2IKQA

Crystal structure of mouse sts-1 pgm domain in complex with phosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
KRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTVIDHVYCSPSLRCVQTAHNILKGLQQDNHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPVSKLAISESYDTYINRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Phosphatase Activity of Sts-1 Contributes to the Suppression of TCR Signaling
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein, immune system
molecule keywords Suppressor of T-cell receptor signaling 1
total genus 77
structure length 262
sequence length 262
chains with identical sequence B, M
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2ikqA01
3KKKA 4MA4A 3EZNA 4JODA 3LG2A 3QPVA 1V7QA 1CVIA 5AJZA 1IHPA 3IT3A 4D4MA 3FDZA 4PZ9A 2ENUA 1XQ9A 2P77A 3QPWA 3MBKA 3DCYA 4ARSA 1NT4A 3GP5A 1H2EA 4GPZA 4PZAA 1E59A 3E9EA 2H4ZA 4PGMA 3LNTA 2P2YA 2WU0A 1YJXA 2P6MA 2DWOA 2PA0A 5HR5A 5PGMA 3NTLA 2P75A 2OWEA 1DKLA 1QFXA 2H0QA 4AROA 5AJXA 4ARVA 4D4LA 2HPAA 4IJ6A 1TIPA 3MXOA 5CDHA 3K4PA 1DKPA 1C80A 2AXNA 3F3KA 2ENWA 3OI7A 1C7ZA 2P2ZA 1YFKA 4EO9A 1EBBA 2F90A 1BQ4A 1SKAA 2H4XA 2P6OA 3LL4A 1RIIA 4QIHA 5HTKA 5AJYA 2BIFA 2EKBA 5AJWA 4FDTA 5AJVB 4JOCA 1H2FA 2EKZA 1DKNA 2YN2A 3IT0A 1T8PA 3K4QA 1SKBA 3FJYA 2P78A 5CU7A 3FDZB 3HJGA 1QWOA 1E58A 4HBZA 1K6MA 2HHJA 3NFYA 1QHFA 1BIFA 2A6PA 4GPIB 3E9CA 2HIAA 1UJCA 1UJBA 2DWPA 1DKMA 3E9DA 1ND5A 4TSRA 1RPTA 3F2IA 1ND6A 2OWDA 3BIFA 1DKOA 4ODIA 1FBTA 1SK9A 3ZHCA 2A9JA 4E3WA 4EMBA 2WNIA 4FDUA 2EOAA 4JOBA 1V37A 4IJ5A 5AK0A 3IT2A 1C81A 3PGMA 1FZTA 4ARUA 2P9YA 3D4IA 3QPUA 3EOZA 3R7AA 2YN0A 2GFIA 2I1VB 1RPAA 3D8HA 5CX4A 2P30A 3O0TA 1SK8A 4D4KA 2QNIA 3DB1A 2P9ZA 3IT1A 1BQ3A 1DKQA 2WNHA 3C7TA 2H52A 2RFLA 3D6AA 3GW8A 3GP3A 2IKQA 4D4JA 2P79A 2P9FA
chains in the Genus database with same CATH superfamily
2UYYA 5C52B 3AR7A 2XUIA 1T5HX 1B16A 3AVOA 1OB2A 5BNTA 1F6BA 2QPAA 3AX6A 721PA 2ZBVA 2XRYA 3PSHA 4JS0A 3KVRA 2ZJZA 2VJDA 1CUSA 4XYMA 4XPIA 4ARSA 1Y9EA 4CMGA 1WG8A 5AOCA 2OZLB 5J4HA 1RS0A 2CLLB 3FN4A 4FW8A 5FL7D 3WSWA 1SUAA 1E6WA 2FSSA 2HZBA 3OTQA 4IUYA 2H1IA 2IPNA 4LY0A 4Q4HB 2F3TA 1BXGA 1O1YA 4NJMA 3GFSA 2FZ5A 4Q4JA 4W8HA 2ZKIA 3YASA 3U5ZB 3GYGA 2OWEA 3EFEA 4KV7A 3Q12A 1LC0A 1M2VA 1BCSB 4L0DA 4GP7A 4JI8B 1ODTC 1O7JA 1XQ1A 1ZQ9A 2V55B 2ZR8A 3AO0B 2BGJA 2QTAA 3LI2A 3IS3A 1L5VA 1QV6A 5CMLA 4FKMA 2ASVA 2PQ0A 3Q8WA 3ZWXA 1W0JD 4W6ZA 4Q1DA 2HNBA 1J42A 1ZK2A 1KR5A 3EBLA 1QGYA 1Y8ZA 1YZ3A 1AZTA 3L5KA 5DHTA 1PR9A 4QQKA 3T0IA 3UTCA 4TYWA 3OG9A 4KE9A 1FMFA 1P7CA 1TO6A 1KSHA 2PS3A 2CFCA 5EZQA 4AUMA 5CK4A 4TUYF 2Z8XA 2LW7A 1FA9A 1U5BA 1OGYA 1XV5A 3E1KA 2IE8A 3CW2A 4L5AA 3SSMA 3TX6A 5CG2A 4MRVA 1A88A 4OA8A 1BN7A 3MB8A 4R8LA 4FMBB 3C1OA 4HH1A 5DIZA 4BPRA 4QQRA 4KHPB 4P9NA 4YT2A 5CB4A 3EISA 2YUIA 4WUVA 1I9GA 3FNFA 3B9PA 5CXSA 4CNQA 1AKWA 1RXYA 2V58A 3JQRA 5KVQA 2RGYA 5I9IA 3AM1A 1M1YA 4HADA 4ZCLA 1GV1A 4AKGA 1KDVA 4V24A 3DMHA 1Y42X 2Z5VA 3N2EA 5L7YA 2FU5C 1U3WA 4DY4A 4NU8X 2F64A 4P36A 4WOPA 1TL7C 5K3FB 2WFLA 3QUTA 4D9EA 5JXGA 2YKGA 3L0BA 2DUUA 3WISA 1MZVA 3FHCB 3HO8A 5KWSA 1GPDG 2HF2A 3NHAA 3CLRC 5D5PA 4OFWA 5CYFA 3KQNA 1VM6A 1YDHA 3O8QA 4OXNA 2J31A 5EPOA 4FLMA 4RQUA 3ZD9A 1C9JA 1IOZA 1HT0A 1G21E 5ECDA 5IJWA 1VL8A 4C05A 1SH7A 4WSOA 2C9YA 4I50A 5ALHA 3QRWA 4DIDA 4PWZA 2NIPA 2MSCB 1DB3A 5BW8A 1KXZA 3QPAA 1T0IA 1UR5A 1ARZA 1PVVA 3AR4A 3GWGA 2HO4A 3FUCA 5HJEA 1SY7A 3LLCA 2FP3A 1LU9A 1C7IA 1EZ1A 1NW6A 2CLCX 2EG5A 4WLVA 4MKIA 4MUBA 1RLOA 4DA6A 4NICA 3PFBA 2WIKA 2GHIA 3Q9SA 2BZ1A 2HSGA 2OOSA 2QE7D 1W6RA 2F1KA 1MB2A 4OMCA 3SDZA 4DNQA 1AMNA 3N6VA 4RUKA 4FINA 5ANRB 5ARBA 1YMVA 4LNAA 4ERXA 3QLJA 4DMHA 5FWXB 2BHTA 4XGNA 3C6QA 1ZXXA 2WE8A 4BEVA 4C20A 4D41A 3LNCA 4WASA 2D4HA 4HFNA 4CHTA 3H83A 1W44A 1K1EA 1P3Y1 1D5WA 4B44A 3GR6A 4FI3F 4INJA 5B55A 5HKAA 1KEVA 2QS9A 4J7XA 4KN9S 4LGVA 5A05A 5MN6A 3CZMA 3HA5A 1C2YA 3OM0A 3CJQA 3LQ2A 1U0NA 1DVRA 3QX8A 4FK8A 1B0UA 1UFRA 2H2AA 3FWNA 4QQNA 3WYDA 4B34A 1AS0A 4FHCA 5LR6A 3C4QA 2WJYA 2W42A 4GKKB 3H19A 1B8VA 4HQRA 1MXHA 2ZWMA 4HLDA 3ZCTA 5BNWA 1M73E 1RAEA 3V7YA 4Q01A 1P2TA 2PUHA 1G66A 2FLVA 3LT0A 2ZSUA 1LVGA 3O73A 4O1HA 2H2IA 4EG4A 4L4SA 5F7ZA 1T2VA 4EYGA 1B41A 5ADHA 3RVPA 4B7CA 3QYPA 4NYIQ 3R40A 4NU0A 4MK4A 5AKYA 1T5TA 2QLNA 4D1YA 4C87A 3GDGA 4XQEA 2QN7A 3DHVA 1E2JA 1PFUA 4GVLA 4WY5A 4GMXA 1K98A 2PWYA 1T15A 4Y2GA 2DPYA 3IPCA 4KBYA 4ZQCB 5BSGA 2V6IA 3JSAA 4FEEA 4KACA 4A26A 1U28A 1A9XA 3CQ9A 4I19A 1VL1A 1GPYA 1QWSA 1L6IA 3AIOA 1CEXA 4HZUB 1JPJA 3JQ9C 2VSXA 3QU7A 4OOFA 1XAJA 3BMNB 1FTSA 4LWPA 5EHNA 3K70B 2O5CA 2Z56A 4PZEA 3BFPA 1NRIA 3LKZA 2V9PA 5ALMA 2NYRA 1JKIA 4J4BA 3V1YA 3T7SA 2YN2A 1JR3A 1L5SA 2ZB8A 3WRYA 1U1CA 4QSMA 1O6CA 1NR5A 3AL2A 3IO3A 2PKYX 1R6BX 3OMWA 4NBSA 1QWOA 2BGIA 2AE1A 3WIBA 5AVSA 1S9DA 4KJZA 3QTTA 2RG1A 5I4KA 2H18A 3GDOA 3RJMA 8GPBA 2A8YA 3FYTA 4GPEA 3E9CA 3C3DA 3GCDA 1J00A 1OFTA 3ILSA 5LIRA 3FAKA 3GJTA 1H8HA 5FPQA 2CVZA 1OYWA 1KFJB 4JLOA 2Z83A 4LOIA 3Q7PA 2ZOSA 1DPFA 3FFXA 4PLGA 4Q0MA 2OECA 3BL5A 4R1MA 3ZLUA 1PNRA 3LCRA 4DJJA 2YFYA 1A9ZA 1H22A 4TTIA 3RV4A 3ZBUA 4ID3A 5JD5A 2YN4A 3C3MA 3OKPA 4RTSA 1W4CA 4NR0A 2QN1A 2A0FA 5HFNA 1CR2A 5P8WA 2OAGA 2DPMA 2EARA 2YNMC 3G79A 3ZDEA 4ATNA 4DG5A 3I42A 2VSQA 1J6UA 4M1TA 2FOXA 4WD3A 4E14A 1EJ2A 3IEVA 1UFQA 1X1SA 1FPQA 4Z7NB 3QLVC 1FNNA 3HO6A 4N3CA 4RIIA 2BOVA 4YMUA 1NOKA 2D1QA 4OAPA 2I78A 4AP6A 3LX8A 3HNOA 4V38A 3OM1A 5JNLA 5KJEA 3PHCA 4OHZA 2FUCA 1PUXA 1S96A 2X8LA 1SUFA 2ZXEA 1NC3A 4WOBA 3UKOA 3C8DA 1FUEA 1Z88A 1GPUA 1QP8A 1UBHS 4RFSB 5JYEA 4H08A 4R9SA 1D2HA 3DHNA 1HFEL 4CF3A 1VL2A 1AJEA 3MB5A 2BPOA 3UV6A 3PDWA 1J23A 2D2FA 4G81A 3KUKA 4ME6A 1KZ7B 3H1PA 2P9FA 3MT0A 4H0NA 4HMOA 4UQLA 1BEUB 4GR9A 1C3VA 4LS3A 4ZVTA 2AKEA 5ADVA 4Z51A 4MWTA 1RYEA 1JIKA 1GA4A 3RCBA 3NAQA 3GRZA 3Q1LA 4XYGA 1AXGA 3U4CA 2XAAA 1P2FA 3M4JA 4QRHA 4LY3A 4KOAA 4NL4H 1U7XA 4MQLA 3AJRA 3FTNA 3TFWA 4JQCA 4KIGA 4NARA 4ZI7B 4I0WB 1OFHA 2ZIEA 4GZ3A 4ALLA 4HDSA 4ZVQA 4U5QA 1BDBA 1XYYA 4XWYA 3O8BA 1R66A 3E7WA 1NI5A 1L5HB 4ASUA 4IYRA 3D3WA 3S1SA 2J3KA 4DCPA 1CZHA 4K9QA 1M2OA 2EW8A 2EFCB 3AESB 4UE6A 4UHHA 3VDMA 2LRHA 1KRWA 1N9ZA 2AMFA 2GD0A 2D1TA 3AC0A 2OEPA 4M0UA 4AO7A 4DZTA 3Q7EA 1DOAA 1QHNA 4P7KA 3K0KA 2VJKA 3K6SB 1E1RD 1TQ4A 3DUWA 3FPKA 2EZUA 5I7SA 2UUCB 1PWXA 5CJ2A 3EIEA 3O8NA 5B6JA 3ES9A 3ZWCA 4GE3A 2DKFA 5K0TA 1JFFA 1AKQA 3SJBA 4MV4A 5JFGA 4YBRA 1A71A 3A32A 4IG4A 1ZMBA 1AKNA 3H87A 3EA5A 2G6BA 2YXEA 3EYAA 3T5GA 7REQB 1QF6A 1H69A 5D7NA 1J2JA 4G4IA 2P35A 2J8ZA 4BO4A 5DNCA 3OSZA 4KKXB 1N7IA 3F5SA 4HMPA 4I5DA 2OCYC 3TCXB 4K81B 4CW7A 1NQVA 1UWLA 5BW5A 5C3MA 3NGXA 3H5LA 1E7SA 4M8KA 4NY1A 4DEYA 1CEEA 3ZH2A 4C4OA 3TZKA 4D25A 4M0KA 3U60B 5CU7A 5EG5A 2FA9A 1MF7A 3FCEA 3R7NA 5IWAB 1C3XA 4QYWA 5TS3A 1UJMA 1KO8A 4HATA 3VV3A 1BU8A 3EARA 4FN5A 1YT5A 3SMQA 4BNZA 4D02A 3RC8A 4Q3BA 5ICSA 1PFGA 1EX7A 3FVVA 3H7IA 4L6CA 3MGGA 2WWVD 2QBYB 2O19A 3ABOB 3TX2A 4M1OA 3U26A 1U2GA 5CT6A 4ZA2A 2CBGA 2JIOA 5KAPA 2ZRLA 5HX7A 3NKLA 5JFTA 4Q03A 2QRHA 3EMDA 4IQFA 1A4IA 4IHKA 1T5IA 4R98A 1ZONA 1VPTA 3A0UA 5GV8A 3T5MA 3KTDA 4X3PA 2VF8A 2VQ6A 3K0CC 3PXXA 2DY1A 4BU0A 4EAQA 4ODIA 4Z9XA 4E5NA 4DWOA 4UTRA 2ZJ7A 2JL1A 4IRUB 2C94A 3I9KA 2VK2A 4OLBA 2HJHA 2AOTB 4QLOA 1QZTA 3LCJA 1GPLA 1U3CA 4QD3A 1KNQA 1HQKA 3PJDA 4OXKA 4F5DA 1RHJA 4REOA 2R65A 1IOLA 1ZW6A 2IHJA 4CMHA 1WDLA 4D9MA 1HRKA 2J5KA 4WKGA 3U39A 1CRLA 3K7EA 5CEJA 1TQ2A 1UJNA 3WB2A 3HP4A 3ZWDA 2XMRA 3HN7A 1GXSA 6GPBA 2B2CA 2V6GA 3NRCA 2O2ZA 2QNIA 4TSFA 1PDOA 2BFCA 2OV3A 3OCUA 4XUCA 4M0EA 4QTTB 3UJHA 1ZRHA 1EP1B 2BP7A 4G5HA 4DJFC 2CVHA 2B9EA 4BZWA 2VHTA 2F6RA 1ZH8A 1TF2A 4AMZA 4MS1A 1PT6A 3LRTA 3L84A 2ECOA 1I1QB 3E0QA 2Z2YA 1PR3A 1LJLA 3LLUA 3ZH9B 4BC1A 2QQ0A 5K0ZA 5C80A 2P77A 1NY6A 4FR2A 1O5IA 5DWQA 1NI3A 1KJYA 3O4RA 3FCSB 2AHRA 3ETJA 3C3WA 2PL1A 3A4VA 4BNVA 5C9ZA 1RW4A 4ZAZA 1Z2AA 3L0PA 4HC4A 1Q0PA 1E0DA 1RAHA 3A4NA 4O4LA 2WTBA 1DTWA 2Q5CA 4BDSA 4W1RA 2YTZA 3MWGA 4OI4A 3VHXA 3VAAA 2Q62A 5BWMA 1IUNA 4WNCA 5FNVA 3WVNA 4QUDA 1CB7A 1GCOA 1RPJA 3V8EA 1L4UA 5DTQA 2XA9A 4WN9A 1G8PA 4MOWA 3RH0A 5BW4A 2QMHA 1DKPA 2GVNA 3SF0A 4J76A 4UE3S 4UOQA 2E7ZA 4IQ0A 2OGTA 3MEQA 1WIWA 3M5CA 2Q5QA 3I32A 3CHYA 3QVJA 4GPTA 1ZCBA 2BHNA 2BSXA 3G49A 4AMUA 3I37X 5KTOA 4Q1FA 4KAFA 4Y6QA 3OQPA 1OA1A 3LX5A 1YSCA 1WUTA 3OMXA 4DR1B 2IBSA 1OBHA 3ACDA 1NR1A 3M2TA 4OHVA 1OC2A 3JVVA 3C8ZA 5HCUA 1VKJA 2ZLBA 3CLRD 4G8JA 5L45A 1IN4A 4I8XA 1FMTA 5AW8A 2GB4A 1NQWA 5C53B 3LXUX 1A2OA 4JBGA 3M8KA 1YDFA 4TQ9A 1YQUA 1QOPB 2B4AA 4EHNA 1JXAA 5J5CA 4KPFC 1OQAA 2OGZA 1GZ4A 2DQ4A 3NTVA 5E7MA 3WK8A 4UAJA 3W2EA 4NNJA 1BDHA 1ZI9A 2R6DA 4F97A 2VPTA 2XCRB 5EKSA 4JVNA 1Z28A 3KVYA 4B09A 2XDAA 3OZAA 5BR7A 1C3EA 2HNAA 4FHFA 4KU4A 4UQPA 5L6MB 1IM2A 2UYCA 1BJRE 1MZPA 3G7NA 1NUHA 2HGZA 1E94E 1NAHA 3BTOA 5DZSA 2GETA 2XB6A 5CDSA 2VRNA 1OZAA 1YI8A 5AKXA 5M2QA 4ZVKA 4ZVPA 2FPXA 3D43A 1AKVA 4R41A 4ZK2A 2R47A 2ZTUA 1W0CA 3JATB 2LWIA 4FU0A 4QXQA 1VJ5A 4JBYA 3RVQA 1QIKA 1IK6A 2ZSIA 3OF5A 5JAQA 4ML3A 1UC5B 4LOAA 4LRTB 2DWCA 3WDKA 1V35A 4F12A 1KC1A 1EJ0A 4WK2B 1T0UA 1LDNA 2X19A 4NEGA 3U7GA 4IGIA 3RLIA 2OG2A 5CT4A 3ZEAA 3EW7A 4RHEA 1N7JA 3MCTA 4V1CI 1F1BA 3TM5A 3PNYA 3GCZA 4TZ0A 1IN7A 2K2WA 3OHPA 4JLBA 4YIKA 4YIHA 2QM3A 1VPLA 4GVPA 3BBPA 2PMFA 3H9UA 3K0AA 4MWGA 4TXNA 4AG6A 5EGNA 4ZDIA 1K5PA 1Y3FE 3I52A 3ACBA 4ZHSA 2Z6AA 3CE6A 2RGCA 3GA5A 5LQNA 3P20A 1D3AA 1YAJA 3PA6A 1XFDA 1MV8A 2OXRA 4R71A 3DXZA 5DRTA 2Q3JA 3ZD7A 4CQLA 2PRYA 3N05A 5DX1A 1GLGA 4BN5A 2V3WA 3OQHA 4UCQA 1KYVA 3CURA 2C82A 1LGYA 3D6AA 1Z6QA 1T5LA 2CNNA 9LDTA 1XD2B 5CLIA 1RMQA 4ED9A 2BL4A 1I2MA 2JAWA 4YNBA 5K8UA 1DUVG 1SVUA 1OT3A 2VP5A 4JBXA 4Y1RB 1SM4A 1U3TA 2GZSA 3NAMA 4R1NA 4H6PA 1WDTA 3KG2A 2I3AA 4JK3A 3JZFA 4UBNA 4B81A 1H1TA 4JLPA 1DCFA 1Y8CA 2C7QA 4Q3EA 5JJCA 5ETJA 2OV8A 3OKCA 1NP6A 3N5KA 3H11A 4L4RA 1NA5A 1ZDMA 2ZANA 5KC9A 3UJ3X 3DV9A 3ZS9A 2JI4A 3M70A 2GUWA 2XMSA 5EP1A 3TYXA 1KR2A 2OVFA 4D44A 1K68A 2C0QA 2V6MA 5L3SA 4I55F 2VUIB 2PZLA 3DFZA 5IKEA 1CZLA 2R9VA 4BQQA 3L49A 4IICA 3V1LA 5KVCA 2Q4RA 4JJGA 3IR5A 4GEGA 5FI0B 1NBMD 2WTXA 2ACKA 2PMEA 3W8RA 1P77A 1R0YA 2A1TS 3ZJ4A 1YXMA 4RORA 3DV0A 1DINA 1ZVKA 4JHXA 3S70A 1U6IA 2TRSB 2O2EA 4QARA 5LYJB 1N2SA 3M83A 3DW3X 1PZXA 1XT6A 4R9VA 4RSRA 3DE6X 2XE7A 1NN5A 1F3LA 5EPUA 1JHUA 4HB3A 4CYMA 1T9DA 4F6LA 1Q22A 4JDPA 3MUEA 2OZPA 4UMFA 4X44A 1CPYA 1Q1EA 1PZMA 3GHHA 2AD5A 4ZEOA 3T4UA 4OPMA 4MW2A 1KI6B 1D2MA 1TUGA 3ET5A 3UCXA 3WRYC 1CUEA 4KG7A 3D31A 3JWPA 2XOXA 1HC7A 3ONVA 1DKNA 1GU7A 2DBZA 2YRXA 4RD2A 1IDN1 5EJGA 5G0TA 5JAPA 2RGWA 5TVKA 4AG3A 4B3TB 1WBJB 4BU1A 4CQJA 1W4AA 3M34A 5B58C 4OJMX 3QVMA 4PO1A 1OYYA 3RK4A 2H08A 1KRHA 4K0KB 1HQCA 3C8MA 3WZLA 5JATA 2ACWA 3D1VA 4MMZB 3AB3A 2C92A 4WZAA 3JS5A 2VHCA 2BGTA 4TMTA 2O8FA 4MGEA 3QYJA 3P0RA 4E13A 3M4XA 2P9GA 5CH3A 5GINE 1YJBA 2QMZA 3M3DA 3RS2A 4S04A 4O3MA 3AONB 4HX5A 1PDVA 3TLAA 3T1YB 1XOIA 4Y2XA 2O5EA 3W2HA 1UPUA 4ZKEA 3GRAA 5KREA 3KJIA 2FX5A 1LDMA 3R20A 3KJQA 4BO8A 2MSLA 3IKLA 4KRGA 2G9RA 1VSUA 3V4RA 2P7IA 3QXGA 3D0QA 1MEEA 5JG7A 4IIVA 3U56A 4H0FA 4UU8A 3TS1A 5IT5A 2BEKA 1B6GA 4BNUA 2J1LA 3FMGA 4RZHA 3KV1A 4ON9A 4AY6A 1SCAA 2RJ3A 4MJ3A 2XT6A 2FR1A 2E6UX 1AZSC 1U8TA 5FUWA 3UGQA 4DXAA 1A1VA 3U3RA 5H83A 4Q9LA 1E3TA 4M8IA 2ACEA 3FTFA 2YASA 2G6TA 2AL7A 2FSVA 4Y6RA 2A3RA 1P1FA 4NECA 4DC0A 4TTQA 3AKEA 5FRDA 1QAMA 4S1NA 1DQNA 2GZAA 1UXJA 4GPAA 1PWZA 1SK8A 4II2A 4XVCA 1AQJA 1XP5A 2GERA 4B2PA 3G6WA 2YH2A 4JQSA 2C3OA 2WU3A 1EQ2A 3SM3A 5IJ0B 1EA5A 1IXZA 1VLMA 2J09A 4ZWNA 3C4JA 2FMIA 3G2HA 3PEVA 1ZMRA 4NNOA 3CLTC 4E03A 4H2DA 2WJPA 3WIUA 3A3YA 4M22A 4D4JA 4QA9A 1PF7E 2HA6A 1OJ7A 4ZV4A 1IEXA 4MARA 1M0WA 1CVIA 1A4XA 4ND2A 3AFIA 1RHKA 5JAUA 5KI6A 4D42A 2IIPA 3I23A 4YCBA 2HN9A 2PAAA 3ZNNA 2GARA 3R0JA 4B6OA 1U81A 4W5JA 4B6JA 4KVZA 1JRLA 4BGVA 4DM3A 2Z3ZA 5BVHA 1LBEA 1EXWA 2IZ7A 2PV7A 3L2OB 3C7KA 4YECA 1PJSA 3UWKA 4DRZA 5A4MS 5JR3A 1VA5A 2QUBA 1O97C 4MYDA 2D59A 3I3OA 4H1WA 4RETA 4EG8A 2SKEA 3RTGA 2ZT5A 4GOND 1KF0A 2XI4A 3WWCA 5KHLB 5GVSA 2BFPA 1VJGA 2YHIA 4IJ6A 4IHJF 3BTSA 4BVHA 1ACLA 1E2LA 4MWOA 4ZHQF 1ZOPA 2RAFA 3C41J 1E96A 1N9GA 2JASA 2P9TA 2PZBA 3LQFA 3OCZA 1GG2A 4WMLA 4ZALA 1JQJC 3BRWD 2QV7A 3AYZB 2Z8ZA 3ABZA 2F4VB 5DULA 5CA0F 4KXFB 4QBGB 1CJMA 1ZSYA 3BICA 3HNPA 4EK9A 3RODA 1JG3A 1RLMA 1XDUA 3BQNB 1V6CA 1NY5A 4MVJI 1B76A 1EUCA 3LL4A 4DUYB 1NXSA 5FXMA 3WOHA 3I4FA 3HBJA 4E12A 1H1LB 3BL6A 2IF0A 5JROA 3I12A 2O3UA 4RIHA 3ENVA 4G1EB 3T9AA 1KY2A 3ANNA 5E4JA 2BKUA 4OF4A 5FT9A 1RXUA 1VTKA 1ZP6A 2NUPA 3HYTA 2GBPA 1K8YB 1E79A 2VDNB 1O94C 5DHSA 3FDZB 1DO2A 4QDOA 1XKQA 4PC7A 1DAKA 1G41A 1P29A 1ZZEA 2AA3A 2B94A 2YQZA 4LZAA 1GT6A 5FI3A 1GCIA 1DFGA 2G83A 3OCWA 3NBZC 4D8UA 1OF1A 4GC9A 3C39A 4IDAA 3OIDA 1QP4A 1JU3A 3JAWB 1P0PA 1W2GA 1KMHA 1VYVA 3NP7A 4BYGA 1CUBA 1PUIA 4N9WA 1YI1A 5G4KB 3VJKA 5A0TA 2IYSA 3LP6A 3E4DA 2E1PA 5KNBD 4QULA 4WESB 2CJWB 4HAIA 4NMXB 3GEMA 3QJ5A 4J9VA 1XCLA 2EF0A 3SP1A 3RT9A 3WL6A 2XVZA 1ONOA 1ODJA 2DGDA 2PS1A 1E1QD 5IBPA 3FMVA 2CJWA 3ENWA 3FPEA 3QE9Y 4DE5A 5EMKA 2GN9A 1NUAA 1JHXA 3MUNA 4BAGA 4JL5A 4NNPA 4IJ5A 1THZA 1S2MA 1KMHB 3GB9A 4QOSA 3TNYA 3D6NB 3K1TA 5BWLA 4G63A 5IZ4A 1MW9X 4CMIB 1N34B 5E7JA 4OH1A 5EHXA 3UJDA 1A82A 2VDQB 5ALFA 3EFBA 3KVNA 5AW5A 3D64A 4LKOA 1FDSA 2Y3IA 4BMNA 4EUFA 2EX1A 3KLOA 2R3SA 4XWAA 1T43A 1Z37A 3S40A 2HCBA 4OX9B 1H05A 3DF7A 2QR2A 1GZ6A 4LSZA 5JARA 4D56A 1ZUNA 3LT2A 1Z2CA 2FZEA 2QROA 2W2VA 4EPYA 5T41A 1RI1A 2JI6A 4GSKA 2HL6A 2PXXA 4KQMA 1K6JA 4IIEA 3KIPA 2O8BB 4P2GA 2OORC 3GF4A 1GQQA 3L6OO 5KDDA 3WMXA 1NDUA 4NI5A 3VPSA 3L0OA 2YNMA 4WZBE 4K3VA 4XSVA 2GOYA 2MINA 3A3OA 3OBIA 1H2EA 1K0UA 4MQFA 1GGJA 1JHVA 4QYMA 1XKLA 5ALWA 4HNAB 4C1NA 1WXXA 4J6FA 2AQHA 5ALSA 3FCCA 2CT8A 1KGSA 2Q2NA 2YHUA 3H3JA 4RPKA 5K0CA 1OB5A 1ZNQO 3TSWA 2KI5A 4DLTA 5KNDH 1CETA 2FMHA 3PTLA 2H2WA 3IB3A 3M4ZA 1T1GA 1QLJA 2ISQA 1P8AA 2JH3A 1ULHA 3H11B 5FBKA 3VMMA 1SXPA 1Z6GA 3AVWA 2EBUA 3LC1O 1P45A 4HX2A 4AG5A 2FMUA 4RY2A 4WKPA 5CIQA 3UHOA 2O23A 2BKEA 4X0EA 1WBBA 4BAZA 4IQGA 2G7MC 3EODA 4GNRA 1Q0RA 5SV2A 3HM9A 3EEFA 1U0LA 3I4CA 3GD7A 1DDIA 2FWPA 3LT1A 3N75A 4JROA 2AJDA 5JVDB 5F77A 1TTHA 1P6XA 4K3UA 4KQ1A 5BV0A 2JIDA 5CM2Z 4UKDA 4CM9A 1RI5A 1RIIA 1Z3IX 5JSKA 2LKDA 1VE3A 2WWFA 4L9AA 5A5GA 1AK1A 4B82A 3CZPA 4H4CA 3KLPX 1GKIA 4OLAA 1YHZA 3BF7A 3GNQA 1Z4OA 2ZM5A 3GPIA 4G0OA 1FP2A 3BJRA 2C2ZA 3D2BA 3DTTA 2IYAA 2J3HA 2JEYA 5A4DA 3ZDBA 2EP7A 1I33A 3DWEX 2C5GA 1WTAA 1J2TA 3GEPA 3VU9B 3SDBA 1PK8A 3QKIA 4JYAB 1JG6A 4UNRA 2QVZX 3IMGA 4KPEC 4O02B 4RH1A 1FS6A 3E3OA 4ARCA 1F9EA 4P2BA 2LD4A 4ZCQA 3ZW7A 1HE2A 5JI2E 1FDRA 3UQYS 3GLFE 1WXWA 4NENA 3QFRA 1CUCA 4MINA 1RQXA 4N8SA 1RQGA 1L4MA 1H3FA 2FWIA 2ZUVA 4NE9A 3T7DA 2A5FA 4D9FA 2JEOA 5CBPB 4AQYB 5SYNA 3AVYA 4I3HA 1WZCA 3G2LA 2C07A 2HHHB 3QXXA 5CCEA 1M6YA 4MVJF 4JZKA 4RVDA 2Q6IA 2AX3A 3QW4B 5E2BA 1QGED 3HH8A 4X85A 5U9CA 1ZGJA 1CZNA 4EB3A 1RQLA 1Y6QA 3IXLA 3L4JA 4U6SA 5AW7A 2QTMA 3L6EA 1WPXA 4RH3A 3KL2A 3SE0A 1Z07A 3LECA 4FE3A 3UZUA 1O87A 1YS9A 1P6QA 2X58A 3Q7SA 2DR2A 5EJ7A 3T1VA 1AKEA 1BCRB 2AQ8A 2GF0A 2C1EA 3KKLA 1PFVA 3KQOA 4EUKA 1AHIA 1CP3A 2W22A 3PHIA 5AKIA 1RM4A 4FEYA 1T34A 2BUAA 2VTVA 5THKA 5CDGA 4J0HA 4RMJA 2Z1NA 1UMDA 4RZIA 3Q3IA 2QRPA 1WJGA 2AQIA 2RK6A 3GRPA 4LXUA 4FFPA 1QU3A 1NRWA 2O7NA 4ND8A 5IG2A 1VJRA 2UVPA 2FGKA 1YR1A 3JQFA 3ROFA 2Z2KA 2D5AA 1Y3DE 1HFKA 1BKYA 2MTBA 3BMOA 1N7GA 3AF0A 4XVRA 3GG9A 5HK8A 2ZUTA 1ZOSA 4A03A 4YT5A 2P6UA 4BMCA 4KZKA 1ZNWA 2GVDC 3H2HA 2BFEB 4JSYA 2B4KA 1C41A 1K3TA 3HCOA 3C6MA 4FKBA 4NAUA 2H4ZA 5FNVB 2DUJA 4YQZA 2P2LA 4CV0A 2ZS7A 4TS4A 4G1BA 3H5IA 3PEYA 1WD7A 2HK8A 2HPVA 1B0ZA 4FMDB 1ECPA 5KKAA 1NLFA 2D06A 2V7WA 3GELA 2JRLA 4AW9A 1E18A 2PUVA 5D84A 3TJRA 2LCIA 3W1WA 2TSYB 1Y9ZA 5I8PA 2XD4A 2BV3A 4QU9A 3E81A 5AHXA 2NU9A 1VKZA 3F7TA 3TZ6A 2WMOB 2J30A 2GILA 4OXXA 1KWGA 4RHUA 3VPGA 5LBUA 5DYYA 3CMMA 3Q0EA 3ZKWB 5B1EA 1N32B 1ZNXA 2ZJFA 3LHKA 2PN1A 3CZ9A 3L7CA 1UJ2A 3DMTA 2I29A 3DFKA 2O8VA 4TTRA 2FW6A 4NYMR 1ITZA 2H4XA 5T3UA 3C98A 4F9EA 1NW7A 3R0QA 5FF9A 5JCZA 4O8ZA 2UXBB 3L7JA 1GZ7A 1N6KA 3BD9A 5C34B 3EEOA 4L2IA 5B6PA 4U8HA 1MQAA 2EWVA 1JA1A 2XA1A 5HG0A 4ZJPA 2NTJA 3DUFA 5BR8B 2YHAA 1IU9A 4WOJA 1Y6JA 4R2WA 1PJZA 1TQHA 2JK1A 5T64A 3KOUA 2BY4A 4OU5A 4LOJA 3F6YA 1TRHA 2VWQA 3V2GA 3ANMA 3OUTA 2H00A 2XNDA 4UNNA 2A86A 3FF4A 1DIGA 2JCYA 5U4XA 3UATA 4EJ2A 3ZLJA 1RLIA 4M9ZA 1RCUA 3W79A 5C8YF 1NMYA 2VHJA 3QKSA 1M8FA 4JAVC 3AFMA 2YWCA 4QGBA 2NX2A 4QTZA 2QX6A 4L3VA 4YJ2F 1WF3A 1BGWA 5DNVA 1WZIA 1ZIOA 1DDGA 1YB7A 1ZITA 3OX2A 3VSCA 4ZYYA 4RHFA 3ZQ6A 3ZWOA 3PNSA 1K88A 5KYNA 2R5NA 4IL5A 2PLRA 2P67A 5FPYA 4D3DA 1JI0A 1OW3B 1A2KC 2Y66A 1HMPA 2NW6A 1N2XA 3FCUB 3R6GA 3BTVA 1GY8A 1R5JA 3FSRA 2C97A 1Z8HA 3RT1A 1HRDA 1Y9DA 3H9JA 5FWYA 3UMFA 1E9AA 1X39A 5DLPA 4LI0A 3TLZA 3FPHA 1UBGA 1Z2DA 3KKQA 2X14A 1O08A 1ML4A 5AVTA 3CPSA 3ED5A 4BJ5A 1AXRA 1U8EA 3V4ZA 1MO3A 1YBHA 2QSUA 2X8WA 2IYNA 2WSMA 4ITUA 5KJ1A 3ZE0B 4IUDS 1UJ6A 2C2YA 3ETDA 1Y5NA 3KJEA 3FNEA 2FQXA 4Q66C 5MN4A 2BONA 1K92A 5DISB 3ZQ4A 3MUFA 2LVBA 4MO9A 3T3PB 2WHEA 3K6JA 2ONCA 3FVTA 5TQJA 4E7PA 4ZQEA 5EWMA 4TQAA 3VUFA 2HMSA 2W2NA 4YJ3F 2P1DA 4HAUA 1KK3A 3UMMA 1V5EA 4DQXA 1CUDA 1T1IA 4ENUA 2HYDA 1MH1A 1PUJA 2VZEA 2WBLC 3HWSA 1CE8A 3DE7X 5DCUA 3TLCA 4PINA 1GSAA 1AK9A 1JDZA 1SVWA 3FDJA 4KFSA 4M1MA 4WJKB 4FT2A 2ID9A 2NZUG 3ZGNA 4WQMA 2V9CA 4KN5A 3K0BA 1RMTA 3UC5A 3PI7A 3QBVA 2HXGA 4FDMA 2BGRA 3F6SA 5AJZA 2TMGA 4FD3A 4UBOA 4BO7A 3WYFA 1WVIA 2GN1A 4L5CA 1UKEA 4D8XA 2ZRIA 2H4YA 4C0AC 3QA3E 4D9KA 4TS3A 2PXAA 4FCTA 3ROGA 3GIWA 1Z73A 2RH9B 2ZSJA 4Z7JA 5D6NA 1YQ9A 3C87A 4QC2A 5JEDA 1SCKA 4R7TA 1Q3TA 3GPLA 2L19A 3AILA 3HKDB 3VHRA 4AROA 2X3FA 3HRIA 4K6KA 4EJ0A 1I7NA 2ZU0C 4JKOA 2DETA 4QBHA 1EB8A 1BMTA 3LUPA 5FOXA 2Y9PB 2IZ0A 5F7OA 4KUGA 2A59A 1T91A 3EXHC 2WSYB 5HILA 4BLQA 3B12A 2AMYA 1R0ZA 3FUWA 3KZNA 3PYXA 5EJ6A 5IDWA 2ZI9A 1WAMA 4IV5A 1Q1NA 3I1JA 2DLDA 2DTEA 4LA4A 1EG2A 4M6WA 3LPCA 4R1QA 3UK0A 4AZTA 5C4IA 1UT6A 2P9QA 2E4XA 1JTFA 5EKUA 4D98A 4L9SA 4TUYA 3CUSA 3WMGA 3CT6A 4HN2A 4ES6A 1QXSA 1ZLYA 4NCAA 3NDIA 1KK2A 4UMVA 1HZZC 3V34A 2J46A 2RGXA 2VJPA 4DMUB 3A3NA 2CXOA 3LE8A 2W6MA 2H5JA 5EINA 1ZHHA 4E15A 5J23A 1Z36A 2FZGA 3PENA 4HV4A 1ZD5A 1X2BA 4M60A 3KZMA 2OG1A 2HGSA 2QVCA 2B8EA 2KS6A 4PTZA 1ZRSA 3IAS1 1A3CA 3O1JC 4Q02A 3B3AA 3ZWMA 2IEAA 2EAUA 3GG2A 1OXXK 3FJOA 1HA3A 3OCVA 3NV9A 2WFAA 2WJHA 3T7KA 1YL7A 3EN0A 1DRUA 2OFXA 3OOEA 4UDXX 4TGLA 1NVVR 1TYEB 1YV9A 1GRVA 3GBVA 5CVJA 2YVUA 4DN6A 4OFXA 5AWFC 2IZOA 3ADPA 2E4YA 5TX7A 3WBBA 1V8PA 1R4NA 3F5FA 4ZGWA 4OXIA 1CS0B 2OWDA 4NC9A 4AJNA 1CKEA 1R5NA 4ZANA 1C3OB 3EIFA 1KFEB 1WCV1 3SHOA 1C7EA 2IYOA 1TLTA 5ALYA 2WNIA 3PGJA 4FFSA 1ZR2A 3RBXA 5AW0A 3LZDA 3ZDYB 1IE3A 3IEIA 3HS3A 1RTKA 4MP8A 2AD1A 2EP5A 1TZKA 2ZUWA 3B7PA 3FNGA 3IV7A 1EIZA 1C3JA 1FNCA 2G07A 1JLKA 4LBYA 3S1AB 3TIIA 2I80A 5B4TA 2KLBA 1JJIA 3L4BA 2INGX 1L4YA 4MJ7A 2B7BA 1GPJA 2OKGA 4YUXA 4I4CA 4UOZA 4XDGA 1YC5A 3R7LA 1P4JA 1ANKA 1J33A 3JYHA 2FJ0A 3ESDA 2MSDB 1EGHA 1ZOLA 1KJNA 3A25A 5DDIP 4KVGA 2V03A 1XTRA 3HR7A 4MRPA 2PUCA 2XBLA 1ID8A 2P91A 1F4VA 2QHXA 1D4ZA 4C2AA 1QGZA 1X0XA 1FVOA 1I7LA 2GN0A 2I1WA 3P8ZA 3Q9UA 4KE8A 3U4HA 4Y0VA 4PZYA 4BQNA 4RZUA 2O1XA 2QZJA 1FTNA 3ROTA 1NG1A 2E5FA 3V7WA 2RGAA 3HC7A 1DIOB 3UHPA 3WGUA 3PGLA 5G0WA 2GM3A 3OLWA 4Q3CA 4LGCA 4REQA 2OORA 5TMDA 1QIFA 2PGIA 3UC9A 1JIXA 4CMIA 4DKJA 3TAXA 1KJ8A 3AESA 3VR0A 3QMWA 1UZNA 4CJXA 3NUGA 2UZIR 1R6TA 2EQAA 4FQ8A 4EB0A 4YRCA 4YDQA 4BNNA 2B4RO 4FS8A 4B3XA 4ER3A 4YRGA 1RRKA 4IOJA 5HXAA 4KE7A 3H8SA 3C3JA 3GFTA 1XTBA 3W5BA 5AVZA 1HKUA 5KOHB 1SZJG 5AK3A 3ZY6A 2I54A 5JISA 1YJQA 1AA6A 4I8DA 1TJ4A 3SYLA 2FWRA 3U4QB 1ISSA 5LZ7A 4AS3A 5LQKA 1QO0A 1QKJA 5MGNA 1MX5A 2O4UX 1G20E 3ML1A 5ITZB 2BUBA 3VRHA 4M9UA 1SQFA 1YMQA 3WRWA 2LZ0A 2QX8A 4JR1A 1IRXA 4KBFA 2OYRA 4DMCA 4KNYA 4FNMA 3BKWA 3DZBA 3MGBA 1BWRA 3PF8A 2IXEA 2Z1MA 4XQ9A 5FPKA 5JQGA 2BBWA 4WN9B 3U4AA 3AIKA 4U7GA 1G8JA 4ESOA 2ODQA 1OROA 1MG5A 2XMBA 3VHXB 1JAZA 2WF7A 1PTJA 1ZU4A 4O4LB 5HGXA 3C5WP 3COPA 4FE4A 1PD0A 4KQ6A 1I3MA 2O3TA 5KUTA 4OX9Y 4OHWA 4ZEVA 4GYWA 3C6BA 1IEWA 3HV0A 1FP4A 4RV9A 2DPHA 4OYHA 2EJVA 4EY4A 2PWAA 3Q15C 4NYMQ 5CDTA 3H5NA 4PFKA 4INPA 1GDHA 1K6IA 2XYGA 2Y0CA 3KT0A 2XUQA 3MQFA 2XYVA 4V39A 8ADHA 4IVQA 3DKVA 1U02A 4S35A 4HVLA 3AQ4A 2E49A 3CNEA 4HDCA 2ZQ5A 5E2IA 1SNYA 2CWWA 3NVDA 4KLCA 1J70A 4RXUA 4BKMA 5HYVA 3LA8A 1C30A 1VIMA 4OP3A 5INTA 1O54A 4K6FA 1WMFA 2ZDGA 3B6ZA 3NIDB 4BP9A 4ARIA 2G08A 3DBIA 4C03A 1Z15A 4W9MC 3ITKA 3FHTA 2FPLA 5H4GA 5FADA 1CFZA 3Q3GE 3GAFA 5ERXA 3KZCA 5F7JA 1E3WB 1L5RA 1F4LA 1C81A 1KAMA 1WDKA 1MO5A 1DXYA 1ZAYA 1A9OA 1ZGBA 3V7UA 5AD1A 1YE3A 4BB9A 5HIAA 5HJ2A 3LH5A 5CFMA 3EXG2 4H6WA 3CRQA 4I1UA 1A76A 5J59A 4TL9A 5BMVB 4V1CA 1CTQA 4BX2A 4KR6A 5L4SA 2FZWA 4G1VA 1HDIA 1H6CA 2BF7A 2VRCA 1VI2A 2H1WA 4EJMA 3RC9A 4IIYA 4IZ6A 4N5IX 3UMYA 4XUEA 2ZW9A 1WMSA 3A1VA 4S1VA 3U81A 2IXGA 2FH5B 4YP9A 1C1XA 2VOEA 3KZXA 3LHDA 3G2NA 4H4EA 2Q7OE 4JXXA 1YOVB 4TKMA 4KGXA 3ZHBA 1XZ8A 1QVWA 4J91A 4YRDA 4JJ6A 2PVCA 1PYDA 1JXOA 1L7EA 2FPIA 1DMSA 4S24A 4WFJA 1A50B 4ZVVA 5FYDA 3VR3A 5BN3A 3GLIE 2PWZA 4JODA 1IWPB 1D09A 5LQDA 2JJ8A 3DHEA 4XFJA 4F21A 1SPBS 1IBRA 2AC7A 4M8NE 3O93A 4BMPB 2F43B 4U7JA 1FSZA 1NLMA 3EXHB 3KU4A 3RHZA 4UZEA 1IOVA 2P2YA 3GQVA 4KREA 1KVSA 1G2PA 2NP6A 4DG8A 3DE5X 1I7SB 5JVDA 3QA9A 1XZKA 3WLLA 1HUQA 3NBXX 3L1JA 2Q4TA 4R3WA 5A4AA 2FX3A 2VKQA 2HJVA 2PFKA 2VH1A 4EWLA 2QMYA 1TLLA 3TDNA 4IDNA 2G40A 2X3YA 3IJPA 3FOBA 3U44A 2OOKA 2P11A 4H15A 4PLVA 4QECA 2OMEA 3I5AA 4TTSA 1O8CA 1TYDE 4WKOA 4LJ7A 4KX3A 1H4VB 2YY6A 4LSGA 2X9LA 3QHAA 5A9SB 2FN9A 2GPTA 2VF2A 5AKJA 4R51A 2B25A 4DA4A 4PLZA 4OI0A 2QIOA 2X4DA 1ZJZA 2GZRA 5EIXA 4J16C 3TLBA 3EEQA 4C7BA 1Y1RA 1BQ4A 2PX5A 1LF0A 1MJ5A 2CNDA 1RR6A 2VHXA 3H5OA 3INRA 3MT7A 3QH4A 4LISA 4X93A 2BKAA 4LJSA 3KTAA 5G4KA 4E4TA 3LF1A 2G5CA 3GZJA 3JALA 1SKMA 1EI9A 1N2CB 2H4HA 1UBNA 3BBLA 4BP3A 2C7OA 2R5FA 2HRRA 2N75A 5AUQA 2EKZA 2WUFA 3TOZA 3D3WB 2AN1A 4PYNA 4D0GA 2P62A 4YUZA 1XHEA 4D9BA 2GCOA 3WLMA 1ZH4A 1R9GA 3W5JA 2QQGA 3D6VA 4IEFB 5HQJA 1WUKS 4GX0A 5TF4A 4D6YA 3QKWA 5J9FA 1Q19A 1LPNA 4L50A 1G8GA 3TUJC 3E8SA 3JZIA 4PVDA 3H5TA 4HSEA 1K86A 4O4LF 2IHBA 3REOA 2ZTLA 2RG7A 3FPBA 2P4QA 4EYKA 2VJYA 1Z6XA 1RPTA 1JKJB 3A4IA 4Y3UA 2QY9A 1R0LA 4WXPA 4EB8A 4ZYXA 3K1JA 3RREA 3WNQA 1WB9A 1XTVA 1NLZA 2PRSA 3V8PA 3E5HA 2FRXA 2Z04A 3HPRA 2FW0A 3LJKA 2AG6A 3E22A 2IV3A 1GU0A 4D3YA 3PEEA 4DW8A 2Z3VA 2XTNA 2O48X 1RFGE 1VSVA 1YVDA 2J7KA 1NFRA 1N2OA 2ZVPX 3P2JA 2IHUA 2I7CA 1KPHA 4QHYA 4B74A 2NU8B 1SOVA 1T6NA 5LKRA 2DBQA 1W25A 2ZRCA 5K3FA 1NM5C 3WWYA 3WZ2A 4I6JA 1VHQA 3H3FA 3DLBA 3FB4A 3U4GA 2I62A 1OXVA 1ZRMA 5ER9A 1NVTA 2KMLA 3INYA 3H0EA 5AW6A 1DLJA 3BWBA 4M49A 3FF1A 1HR0B 5DNWA 4G5SA 3OBBA 1A72A 1E4OA 1VMEA 3Q6IA 4FQ5A 4JR0A 5I7RA 2KQUA 1E0JA 4LV6A 3IT1A 1A2BA 3ISJA 3RUCA 5JMOA 3CUUA 4C5AA 1XJ0A 1PQYA 2QA5A 2QAGB 1TEZA 3MYYA 3NX4A 4P84A 2V74B 2W8BA 4UHDA 1XTUA 3QYFA 2JA2A 3TRJA 3N0WA 3CJRA 3ZZNA 3CBQA 3EZNA 2ORIA 4GDMA 3CF2A 2ZTMA 5G4LA 3OZ7A 4IX1A 2JFNA 1IYZA 4RLQA 3RS0A 2PKWA 3ZY2A 1G6OA 3K1AA 1KGDA 3SS8A 1GTG1 1IVNA 3ZHZA 2I34A 2NZ8A 3L1UA 3ZE7A 3QF4A 2FSGA 4LE0A 5FBHA 4HUQB 4JXZA 3O1HB 4L02A 5ILOA 2OHXA 2OO7A 2BKVA 1KP2A 3I2JA 3NTLA 4M1EA 4AKEA 2IV7A 2MINB 4X63A 4ZICA 4ARVA 2QTNA 1T5SA 3A1FA 4QUBA 2EBHX 2R87A 4QJ4A 3C5EA 5CXUA 4IDHA 5LXTA 4E32A 1MEOA 2R11A 1BXGB 3LK7A 4QVGA 2OGWA 5JU6A 1PE0A 3V4PB 1PLKA 4B80A 3CZRA 5ILQA 3J7TA 3GLGE 2NXCA 2Z57A 3DJYA 3HCBA 3WLKX 5EWLB 3PTAA 4PO9A 3G0CA 3U3JA 5AOBA 1O9BA 3OPYB 5THXA 1GAQA 4E5PA 5KQPA 1RYHA 3OESA 5AJYA 1W1IA 2AZMA 1GPMA 1F0YA 1YZFA 2ZRDA 3OICA 4GP6A 2F3SA 4O63O 5REQA 3UEOA 1J20A 3A6EA 2WFMA 3BMCB 4C7KA 2WDZA 1PK9A 3ICVA 1XTKA 4OJKA 4POOA 3OE7A 1VDMA 1M2FA 2YV4A 3A7EA 4L4UA 4NV0A 4BTEA 3LF2A 1B00A 4P0QB 3RTBA 2ECQA 3V80A 4M9SA 4KO2S 3CU5A 4Q00A 5C8VA 4UUNA 2H5IA 1PNTA 1XA0A 5M3BA 1H6BA 2FEMA 1V2HE 5BQOA 1G5FA 2WIDA 3ZV3A 1MVNA 1PG2A 3B5EA 5FPPA 5BURA 4KWHA 2OAEA 1GQRA 3PRKE 1LPPA 3OH8A 5HMLA 1CERA 3IKTA 3HA3A 1UBRS 1P7PA 4N0PA 4EBFA 2UDPA 3LGSA 5JYDA 2ZUSA 3EBOA 3N0XA 5H1YA 1F17A 5JCOC 4FOLA 3IEMA 5U1PA 1EUZA 5LA6B 3O91A 4BMVA 4DLYA 2HMAA 3AR6A 3OURA 2NYVA 1YGPA 1JQEA 4QFMA 1UBKS 4W7HA 3B5IA 3JCZA 5FLKA 3HY4A 3C6YA 2YFQA 3H9QA 4LJKA 3FTPA 3IHWA 4M86A 5TF0A 3NDBB 1J2EA 4G0QA 2IQ5A 3DKIA 1T0JB 4PLCA 2EGGA 2Q6OA 4JBLA 3WFZA 5TRTA 2G4CA 1V7PC 4NATA 2ZXUA 1FW8A 3IBCA 3CONA 1VE5A 3DZCA 4FJ1A 4QG3A 2XQVA 3NV7A 3FFTA 1E99A 4M2LA 5TC4A 1N0IA 4HXEB 4RKWA 3HY6A 1EUCB 3HR8A 4D6XA 4I50B 3L93A 2CCGA 4G0NA 5DTIA 3HBLA 2WVAA 4KGDA 4BV9A 1P0MA 3QY0A 3KAJA 3HPQA 2ZAYA 3VX3A 5GGYA 4HTAA 4UUMA 2I3GA 4R1SA 3MUOA 3GVIA 4MAFA 1JHMA 2R97A 4IH9A 3TG2A 3GLGA 3AZOA 2PPLA 1H4QA 5L53A 1P1IA 3DAYA 3OIWA 2VKTA 4UOEA 2QE6A 3V1NA 1CY2A 3DQQA 3H2YA 3JQAA 5KYWB 3B7GA 4MS3B 2ZBQA 1U0GA 2EYQA 1IL0A 4I1VA 2PUAA 4IIFA 1SXJE 3ZK9A 3VR6D 4JYBA 1K7XB 1NW3A 2WD7A 4GPZA 5GZ6A 3PFGA 5IKPA 3VI4B 1M1YB 1II9A 4NU5A 1R6VA 4WEOA 2ZUEA 4BLVA 1HNWB 1HLGA 2VT6A 4B4KA 1FFAA 1Y82A 2HCFA 5DK4A 5CB4B 4G0UA 3FMFA 1U7TA 5AJXA 2JJQA 1CY8A 1GVNB 4WPGA 5TT0A 4BP8A 4P7GA 1RZVA 4JVSB 4XJVA 4AFNA 4DYVA 2V0GA 3ER8A 3IUEA 2E9SA 2WLTA 4TS9A 1SHTX 1A9PA 2C9BA 2X6QA 3PEFA 5EAIA 3GEGA 2DH5A 1K7SN 1RJFA 4AO6A 4MPJA 3KV3O 1NJ5A 3U1BA 4EF5A 1OI4A 2DPLA 1IIRA 3UH0A 4D45A 3VKGA 4DIFA 5K09A 3KR0A 4ENRA 3PJFA 3H1FA 5J4KA 3U48A 3IQWA 3H4VA 1L5ZA 3NKVA 3ADCA 3VR2D 4ZCIA 5B7GA 4PXAA 1E0KA 3DO8A 3GLQA 3SZMA 3N76A 4JELA 4NBLA 1F0NA 3DO5A 1M33A 4XQCA 3M2PA 5F3DA 1EIWA 1U9CA 2FEOA 2AG8A 1SC6A 3JAKB 1YJAA 1Z0ZA 4W8GA 4PG5A 3IOMA 2AJCA 3EEIA 3MAGA 3N70A 4M0MA 1U3FA 2HQRA 5HF9A 3PQEA 3UXMA 4KN8A 1M2VB 1Q77A 2V3VA 2EIHA 4YJHB 4CBVA 1AKYA 4K40A 1RCFA 3RC2A 5EXPA 2PKQO 2B82A 4MB0A 3H65A 2AIRA 4Q4HA 1ULBA 1UBMS 1LX7A 1KZYC 3EWSA 1U9IC 3GUUA 3N86A 2I6FA 3PE6A 1SHJA 4H7KA 2GXSA 4XLLA 4XWGA 4LZLA 1FQKA 2QAIA 1K27A 2M6KA 3SC2A 3H5WA 5MF6A 3PRYA 3UA4A 5K6AC 1JHAA 1V2GA 1GRRA 1DI0A 2DBVO 2FCAA 4FZJA 5CX1A 3UK2A 1M75A 5BNFA 3QWFA 3GJ5A 2IVFA 1C4OA 1E1DA 1ND6A 1DE0A 1Q17A 3A2MA 3R2JA 3IEXA 1KEZA 3V1UA 3ZWKA 4AJJA 3HL4A 2BELA 1GV0A 5AHWA 2NTEA 2PAFA 3TQHA 4KDEA 5FA5A 3P2IA 1PJ2A 1Z6PA 1FFWA 3LP8A 4D3FA 1E32A 4ALNA 5CA1A 1YGYA 1Y98A 1OD6A 5AK0A 1C4WA 2JGDA 4RTJA 1WS6A 1SJ9A 2OCGA 2JLAA 3MS2A 1DCKA 5TGZA 3TOVA 4X8OA 3WADA 1LWNA 3WQSB 3ZY3A 1O89A 1PV2A 1G5RA 1Z08A 4J49A 1E8NA 1KKUA 4MTCA 4RGYA 5EIWA 4DR7B 2O7QA 3IESA 4WOCA 2P3LA 1ODCA 6YASA 1VPDA 2GK7A 2WZCA 3BSWA 3FTDA 2OV1A 4Z6KA 1NRXA 3AI1A 3HDGA 4R0NA 5DH9A 3M6VA 3ZW9A 4QAJA 1DQPA 3AW9A 3KFXA 3VZPA 2IHKA 4RMHA 1KMCA 3MAJA 2DLCX 5C1DA 1Y5IA 1AUOA 3L8YA 2IYPA 4FE7A 5IJ9A 4Q4LA 2Z98A 3HG7A 5HKLA 5JLJA 1EFDN 1FQOA 1LBSA 2NG1A 4QDZA 4S1OA 1LK0A 1M1UA 3PIDA 4W9NA 5H70A 4UW9A 1MU0A 1TVKA 4V3BA 1J0DA 4H0CA 4Q9HA 3BSFA 3GHYA 2VQ3A 1BVRA 1YA8A 1T8UA 1ZM9A 4KFRA 4TKVA 2OMKA 3GUZA 1OXSC 2FN8A 1I80A 3I83A 5EJ5A 5LD2B 3HXTA 2V7QA 5JUWA 2UVPB 4NH0A 3DEFA 3UJCA 2OV4A 3BWCA 5MDHA 1QK4A 1UBEA 1J9ZA 1PGJA 3EQ6A 3FVWA 3OTIA 4BJ1A 3UMCA 2X76A 1GD1O 4RA9A 5LP6C 2CLEB 5BUCA 3HDJA 5EGSA 2Z3WA 5G0UA 5BYBA 3KQWA 4PAWA 5DN6A 4RHYA 4R83A 1FS4A 1XRNA 5D01A 5T57A 3WL7A 3CPEA 2OXCA 1QCZA 2QJWA 3JQDA 4WXYB 4TKVB 1GHTA 1LSSA 1T8YA 1TMYA 1UXKA 2HPHA 3EUWA 1CUJA 3ZG6A 2EEZA 1OLSB 1EE1A 1TA9A 2PX2A 4KE6A 4QNNA 3W1EA 4B6RA 4DREA 5IHXA 5HVNA 3O9MA 3ZHYA 1V39A 1C7ZA 1G0OA 3NT5A 4P86A 5L3RA 4C4RA 4R2LA 2AZTA 4CQMA 4L08A 1U2RA 2QUIA 1R6XA 2B4TO 1TAHA 1BNCA 1ZD2P 4YFYA 1U4NA 4BQPA 2OR3A 4CKEB 2RH5A 4EFNA 2ONKA 2FCRA 2GFHA 4Q19A 4ZZ3A 9ATCA 3L0ZA 1F8YA 1QQ7A 4GRIA 1L7AA 2I6UA 3K0AB 1K9VF 2ODNA 4X8HA 5ALJA 2B8WA 3R5HA 4HBGA 4Q4DA 3JWHA 1MO4A 4B8WA 1JLRA 4MJXA 4GZLA 2OO5A 3V7FA 1PJ3A 3E3NA 4IOKA 3VH3A 4FFLA 1XL0A 3EYWA 3EDRA 4Q6WA 1NFQA 3C3AA 4MR7B 2ZBPA 3TEJA 2FUG6 4AQDA 4BKQA 3DBLB 4G1UC 4IIBA 4Q7QA 4FBLA 3IEKA 1V8ZA 1Y4AE 2W58A 2J3MA 1I51A 1OAOA 1TE2A 2X1MA 4ZOLF 5J5VA 2BFOA 3G68A 4E2FA 2BFNA 2I03A 4EG3A 3BB1A 2B69A 4LK2A 4HUQA 3IILA 3PR3A 1AHHA 2MDTA 4N3BA 1DDOA 2D00A 5J1SB 2PPVA 4QYIA 4EW3A 1HFJA 3PNQA 5B6IA 2NT4A 3I8SA 4NAVA 2V65A 4UMEA 3UPDA 2DECA 1OU0A 5GQSA 3INNA 2YFKA 3H4TA 4TL8A 3MQ4A 1JIUA 1XFAA 1Q3HA 1TYCA 2OT3B 1ESEA 3HVJA 3OLVA 3DZIA 2CHUA 2QTBA 3C3KA 2JCBA 3NCHA 1M5UA 1AV7A 2B37A 4JP8A 3RVKA 3WMFA 2HLDA 1VIDA 2AG5A 2GNPA 3IT2A 3QOWA 1RJDA 1SKYB 2ET6A 3BCUA 2POCA 4JI6B 1OLSA 3BIJA 1S1MA 4CRWB 2DRIA 1E9BA 3UJ8A 4NG4A 4GLLA 2HUPA 1RE1A 3IDAA 2CE2X 4G01B 2GFIA 3WNBA 5L7WA 5JS7A 2CDNA 3EZ7A 4CKBA 4KQJA 4CUZA 3HUFA 2QXTA 1W34A 1D6SA 1JZTA 1NYLA 2FFBA 2Q6TA 3ECAA 5C0OE 5B58T 4MW9A 1KE2A 3D7MA 3WKAA 1E3LA 1YR3A 2VWGA 1UPXA 2GAJA 3DNMA 3H4MA 2NU8A 1KU0A 1G20A 3U4MA 1WR8A 3UHAA 1B93A 1KO4A 2QTGA 1NR7A 4ZMRA 3C3XA 4A15A 4LF9B 4P32A 2X1HA 4BJ3A 4FGWA 2C3YA 4MQFB 4UEKA 2RGGA 3PHLA 4NIMA 2WD9A 3SS7X 3O3MB 3BXXA 4GR5A 3ROXA 3N6RA 4LZOA 4E5DA 1GO2A 3RRNA 3IQFA 3EIOA 2NVWA 4MDHA 1T2AA 3F9IA 2IY8A 1GZ3A 2HM7A 1LFDB 2XJ9A 3C74A 3KJHA 4XSHA 1HQDA 5E0KB 2YWDA 1NUSA 2A9KA 3MRXA 4MRRA 5BSTA 3UCEA 4DC1A 2ZI4A 2HIGA 4QGAA 4XXHA 1TZJA 3SOZA 3UMVA 3IB6A 1QFYA 4L51A 5BNIA 2VIIA 3NASA 1XMSA 3O8QB 2YMQA 1A8PA 2IPOA 1NP3A 1ATZA 3E5NA 1MC1A 1KQOA 2JJ1D 4WXEA 4F3KA 2PS9A 1N25A 2NU6B 4RVGA 3LVRE 1CIJA 3KYBA 3PFFA 3PWKA 4G8BA 3ETNA 4WDRA 5E9QA 3G5AA 3VH2A 2ZWAA 1J0XO 4PICA 3K92A 3NU1A 1TQDA 1XMIA 3D8BA 1PVDA 2BFCB 1JKXA 1QZZA 1XELA 5AXDA 5E6SA 1XZPA 3KXKA 3DBHA 4WNYA 1QH9A 3TLXA 3D7SA 1OIVA 1P72A 1FYWA 1GOTA 1H2FA 2O4CA 4D3SA 4ZKDA 3MG9A 3OQVA 4FGJA 1EMDA 3SM9A 4DAEA 3WK6A 1N3LA 1XLWA 5DEIA 4BX3A 3CISA 2IYEA 1ZUIA 4IEEA 1RNLA 2IYXA 4L0CA 1Q0SA 4QTXA 1R0SA 4HYEA 3RVDA 2NT3A 2VXOA 2ZJ8A 2YVQA 4XEHA 3LLMA 1KK0A 4DADA 1M2KA 3E9QA 1JR4A 3JD1A 1MHPA 2X5XA 2CZGA 1DXHA 4CIAA 3HEBA 1XQYA 5F5NA 3DKRA 4QJBA 2W2KB 4LDZA 3G13A 4UNSA 3ADDA 4MI9A 4MVJA 5EQTA 4BO1A 2JI7A 1E63A 2PL3A 4HNQA 1WP4A 4NZZA 4UULA 5IFKA 4KKVA 5C5DA 1SD5A 1GZDA 2XADA 4G5OA 4N8EA 3ZY4A 2H8KA 5DNAA 1CQZA 2X42A 3C6ZA 3GT0A 4M1SA 1D7OA 3DE1X 4IJQA 4IR7A 2QL5A 3NC0C 4I4TF 5GM1A 4ETNA 3REFA 4EJSC 5B3AA 2VK8A 1E5XA 2AX4A 3ENNA 4UUOA 4JC8A 1E1LA 3BMCA 1T3GA 3IX7A 4JKYA 5AOAA 3BT7A 1H5QA 4G97A 5BSMA 4IS3A 2XMZA 3O0TA 4YRTA 3NB0A 3Q0IA 1EFVA 2P4SA 3PR1A 2NZXA 3K5WA 3EXAA 2PZAA 1NJ2A 1DAHA 1GR1A 1RYMA 4HQOA 1QYWA 4LUCA 5FJIA 4A1OA 4PLPA 4F56A 3T7AA 3UWDA 4R1TA 2HAEA 4J2TA 4MUXA 4NPCA 2YJ3A 3ZI0A 5DGDA 4DMGA 4ZYLA 3TAUA 2UXCB 4MV1A 4J0EA 1CR6A 1SA0B 1ES9A 4BMOB 3CB2A 4JBWA 4ZVLA 2LUOA 3GZNA 3SLGA 3PC8A 1Q91A 4C0XA 2FMFA 3T5BA 1XEWX 4B17A 1OX5A 1AIPA 1ZX1A 3GLGB 1LPSA 4HXFB 4MYTA 1H9AA 3QV1A 3LBNA 1RCTE 2W6QA 3GMDA 4BCCA 4ZOLA 4AU1A 1W59A 4CM7A 4GM1A 1G5HA 4DLZA 2H2FA 1J4AA 4EX7A 5BVGB 1JHZA 1N6OA 4IS2A 2V7PA 1ZJ6A 4KR9A 2QL9A 3IIKA 1JEDA 3TD9A 4A73A 4Z54A 1F8GA 2DVMA 2HPAA 5CIYA 2BTEA 1T5DX 3UICA 4B40A 1USGA 4CN9A 4DNXA 4RM3A 4RDCA 4A27A 4LYJA 4HNRA 2OL4A 2DJ5A 3IQHX 4X65B 5JALA 3KPVA 4WJZA 5EQJB 5JFOA 3C3CA 3IBSA 5A4KA 1TMOA 3GEDA 3I9V1 4WKNA 4YJGA 1NIJA 2DUWA 5EVJA 3VZRA 1F2DA 1RC0A 5CVTA 4Q9IA 4C21A 5ITVA 2HD4A 4YRFA 2REQA 4DR5B 1US8A 1S2IA 1ZUWA 1PJ4A 5KQLA 1JFLA 3GJYA 1D8AA 7ABPA 2ZT8A 1AK2A 1DFIA 1VJDA 1XTTA 2A5GA 3QE2A 4PC1A 1QVAA 2B35A 2EATA 1L8AA 2Z8YM 4GYJA 1T2EA 3ZVKA 3K0FA 4CQMD 3MMSA 2PJUA 4GPBA 5D87A 5CYPA 5ESRA 4B4OA 1H94A 1YHYA 3K6RA 2ORVA 3ZE8A 5K4AA 4L0MA 2IS1A 1W9MA 4GMDA 4DT1A 4P6VF 3GLIB 2IYVA 4RULA 2AOUB 2MSNA 2G36A 3Q0TA 3PJEA 4QJIA 3W5UA 1JQKA 1TZMA 1IZ9A 1L8OA 4DILA 2REQB 3X1WA 1FYVA 1MGOA 2G9QA 3O74A 2FV8A 2MHCA 4MKRA 4OMDA 4AJ9A 4P5PA 5DW3A 4ZHQB 4W1SA 1SOWA 3UH1A 4BZQA 1EGMB 2VATA 3EVFA 4JENA 4L7VA 1R1DA 1UJCA 1U9IA 1XZLA 3G8BA 4XVUA 3KSBC 1DCTA 1DC4A 3MBOA 2ZIWB 3BDIA 3KQTA 1ZIXA 4W5WA 2YZKA 2FFQA 1NMSA 3B1XA 3OPMA 2IXAA 3B6EA 5DX8A 3ZXIA 3ZJTA 3HZOA 1QRAA 2E48A 4WGFA 1BXZA 4GAEA 4CTJA 1I2CA 5L3ZA 1NN3A 2QTVA 1W96A 2XQFA 3O4GA 3W7VA 3NEAA 3WI7A 6REQB 2AT1A 5KKNB 3CPJB 1KI6A 4ZTUB 5CEEA 3HL0A 1JUDA 1YASA 1K3FA 2C5AA 3IXQA 2W48A 2B6HA 3OJEA 2BGNA 4IFTA 2H31A 1XTSA 5BR4A 4UEJA 2YOHA 1YFJA 1SXJB 4MQEB 1CRPA 3JWJA 3O31A 5EIFA 2M9MA 3II6X 4R6WA 3KALA 5FORA 2EG9A 1OU4A 1VSTA 3K96A 5DYGA 5KO2A 1LK5A 3ZZUA 2YN0A 4XD2A 3JWGA 5L6LB 2RHTA 2ZS9A 2R44A 4FN4A 2ZJAA 2QZPA 2ZB4A 1KA9H 3NOQA 1JEQA 4FWBA 3NYRA 1G1AA 1JDSA 5CXQA 3KPJA 1HYBA 2ATEA 3NPAA 4D0SA 2VC2B 5IVPA 1U6JA 1VSBA 3LDUA 4XSGA 2HSZA 3GAAA 1JWAB 3VKHA 2RBGA 5KX5A 5G3ZA 3SC3A 3W5AA 3Q3CA 1Q7GA 3EZFA 1NVDA 1EWKA 1QG0A 2PS0A 4MKXA 2LDBA 1U11A 4NCNA 4EHBA 4D5EA 1VKNA 2P40A 3SZ3A 2QSYA 3HLYA 4C5CA 2IH4A 2WB4A 3EGEA 4S2UA 2NVUB 4RIGA 4JGBA 1O2DA 1HZZA 3KDSE 3MTEA 4UHFA 2PGNA 4UAUA 1M1NB 1T2UA 3ZE6A 1FVXA 1F2TB 2QMOA 3EVNA 4X1KB 3LCVB 1HEUA 1ADCA 1XD2A 4ZT6A 1GL9B 2VYVD 3EEBA 2WY2D 4OUDB 1CY4A 2DEUA 5F7XA 4F45A 4JP5A 3W5IA 2QKYA 1U04A 2BZSA 1V5FA 1CUGA 3PNMA 1Q1ZA 3G8YA 3GFQA 4ZYWA 2W2LA 3GJ3A 4RABA 4P4TA 8OHMA 3MSCA 4ETIA 1DIBA 3KLNA 2Q07A 5ELMA 2G5TA 2YFHA 3MMZA 1G2QA 1OILA 4ALIA 1BRMA 1EFRD 1CZRA 1SMKA 2JFWA 3KSMA 4P31A 4P54A 2WHPA 5CGZA 3TMYA 5HZMA 3U7QB 2CYCA 4U9UA 1UDCA 1DBIA 3GJ0A 2A1UB 1KAEA 3EX7C 3RI3A 3PPWA 2FEWB 3OIYA 1NVAA 2GZHA 2OCAA 5HUHA 4XGKA 4C6TB 1FXUA 1XDZA 4IGAA 3HJUA 3OT4A 4HJXA 4RELA 2QM0A 4UASA 1G21B 1MRSA 1RACA 3LUCA 3VTZA 2B5WA 4IY1A 3T3GA 1FXWF 1SKBA 4L78A 1HTWA 3A2KA 3IEPA 3GFRA 4BO6A 2PLAA 4TV8F 3U6KA 3E1SA 3VAZA 2WQZA 4JB3A 3IUNA 5ALLA 4BVFA 1JW9B 1L6RA 1UOQA 1Y63A 3LUBA 2LCFA 4IIDA 1H23A 3K5IA 4X61A 3DLPX 3H2ZA 1Z34A 3BQMB 2ZREA 3SHFA 4P4GA 1WM1A 1QFZA 3W2TA 3FOZA 1B0PA 1NNLA 1ZINA 3IULA 5BOVA 2MYTA 2GBIA 2ZWIA 4TSRA 2F67A 1NYTA 5T3YA 1JR3E 4EP1A 1Z29A 2ORED 3I6YA 1KEUA 2QSJA 1YR2A 1HORA 2RHWA 3JQAD 4I3GA 2MYNA 3K9WA 1OZGA 3WKCA 1X13A 3U40A 4PZCA 2AFVA 2IXDA 4ZODA 4L75A 2J3JA 3CEHA 1FLDA 3GEEA 3SWWA 2PMDA 3QLVA 3OO0A 4KXMA 1WA5A 1TD9A 1QZ3A 1WMBA 1NVGA 2BFMA 2HRQA 2PGXA 4LZJA 4MUYA 2WUGA 3SAJA 3T34A 3UCFA 1HI9A 3GMIA 2FQYA 4HO1X 5EI5A 1G21A 3ZJUA 2Q3LA 3X1ZA 3GXOA 1W36B 2X2EA 1U5BB 4X3CA 3IKVA 4V2UA 5T7BA 2HOQA 4A2WA 2XXBA 2GBLC 3LDGA 1JG1A 2DMRA 1RWWA 4CU5A 5AM1A 4XCXA 5GONF 1FLNA 4XRGA 4BMYA 1MENA 4G36A 2WUVA 1XZFA 2ZSAA 4BZZA 2EW1A 2V5AA 1VB5A 2AMVA 4U2EA 1MC8A 2QRGA 3PE3A 2CKDA 2X15A 3PPXA 5E3IA 3I2GA 3THYB 4AVYA 3D3JA 4M21A 3ER9A 5F4BA 4RYLA 3MWFA 5I7WA 3E9ZA 3FBGA 1T2FA 1WBDA 1QQAA 2V1UA 3LSTA 4YUWA 2AVNA 4EAAA 4ENVA 3KNZA 1CJTC 3GFPA 3NIBA 1XD9A 1ZLXA 3KQPA 1EFUA 2PKXA 3D8RA 2I4OA 3O8LA 5E6UB 1LLFA 5IXJA 1T2DA 1C8VB 2L18A 5A7GA 3H0CA 3BGSA 4OQZA 2PWPA 4EMSA 5FWAA 1DEKA 5IUKC 5CPBA 3B3GA 3HCAA 5JZ9A 5M29A 3HXQA 4EY5A 5B2EA 1O96B 5E2AA 3CC8A 2ZAOA 3DHYA 1HWYA 5C8YB 4ZTZB 4NAHA 4AJEA 3MTIA 4JC0A 3HVKA 1CNEA 2SCUB 4BNMA 1SZCA 3FKSA 1KDYA 2C9CA 1P1JA 2OHVA 1ZISA 3OPVA 1N2EA 4YRJA 3ULKA 2VCEA 4LVNA 5EJ9A 3DYIA 4U63A 4RXTA 2QAJA 4ZRNA 1QRRA 1P5HA 4GUDA 3UB3A 4CEHB 3LO8A 1QS0A 5EKXA 3ZIAA 2GRAA 1A98A 3QVTA 2FPPA 2VJCA 2GLTA 4U2BA 4ZCTA 2O2IA 2B83A 3AM3A 4AWAA 4ZOCA 1DAEA 3LU1A 1C30B 3FLAA 4IIUA 4HXGA 4BN4A 3S2GA 2RMKA 2I7DA 2VAMA 3LRPA 4U4AA 4BNJA 3A7DA 3EULA 4R9RA 1Z33A 1C8BA 3AP1A 4NCXA 4DCGA 2D2EA 1ZH0A 3D0RA 3IQXA 3VPDA 4ZV9A 3OTGA 1ONSA 3H84A 3ECSA 3B5JA 4YPFA 1AHNA 3I30X 1A8IA 1XMPA 2EZ8A 3FZNA 5KC8A 4YA6A 1TKAA 5JTUA 4MQ4A 3CMCO 4XW2A 1YZGA 4OK6A 5J40A 3B9BA 1EFRA 1MVOA 1XAGA 3QPCA 4OI2A 4AJOA 5KINB 1EUQA 2O5VA 2I0FA 1I4DD 3VA7A 3TTYA 1Z0DA 5HZGA 1C3OA 4D2IA 3P71T 5C81A 1FUUA 2JKZA 1NQOA 2GBFA 3BFJA 3DMTC 3ONNA 2WJJA 1UMCB 4MULA 1RAAA 1M74A 3ZBPA 5TR9A 3IVCA 4MW6A 4RZQA 1T29A 1CUIA 2QOEA 3I1YA 3U9SA 3PX2A 5CFOA 2ECFA 3SKXA 3D5EA 2VYVA 2GD1O 3BHIA 3HFRA 4F5WA 2JGMA 1L5FA 3E48A 2IP4A 2Z2ZA 4H77A 1V0JA 2PXCA 3CEPB 3G7UA 5DMXA 4GOOD 4OFBA 5ITZA 1R64A 1A9SA 3RJTA 1POXA 2FR8A 2IXTA 1KMIY 1N5KA 1I3LA 1MH9A 3A4YA 2R85A 3EXEB 4NJEA 5FLYA 2DJIA 3V4OA 1NW5A 1JHDA 5DGHA 4H7PA 2LXNA 5KOHA 4QBKA 3DYBA 1KVQA 2NYAA 3U3KA 2FHPA 4H7JA 2HREA 1UK7A 4CNBA 2UZ1A 3ENZA 3LWDA 4ARZB 1G8KA 4HB2A 3B51X 3KXLA 3PQ7A 2GAAA 1XZJA 3BE6A 621PA 4ZVNA 3HKBB 1ATIA 1XKXA 4Q34A 1S2LA 4ZT4A 4F11A 2R2AA 1XEXA 2J33A 2LDXA 1E2MA 1NBOA 4J7CA 4B48A 3R6WA 4J29A 4KIFA 2C5LA 1JBKA 4MKFA 5A5FA 1ECLA 3BXOA 3KC2A 1WOYA 4HLUC 9ABPA 1TECE 3O6VA 4MUHA 3CVOA 4AUKA 4BB5A 2IIQA 2JGAA 3QQ5A 4A6XA 2JLCA 4RM2A 3GRKA 1IHPA 1PJCA 1P3DA 2JFHA 1N1MA 3D3NA 2ZE5A 3GY0A 1YVRA 1GAJA 4TYQA 1DRWA 4RJKA 1E9EA 1ZQ1A 2CWDA 4WLFA 4BLPA 2VDVE 4B5KA 2OHIA 1YK0A 2RHOA 1PL8A 3QX9A 2W4IA 5CVUA 1NTOA 5HR5A 4XGIA 3K2IA 4ZP1A 2VJMB 5CPFA 2PX3A 3AHGA 1XN1A 2CXSA 1W36C 1KMQA 1RJWA 1R9MA 3T61A 4CKCB 2J3DA 4L9RA 3FPAA 5D00A 3GROA 4OHCA 5CD1A 3E2MA 1DC5A 3IUPA 3REQA 4S05A 3DD5A 2HFJA 2RCNA 4DLBA 3ZDAA 3H2IA 1FNDA 2M98A 5AHRA 4TROA 1DQYA 1E6CA 2ZBRA 2RHLA 4PQYA 1O4VA 2PBZA 1G3IA 3JYQA 1NQ5A 4EO9A 2P3QA 4FIZA 3KPYA 5E4FA 4B9AA 2WTMA 2HA0A 3RPEA 4C3OB 3K1YA 2I7TA 2YQ4A 1NLYA 3TZQA 3ZE9A 2K5UA 5EFOA 2I8LA 1MJGA 1DWQA 4DF3A 5LSAA 1E6KA 1RADA 3FNRA 1VE7A 3N39C 4KR0A 3L6CA 4O2LA 4UPDA 3S44A 4GHWA 5A71A 2P5SA 4W6QA 4S0XA 2DCUA 4ZVUA 2PZGA 5K4GA 2YVLA 5JHGB 4Y1RA 1H5UA 4BKPA 5B4UA 3LIPA 4BNXA 5HM6A 2H59A 3IDSA 2Y92A 1QBKC 1Y6GA 1AD2A 1IWOA 4DNOA 3W4IA 1Q84A 1K4YA 3MTAA 3PRHA 3PWSA 4IIJB 4X60A 4G0MA 5FPHA 3EXIA 1FRVA 2M6LA 1ICEA 3DOJA 5L3VA 3K9GA 2O50A 2IXFA 3DLAA 2PM8A 2QGNA 5JNTA 3TVDA 2Y1WA 3AR5A 3PUWA 4IF6A 3F49S 5CBKA 4AJ2A 5JV5A 5FAKA 3DM5A 4A1FA 1XKTA 3KRTA 5LDDC 1GQSA 1Q2UA 2HK7A 3BCRA 5FOTA 2DHDA 5ES4B 3HJRA 2ALJA 2X5KO 5JCPA 3AR8A 2BM0A 2M6SA 3DBRB 4IDQA 1WDWB 2C4MA 4B3GA 4JUFA 1KDZA 4FSDA 3N2KB 2FW1A 5DTJA 7MDHA 1BGVA 3F71A 3USCS 3G0OA 1QX3A 1R0XA 1YI0A 2ZETA 2QVXX 3CW9A 3GGPA 1N8NA 3QEMB 4PR0A 5DT9A 5GOZA 3QKSB 3KQQA 3VR3D 3CV3A 5DBOA 5DBFA 3FZEA 4I2VA 4IH1A 5KSOA 4NBRA 1ZD9A 1U0FA 3EDMA 4U0KA 1W73A 3GL9A 2I6QA 3P27A 4BTVA 3IUYA 5HE8A 1IAQA 2VHQA 4R7ZA 2TECE 4YP0A 1P1BA 1I32A 5LQAA 1IUPA 1A7KA 5EJEA 1X1BA 1ENYA 2WJ4A 3GRRA 3D6FA 5I7OA 1CUXA 3SNHA 2C9MA 4X24A 4HQLA 3HKDA 3E5RA 4QWMA 4IXNA 4ZCRA 4CR6A 3GFFA 3IERA 3TVYA 5AXBA 3WYEA 4N8DA 2O8EB 4IZIA 3JVIA 3BFKA 1BMQA 3P52A 3M81A 2FOIA 3ZUGA 1O0SA 4KXYA 3AF3A 2W2TA 1ADGA 3A6GA 4OATA 1GARA 1XZBA 4BB6A 3I9FA 1NKVA 3VTKA 1DUIA 2ZKLA 3TXYA 3WP0A 3GJRA 1NT4A 4PN7A 4YCAA 2J0QA 5BUQA 4IINA 2Y68A 5JZSA 1QRSA 4BCDA 4P8RA 2EJUA 1SR8A 2V98A 3DDSA 3Q5EA 1QV9A 4H17A 4HX9A 3F4BA 1JMYA 2GJ9A 1KNXA 3SQOA 3DL0A 3SXJA 4URHA 4PNPA 3BCSA 3TPCA 2A5DA 4N0EA 5FWXA 2YZMA 3EVGA 4C4ZA 4EHDA 1GIAA 1GQFA 1YR7A 3DH0A 1U9ZA 1Q92A 3CB4A 2GKOA 4GVXA 3WGMA 1Z17A 4E11A 2C58A 2FPUA 3CSUA 1HO3A 2Z5LA 1XROA 4MMXB 4Q3KA 3GRVA 1JAHA 4C5BA 1QG6A 1T9ZA 5SY6A 4YEDA 3RAGA 4DGQA 2WT4A 3TRDA 1I5RA 4IX9A 4R8MA 2NQTA 1H1LA 1ML3A 2I2WA 4QUEA 4L6AA 3PEWA 3EC7A 2DWUA 2PUWA 1CBUA 3AEKB 3G9TA 4H7HA 1S2NA 1ZXBA 3IO5A 5J2TF 3UJBA 2OHFA 1B8NA 5DHFA 4MWCA 2WICA 2O2XA 3SFZA 2XE8A 2CXHA 1SPXA 2ZRHA 4M1WA 4YV1A 1CRZA 4QOEA 3GLFA 3AT1A 3C24A 2WEKA 2Q3CA 4QJ3A 4ZAYA 3WLJA 1SEPA 1O95A 1UZAA 2PMCA 2A0YA 4Q7JB 2OXEA 3RSFA 1E2IA 4JV5B 4YPOA 3HSKA 4PLWA 3BF8A 5IAGA 4MRAA 5AP9A 2ICAA 2FN3A 4XE5A 2GEFA 4DUGD 3R5FA 4U0JA 1NMZA 3LSYA 1P9NA 2IKSA 3NVAA 1RP7A 1HL7A 3VSBA 1DBSA 1JDUA 3AFOA 3GUCA 3PQDA 4J0FA 2J6BA 1Z0KA 1D2CA 1W5AA 4HFJA 3BSYA 3SICE 4OKIA 5H3CA 3OIUA 1D0VA 4JIGA 3BYZA 3S6JA 3FSJX 3F4LA 3D2LA 1I0ZA 1PS0A 2WJ6A 1P9WA 3DFMA 3FWYA 4JLNA 2ZJ3A 1V16A 2Q0XA 2MOKA 1OT5A 2O1WA 3PXCX 1QC5A 2UYGA 3IVMA 4LRXA 5IDYA 3UJAA 4URXR 2A67A 2Z6QA 4KXVA 1EXMA 4M8LA 2A1UA 3R0VA 4ZDWA 1J25A 5HF8A 2GYYA 3S2YA 4YV7A 3H2GA 2V0CA 2R60A 1KZ6A 2NPFA 3CXRA 5SY4A 2IGBA 2DSTA 3IP8A 4PRKA 1Z0FA 4FIDA 4X7MA 3UW1A 5AFSA 2GZDA 3S5JA 4I55B 4EARA 1XZDA 5H9WA 3QUAA 4XAQA 1DNPA 4K8RB 1FZQA 1FP1D 2B6NA 1F9AA 5LB4A 5J2TB 5EIBD 1Y7HA 1LW6E 3HBFA 4WBNF 4G9BA 2GZ2A 3KYJB 2JPDA 5F9FA 3R9KA 2I6XA 1SQSA 5KS2A 2IIBA 2WA1A 3HKCB 3JQBC 3JQGA 5LD2C 5KEIA 4Q4JB 4OBWA 4D6PA 2HBQA 1R4NB 2XW6A 2ZWPA 2GHTA 2ONZA 2V96A 2YOGA 3A1WA 3I3SR 3N6XA 3VH4A 4FXPA 1DJLA 3PCXA 3AWIA 1KBOA 2Z9CA 2CE7A 3V32A 4II3A 2PT6A 3NAGA 3IAFA 1EGQA 4JGIA 1I7QB 1YDMA 3AETA 4ESVA 2FZKA 4YY3B 3QVOA 4WBSA 1J9EA 2JCGA 3GGOA 5IC4A 2O0HA 5JBQA 4ZK6A 4ZEWA 4PHGA 5GADl 1TM3E 4A0SA 1VHJA 2IU4A 5C8YA 4AN0A 4N0QA 2Y1CA 1N1DA 2R00A 4LX0A 2NSHA 4NXNB 3JYOA 3FB1A 5IULC 1N3YA 1LWOA 1PBNA 1TB4A 2Q3FA 2Q29A 1L5NA 3EVZA 5LVAA 2A92A 3ONWA 1XWFA 2CDBA 1L5HA 1IB0A 2FWNA 3DMGA 4URUR 2EJTA 5DM1A 1G8YA 2HT6A 2N3ZA 2BT4A 2PGLA 1Z7EA 1BDMA 1T25A 1E9CA 3OFND 1KPIA 4J7UA 2DULA 3IOBA 1BSVA 4QBFA 1P7ZA 1MABA 4MMYB 2OPBA 4M6WB 3ONFA 1MO6A 1K63A 2HWWA 1ZWLA 1L3CA 4OJTA 4N6GA 4CTOA 3K3PA 2QMEA 1GCGA 1X8LA 5ITSA 3DM9B 4Y9RA 2HQ1A 4K6CA 1PW7A 2A0XA 4E4YA 1O94A 4BCBA 3TGLA 1E5DA 1MG0A 3ECCA 4W7SA 4BLWA 3GC6A 2QK4A 1GTMA 2SNIE 3HZZA 3AF4A 4TYPA 4AAYA 2B61A 4D9NA 1P3JA 3PGVA 2JGDB 2QI9F 1IPFA 1IY9A 1JL3A 1QH8A 3ZZMA 4TXLA 5DEOA 3IE1A 4PYKA 3C3EA 2GBCA 2D7CA 4OHRA 5FPTA 3BQ9A 3OY7A 4YJ3A 1X80B 1XXHA 5HMMA 3SOPA 1N2BA 4GRAA 4TVKA 1RIFA 2F9MA 4NZNA 3UA3A 4X84A 4H1HA 3MHTA 4GLFA 4Z86A 2LTAA 3IELA 4YXWA 1GPAA 4PEVA 3E18A 2GRJA 1QUEA 4WLUA 4BLRA 4BO9A 1OIXA 3CTMA 3FKJA 3NDRA 2PCLA 4E21A 4Z1OA 2ZJ0A 3UBTA 1H0HA 2O06A 5DI3B 2XOKD 3SVLA 4EZEA 2QUJA 3K09A 2COKA 5ALRA 4YWHA 3HWRA 2XTAA 2GPWA 1SD2A 2XCLA 2CYAA 3QU5A 4JUDX 4UHJA 5JZBA 5EFZA 3KTFA 4KMSA 1F8FA 4YCCA 3Q2IA 1AQNA 4FW9A 3ANLA 1GSIA 2WA2A 1N5OX 4FZ5A 5FJJA 2PIAA 1EVYA 2FOLA 1P7WA 2XE4A 4QEZA 3RHTA 1JJ7A 4XD7A 1XEFA 1XMXA 1EEXB 3GVXA 4CM5A