 2E4XA 3N5KA 2D3TA 1H2YA 4HN2A 1I4TD 1PR2A 1PSWA 3GIWA 4KQ9A 2VQFB 2I76A 1WETA 1ZA1A 4NEGA 3DAGA 3RFVA 3NTVA 1YL6A 1D4ZA 1UJNA 2HNBA 4R40A 5FBVB 4MUFA 3NVMB 4TV8F 1ID8A 1NXPA 1XUOA 4S05A 1Z88A 3OLYA 4RF5A 1OV4A 4IMPA 5A6SB 1L8LA 3KFLA 2H52A 3WJAA 2BMEA 4B84A 4AWBA 4C0KA 4GZMA 3R2JA 3BTVA 3NAGA 2I2XB 4BO8A 5HS4A 1CTQA 1SUAA 3C70A 3RM3A 3PB3A 2M2IA 4DIMA 3HKCB 4LSWA 4QDJA 2M6KA 1RWOA 3UXYA 5ADHA 5IT9A 3UGKA 1OLXA 1YVUA 2F67A 4TS4A 1LF0A 4OHOA 4EDHA 4FKBA 1CY8A 5EJ6A 1H9CA 3EPJA 4UTVA 1NRXA 1CQIA 3OIFA 3C3AA 3D43A 2ZPUA 4WASA 1IPEA 2WJYA 3GF4A 3QIAA 4W5RA 1WX1A 1IVYA 3R0JA 3OKPA 4B3JA 4IJUA 2NQTA 2G70A 5EXTA 5LWHA 3QWBA 4DG9A 1PJBA 2G9UA 5LNK1 2C4HA 3QU9A 2GJAA 2HYIC 5AJWA 1QWSA 2WUVA 1DLJA 5ALOA 4HAIA 3MBKA 4K8OA 1PSDA 2A88A 2PUBA 2AW5A 3USCS 1G0OA 1ZMOA 4OJYA 4ZVKA 1E9DA 2IEIA 5DWQA 3FUUA 3D6UA 4B35A 4EATA 3MD0A 4CF6A 1E6KA 3TLCA 1LJLA 3C5WP 5C8YF 3IUPA 3ZK8A 1A98A 1ESEA 2G5TA 1KI6A 3CWZA 1EDBA 1E1DA 1L0BA 5IAJA 4TYNA 1Q3KA 1EX1A 1OX4A 1YKGA 1W5BA 1FTSA 3CLUC 4FDUA 1IN1A 4G4SP 2ZTHA 2C03A 4RIHA 2ZDGA 4D0GA 1H8ED 3W04A 4Z3OA 5LMNB 2ID8A 3DE5X 3DOFA 3COPA 1NA5A 2GPBA 3K4HA 1KAQA 1RS0A 1FA9A 1OAOC 2POCA 4ITVA 4K7JA 3WWOA 4MQBA 4DSTA 4EG1A 4ETNA 1RSZA 3ZU5A 3LT2A 1JQJC 3JV7A 4FMPA 5HTKA 2QTFA 4DLTA 1G16A 2IHJA 3JAWB 2O57A 4N76A 3L7KA 1Y5IA 2PS0A 3H3JA 9LDTA 1JPUA 4RTJA 3GGSA 2QUHA 2PQ0A 3MMSA 4KBYA 4QKQA 1SULA 3HCDA 2PR7A 5GZ6A 3AINA 2WTBA 3H9GA 3NTUA 4ENTA 3L05A 2GZRA 5JAIA 3FPEA 2IGBA 4BNYA 2D8MA 3HB7A 3IBFA 3H0CA 2AUMA 2A6PA 1JFSA 1Z5ZA 4MVCA 4RSRA 2WWVD 3ZN2A 5F12A 1GGJA 2GHQA 1TF2A 4GI3A 4PZCA 4NU5A 5L6MB 3I42A 2KBEA 2UZAA 2ZI4A 1POXA 3WKCA 2OMEA 1JQEA 1W2WB 3HM2A 4UNQA 5AIBA 1HSOA 2W6NA 3UANA 1JDJA 3IIIA 3BFKA 2EXXA 3RR2A 3WL5A 2RGUA 3BFXA 4C78A 4EJSC 1GA1A 4DV7B 4HZUA 3PHLA 5I45A 4HV4A 2A2ZA 3Q3CA 3DHVA 4U5XA 5IJZA 5CK4A 4G1CA 3AVVA 3K70B 4MTCA 1ARZA 1MC5A 3PF9A 3L6EA 2AOTA 1YWGO 3FOAA 1JQDA 3RG2A 3UT5A 4RA6A 1YZQA 2PGXA 1PR9A 4QU8A 3PI6A 4CF3A 1DAEA 4TQ9A 4B6QA 1TT5A 2YFQA 3OP1A 4S1NA 1L5ZA 2JDID 5LZ2A 1YR3A 4IYJA 3T1OA 1AXEA 3COZA 3UMFA 2JI4A 3BS4A 2Q45A 5F73A 1WWKA 3JQFA 3VJKA 4W6ZA 5LMZA 2HK9A 2YUIA 2RHGB 5FPHA 1QF6A 3KKMA 4TMKA 3AERB 1FK8A 3WHLA 4KIFA 2O0JA 1XC7A 3L46A 4MPRA 1PZXA 2PBRA 3R4VA 5JSZA 3E3OA 3AEKA 4I1YA 1FY2A 1KJYA 3HN7A 3LIIA 3OOSA 1Z35A 4YMLA 5CT9A 3BMNB 1II8A 1MB3A 3A4TA 3TRJA 4F56A 5KREA 1F14A 1XMIA 3P0RA 4I50F 3DMGA 2A8YA 3D59A 1CUDA 5G4KB 1YZNA 5CB4F 1HWYA 4KIUA 2PO5A 4JENA 2ZB8A 4GM0A 4RESA 4CN8A 2I8LA 4Y6QA 4Y9DA 2VTBA 4M7OA 1MTZA 5JS7A 3IQWA 2OXFA 1ULBA 2XODA 2O8DB 2OCXA 4GP9A 1L5HB 5HSGA 4TTPA 2BBTA 1M1UA 1BMFD 2C5GA 1A97A 3A6EA 3EXEA 3OECA 4AY3A 4BVEA 2GF2A 1PJQA 5TC4A 3TW6A 2GHRA 5KNCH 2YV4A 3LHDA 4R5MA 3OZEA 2WWFA 3O31A 4JOQA 3OP4A 2CKDA 1AY0A 4OHCA 1CUCA 1L7QA 4PC1A 4PLHA 3L6OO 3QV1A 3WTBA 4PNZA 5EZSA 3ZDQA 4FT4A 3RT7A 3WC4A 2ZETA 2HX1A 3L93A 5IM4A 3S44A 3T35A 2FPWA 3HI4A 4PR3A 1HLGA 1FFEA 1NBEA 5JQGB 2G08A 4N0DA 2XWPA 1XNHA 2WF9A 3HDJA 4MUKA 3ZQ4A 3ZV7A 5FADA 1N2EA 3O8QB 2NN3C 1MNAA 1J0AA 1SBTA 3WL7A 1GTG1 4LRQA 4BFZA 1F0YA 4R01A 4I08A 2PX5A 4Q7JB 4R7TA 4ARSA 2VK8A 2FCAA 3PIIA 2RHLA 1U1GA 4YJGA 1UK9A 3NBUA 2OEPA 4A8PA 5K2OA 1JG2A 2YY5A 1U0HC 1J39A 3T5GA 2OZLA 2FSGA 3ZEIA 3W3AA 4MYTA 3UO8B 2Z2XA 1QMGA 1UAYA 2AKAB 3DLIA 5J63A 1Z56C 2BMJA 3K9NA 5ECDA 3FWHA 2Y1WA 4FSXA 1XN1A 2AN9A 3SP1A 3WMFA 2O1XA 1SZDA 1G6Q1 1ZJ5A 4U9IS 2RJOA 1YRBA 4QODA 1ZOOA 2G4VA 2I87A 2R8YA 4FWIB 3NR2A 4REMA 4JI4B 5CDYA 4PRKA 2QZ4A 1RMYA 1J22A 1T5OA 4UDXX 4D45A 1M66A 1KMHB 3FFXA 4YO8A 2D1QA 1JP7A 3FFTA 4K9PA 5LXTA 4U7DA 1P4RA 1XN4A 1G3QA 2C9YA 2JGLA 5G0VA 4B8WA 5JARA 1XCJA 3K3PA 1SCIA 2XT0A 3IVGA 5JLAA 3IIEA 3P9RA 1V26A 2DFDA 2IBSA 3SU8A 4NICA 2X9VA 1ZGHA 1JHUA 4H7PA 5BR8B 2AQHA 3BORA 1CY0A 1Q1NA 3RV3A 2IGTA 2WWXA 1XAIA 3EGDA 1Z13A 3WHPA 1M2GA 2JIZA 5B7GA 4H4DA 1Z62A 5GQSA 2A94A 2VJPA 3ORYA 4LA4A 1OYYA 2VT7A 5SY4A 2VF2A 2X9GA 5KSPA 3ZV6A 3A36A 5JO0A 3AM3A 4YP9A 2R6R1 1WZCA 2C31A 2Q4OA 4B4OA 4UC0A 1N6OA 4R8MA 1VBKA 2GD6A 4E4RA 3IJPA 1XZEA 3M8KA 5BV0A 1HGXA 4P4LA 1SRQA 1Y8RB 3T52A 1GA4A 5ESDA 1V5IA 3SLGA 1ZH6A 3BK7A 4HP8A 5DI9A 4B6RA 3L0OA 2JFBA 4G56A 4GOND 2BSAA 4KFTA 4ONEA 1RR6A 4IOKA 5CXSA 4F1WA 1Q74A 3OIDA 2WR8A 3A0UA 3M4JA 3FJYA 621PA 3NMUF 1JMYA 1ZRNA 1ZNQO 5K0NA 3UJAA 4DMGA 1U1IA 3GUUA 3I23A 4BMOB 1M2FA 5ED4A 3KKQA 1XDGA 4D5GA 3I92A 1TZKA 1GV0A 4QBGB 2BMWA 2HBRA 1CQJA 3HMKA 3BJRA 3ZGXA 2FOIA 1J09A 1OXKB 4WCFA 4B46A 1THTA 3TXYA 2Q3FA 2HREA 2BONA 2VHXA 5LDHA 1X80A 3HGQA 2GEBA 5EP3A 1ODJA 1XRMA 5AHXA 1GCAA 4NATA 1RXWA 1W19A 3QU5A 4N7MA 3WRWA 1VJGA 2WVHA 2HCTA 3KZMA 1WUKS 3LC2O 3ICPA 1U5BB 1FJHA 2GD1O 1TZ2A 3PIRA 1SJ9A 2IKQA 5A62A 2CCKA 2Q07A 4JUCA 4DVGA 2GUGA 2HF7A 2H1LA 5CVTA 5CH5A 1LDBA 10MHA 3A9UA 3MQ4A 4QUHA 4BP1A 1K0UA 3Q5DA 3EFOA 2OK7A 2XE6A 2VAMA 3L8HA 3O8NA 4IVPA 4PFKA 5FYDA 3WLFA 3UXEA 3AHJA 1Z82A 4EZIA 1F48A 4ARIA 821PA 1QB8A 4LGVA 2NNWB 1ZOLA 5KMGA 3UWOA 1ND6A 3A26A 2VP5A 3Q4GA 4FHGA 4GKBA 1LA2A 4R69A 2IWRA 2ISSD 3W0LB 4QDKA 4N12A 1U5CA 4LJ7A 1X7DA 1J00A 3QQPA 1C0PA 3DE2X 1T0BA 3LP5A 3LSYA 3QE4A 1K0FA 4YT8A 1C8KA 3RUPA 5LR6A 3GC6A 4EJ0A 3KT8A 2AWOA 4LI0A 2QNIA 4URFA 1KDVA 4AZ3B 1UFKA 3WWDA 2CJPA 4Q5IA 1K06A 2DB3A 3TLBA 2ADFA 1RD4A 4ECAA 5L45A 1TMYA 3HNRA 3TPZA 3OOEA 2VJLA 1WNTA 2XUKA 3EF0A 3SHFA 4ESOA 4MR9B 4IICA 5FOTA 3ER9A 1T2AA 1Q16A 2WIJA 4UBMA 1E0KA 1PI3A 4AU1A 3H4VA 2PQ2A 2GGSA 2B8WA 2Y99A 5F4BA 1QCDA 2VK2A 3F6CA 3H5TA 1J5EB 1JHAA 1AF4A 4QSMA 5FI5A 1GXSA 4E5UA 3X1DA 5IVPA 3GFSA 3RQSA 4MHOA 2CXPA 2E37A 3ICWA 2NU6A 2AX3A 3AIOA 2ZZKA 2HMUA 1R0BA 2NYVA 2W9XA 4Y9RA 3L8GA 4C4ZA 1PWYE 3ORFA 1QHIA 4ZXFA 1IZ7A 2CYAA 3W9BA 1J7JA 1G291 1QQ6A 2JFFA 2WY2D 4L4UA 2WWTA 5D5HA 1IBMB 3MWDA 2R7LA 2VKTA 1SXJE 4GBJA 4RVOA 1GOTA 1WLYA 3EZYA 2FEMA 1Y4ZA 2V9ZA 1LBHA 4IDOA 1Y1KE 4BN0A 5IYZB 4W9NA 4RTLA 1YA8A 3TNJA 4J2TA 2OT3B 1N0IA 3CF4A 4DADA 1TECE 3FWYA 5IVIA 3MTQA 4FZVA 3G9XA 5G40A 2IPNA 4D9MA 5AVUA 4XSVA 4UUQA 4ENUA 3WX0A 3GLGE 2LCIA 1FX0A 3V4OA 3OIUA 1FDUA 2D1SA 1G8YA 1HYGA 2OBLA 4P8RA 2EJVA 3ZTYA 4DIBA 5FPKA 4YRJA 3F9CA 4FR5A 2DPHA 4FBGA 3AJDA 2J0UB 3BJZA 3M4XA 4YUVA 1W73A 4HWOA 4JNCA 3ODPA 5TMDA 2W8BA 2V0CA 3JWJA 5KVQA 2B8TA 2C2GA 2VIIA 1ZC4A 1QZXA 2VSNA 4PPNA 4I1OA 5LP6C 1U7DA 3P19A 2BSQA 3DJFA 4BC1A 1DX9A 3AT1A 2XCRB 3GJTA 1RHKA 1E2UA 3R0ZA 4QG3A 3ZGZA 1Q7EA 1L7MA 2B8JA 1MGOA 3RB8A 1QO9A 1WDLA 1ZD4A 2YJTD 5EHQA 2R48A 4KIGA 5ER6A 1QX4A 2SICE 4S0XA 4G67A 2OWDA 1E1QA 3ROPA 4ZGGA 3LHKA 4R1SA 5K99A 3N87A 3PNBA 1L5WA 2B61A 4MR8B 4MUEA 1E79D 2PS1A 2AOUB 1YRYE 4PR0A 4Q3DA 4V0QA 3EUAA 3W79A 4TRJA 3SKVA 3G23A 3BWMA 4ZVUA 2JJYA 4UDNA 3ZE0B 3U39A 4NCBA 2WJVA 2IS1A 2PMEA 3U26A 4JJKA 4ZV7A 5B1HA 3GI1A 1TZCA 4GOJA 4P0QB 5CT5A 1AZTA 5REQA 1P17A 3KJHA 2PTGA 3CCFA 1XCMA 1PV1A 4NCXA 2Z5FA 3KKNA 1FP6A 1GHTA 3P0FA 4QBHA 3VR4D 3I9FA 4JROA 4BGUA 2AYZA 2OORA 2X4GA 5MN6A 1ZYUA 1TQ6A 2C2WA 2ZYHA 4AJOA 4F5WA 1VCOA 3OE5A 3NGMA 1E7WA 4L08A 1K7SN 1LS1A 1TEHA 2CK3A 4BWVA 3GDGA 2FSSA 3JASB 3PHIA 2X6RA 3FBTA 3UWDA 2ZJBA 2Q8PA 3IOBA 2BKVA 3C0KA 3UN1A 3ZDEA 5T4EA 4EX7A 3V9AA 2PJZA 2PZMA 4B17A 3ZBTA 5J4VA 3H16A 3VKHA 5KVAA 2GEVA 3A1SA 1ADYA 2Q3BA 2VVTA 2C96A 4N48A 1NVGA 5FUVA 3HPQA 1JLKA 1SKQA 1JDNA 4MCHA 2Z1MA 2HSDA 3I62A 2HU7A 3LLSA 3P9XA 1IRIA 1VZ3A 4L8GA 4P5DA 3MM4A 2H2AA 4PW0A 1NXQA 2ZRIA 4YCSA 3ELDA 1AMOA 2H4XA 2QTMA 3O8OA 1RJ9A 4LKRA 4FHFA 4F7DA 3HBFA 3UWSA 2ZE7A 1RXCA 3GNQA 4IFTA 2Q0SA 4JR0A 3SR0A 4RE5A 2B5WA 4YN3A 2IHTA 2VDJA 2X14A 1SXJD 3DMFA 3LHIA 2GRAA 3AUYA 4QYIA 3AF6A 1THMA 2H2WA 3DDWA 4K05A 1L1QA 1MQSA 3I9V6 4Z0TA 4LTMA 3LUBA 4NBLA 4NU8X 4WNAB 3IGFA 4TWZA 3HKEA 4HH4A 4HX5A 4DR5B 2BP7B 4XWKA 3TIXB 1FRZA 3H1AA 2EL7A 4LCEA 4V0KA 5HDBB 1FMFA 2OZVA 1RRFA 3RS4A 3WNDA 3D4NA 3LRPA 2I78A 4PBSA 1M10A 1O58A 3B5JA 3QUSA 4PG8A 1XF1A 5BURA 1NJFA 3BTSA 3IOCA 3NEPX 4XJTA 2V8OA 2Q8NA 3C85A 1PT8A 3ES9A 4NIMA 4NYMR 3ZDDA 4RZXA 3NBXX 4GC9A 5KC9A 1XVAA 4K3VA 1OIVA 1WMBA 1A69A 2Z43A 3LBFA 4MP8A 4QJIA 1T1EA 4U2EA 1W1IA 5LA6F 5I7RA 1QO0D 1ZAKA 3BG5A 3BMXA 4HDRA 1C0KA 4PLVA 2VK4A 3WRXA 2ROQA 3N2EA 2AZ4A 3RC1A 1T5IA 3STTA 5HKBA 1AF7A 4H60A 2HUNA 2J3LA 4WKPA 1IK4A 2JLWA 2ZRGA 1O96B 2DKOA 2ORIA 4QHSA 1HC7A 1FB5A 2CUKA 2FWJA 4D9BA 1VA5A 5IDWA 2ZDHA 3HXOA 5B4VA 3EVAA 5IH7A 5JFTA 3INGA 3NM6B 3VMFA 3WLJA 2XY4A 4R84A 1EA5A 2R751 2ID7A 4D9NA 4LF6B 5A0VA 1BKSB 3EVFA 4HGQA 4KQXA 1YZVA 3GFBA 4Q1CA 4C05A 4G8CA 3VI3B 5EWMA 1GRQA 4PBTA 4C7OA 2ECPA 1CJMA 3PQFA 3TJMA 4B40A 1RQNA 3P1JA 4D0NA 4L4RA 4E4YA 2EOAA 3IPAA 1TUIA 5FOVA 1LDNA 3GN2A 4OMUA 3ANTA 3JYOA 7ADHA 2YZNA 1SGWA 2V6GA 3TTVA 3WVNA 1LUAA 2C04A 2QLBA 4U8GA 2JD1A 3PLNA 4Q00A 2GS9A 3W6PA 2XR1A 1M7BA 1BGVA 1JXQA 1V5WA 2G9QA 4WZAB 1RYYA 1LRJA 4MHTA 1DOAA 1FFXA 4M86A 4F2WA 4ZYLA 1QP0A 5AXAA 2C7PA 1N5JA 2CXSA 3ISVA 3V7YA 2ASEA 3T0FA 1Y8AA 4O4JF 2J59A 1L4FA 2RK3A 2YS7A 3FPCA 1NVVQ 3LKVA 4TKVA 1VFPA 3U7RA 1E2EA 4WKOA 3B3FA 5FT9A 4LNUA 4LWPA 4P98A 2C42A 4N47A 1IBCA 2ZRQA 3VOBA 4ANFA 2J3DA 1I36A 3SVLA 4G0QA 1JZQA 3QFTA 2E85A 5HIIA 1R6VA 1UEIA 5JD4A 4A8TA 1UKYA 4MCIA 3TZKA 1YACA 3P97A 5CFZA 1E98A 5CGQB 3PPXA 1XSEA 3KOOA 4YLEA 4D97A 5H9VA 4YAKA 2AR0A 3AUAA 4W5JA 2UZ3A 1OFUA 3OSUA 4HEJA 3DKKA 4OLJA 4P08A 4XGRA 1O9BA 1XX6A 5K0FA 1I7DA 2M1ZA 2ZVQX 2FEOA 3BK2A 2XOKA 4NU6A 1NR5A 3LFUA 1U6IA 4RY8A 5DASA 3UJ6A 1VI5A 4B7XA 2ZVDA 1HNWB 1YCFA 5CDUA 4CM9D 1Q57A 1U8CB 1Y42X 2RBEA 4J0KA 4LCBA 5K20A 2CJWA 1U2TA 4JX9A 2JHGA 1LBEA 1PX2A 3PLAE 2O8VA 4NX2A 1FXWA 3L04A 3V8BA 2EHDA 3GRVA 2IWHA 3BWYA 4L0CA 4EHBA 3R7AA 4YROA 3X1KA 1GZ7A 5HIAA 3W2FA 4EP1A 3R0IA 4LGMA 2W2QA 5E1MA 4GNRA 2YV5A 1NF9A 2PS9A 2AXEA 3GIDA 1WHTB 3H1EA 3RABA 2NTYC 5EXEA 1UK8A 4RD1A 4UUNA 2PVCA 2PYDA 1QF9A 2QZPA 1PNTA 3WLTA 4D0SA 1B8UA 3KAKA 5H1YA 2FOXA 1C29B 4KAXA 2V03A 4FMCB 3CISA 2DQSA 4LZWA 4YALA 1U7XA 3LY9A 4FEGA 2QY6A 4EX6A 1U0GA 2OQIA 3NETA 3TKLA 5ALDA 4LRTB 2QRJA 1R1DA 3ABQB 3IQGX 3JQ7A 4G1BA 4AZVA 2GFHA 2XDWA 3LT4A 1GRCA 3MHPA 2ATCA 1ZUNA 2FVXA 2DJ5A 1FNNA 1VMAA 1AXRA 1WMFA 3G9TA 3HVHA 2GBCA 3DXFA 4KXWA 3MRTA 3TD2A 3LECA 1TZMA 3ZHTA 1T8RA 2MR6A 1BW9B 2R86A 3C41J 3KSUA 5KNCD 3FZGA 1YE5A 4JASB 4UU8A 1KI2A 1MDFA 1PGJA 4BJ5A 1ZR4A 2WPDA 1XAJA 2VJDA 3B20A 2W00A 1LSUA 4WI1A 1OXVA 3HCEA 1YJXA 2FUCA 4YWHA 5HDQA 3PQDA 3HR8A 2GFQA 4OQ4A 1EH5A 2DFNA 5FUYA 2PTHA 3P9CA 2SBTA 3SOZA 3I61A 1S2LA 1G17A 3A1VA 3ICQB 1WBDA 1TM4E 3DL0A 1GSHA 1QZUA 2Y0DA 1JKJB 5IU6A 2BZ1A 3EARA 2RBKA 2XTAA 5BVGA 4XYBA 3EZ2A 3NWBA 1ZH0A 2HXSA 3N58A 1ILWA 4WXYB 5H80A 4JI2B 2VWPA 1NYTA 4ERXA 4CT0A 3S8YA 5CB0A 4K9QA 3ROQA 1NURA 3KZ1E 4JVNA 5IHPA 1G1MA 3DVLA 3NUGA 1QSGA 2EP8A 3MXOA 1U0LA 2MYTA 2Q1UA 2Q6IA 2ZIVB 3GXOA 3QITA 2ZSIA 3H5IA 1HQCA 3NP7A 1DRKA 2NAFA 4JUBA 5HCNA 3QVMA 4BN5A 4F4JA 4ZVRA 1QG0A 1CR6A 2EF1A 3L7AA 5J59A 3RK4A 1VKOA 1DEHA 1WCV1 2GD0A 4XJSA 3M3DA 4G4GA 4CMIA 4UPEA 1NVMB 2CLMB 1CK4A 3IXMA 3FM9A 4Y3UA 2ZJ7A 4OBEA 5DHAA 4B2PA 1ZIPA 3ED5A 2AUTA 4TMYA 4ZDIA 2MMCA 2UUPA 3DTTA 3P2IA 5DHRA 1V39A 2FH5B 1QGZA 3FH0A 1AHIA 1GNSA 4NZYA 1IM8A 1IPHA 1AQ6A 1ML3A 1AQIA 1B8VA 4HUJA 4XIFA 1NRWA 3WZLA 5BN4A 1XQYA 4G4SO 5JAMA 1Y81A 3HFJA 1X92A 1R18A 1ZJ4A 2DLNA 3DWIA 2LIPA 4L27A 1H2BA 4YAGA 1G5FA 3ZK7A 4B3DA 4RJTA 3O8RA 4M0CA 1G3IA 1S7CA 5AUNB 1C80A 2RG7A 4N9WA 3ZE6A 4D6PA 5KJ1A 2ORWA 2G36A 3AVPA 3V3KA 4EY3A 1J6UA 5CHYA 5AVXA 3OTOB 3JYPA 4DOMA 1ZC3A 2NTEA 5ECGC 3ZJYA 3KTAA 4NE7A 4TROA 3DKIA 3NM5A 4NS4A 2PFGA 1GN9A 1OBFO 2A1UA 4MKRA 1YU6A 4ZT5A 5SZJA 1JECA 1SHLA 2C5LA 4JT4A 4PS1A 5KBYA 3M6VA 3U7QB 2IYYA 3E7FA 4MYSA 2OXTA 4PQYA 1DXQA 3EQ2A 1Y1SA 16PKA 1DIGA 5AKGA 1VPEA 3F46A 1U8UA 1N0VC 3Q9SA 2WSMA 1AB5A 4CI9A 4YRNA 4ZAYA 1V4VA 3TTUA 5KNBD 2DQ4A 1FUUA 3OEED 5GIPE 2IEBA 2YCBA 1DO0A 5AK4A 3HP1A 3TTWA 4RY9A 1TLLA 1X0XA 3H05A 4BQIA 5FDFA 5J23A 4G0NA 2HN9A 3PXAA 3WBKA 1GTJ1 5I01A 3MGAA 3NWJA 2Z6QA 1USVA 1RFGE 2UU9B 3AUKA 4HPXB 3WBFA 4HI0E 3D5EA 3OOJA 3AEQB 2ZWMA 3CVJA 4M6WA 3HYTA 1HLPA 1U7OA 1EINA 1XAHA 3K9CA 3SIWA 4AWAA 2WKWA 3V8EA 3NDJA 3CN7A 1NWHA 3KFXA 5LBIA 5JS1A 2O05A 1GPMA 3P71T 2YW2A 5FLYA 4XLTA 5C8YA 3WLKX 3ABZA 1BG6A 2EFYA 2L69A 2YWJA 4LXGA 1AK9A 2DSNA 1TIPA 2FF7A 4BJ1A 1Z2DA 4I55F 4WDQA 5BMVB 3T5CA 3ZVRA 1X7WB 4G1VA 4IDEA 4IUYA 3UMJA 5H9WA 3D3WB 5C35A 5JOQA 3LY5A 3GLTA 1JXAA 1R50A 3KNZA 1M75A 5JNWA 1NXSA 2REQA 1Z5PA 1C4WA 1KDRA 1L5QA 3FUWA 1YOVB 4UEKA 3KVRA 4TVKA 3UH0A 4BECA 3K31A 4I81A 3Q7IA 1RM4A 1SCDA 4J4HA 2PX8A 1PR5A 1ZN8A 1IJKA 3M6AA 2FZ5A 4RDIA 4L3VA 4UUOA 1MOSA 3CTMA 2GZDA 4C0SA 3B78A 3K6SB 3NC1C 2GAAA 4RTOA 4LHZA 4HS4A 4CIXA 3NHZA 4NYIR 5JDIA 1G9SA 2C2ZA 4R7ZA 2I8CA 4L15A 1TQ4A 4G9EA 3WRYC 1V8DA 1ORVA 1AKMA 2JFNA 4ND6A 1U02A 1ZBDA 3M3HA 2N47A 4NZMA 2OL4A 4OP3A 3O38A 1KBZA 2FKAA 5KOHB 1E79A 3ZV3A 5IDVA 1YFKA 3R9XB 4ER5A 1NP6A 1Z0ZA 2A5JA 5CURA 4QIHA 3QXXA 5TSDA 4OJNA 4I1UA 3Q9LA 3DONA 3DULA 2DF8A 2QRLA 1CIJA 2WM2A 1Z15A 1B15A 1GIAA 1PJCA 1HE4A 3QFSA 5HG0A 4D82A 4F3YA 5JNTA 1RZUA 2WU1A 5DE3A 3UMVA 1O8BA 4ZI7B 2DHDA 4X44A 2H6EA 2R4QA 4CF4A 4Z4CA 4CKCB 5EXXA 3ITDA 1OOEA 4ZGBA 5F9FA 4N1AA 3EWIA 4GX0A 4B43A 3LT1A 1IHPA 3H8SA 2XQKA 4O25A 3NDBB 3B2NA 5L95A 1TU4A 3UAGA 3KO8A 1J07A 4MULA 1AU9A 4PAOA 2H4YA 1SK9A 3DVRX 4FJ2A 4L73A 1VLZA 2V7EA 3H8WA 4EHIA 5JAUA 2PCLA 2QTLA 2J3HA 1H22A 2JBHA 5LQCA 5F33A 1NT4A 2ZK7A 3DVAA 3L5OA 4JYCA 2P6OA 4ZN6A 3VKUA 2XUJA 3ISTA 4EENA 5BRNA 4NBTA 3G2HA 4XTRA 1FNCA 1SQ6A 3VU9A 4BL5A 1H2AS 2C5SA 1MX9A 5FAXA 5FO1A 3RTEA 1EVQA 3HADA 3JTMA 2WJHA 1YB1A 3A0RB 2MOKA 1T2DA 2IZ5A 1FNDA 1YJ8A 3EK2A 3UPDA 2VDMB 1KMCA 4HFRA 4M87A 4RY0A 5CVCA 1RAFA 1V8OA 2JBWA 3BFPA 2XZPA 3HWWA 4WZBB 3MJTA 1H8HA 5JBNA 2RGNC 4NQRA 2B0JA 2XTZA 2CY0A 3EIXA 5D2CA 3HCFA 3W90A 4I50A 1RHUA 4ARBA 3CEHA 4C9BA 5JQGF 2QBYA 4UVDA 1CRPA 5JCJA 5IAAA 3EIQA 4RK6A 4X1IB 3N2GB 5CB4A 2BTEA 1HEIA 5HZKA 3IC5A 3UV6A 2PKRA 3S2EA 5HKOA 1WLSA 3CO5A 3I30X 5AHOA 2C9ZA 2I6TA 4JJFA 2DBVO 5KSOA 3P27A 5EXDA 5F1KA 3WLMA 2ZEJA 2JJ1A 2VDWB 4JOBA 4Q03A 1ZXLA 5LZ8A 4MS3B 4Q39A 1PD1A 4UM8B 4C6TA 4Q4HA 2YWFA 5A7GA 4QQNA 5KPDA 3T3OA 3EIWA 1P1IA 2F9FA 3ESQA 3CT6A 1CY1A 2HADA 3GJ7A 4TWIA 3LCVB 1KO1A 1MENA 2SNIE 1CUWA 4LIPD 5D3ZA 4FMBB 2Y9PB 3LCUA 2V9PA 4BP8A 1AA6A 1ZJZA 1E2QA 2XWQA 5BQPA 2WYOA 3T4EA 3DGFC 3EDYA 3IAFA 4OHXA 3O4VA 5D8DA 2ZUTA 4BNJA 1AZSC 2WD8A 3CX7A 1JYEA 3MTAA 4J94A 4O4HF 4RGYA 5MF6A 3NEJA 4EL0A 2ZYIA 2NW6A 3NBAA 3N1UA 1Z2NX 2YJ3A 4HQOA 1Z63A 1YB2A 2F3UA 4JQZA 1G5HA 1DIBA 1Y8QB 3CW2A 5AOCA 4BX9A 4D92A 2JAXA 5DNUA 1XPJA 1KAHA 1ZZEA 4QICA 4MGEA 1EG2A 1EVYA 4C06A 2XZDA 2XYVA 4DCPA 4B6OA 3JD0A 4DUYB 4FMDF 4WT7A 2VZLA 4BO2A 1V71A 4X7PA 1GGMA 3JD1A 1UZMA 1ZA2A 1QS0B 2IV3A 1EP9A 1SUWA 2OLEA 5K03A 4OL0A 5FTJA 4L7VA 1XTBA 4IXDA 4TMXA 3LUJA 4AJKA 4QPNA 5BNTA 1V5EA 1QH1A 2I7TA 2OVBA 1XJ0A 4GW3A 4J1TC 5IBPA 1P3DA 3OA2A 4MLPA 5ALTA 3T3MB 1LX6A 1YQQA 3O8LA 4NBKA 2Z6VA 1NDQA 1T6XA 2A92A 2BKAA 2R8XA 2XCUA 3DTNA 3FNBA 4BO4A 4R2LA 1K6JA 1GPAA 2FMFA 1MFZA 3N0TA 5DV9A 3I0MA 4RQAA 4B74A 1A71A 4JOCA 5J1TB 1MVLA 2ZS8A 2OOKA 2PLNA 4FC7A 1RT9A 2N42A 3IKLA 4CM4A 5DW0A 1DKQA 4NCIA 5LYYA 2RHCA 4JXJA 3D8NA 3SFTA 1FP4A 3IAS6 4S35A 5FWDA 4PPFA 1NLUA 1OZ0A 3OM0A 1NYQA 1B00A 5HS6A 4YXWD 3GX1A 1Y6QA 3KZKA 1Q21A 3KETA 2EQAA 4DLSA 1T8UA 3OCXA 3R5FA 3ITNA 2YJNA 3O8BA 4HAZA 4V1CA 4IG9A 4INAA 3DEHA 3IBSA 5IN4A 4JZKA 4YR9A 4FFWA 5J43A 4CLRA 5FUMA 2C5FA 1HUQA 5FFMA 1J42A 3ZY4A 3MD9A 1SXJC 3BXGA 1UPBA 5JZ9A 1T5SA 3DP9A 3HJFA 1HE5A 1IY0A 3PHBE 1NUPA 2LDBA 5FOSA 3VZBA 4DR2B 1ZIOA 3LYHA 2I9PA 5K3BA 4UARA 3CR7A 3U3JA 4J16C 4BWYA 4RHEA 5IAEA 4D9FA 1PP4A 4NCNA 2FMKA 3RYIB 4BO7A 3H9UA 4E5MA 1DEOA 2PRYA 5DOVA 4UDYX 4WXMA 5HRUA 2NOAA 3C1AA 4MKGA 1VLVA 1NVUQ 1JMKC 1X15A 3VZDA 1D8TA 2BEUB 2X5NA 1FYVA 3OE4A 3IP1A 4G65A 1N8TA 2C00A 3KZVA 4KO8A 1VGVA 1N92A 4CR7A 4ZCRA 5D3MA 2OGZA 2R7MA 4LMRA 4Y9SA 3AVWA 3MLEA 1KZ7B 5C0OE 1FTGA 2IEZA 2Q2WA 4QLOA 1YRHA 3AR4A 4K3UA 2NZ8A 5BYJA 4GPEA 4DBLE 2I4IA 1UOEA 3FAZA 4LVNA 3DZJA 1QFSA 3EEIA 2NPFA 2AG1A 4BNFA 1G7CA 2QE6A 4DMFA 3AY3A 5TVGA 5DXJA 1V4BA 3UUWA 1WY7A 2HV9A 2IYVA 3QF4B 5JH7B 2YX1A 3ENWA 3PIDA 4WJKB 4XYMA 1CZUA 2JPDA 5HCUA 5TPWB 1M3SA 1CRLA 5HBGA 5LCXA 2WAOA 1UUFA 4O0LA 1E69A 1Q1GA 2HSWA 5FPSA 3SZGA 2RHDA 2QT0A 2EGHA 4HQKA 4KXUA 5ALQA 2DY0A 1SEVA 5JISA 3QK7A 1XZNA 1I4EB 2FW7A 4IR7A 5I4CA 5JS2A 3QVGA 3A1WA 4N39A 5DLYA 5IAGA 4X3PA 5DTQA 4F7WA 4BMYA 2GQ0A 1GPLA 1PVDA 2IUEA 5LB4A 3PEYA 2O14A 5K8LA 2FRVA 4LYAA 3S0JA 2HEIA 2ID9A 2UZ1A 1KK1A 1MJNA 3WY9A 4B3MB 4JI8B 3MJCA 3OEHA 1EUCB 1U6KA 1DKUA 1G8KA 2WV7A 2ZUVA 1SC4A 2IYOA 3FOWA 1DJPA 3GGDA 3M1YA 3ZXIA 5CPBA 5IYZF 2Y1XA 3GRUA 4D81A 1QK4A 3Q9NA 4AKEA 2CVOA 3ONVA 4O59O 4MOWA 1ETHA 3ZI0A 1QIJA 2IOFA 4QVGA 1FFGA 4IRMA 2ZJ3A 3HBAA 1E2FA 3U4GA 5JEEA 4PO3X 1RLMA 3ZD6A 2J45A 1NLZA 2V98A 3NB0A 4EVSA 5I7SA 2GCOB 4UHCA 1U7UA 1MJ5A 2AG8A 1BQ4A 1WA5A 2YZMA 4ZA2A 3UXMA 3DEIA 1GAXA 4QGSA 1R0RE 3O2JA 4IXWA 2CUNA 2FWAA 3IX7A 3RSGA 5JNUA 4DDWA 2YXEA 4WJZA 2C3UA 1R0SA 4UQOA 4LF8B 5EAIA 3KR2A 2XE7A 2FTKE 3VHRA 2Z58A 2FDXA 5J5VA 3NS7A 4N03A 3IP5A 3DNPA 4OHMA 2RHMA 4DCCA 3MJRA 1JILA 3AFGA 1N2IA 2Q5HA 2IV7A 4QVIA 1AVTA 1FYDA 3BSWA 4KYTA 4ZGWA 2SKDA 4F11A 4LOAA 1U5AA 2VNHA 3HR7A 1LK7A 3TSZA 5TE9A 3X1YA 3DWFA 5IKOA 1VI2A 5JSHA 2OHGA 1ST2A 1KJQA 1KP3A 2CC2A 2P4EA 3QFHA 4FT2A 4PYKA 4CKZA 1VCNA 1ST3A 1YS9A 2J9YB 3DV9A 4WECA 1K88A 4IYRA 1AOXA 1JU3A 3PXEA 3VKVA 1VHDA 3QG5A 1RBYA 2P3LA 3U19A 1JL3A 2H2GA 3CH4B 2UXDB 3LA6A 2WSSA 1NOIA 3E27A 2WJJA 4P9NA 5GM1A 4UTNA 2VT3A 2H31A 1R88A 1NFRA 2H16A 3H6KA 1Z9BA 3H1TA 4Q47A 2B35A 1ONPA 2ALJA 4DCUA 5BSKA 1DAPA 1HDIA 3A1TA 3CW8X 1NJ2A 3O9MA 4LBWA 1KOLA 4EGCB 5M7EA 1KAEA 1BGXT 1G5QA 3UMMA 1Z6TA 3ORSA 2O5EA 1IHDA 1XXHA 4BZQA 5BSFA 3GUCA 1QVWA 2ZBDA 1U0NA 2ZPTX 3V4LA 2NUAB 3I2JA 4WLOA 3HE3A 4DLLA 4G0YA 1BH6A 2YHIB 1CUXA 3Q8XB 5DO9A 5IH3A 3RVQA 3EEOA 1JRLA 1O9GA 3BRCA 1UMBA 1BEZA 2E21A 2BFPA 3WQQA 1CEEA 4OIMA 2CHQA 1SCBA 2VJAA 2Z5VA 1F17A 2YHAA 1BRMA 2DYKA 2PH1A 5JAHA 2OTCA 1HL3A 1DC6A 2ZI6A 3EGIA 1SELA 2BF7A 2I3BA 3DHNA 1IBSA 2NTNA 5T3YA 4PZZA 5F7OA 3WA6A 2WILA 3FFAA 1JW9B 2WZQA 2XB9A 1W0JD 1QVVA 2GM5A 1ZXXA 1EXMA 1YGPA 1HYEA 3ESRA 4MW1A 4OSPA 3S5UA 1NW7A 2DR2A 4RZUA 3GDWA 2IIPA 4QTUB 1JVBA 1VHWA 1CRQA 3EPHA 1FXUA 4GM1A 5IFLA 2RGWA 5IKMA 5EJGA 3K94A 3UYLA 1DDOA 1BHJA 2SECE 4MV9A 3HJBA 1XJQA 2FMIA 3T99A 1UK6A 3N6VA 1IN5A 4YDRA 3MILA 1E3TA 3LXUX 4RORA 3AZOA 3CNHA 1SQ0A 4UBKA 4BVLA 4BCDA 4KODA 1I6WA 3EAFA 3B8EA 4WLFA 3T54A 5FL3A 4O1IA 1CF9A 2EKDA 4UMVA 4OP1A 2DKNA 2OZPA 1AO0A 1F20A 3K9FC 3U4QB 3C3KA 2QSYA 4V1CI 1SC1A 2I2CA 2C92A 5DM2A 5BW8A 4NV0A 3VNBA 1UAAA 1NW8A 3E9CA 3FFBA 2RCNA 3QEMA 1YKSA 3LGAA 2NUTB 5JWHA 3GXBA 2R8ZA 3LQ1A 4L3WA 1KERA 4G0OA 1UM9A 3PC8C 4W8OA 3UMGA 3FLAA 4R8LA 3V8RA 3DF7A 5FBWB 4UBIA 4E5NA 1OI3A 3PZBA 3GK3A 1WVGA 4N3NA 4RIGA 3M70A 1XCLA 4C08A 3J80A 1G8HA 1WG8A 1KQ3A 3ZU4A 2EBWA 5DTJA 5EIBC 4IG4A 2LCQA 3VYUB 1G8GA 4DCJA 2ATEA 2CNBA 3DFIA 3MIZA 2QENA 3VGJA 5JMTA 1VB5A 1Q3TA 3WZ2A 2I67A 4YRDA 1SU8A 4OGWA 3D6AA 3JYHA 2FPPB 3WK7A 1I0ZA 1WDKA 3O93A 4Q1FA 2V6MA 1IXYA 3OZCA 5C18A 4UASA 4PGAA 1XEXB 5LA6A 5KWSA 4MGHA 1G9XA 1H2HA 4PSCA 1YNOA 2R85A 1RTTA 1ZSYA 5KDDA 1BXGA 1DPGA 1H6AA 3HP4A 1XKQA 4RPGA 3LUHA 5IMBA 3PSHA 3U3DA 3AETB 3CGGA 3A3KA 1QTRA 3RF7A 4PO8A 4B4UA 2AFHE 1WSAA 3K0AB 3IVAA 5I9TA 1G5TA 2AG6A 3SYKA 1ORTA 2OB2A 5A0FA 1ITZA 2HMVA 2YH2A 1HZZA 1W36D 3AG6A 1PDVA 4WKCA 3SF8A 2R4TA 1KARA 4OHZA 3Q15C 1M5UA 1J8MF 3IQIX 3PFFA 3BREA 1NPYA 4IKOA 1YZ3A 3OD5A 3LGXA 1FNBA 3DT8A 3WJ1A 5I7UA 1E6WA 2D4AA 2JW5A 2J09A 4GPAA 4HG2A 4JLJA 4CXMA 1KE1A 1JBKA 1GZVA 1R6TA 1X1BA 3O4IA 1UANA 2IUTA 3M9WA 3OY7A 3BRWA 5KNLA 2NLOA 3B7GA 3DQPA 3DLBA 3KUKA 4EYSA 2GB4A 2IPAB 3FB1A 4IIVA 2OGTA 3MOGA 4GLFA 1FE8A 3I9OA 4XJXA 5TQ2B 3ZCUA 5J47A 2DVMA 3VDQA 4PC2A 1HQDA 1VFNA 3RIMA 1EGHA 3SE7A 3WMWA 3ZDFA 5B12A 5JD5A 2IYTA 5ALLA 1V9SA 2C99A 3LI2A 2KLBA 3FHCB 3WSTA 2VAWA 3FNRA 5EINA 1I7SB 3E4DA 4P4SB 2Z9DA 5J4YA 2G6BA 4F6CA 4XD2A 3GNLA 4I5IA 1OREA 1I2MA 2BFMA 5DEOA 4X3CA 1E64A 1MV8A 2EJBA 4COKA 4JCOA 1SO8A 1CUHA 3R6LA 4CMHA 1ESZA 2PG3A 4NXNB 3DAYA 1I2BA 2Q2QA 3H84A 2HSGA 2P67A 2ZPAA 4O4JA 4ZYZA 4F3NA 5K1ZA 1Z0JA 3DKRA 3C3XA 4JDPA 4AQYB 3GGOA 4JUIA 1BXRB 2VJNA 4I1IA 1K7FB 5BUQA 4LWQA 4PHFA 5FTLA 2QPAA 4I14A 1NXWA 3Q7QA 3U4AA 4Q9AA 1IOWA 3OQIB 2YJ5A 3CKKA 3O94A 3A9WA 2H1SA 2P2LA 2PUJA 4PN7A 2J3MA 2ONZA 3N07A 1FQWA 1Z0IA 4RNDB 5CLLA 3R76A 2YW9A 4FMCF 2HWYA 4KPUB 5EOVA 3L9XA 1A9OA 1Z18A 2R7NA 3BL8A 5AKXA 1V35A 3FAKA 3PKJA 4KJZA 3P9NA 1NXTA 1NUQA 1A9QA 4NNJA 4CLOB 3DD1A 3VTZA 5A5EA 4OL9A 5EG5A 4QECA 4REOA 4Q3OA 1KKMA 1YMQA 1SU4A 3TUZC 1J8VA 4ATNA 4FIZA 5TEWA 1ADGA 5BV1A 2OGWA 1DBSA 3HO6A 1MAVA 2BMVA 1Q44A 3E1SA 2OKGA 3D5QA 3NIWA 1CETA 1EVJA 3FZYA 3JARA 3A9CA 4MVJP 2IE8A 3K5PA 3JQ9A 2VDRB 1DJNA 1OVGA 2Q6LA 4PN3A 2B2CA 3ZUGA 3PJRA 3HA5A 5DF1A 3DNFA 2GKSA 3DKPA 1OXSC 1TK3A 5KYYB 3KHKA 5G0SA 3U4MA 1J9EA 1N6LA 4D9HA 3HM9A 1KNQA 2X0DA 1QUFA 4MV4A 4UFNA 1OILA 4MVWA 2YWBA 1AXGA 3AGQA 3N05A 3NHKA 3B6KA 4G89A 4II3A 5HKKD 5LD2B 5K4GA 4C29A 1QHXA 2JGKA 2QXTA 5KTPA 4RZHA 4P36A 4CG2A 1JYSA 3IESA 4AIRA 2EWWA 2D6FA 5BSHA 1D9ZA 2PJUA 5C2JB 1T8TA 3CEPB 3O95A 1JSZA 3G1WA 4GI7A 5HIMA 4JUDX 1PCXA 1EWYA 2VAPA 4GVLA 3PD7A 1T2EA 3U80A 3DLHA 1EFRA 4FGZA 4UHFA 3WL4A 1ZLYA 2AJ8A 4OQPA 5DBOA 4MLDA 1G5IA 1RQ2A 4J43A 4HNTA 2C2HA 5HRCA 3DDSA 4DMCA 2IQIA 2N0SA 4IV8A 5A1JA 5CB6A 1TDJA 2JFWA 1D9XA 1VSVA 4K6FA 3URMA 2BMDA 2X6QA 3KU4A 3ZHOA 4ZVPA 1UIMA 2Q1YA 3LD9A 4BLSA 1K66A 4INPA 2X8WA 2NT4A 4QWWA 2P6RA 1XKTA 4GLJA 2VJKA 2ZUWA 4ZQEA 5ALKA 2J3QA 1OZAA 1BNCA 1BU8A 2JLQA 1P6QA 3ND6A 3ZNOA 5BQ5A 3WWCA 4K0KB 2ZM6B 2CLLB 4D9JA 4L8VA 3G1TA 3WR5A 2QP9X 2OSVA 3B7PA 1ICEA 4MZXA 1ZJYA 2RH4A 3DEKA 2E4VA 2IFTA 3O47A 1XMSA 4EO7A 2BEWB 3AF2A 3OH8A 3V7WA 2GXAA 1AGRA 2O8EA 2NUPB 3D2CA 3NTOA 4MI3A 3FYUA 3HS3A 2QRKA 1DQNA 3DE0X 4TQUS 5DSTA 4A1OA 5K0ZA 3QG1A 4D43A 3U7GA 5IZCA 4CIYA 4BNWA 2Y66A 4GZ3A 1NWCA 3MB8A 4TLCA 1R8QA 2VRNA 3HA3A 5LP1A 2QNRA 3H3FA 1N2GA 5EA2A 4RF2A 2H7XA 4CQLB 4X3OA 5TR9A 2WZCA 4X93A 3I2IA 2EJUA 3AC0A 1Y9JA 3QBVA 2FP4B 2YIVX 3C3BA 4I9NA 3QUTA 3SHWA 1PYDA 1ZSVA 3PV0A 1QQBA 4L2IA 1JKFA 3G7UA 4BQRA 1HQYE 1N5IA 1FRNA 3FKSA 3U61B 1R4NB 4ZALA 2AEEA 1EWVA 2YWGA 4K9NA 1OFGA 3PEWA 3CIFA 4CVNA 4BRZA 2M98A 5CCEA 3AB3A 2W2LA 1YU9A 2YZ7A 3T3DA 4ZMSA 5A3QA 4CWAA 2NP6A 1KXJA 3IA2A 4MWBA 1ULTA 3OHPA 4GM4A 1A95A 4DZZA 2M32A 3ONFA 4Y9TA 2DUNA 4A5OA 1KSFX 1E2IA 4PYQA 4IOMA 3KQVA 4DMHA 1Z4LA 3ZWPA 4PVCA 2XAAA 4QRHA 2NVBA 2RAFA 1NM5C 3MXTA 1XZIA 1I13A 5BSGA 3HBLA 2RK6A 4RXMA 3I8OA 1E0SA 5KTMA 3BH0A 3BN3A 3QKIA 3EXHB 5LNK6 1J0CA 1GITA 1QH8A 3U37A 4CE6A 4UQLA 2I4TA 2JHFA 3JQ9C 1SCJA 1F2UA 2KBFA 5ANRB 4XGNA 3WLEA 2O3RA 1GRNA 3LRXA 4WOCA 4O5AA 4WNCA 4N3BA 1FRQA 2CNDA 3DPIA 3STHA 5BQFA 2VRCD 3C24A 5HJ7A 3LG2A 4I4NA 1FXSA 4WY5A 2P1ZA 2JGRA 4W7IA 3SS9X 3A2KA 4GX5A 3WSVA 1AKYA 5CLJA 2CW5A 3OTWA 4K1XA 1NW4A 4RANA 1A5SB 3MMPA 2CB9A 4H0FA 5SV2A 4BGDA 2OPHA 3WLQA 1XXLA 2QIPA 5LPNA 2REBA 4I55A 5AW8A 3RS8A 1H0KA 4CM5A 2GBLC 3E7WA 3UBTA 4MEJA 1YRWA 4B4VA 1ELOA 3PRHA 3RJTA 4KLNA 5KQRA 1Q91A 3L1KA 4LHEA 4QU5A 3RSFA 3VYWA 4EPVA 5CXXA 1NR7A 4LJ8A 1IJBA 4JWTA 1E18A 1JR3E 1E1RD 1QLHA 1WOYA 2QD5A 2Q62A 3OT4A 3PL5A 3SLKA 3TOSA 5DYNA 4ZI7F 1DP4A 5LUBA 1EUQA 3FKQA 1I5RA 1CLUA 2JCYA 2V7WA 4QBFA 5ALVA 3K8YA 2WU4A 4LE2A 1LPMA 4RJKA 3KQMA 3ZZ0A 4CDMA 3ROMA 1G20A 1KDOA 1N3IA 5D84A 4US0R 5C46F 3LTNC 3FSGD 4EQZA 4GI1A 3CSSA 1DAOA 3DZIA 1DWPA 3HFRA 3EDMA 3TE6A 2JIQA 2G7ZA 5LIRA 4HVAA 1BHSA 1CIVA 1GLNA 1WD5A 4L28A 2P2YA 4BUZA 5JDCA 1EJ6A 1E3JA 2IITA 1KJNA 4QYMA 4BNKA 3HXMA 1W5SA 4EGSA 2QRUA 1GGHA 1NVKA 2XWJI 2IT1A 5DN9A 3DDNA 1Y1LA 3VPHA 4BEBA 4Q01A 4F84A 4AROA 3I01A 3QSYA 1T0IA 2O8BB 1Q6YA 2O0MA 3AERA 4MW6A 1FYEA 2OQRA 4MV3A 3RT1A 2MTBA 4ZK6A 5ICGA 4EPXA 4Q3EA 2B6NA 3P20A 1P2FA 3TLAA 1QXSA 2A9QA 3H2JA 5JADA 3T7KA 3O4HA 2WVAA 4LUCA 1LBTA 4J9UE 3AL0C 3REQB 2V5VA 3DW3X 3NYWA 4YTEA 2DR3A 3P0JA 1I1NA 1P2GA 4F3CA 3B7WA 2E1PA 4NOLA 4R1TA 3V7NA 4BLVA 4NCHA 4QREA 3G2QA 4PNHA 5FUXA 2AD1A 3U7JA 4Z4FA 4IDCA 4GL4A 2MJLA 1X7ZB 2GZAA 2WP0A 3GN1A 2WUDA 4FGWA 4KDCA 2FWRA 4YP7A 1QPBA 4J91A 3SS8A 1JH9A 1OA0A 1LI7A 4XUEA 3V1UA 2NUBA 1R4MA 1GGKA 2XX3A 1EXWA 5CJ2A 5A06A 3HV0A 2Z83A 3VO2A 4BBJA 3L1HA 1TLFA 2Q99A 5GONB 3WBBA 4BNHA 3NCHA 5JMPA 4BZZA 4DRXB 4WZ6A 2GPAA 3E8SA 3EMVA 2PMFA 1USIA 2XYQA 1N8SA 5AW6A 2E4WA 3AUFA 3LLUA 3WI7A 2X5XA 4HFNA 1GJRA 4YACA 4OLBA 2GNAA 4FFBB 3VH1A 1PEAA 4K9KA 2H5IA 5EPUA 2H0RA 4P7FA 5JBIA 2WYUA 5JQGA 2COKA 1A9XA 2ZYGA 2O0HA 2BFOA 3O8QA 4A5SA 2Z1DA 3FETA 1DKMA 1LVHA 2PT6A 4I5DA 2BGMA 5LUAA 2XKKA 3PPIA 4ZVOA 4IGIA 2I3AA 3F71A 3PGJA 1B26A 4FE7A 3V55A 3VVCA 4AX4A 4NOKA 3DAPA 1Q0SA 1VQ1A 1IZ0A 1KR2A 2AT1A 2I2WA 3DUWA 3R20A 3ETCA 1Z4JA 1JR3D 4GECA 4Z9FA 4X5OA 3OZXA 2GEFA 3VC2A 4DCTA 5B30A 4IV0A 4Z1OA 2SCUA 1ECBA 2ZYUX 3GZJA 1J8FA 2NM0A 2B82A 2X58A 2ZRCA 1VE5A 4R0VA 5E9JA 1TKAA 1WBBA 3CV3A 4KMMA 5FOQA 1KZ1A 5AKEA 8ADHA 2PUCA 3B1KA 3CRRA 3SIPA 4AXBA 1KMHA 3K0HA 2FZWA 2WT4A 1FMJA 5DISB 4FKZA 4GKVA 4JP2A 3RTBA 4RL6A 4E88A 4DBLC 4O4HA 4DQ0A 4HH0A 2WOOA 4G1EB 4LF9B 4LEIA 2GPTA 3LNTA 2B1JA 4EJ2A 4XOUA 5JJIA 1OWPA 1X7XA 4NNPA 3ZLTA 1N5LA 4YQZA 3KE8A 1IB0A 4FDLA 2I4RA 1DAKA 1HURA 1I3NA 1KXZA 1LNQA 1V45E 2QQFA 2YFKA 2Y8EA 3LUDA 4KQMA 1W85B 3UWPA 1ZH8A 2D1YA 4RD4A 4KLAA 5JSQA 1AMNA 4JIGA 1ZVVA 1ZQ9A 2YN0A 1CY4A 1SZCA 3DH0A 5THKA 1C8VB 3ZBUA 4KNVA 2P68A 4QTYA 2G7MC 2BRUA 1L5OA 3KL4A 3N8DA 1HG0A 5BN5B 1CE8A 2E89A 5I47A 2UYOA 3ETDA 1ECLA 1RWPA 3EEBA 3PXUA 1BVHA 2WU0A 1H94A 4Y2HA 2O23A 3TEJA 4PZ9A 4V0NA 4HDOB 1I3LA 5C4MA 2AQKA 1Y8RA 3CRMA 2NZYA 4AN4A 4JV5B 3VR3D 3FZEA 4RLSA 2F4NA 2R5FA 4J1SA 1ZD8A 1KRHA 5J2UB 3W6ZA 4CMEC 2FMHA 3CRNA 2XMPA 3VOSA 3UXHA 3OLWA 2GPJA 2PX4A 1ZWLA 3DW1X 1O87A 4C7XA 3VR2D 2OP0A 1DWUA 3JQDA 4YRAA 4BY9E 1HE2A 1HDEA 4I9GA 1HZJA 1D2NA 1G8FA 3THXB 4TTAA 1PZHA 3A05A 4QELA 3UJ7A 3FCCA 4DMLA 4ZCIA 2G09A 2PLAA 3C48A 3NHBA 4RABA 4IDFA 3MN1A 3V8PA 4ALIA 1NGSA 1JEQB 2WV9A 4ZOAA 1XLUA 1N9GA 3TVYA 4AF7A 5L7TA 3PTAA 4KZKA 1XYVA 2X2EA 3PL1A 2Q3EA 4NHOA 3PHHA 3T7EA 4NJMB 4CU5A 3FMGA 3QKSB 3ZWMA 3ZW8A 5JJ5A 1S3FA 1TA4A 4UHKA 5LOVF 1K89A 3C87A 4DWOA 3FVWA 1EHYA 4UREA 1ULSA 1BU5A 2CWDA 1TYEB 3HBJA 1VYTA 1LGYA 1JFLA 2CEAA 3H1BA 1ZVQA 1CWUA 2CZGA 4OAPA 4MGZR 4P31A 1ZMRA 3UAVA 4AJ9A 4S2EA 2PUDA 3JYQA 2E2WA 4AFNA 3GPBA 1X0VA 3U9LA 2J41A 1MH1A 2HLDA 2XVMA 5C81A 2MHCA 3THSA 1P4SA 5DYGA 3D6TB 1DEXA 5FTKA 2AH5A 2PR2A 4KO3S 4MNTA 4LK3A 4P1ZA 2BHTA 1C7IA 3INRA 4ND8A 2R1TA 4P7KA 4LZLA 4G07A 5JMWA 3ENZA 4BTLA 4B5KA 1Y1PA 2GCEA 3U3XA 4ER3A 5CFRA 1T8PA 2FUNB 3K0SA 2R6JA 3L0DA 4A6EA 3EZ6A 4DLAA 2GERA 1KEKA 2RI0A 1COZA 3L5KA 4D80A 2X22A 2QN6A 3WQHA 1JHMA 4H4EA 1JH8A 1DTWA 1KNXA 2QMQA 3AJ8A 3VSBA 5JAPA 5KYTA 2H1OA 1O1YA 2Q27A 2VUIB 3NIFB 2X86A 3MRXA 3K71B 4KK4A 4LQLA 2PYZA 4ND1A 3T9CA 1XJWA 3RODA 2XB6A 3CRVA 4A23A 1C4KA 2GN8A 1HT1E 2KI5A 1Q1BA 3P32A 5B2ZA 1J23A 5IBRA 5BSRA 3S2YA 1M7HA 1Z2PX 3O73A 4R7GA 3AYXB 2XVZA 3GDOA 1K3FA 2YQ4A 2W6ID 1W36C 2OKCA 2PUTA 1PV4A 3MMNA 4HNVA 1UXHA 2QX6A 4UE3S 3R3JA 4WDRA 5C53B 1UKVY 4YHHB 5CNIA 1A1VA 3GPDG 1WB6A 1T0HB 3DOIA 3MNFA 3O8CA 4RH1A 3UHPA 1USKA 4MWDA 4EG5A 1QIIA 1SBYA 4YDHB 1NF2A 1H6BA 3TNLA 2ZSUA 5BV8A 5BMOA 2CD9A 1JXOA 1EDOA 2VZ9A 3L1IA 1RW4A 1M6VA 1C50A 3BXEA 3S40A 2EKBA 3QY0A 1NUTA 5I7WA 4UVEA 4WFIA 2ZYWX 1OF1A 1GG8A 5IYZA 1WE2A 4DKXA 1BD3A 4EGJA 2AI2A 3ZKWB 1GAEO 2PYIA 4BXOA 2HEGA 3L0BA 2Q6KA 1PDWA 2X1VA 3F96A 1ZLXA 3L9WA 4DW8A 1PEDA 1YZUA 3G7NA 3QJGA 3HVIA 5JJKA 1NN0A 2RGYA 3NBMA 4YFVA 3QBDA 4QTZA 4A9AA 2Z2KA 3MCTA 1A7KA 2AK2A 3C6XA 1FVXA 2QG6A 3B85A 3NBYC 3PUXA 3UCEA 4JVOA 2AHRA 4BTEA 5CNKA 2QOEA 2R47A 3GA0A 5IJ0B 2UUBB 3P96A 5KQSA 2M6RA 2BHLA 3FNFA 3ITEA 4N5DA 5H70A 2LKCA 2HCJB 4CM8A 1TT7A 5HZMA 4MUMA 1Z8DA 1T9BA 4NQZA 4N8EA 5EE3A 2QG9A 4A0QA 3P9YA 3GNSA 5LKRA 4Z9XA 3W6OA 5HUJA 4P4NA 4G8DA 2BYTA 2VA9A 3L7BA 2EZTA 5C1DA 3NIBA 5KU1A 4FFSA 1OH5A 3IYLW 2VYND 1E7YA 2BL4A 4BQQA 2HU8A 2DWOA 3OIWA 1OXUA 2ZXEA 3OMWA 1B0AA 1GGNA 1QDEA 4OJTA 3RCBA 4ZI2A 3K92A 5KJ6A 1RI5A 3IPXA 3AHFA 4EHLA 2WTEA 3TH5A 2V6BA 3VOTA 4BLRA 3LOQA 3M6WA 5D6OA 3KFVA 1M1YA 5SYAA 4B7UA 4WKBA 3OI7A 1BWQA 4PINA 3R7WB 3TSCA 4EEKA 1V9LA 1NQTA 4TKUA 4MB0A 3CVWA 1QYIA 1K98A 1J8YF 1P2UA 3RS3A 3WDKA 4NBVA 4R2MA 3ILYA 3EB9A 3GZ4A 4NULA 2OYSA 1ECPA 4M0DA 4EG6A 2RB5A 5C8XA 2FR0A 4KIWA 1FDVA 1F8UA 5H02A 3RVPA 2BHNA 1DC5A 1DRUA 2QAIA 1W2HA 2CNWD 3TLJA 2D2IA 3TZ6A 4QOHA 5IANA 3KSZO 1WW8A 4MS1B 1ZUD1 1PTKA 4Q9DA 3A9RA 3M0EA 3DP7A 5BV7A 4Q66C 5DCYA 5HMLA 2XVAA 5A5VA 3ZD7A 1U65A 2YNMA 1EK6A 1T3SA 3AUXA 1YBMA 3B9QA 3C8ZA 3OOWA 2LKDA 5EKDA 5TQVA 3RSHA 2G8LA 5GZ1A 3TJRA 1P7WA 3A6GA 4V24A 2QXUA 3HL4A 4KR2A 1VL0A 3JASA 5E0OA 2GD2A 3DLTA 3K4PA 5CLFA 4EA6A 7REQB 1QYWA 4ZHQA 3HC7A 3AKCA 2DPLA 4UAUA 3AKEA 2VFAA 4WJLA 1G21B 2A14A 2I80A 4ENSA 3IIKA 4M9ZA 1BOFA 3OEWA 3MA0A 3MT8A 4F1JA 1G7RA 2WWGA 4E7PA 1J0EA 4ND3A 2C82A 2EGGA 1U7PA 4IH1A 3UFXA 3I34X 2JAHA 1G6OA 3C4QA 2WJZB 1Y3FE 4OUKX 3LDGA 4MVJE 2WMYA 4XKJA 5F2OA 4E2FA 3W2HA 2VT6A 5LMUB 4M55A 2X5OA 3UOGA 3WLPA 4IO0A 3HKDA 3KEGA 1UWVA 3QLJA 4TYPA 2VTVA 2ZWAA 5FX2A 3TECE 3E35A 4KXQA 2ADMA 4FJ1A 2QUKA 2J3JA 1JAXA 1DUIA 2BP7A 1JPJA 1OLSA 1R15A 2ESRA 2OCDA 1UPAA 3P5SA 1A8HA 1OVMA 4GKJB 4LHWA 4Y98A 2PVSA 1BYIA 3AK4A 4OYRA 5K5EA 4TL7A 2OV4A 2V7XA 3EF3A 4MJ3A 3RIHA 3BOSA 1YK0A 3OZFA 1XA0A 3ZDXB 1PZNA 3O92A 1Y4UA 1XELA 2NNLD 1Z6AA 3KEFA 4PCVA 4RSGA 3BDVA 2E18A 3VI4B 2V54A 4ZRDA 1UQTA 4QFMA 3OPXA 4G5YA 4TXJA 4X8MA 2PKQP 3DCYA 4CR8A 2BGNA 1KWKA 1PG0A 2IEYA 3PGMA 4HLNA 3BXXA 5DKFA 3T6KA 3GWZA 4FOTA 5EI5A 5FP0A 1JSRA 4RPIA 1O95A 1H42A 4HYTA 1V95A 1VMKA 4YQEA 4EA8A 1LPNA 2X9QA 4QNNA 5EKXA 1Z37A 3GHHA 3BK1A 1SG0A 1T6ZA 1E9EA 2O5RA 1P7PA 4QOEA 4NMXB 1H2ZA 1FZTA 1I7QB 2P2CA 4P3YA 4LZZA 1KO4A 3A4LA 4WVLA 2NZ2A 3H1FA 4JUAA 2HCRA 2QYSA 3T9EA 1PIWA 1OLXB 3VX4A 4EA9A 4NONA 4Z99A 3U4IA 5HX7A 3ZHCA 1RVDA 1H1LA 3R7SA 3SZRA 2BZ0A 3FCXA 3JALB 4H7KA 3CSDA 2XGOA 3OHMA 4H6VA 4OHVA 1MRZA 2WPNA 2GWHA 1T4GA 4U1RA 3WLHA 2QA5A 1F6WA 4E51A 3ENNA 5FUBA 5BPHA 3FYDA 4FEYA 4N7BA 4X0EA 3W8EA 3GWGA 5KTSA 3O2NA 3P26A 4PXYA 3ZIUA 4JC5A 4EHFA 2AA3A 2OCPA 1WZ2A 4LY3A 4HZIA 4ERNA 5T64A 1Q19A 5CXUA 1EG7A 4U6SA 2XCSB 2YBEA 2C0CA 3T7SA 3B89A 1LU9A 3U2QA 1UOPA 3UJDA 1J0XO 3MCWA 5KHOC 3WTCA 1TADA 4YT5A 4L5YA 1E92A 3OU7A 4RE6A 2EAUA 2V96A 2VOEA 1GUZA 2XGJA 1I3MA 1P0CA 3E15A 3WLLA 2HA7A 3DMTA 3CLHA 1FUIA 4WA7A 4AW9A 1ZD3A 1OX4B 5M04A 1YASA 4X64B 1WAMA 4F38A 3MBOA 4WK4B 3FRJA 3UCXA 3ET5A 3TCNA 3TQQA 4RZ2A 4AL4A 1SBIA 4AG6A 2XOEA 5FTWA 4U7HA 4Z3DA 4YCCA 1YA6A 1XKXA 3E81A 3VC1A 1ZIDA 3SSAA 3DBIA 1U0JA 4MVJD 4UBNA 1KK2A 1VJ0A 3CH7A 5TF4A 4YUWA 5LIPA 2QKYA 1AX9A 1CUIA 2D13A 1BCSA 2JFQA 4WH0A 1WSWA 3ZQKA 4RSHA 5TPZD 5KYKA 3LF2A 4PVDA 2J32A 3NYIA 4E2ZA 1UEJA 2RAUA 3NV9A 2DAPA 4GMHA 4ZEWA 2YFYA 4P3XA 4BGEA 2H1FA 3PJDA 1JKIA 3GFFA 3FPLA 2JGNA 2H11A 3P45A 3PP8A 4O2RA 5DLEA 3RYFA 2XADA 1PJ8A 2WT9A 3DL2A 2Y1GA 1RYMA 4C1NA 1UINA 4EB0A 4LV6A 2HZBA 3RADC 4PGHA 1R12A 3I9KA 4C7KA 1AE1A 1I4LD 2IP1A 3DM9B 4XA8A 3ROTA 2XVXA 2P41A 3TX2A 4P4TA 3MMXA 4S1WA 1KGSA 2QR3A 4KHZA 4ZAXA 3L7NA 4YGXB 1G4HA 3SLRA 3VV3A 4XX1A 5BWOA 2V3CC 3K1JA 1W25A 4OHYA 3WLRA 3D4OA 4MR7B 2ZJ8A 5IVHA 4RKYA 3FOCA 3FR7A 4BNGA 5JNRA 2A9RA 2LR0A 2PSHA 5L7WA 5LN1A 1ULZA 3V4VB 3PUVA 4QRDA 1SQSA 3KIPA 4HZUB 1OZGA 5AVSA 4PY2A 3QYJA 3C5CA 4A16A 4J3JA 1YGYA 5A0TA 3H9EO 1GARA 4YIHA 5HM6A 4ND7A 2FSHA 4CMGA 3UT5B 4RA6B 1CRWG 1IXRC 1YI8A 2VDOB 1R0KA 3N0XA 2GOYA 4LBYA 4B3RB 1N4AA 1TT5B 4B3XA 1NJSA 1A9ZA 4IWNA 3UJNA 1HL7A 1XE3A 5KDLA 2WYIA 1PN3A 1H0HA 3C6KA 1DO8A 3FMIA 1HE8B 4BQNA 3H65A 1XMPA 3KAPA 4CETA 5JSZB 3UT0A 4M3NA 1YJQA 2HUPA 3AEKB 2YOGA 5AI9A 5SICE 2AC7A 1SHKA 1UBKS 2CUTA 3BIWA 2J0EA 3QX7A 5LQMA