2IM2A

Crystal structure of poliovirus polymerase complexed with utp and mg2+
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Stabilization of Poliovirus Polymerase by NTP Binding and Fingers-Thumb Interactions.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
molecule keywords poliovirus polymerase
total genus 138
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 2im2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2im2A02
1FKPA 4R0EA 1LWEB 2OPSB 5KFUA 4Q43A 1C1CA 3G6VA 3MEEA 3KLEB 5F8NA 4IDKB 1RYSA 1S9GA 4Y3CA 4JUZA 5KFVA 5KFRA 2VG5A 1FK9B 4NLDA 4TXSA 5L1LA 4EBDA 2FJVA 4NLGA 4PUOB 2J6TA 5J2PB 4J9QA 4ZP9A 1TKZB 3H40A 1JLAB 4LSNA 2R8IA 3OL7A 1LW0B 5L1JA 2VA2A 4O3QA 5FDLB 1RT5B 1LW2B 3H5XA 2YNHA 2R8JA 1RT5A 4Q8FA 1S9EA 3DM2B 4ID5A 4IR1A 3BSOA 4I2PA 2B6AA 2HMIB 2ASLA 3QIPA 3UDLA 1TKZA 5CYMA 3OL6A 1NHVA 3PHEA 1JXLA 1S10A 3E01B 2XGPA 3GIIA 3BQ0A 3V4IA 1FKOB 4IH7A 1TL3A 4LSLA 3TQ1A 3MEEB 3KLEA 1EP4A 1VRTB 2IJNA 3BQ1A 4MK8A 1IKXA 4RNOA 3KLGA 3SFUA 2OPRA 3GV5B 4JV1A 1LWFA 1KLMA 4K4VA 1XR6A 5DGBA 3GV8B 1TV6B 2R2UA 4WZQA 3DLEA 4GC7A 2C28A 1RT3B 3BREA 3I5BA 2CJQA 3UQSA 3PW7A 3PR5B 4KHMA 5KFHA 2C22A 3CO9A 1HQUA 1D0EA 1RTDA 4TY8B 2YKNA 1N4LA 4ZMMA 5DLGA 4ZPBA 3M8QA 4TY8A 2OPSA 5KFYA 5J1EB 1DTQA 1JLQB 3NAHA 3CJ0A 3CJ3A 5J2QA 1N48A 4LQ3A 3KHRA 2UVRA 2BRKA 5HP1B 3DMJA 4ZVEA 3BGRA 4ECSA 1IKVA 2BQUA 2BR0A 1RT1B 3IRXA 1KHVA 3I0SA 2ASJA 3DLKB 4ED0A 5KFFA 4O3RA 1HPZB 4IKAA 4JV0A 3KK3A 1IM4A 3QGHA 3HVWA 5KG0A 5FDLA 4O44A 4RNNA 3KK3B 5I42A 5EWGA 1LW0A 3I5CA 1SH3A 2RKIA 3RBEA 4RUAA 2XCPA 3VQSA 1GX6A 4QWCA 3IN5A 1RT7A 4J9OA 3FFIA 5KFIA 1S1TB 4RZRA 3KK1A 1HMVA 2OH2A 4WYWA 1FKOA 5F9NA 4IR9A 3NKYA 5KFQA 3KMQA 2AGQA 3TVKA 1VRUB 2W7OA 4O4GB 3V81B 2WONB 4IRCA 5KT3A 3G6XA 2WK4A 1C0TA 2B6AB 4KFBB 4EO8A 4ZHRA 1TKTB 5C5JA 4NLRA 3QO9A 4H4MB 1LW2A 1HPZA 3PW5A 1C2PA 4NLOA 1EETB 1U09A 4NLYA 1S97A 2AWZA 1TV6A 3CJ2A 5DG8A 4PWDB 4ECXA 2BE2B 4ZPCA 4K4YA 1HNIB 4MH8A 4ZHRB 1K1SA 5K14A 2IC3A 5J2MA 4O3PA 5KG7A 1S0OA 1IKYA 5DQHA 4G1QB 4I7FB 4PQUB 2WHOA 2ZE2A 1HQUB 3CWJA 5KT5A 1RTDB 1JLEB 5K14B 3BQ2A 5CYQA 5F8LA 3MR2A 3MFHA 3V6DA 1RT4B 4MK9A 2HWHA 2V4QA 2BQRA 1XR5A 3HVAA 3RB4A 2W9CB 3QZ7A 3LAKA 2FJWA 1HYSB 5F8GA 4FBTA 2JEGA 3QO9B 3I5AA 3KLHB 1LWFB 3PW0A 3MFIA 2JEIA 4K4ZA 1S1WA 1S1XA 3GIKA 1MMLA 3BJYA 3T5HA 1I6JA 1TVRA 4IH5A 2IAJB 3V81A 2OPRB 3HHKA 3DMJB 1T3NA 2HAIA 4Y34A 4FS2A 4DL4A 1FK9A 4PUOA 1T94A 2HNYB 2JLEA 3MEGA 1S6QB 5HROB 5DGAA 2XWYA 5HROA 3QGIA 3FQLA 2E9RX 1ZTWA 3FRZA 1JLGB 3Q8RB 2JEFA 3G86A 2YKMA 2VG6B 4WE1A 1TVRB 3KMSA 4KKOA 3MECB 4IFVA 4OL8A 2AX0A 4YP3A 3MTKA 3QLHB 3RB3A 3NBPA 1SH0A 3LP2A 4J9MA 1HQEB 1N6QA 3PJXA 4NLVA 3KLFB 1N5YB 4O4RA 2W9CA 1QUVA 3CJ4A 5F9LA 3I0RB 4F4YA 2W9BB 2I1RA 3QGGA 3QIDA 4EO6A 4NCGB 4TQRA 1JKHB 4TLRA 3V6DB 1C0TB 3DI6A 4QWAA 3NGDA 3RB0A 4EEYA 2WONA 1S0MA 5KT4A 3LP1B 2WTFA 4Y2AA 4NLWA 3OHBA 2BQ3A 1IKWA 3HVTA 4IH6A 4RW6B 1T05A 4NRUA 1Z4UA 3DRRB 3TAMA 2OPPA 1S6QA 5KFJA 1C0UA 1UWBB 3V4IB 5KG2A 3KJVA 3KK1B 3DI6B 5KFTA 4YMEA 4R5PA 2V9WA 3N6MA 1HNIA 5D3GA 1BQNA 4TYBA 4LQ9A 4J9LA 2IAJA 4J9NA 2I5JB 4URSA 1C1BB 4DG1B 3H4BA 1REVB 2HNZB 4ECZA 2R8KA 2IJFA 4KE5A 1RT2A 4TN2A 3EPIA 3DRPB 3E51A 3LP0B 2D41A 3LP2B 3MR5A 3GQCA 5C42B 1ZTTA 3PW2A 1TP7A 2O5DA 3MEDB 5KFBA 3NAIA 1C1BA 3CDEA 3GIMA 5L1KA 2YKMB 2QV6A 1RT4A 5KFOA 4RU9A 3CIZA 3T1AA 1VRUA 5JUMA 2V0NA 5J2PA 1SV5A 2R2RA 4J9PA 1ZETA 1VRTA 4Q45A 5T14A 3GIJA 3OL9A 5KG5A 2ZE2B 2HNYA 2IM3A 3DRRA 1HMVB 3IGVA 3TAMB 3M8QB 1JLCB 1IKWB 3HVTB 4RW6A 2YNFB 4ZVHA 1FKPB 1LWEA 3M9MB 3M9NB 1T03A 4WZMA 3OL8A 4IQXA 3QIPB 4KKOB 1S6PB 4MKBA 1W25A 5HBMA 4ED8A 2YNGB 2UUWA 2R8GA 1CSJA 2YNIA 4R8UB 3OLBA 2BE2A 4KAIA 4ZP6A 1BQMB 1JLBB 3KLIB 1RA7A 3JYTA 1S1VB 4NRTA 1DLOB 2JC1A 3KLFA 3I0SB 1GX5A 1JX4A 2RDIA 3HKWA 1JLFA 3LAMA 4K4UA 1HARA 4RNMA 5EWEA 3MECA 4IFVB 4IOBA 4WFYA 2ALZA 5DQGA 3H4DA 4WE1B 3V6KA 2AU0A 3C6UA 4RUCA 3BSNA 4WFZA 3H5SA 4K4WA 3ITHB 4I7FA 3KK2A 3RAXA 2FVQA 2UVUA 4NLTA 5JXSA 4H54A 3DLGA 4IG0B 3N6LA 5KG1A 4O3NA 5KG4A 5F8IA 4IG3B 2EC0A 4RW8A 5J2NB 4XO0A 1S1UB 2D3UA 3FDSA 1RTHB 4KHRA 4XPEA 4KSEB 4M94A 4NCGA 2IM0A 4PWDA 4K50A 2WOMA 1S1XB 5HLFA 2E9ZA 4ICLB 5KFCA 4TY9A 5KFWA 1N5YA 1YVFA 1SH2A 2CKWA 2FVRA 3RB6A 4KB7A 4ECRA 1HYSA 1JIHA 3QLHA 1MU2B 2ZD1A 3DOKA 1TKXA 3H59A 3KOAA 1JLAA 2YNGA 4LSNB 4G3IA 1S4FA 3M9OB 3GV7B 4WFXA 1BQNB 2VG7A 3BSAA 5HP1A 5CYQB 5KFMA 1QAIA 2WRMA 4MIAA 2FLLA 1RDRA 1SUQA 3C6TA 4J9RA 2FLNA 4PQUA 3G6YA 4ECYA 2C2RA 3T19A 2VG7B 5KFZA 4TQSA 3JSMA 4K4SA 2RKIB 3UPFA 4I2PB 4NLUA 1OS5A 3PVXA 1XR7A 2BRLA 4KBIA 3PR4A 3DRPA 3MR3A 5EDWA 4TYAA 3KHHA 4ZPDA 1WNEA 4FS1A 4ZP8A 2IA6A 5I3UB 5F8MA 2FVSA 5KT2A 2ASDA 2JC0A 4WXOA 4R5PB 5DQIA 2BANB 3DRSA 5KFKA 2AQ4A 3KJVB 2VG6A 3H5YA 1DTQB 1JLQA 4O4GA 3LALA 2UVWA 4IDKA 1IKXB 4YR2A 5C25B 4RNHA 2XC9A 4O3SA 4ECVA 4RW7B 4U6PA 5KFAA 3SI8A 1SUQB 3C6TB 4QWDA 4EYIB 3IG1B 1TL1A 4I2QB 4DL5A 2BANA 3DRSB 3Q8QB 4DL6A 1HNVB 3PJWA 2QE5A 3QYYA 1S1WB 4K4TA 3NMAA 1EETA 1S1VA 5KFXA 4NLXA 3DOLA 1HQEA 1N6QB 1S48A 3LP0A 2GIRA 3H2LA 3NBPB 4KV8A 2W8KA 1IKVB 2HWIA 3Q8SB 3IS9A 2E9TA 2ZKUA 4IRDA 4F4WA 1RA6A 3CDWA 2HNDA 4YR3A 5KFGA 2XGQA 4WYLA 1DTTB 4F50A 5F8HA 4QPXA 4IFYA 1T05B 3GILA 2W8LA 2YKNB 1RT7B 1IKYB 2WB4A 4DEZA 5KFNA 5F8JA 2J6UA 2ZD1B 3DOKB 1JLFB 3RBDA 4NYZA 4QW8A 4J9KA 3BR9A 4QWEA 5C24A 4Y2CA 1RT2B 3DLKA 1REVA 2HNZA 3JYTB 2WOMB 5HLFB 1K1QA 2WCXA 3EZUA 3Q8PB 4B3OB 1KLMB 4MIBA 4KO0A 4Q44A 3LANA 4H4OA 3D5MA 2C2EA 1JLEA 2DPJA 4FBUA 4IG3A 4URGA 1S6PA 5HBMB 5DG9A 2OPPB 2XI3A 4URQU 1C1CB 3ITHA 3KK2B 2FLPA 5C25A 4ZVGA 1RT6A 3QZ8A 4QW9A 3D28A 4DL3A 2IC3B 1C0UB 2ILYA 3E01A 3T5JA 3MF5A 1JKHA 5KG3A 1TKXB 4ED1A 3V6JA 2FVPA 2IMWP 1J5OA 5KT7A 1S9EB 4NLSA 3DM2A 2B5JA 3IGNA 4RW9B 5C24B 4Q0BA 2JEJA 4H4MA 4O3OA 1BQMA 3KLIA 4ECWA 2B43A 2IM2A 2V4RA 4EBCA 1RT1A 3IRXB 3NL0A 5KFDA 4YQWA 1QE1A 1RTJA 4F4XA 1HNVA 2XCAA 3ISNC 1N56A 2W9AA 1RTHA 4X2BA 1JLCA 5EWFA 1NHUA 2VG5B 5J2NA 3SFGA 5J2QB 2R2TA 3FSIA 4ECTA 4ED3A 4ED2A 3KHGA 2VA3A 2HNDB 3FFIB 4G1QA 2AX1A 2GC8A 2AGOA 3LP1A 1S9FA 5L9XA 1R0AA 4JV2A 1RTJB 3ICLA 3MEDA 3BSCA 2GIQA 4H4OB 3OLAA 4ID5B 2AGPA 4O44B 4F4ZA 2XI2A 1RT3A 4ED6A 2FVCA 5KFSA 4MFBA 4ZPAA 4Q0BB 3DLEB 5EUHA 4YR0A 3EPGA 4MFBB 4ICLA 3M8PA 4DL7A 5DG7A 4Q8EA 3OSNA 1TL1B 3JSMB 5L1IA 2IM1A 2R8HA 3KLGB 1JLGA 2ATLA 3T5LA 3OHAA 4IFYB 1RTIB 1NNDA 1TL3B 3H5UA 4LSLB 2C2DA 4DL2A 3MEGB 4ED7A 2F8EX 4ECQA 5J2MB 4IRKA 2J6SA 1S1TA 3PW4A 3DYAA 4RW4B 3M8PB 4KO0B 1RYRA 2OPQB 5CYMB 1LWCA 2RF2B 4B3OA 1TQLA 3CJ5A 3IS9B 5I3UA 3N6NA 3I0RA 5C42A 1DLOA 4HKQA 4XPCA 5I42B 1S0NA 4ECUA 4NLQA 4EBEA 4MK7A 4WXWA 1QAJA 4J9SA 2UUTA 2IBKA 2B5JB 4RW9A 3FQKA 3DOLB 3CDUA 1TKTA 1J5OB 3OSPA 4RNFA 2UVVA 4U7CA 2ILZA 3DDKA 1RAJA 3BGRB 2FJXA 1R0AB 1LWCB 2RF2A 3KLVA 2YNFA 1T03B 1S1UA 1D1UA 1EP4B 4I2QA 3RAQA 4NZ0A 3DLGB 1S9GB 2D3ZA 1DTTA 4IG0A 1RT6B 1KHWA 1RTIA 5KG6A 2RDJA 5J1EA 4RW7A 5KT6A 1SV5B 3CVKA 2W7PA 5KFLA 3C6UB 5DLFA 4ZVFA 3GYNA 1QE1B 1S49A 2HMIA 3ISND 4KV8B 3MR6A 3PZPA 4ZP7A 1MU2A 4EYHB 4M95A 3KLHA 4QWBA 2YNHB 2W9BA 3T5KA 2DPIA 4NLPA 3V6HA 5KFPA 2I5JA 4DG1A 1JLBA 5D3GB 2OPQA 3KNAA 2YNIB 4MKAA 4R8UA 4KFBA 4K4XA 3DYAB 4RW4A 5KFEA 2R2SA 4HYKA 4RW8B 3KHLA 2D7SA 3UR0A 3IG1A 1UWBA 4GC6A 3H98A
chains in the Genus database with same CATH superfamily
3D9BA 3TZXA 2OPSB 2G0CA 1WC3A 2YWHA 3J81U 2H5JB 4QU6A 1RYSA 1WC1A 5CD4A 4JI0F 4FN5A 5KFRA 4EBDA 2BYCA 4DV3F 4NXNJ 5LOQA 2J6TA 2M88A 4DCPB 2EPIA 2VL1A 3GR0A 3E3XA 5HQMA 1ZPVA 2WSCC 4O3QA 2KJVA 3H5XA 1Q8BA 1S9EA 5CZXA 4ID5A 4LFCF 4DLEA 2DYAA 2YPZA 1SI9A 4QPTA 2M2BA 3W65A 4HACA 4NA3A 2RQKA 1S10A 3E01B 4Y00A 2C2NA 3N4WA 3BQ0A 1VQ8S 3U7JA 2MYFA 2AF6A 2YWEA 3BF4A 3MEEB 3KLEA 3J7ZT 2KYZA 4MK8A 1IKXA 1NM2A 1OSCA 2ZBRA 1N5SA 2OPRA 3W66A 2PT0A 1WC4A 2BVZA 4CLFA 3N5FA 1QAXA 4P75A 1T9YA 5J1NA 1E6YB 2V69A 2HFOA 1FI4A 3AODA 1KC8T 3DU6A 2DNGA 1HIYA 1Y00A 4GC7A 2C28A 5CCLA 3OFGA 1N36F 2K7JA 4C8YA 2MZQA 1EKSA 1X4HA 2DCLA 2UV8A 3M05A 4KPCA 3UQSA 3PW7A 3M2RA 3PR5B 2J8SA 2QLFB 4KHMA 4ELUA 4ALZA 4PQAA 1M1GA 1HQUA 1SJ3P 6FD1A 1ZH5A 1GMUA 4BWJA 1HNWJ 2YKNA 2AP6A 3K2YA 4AE5A 4ZPBA 3M8QA 1SJQA 2JRSA 2GCFA 2OPSA 4TY8A 1UVJA 2Y0BB 3K5OA 3OVSA 5J2QA 3NAHA 2P9EA 3UVJB 1NBEB 3KHRA 4N77A 2BRKA 2E5GA 1UETA 2UU9J 2HVEA 1YZ7A 4H4KA 1NKEA 2F8MA 4OX9J 2QO3A 1S59A 2OELA 2BQUA 1KHVA 2UXBJ 1X4AA 3DLKB 3MCNA 2XMAA 3D0HE 5B0EA 4B08A 1U45A 5AXKA 4IKAA 3TAPA 1AYEA 1BY9A 1V5IB 3OVAA 1VLOA 2UUAJ 2ZHBA 1LW0A 3G71S 4PRFA 4RUAA 5H1SV 2M52A 1GH8A 3VQSA 2DNPA 2HZCA 3SSSA 5E7OB 3M6UA 1ELOA 3M8RA 3KK1A 2RMLA 2MQPA 4TNOA 4C8KA 5IT4A 3HSGA 5D4PA 2D3O1 1NJWA 2JDJA 4K0KF 2WSEC 3NKYA 1HA1A 1WKKA 3PEHA 2IA0A 3CCVS 3H2VE 3W9HA 3JSBA 4N8OA 2MEWA 2PO4A 3HULA 2AIRB 2WONB 4OYAA 4IRCA 1YWXA 3G6XA 3DKDA 2WK4A 1SCJB 2EK6A 2N7YA 3C15B 3KG4A 1UVNA 3CULA 1TKTB 1FDAA 3KUEA 2MHEA 2M4MA 2XG8A 4F67A 3AX3A 1HPZA 3PW5A 1C2PA 3VHQA 2GVDA 3SQGB 5HVHA 3BGOP 1F0XA 2MKHA 4OJ3A 1WHVA 2Y1LB 4ZPCA 1HNIB 4N5SA 3SQOP 2HBYB 5K14A 1FVSA 2XM3A 3QQCD 3M30A 5KG7A 3GJRB 4EZ6A 4B3SF 1O5JA 5DQHA 2HHQA 2LEAA 2KI2A 2V6AA 3C66A 3PEJA 3TWZA 4DUZJ 3CCLS 2ZE2A 4PQUB 1RTDB 1IWGA 3EX7B 2HSEB 3SV3A 1KD1T 3BKUA 1F3FA 1B3TA 1TK8A 5CYQA 2RHQB 3MFHA 4NWBA 3SXLA 1RT4B 2CXEA 1Q78A 3C16B 1BC6A 3GSIA 4DR3F 2A10A 1OM2A 2HWHA 2YX1A 3MPVA 2V4QA 1U1LA 3J7YI 2E1PA 2KT3A 3POTA 1BXNA 4WBFA 1S77D 4FBTA 1ZM4A 1F5BA 5A8WA 1TL4A 2D74B 3I5AA 2YH1A 1LWFB 3HD2A 3AD9C 4XDDA 4OZ5A 4AD6A 3UNYA 2RHSB 1S1XA 2H65B 4ITSA 5L39A 3BJYA 3RTVA 7FD1A 2UVWA 4DBQA 3V81A 2DGQA 3HHKA 2EBEA 3D54A 4LF6J 3LW5C 1LQ9A 1AA1B 4PUOA 5K8OA 2CQ1A 2HNYB 1JQGA 3KNGA 3VWSA 4L72B 3CCSS 5HROA 2PFDA 3FQLA 3ZZOA 3FUYA 1SXLA 3W1YC 1SJFA 1TMJA 3Q8RB 3OTOJ 2XS5A 3G86A 1U2FA 2VOPA 4PZVA 2UXBF 4JI2J 4OL8A 3GG1A 1MLAA 1P9QC 2CPYA 2GZOA 3G8SA 1SH0A 1F9EB 4A8YA 3LP2A 1BE4A 2HBQB 3RB3A 4JI8J 5U47A 1LK7A 1OY6A 3PJXA 4OJ1A 4ILLA 1N5YB 1BWVA 4AT1B 4O4RA 2W9CA 1SKRA 4QYZJ 1VK8A 1T0TV 2DNMA 1ZBTA 2G2YA 4DN9A 2W9BB 3FGVA 3QGGA 4DV4J 1PJ5A 4WF9Q 3ULHA 3NGSA 1FA0A 1BHNA 4DSKA 2ZWPA 3ZZRA 1SIWB 3DI6A 3VVUA 4A8OA 4QWAA 4BWMA 1R31A 3ZO7A 5LSLA 5KT4A 4NLWA 2NPIA 2XYGB 2EI5A 4IH6A 2ZM6J 2IRYA 3FBBA 3MD3A 1T05A 5GMEA 2OPPA 3LTOA 5F0WA 1UWBB 3UDVA 1URRA 5KG2A 3KJVA 1AUDA 4M5NA 4ZK7M 4PYDA 5ETMA 4YMEA 1MNEA 2B4PA 1VQ6S 3N6MA 1HNIA 2VKZG 4ZVQB 2H4YB 2AEMA 1WHYA 3S7RA 4U7UD 2IDEA 3LF0A 2JNJA 1C1BB 3NEKA 3RU0A 1WEZA 1UVIA 2PFFB 4X62J 1ZA1B 3KXDA 4KE5A 3QT7A 4G65A 1RT2A 1G6BA 3BYPA 1FD2A 3M2UB 1L3KA 3JAMU 3DRPB 2G4BA 1PGZA 1ROFA 4NPOA 4ZVOB 3A8IA 4YY3F 3GQCA 1F9FA 3PACA 5C42B 3PW2A 1TP7A 1VJQA 2O5DA 4UUXA 4V19X 1U26A 2DGWA 1M0SA 1RT4A 5J2PA 1FRJA 1RCOB 1AFJA 1F2HA 1NB2A 3I4HX 4F36A 2PI5A 3CJ8A 5F41A 2ZE2B 3EXCX 2IM3A 3IGVA 1U2RA 2BDPA 2PI4A 2ATCB 1GMVA 1JLCB 1IKWB 3ENAA 4DX6A 3M9MB 2W2PP 1FKPB 1LWEA 1QVGR 3WX4A 4K2JA 4KKOB 2BOAA 3MUMP 2DH8A 1HNXJ 4A4JA 3S8SA 2R8GA 4FDFA 1OWXA 2YPYA 2XSJB 2JH3A 2QT7A 2YNIA 2CJYB 4PXCA 5ETTA 5HVFA 4R8UB 1RA7A 2IBOA 3GG0A 4P7TA 4AQYF 3JYTA 2J5AA 1XMOJ 1EHWA 4NRTA 1OY9A 1DLOB 2B9XA 3I0SB 1VFJA 2DXFA 4Q7AA 5DDOC 1GTEA 1JLFA 1JNZB 4K4UA 2F3JA 3ILIA 4J90A 5EWEA 3MM9A 3MECA 1WKJA 2FGOA 4CTAA 1LOUA 3H4DA 1P8GA 2PD1A 9ATCB 3V6KA 2K3IA 2Z2ZA 3C6UA 3HDSA 3ITHB 1KTVA 4I7FA 4OI3A 3RJMB 3KK2A 4NLTA 3RAMA 2FVQA 2UVUA 1NCLA 3THVA 4IG0B 5KG4A 2ACYA 4IG3B 4WP8A 3R6LB 5J2NB 2HBZB 2V1SA 3D0IE 2ZZTA 1RTHB 2O01C 3CJKB 2HFSA 3ZZ0A 3IWNC 3AY0A 1Q1KA 2IM0A 3D66A 1CJVA 2CPEA 2GO8A 4F25A 2CADA 2D9OA 3KJFB 1BWEA 3M8YA 4AFFA 4M63A 4TY9A 2ZDPA 2XO6A 1FFGB 1OSDA 4KB7A 1N36J 3PDNA 4YOEA 1NK7A 2J7UA 1W7WA 1HYSA 1JIHA 2RS8A 4CYUB 1DRZA 5B0DA 1FRLA 2MZTA 1NUEA 1RKJA 2GMLA 3KOAA 1JLAA 4LSNB 2HQFA 1SJ4P 1JJ4A 3GV7B 4WFXA 5LSOA 3BGLA 5GAEU 4ANCA 3BSAA 4OHZA 5MAOA 3EE3A 2RD5C 3SYZA 2E1RA 2NYHA 4I6YA 1OO0B 2V34A 1RDRA 1SUQA 2KRBA 4WTOB 3JQJA 1YRTA 2AYGA 1D9DA 4UW2A 3WX8A 4PG8A 4ECYA 5DETA 3T3FA 2C2RA 1U1MA 3L7PA 4MKYA 2Y9HA 4TVAB 5KFZA 1FESA 1WOOA 5B0AA 2I8EA 4K4SA 3A13A 3NGRA 5CCMA 2CFXA 1FDDA 4A47A 4DCOB 1OS5A 2H54B 2LLZA 1A7GE 4LF2A 4CCHA 2GVZB 4FNHA 2XS7A 3DRPA 2M8HA 3VQTA 3B4DA 3MR3A 5HMXA 4DV1J 1HBOB 1PC5A 2N7CA 2AJ0A 2F8HA 4ZJQA 4ZP8A 1AFIA 5I3UB 4CRJA 1FDNA 3DCAA 5EHHA 2FVSA 1NJZA 3B54A 3FMWA 8RUCA 1PKUA 4WXOA 4R5PB 2ZH1A 2HGMA 2B9WA 3DRSA 3C2PA 1WTFA 3KJVB 3P5BP 2ZBIA 5DRKA 2BW7A 1L3UA 1LFPA 4UY85 1IKXB 3WC0A 4LFAJ 1B0TA 1PC4A 1U1QA 2K1RA 2CA9A 3THTA 5H9EK 1NZAA 4USJC 1UEVA 1R8PA 2UV8G 4I2QB 2I2YA 3MCSA 4LVOP 3Q8QB 4DL6A 4A8MP 3W9JA 2NXEA 3I82A 1UPMB 3GB0A 2CPDA 3OXLA 1XMBA 3NMAA 2GV1A 1RBOB 1S1VA 2F4FA 3DOLA 5ETRA 5D77A 5GAHU 1HQEA 2LQ8A 1N6QB 1I94F 1ZAWA 3NBPB 3HX9A 2XNRA 5DO2A 2J0WA 2WVCA 2QMUB 3IP0A 1IKVB 4R0JA 2KU7A 3I9V9 4C0OC 2W4DA 1IR2A 1PJ7A 2LECA 3CJKA 2UZAA 4ER8A 2W1BA 5RUBA 3HK2A 3K17A 1EZZB 2AEFA 1NK6A 1FXLA 1MN7A 2FGCA 2V94A 2KXFA 3PYEA 4XK8C 4F0MA 3ZZPA 5GVQA 1IBKJ 1RT7B 4KGMA 5KFNA 1NRKA 3LO3A 4DV0F 5F8JA 5A6PA 3VGUA 1G1XA 3UO0A 4F4AA 4J7CA 2ZD1B 1RB0A 2IFXA 1S57A 3DOKB 2YH0A 4YN3B 3VAHA 4DR3J 4KPYA 1JLFB 4NYZA 1HBNB 1P1TA 1P9YA 1DY3A 2HIYA 4Y2MA 4QW8A 3V4MA 3WQPA 4ZIVA 5C24A 1B0VA 4RWWA 4ENOA 2VFTA 2CQ3A 3PRVA 1UJ6A 2MQMA 4ELTA 1REVA 2HNZA 3JYTB 4CO2A 1K1QA 2WCXA 3CNQP 1DHMA 4B3OB 2RJZA 4OYZA 1ZS6A 3CCRS 5ETSA 4DSIA 4I4BA 1YJVA 1UKUA 4OYXA 2C2EA 2NCKL 3BBBA 3ET6B 5HBMB 1PBUA 3UN2A 1E6VA 4HTIA 2FJEB 1C1CB 1L3TA 1H38A 2RVJA 1RT6A 3PIPQ 2RT3A 3BPDA 3FBEA 4LF9F 4DZ6A 4KJIA 2W2MP 4DL3A 1N0VC 2NR0A 2N4CA 2ZWOA 3MM5B 4M5JA 1AW0A 2DNNA 1O0PA 4V19J 1JKHA 4DI6A 1M5KC 3MPUB 2I0XA 5G0RA 1RAEB 3DU5A 3AH6A 3BH6B 3V6JA 5GMDA 2C3UA 2IVYA 4W98A 1J5OA 3DM2A 3VGVA 5C24B 4RW9B 1KWMA 2JEJA 3D2WA 1TR0A 1BQMA 2AZ3A 1NPPA 2OO4A 3KLIA 4X65F 4DWIA 2W4CA 2XWXA 2Z57B 4QR1A 4CLLA 4B3TF 1RT1A 5KFDA 3PJ9A 1FRHA 3D6HB 1RTJA 3DDIA 3FBCA 3WHIA 1ZM9A 1D8ZA 2E7VA 2W9AA 3L7UA 3FK4A 1VCTA 1HBMB 4OI4A 2MB0B 2VG5B 2N4DA 4ECTA 1SQEA 3DHWC 2DR8A 3KHGA 2XY6A 2CZ4A 2VA3A 2Z8QA 3SV4A 4DU7A 4A8KA 3QGPA 2VH7A 4KR0B 4DR2F 4NOHA 1S9FA 2H9ZA 4JV2A 4L3NA 3MEDA 4I64A 2EBGA 4C8NA 4M5IA 4C11A 2A6OA 1PILA 4CIOA 2AGPA 2HBRB 1WEXA 3X3UA 4U96A 2OGUA 2J0SD 2DT9A 2VPYB 4OX7A 3VR1A 4F3QA 9RUBA 5KFSA 4Q0BB 4MFBA 2XTJP 4X65J 4YR0A 2LXFA 4ICLA 4EFAC 3CCJS 1HI0P 2C3MA 3EZ5A 3Q0AA 4DF8A 2DISA 3I9ZA 1N5VA 1IUJA 1R0BG 4DL7A 1WG5A 3P49B 3OXFA 2ZUGA 4K7QA 1QM9A 4D3HA 1KLNA 2MKKA 5L1IA 3KLGB 4ELVA 1FX4A 1XMQJ 3KJNB 2Q3PA 4RBTA 2L9DA 3R7SB 1TL3B 3DLHA 2F8EX 1U8WA 1X31C 2OSQA 3EM1A 3S6EA 4CM0A 4CM2A 5J2MB 4RW4B 2MTLA 3M8PB 2OPQB 4QCLA 5KOXA 5HSPA 1GQEA 3N6NA 3BPSP 2H48B 1IBLF 2W25A 1DLOA 1WACA 4XPCA 4Y28C 5HJXA 4EBEA 4WXWA 2VZ9A 3UCZP 4PR6A 3FQKA 3DOLB 4DPWA 1NJYA 5HVGA 2UVVA 2B8QA 1PYTA 1RWKB 2L3MA 5H9EJ 4RWXA 2ILZA 3DDKA 2JFDA 1RAJA 1QUPA 4X4OA 2E5IA 4PG4A 1R0AB 2RF2A 1FX2A 1H74A 4LSZB 1D1UA 2E7XA 1L5UA 1VQ4S 2NYIA 4M5GA 4IG0A 1S9GB 2D3ZA 2LCWA 2MLZA 4DUYJ 1KHWA 5KG6A 4NEZA 1GAOA 4WK3A 4RW7A 5CHCB 5M2UA 5KT6A 1UJ4A 2YWKA 4LBPA 3CVKA 3OUYA 3CPWR 5DLFA 3C6UB 2FHMA 3IAS9 4OZ2A 2KZMA 3RRHA 1FJEB 2HMIA 2JSXA 2XY5A 4KV8B 1MU2A 4DV6J 4P7VA 2XHWA 2DK2A 4J5OA 3HM9A 4QWBA 3OR1A 1R3NA 2EXUA 2C42A 1YQHA 5BYRA 3TA1A 3OTOF 3T5KA 2KL8A 1XEZA 1HLWA 3M2VB 5L8RC 2DPIA 1IBMJ 3BDPA 5L9NA 3GIRA 2MLYA 2V5HG 3BGUA 4NYPA 2M0GB 4ZJOA 1JLBA 2R7SA 2OPQA 2YNIB 4R8UA 2HK3A 1WSRA 2R2SA 5A2QU 3A8KA 2M7SA 2VQEF 2G2OA 1C0UB 2IDLA 3BV8A 3CD7A 3LPEA 3OT9A 2ABYA 3R3TA 1FKPA 4R0EA 1LWEB 2HRTA 2HPUA 2YWFA 1E6VB 4IDKB 3VGTA 4JUZA 4JI5J 2VG5A 1FK9B 2PMHA 4I0WA 4TXSA 2YY3A 4CTAB 3MWBA 5L1LA 3WIVA 4ZP9A 3K8VA 3NCRA 1JLAB 4LSNA 4OQJA 3MM8A 4OZ0A 3R1LA 5D3GA 5E2QA 5L1JA 1Y5NB 4KQZA 4CLKA 4CLZA 1PO6A 3BN4A 3W63A 5LJ5Y 3FZ2A 3W5XA 3DM2B 5AJ3F 1NK8A 4IR1A 3BSOA 4I2PA 4ZLJA 1CEZA 1DAXA 1F1BB 2FB0A 3E8OA 4LRBA 1SL1A 2ASLA 2B56A 4OYMA 3GCXP 1NHVA 4NCBA 1VK3A 5EX3A 2VQFF 3K89A 4V1Ak 4LFAF 4ZPTR 1TL3A 1FJGJ 2IJNA 1WEYA 3ZC4A 4ERDA 3JSYA 3ILJA 3JS9A 4JI3F 4JI6F 3KLGA 4OJGA 1RBLA 1IR0A 3HP6A 2BX6A 3GV5B 4DS4A 3OW2R 4DR6J 1Q79A 3MOZA 2CPFA 4CLTA 2HGNA 2CPIA 1LWFA 1T9UA 5C2GA 4YEAA 3G82B 2XMTA 1TV6B 2R2UA 1Q4RA 3DLEA 5AJ3J 4IOCQ 4OFZA 1N88A 1U49A 2Q1LA 3I5BA 5BYSA 3MMBB 3ZZYA 1YJ9S 5CABA 2XTCA 5LMNF 2C22A 1SPBP 2MQQA 3ENWA 1W2BR 5K8NA 3WBZA 4I56A 4F26A 1N4LA 4F3MA 5DLGA 2ZOGA 4UUWA 3PKMA 1HI1A 2ZHOA 3C46A 2XMMA 3M8SA 5IC6B 2UUBJ 1N48A 3QJPA 2V8HA 1S6UA 4IO1A 4DU8A 2A18A 1M5VC 1F2GA 3NGTA 4HDGA 3EYZA 2QFIA 4B3RJ 1IKVA 3GJQB 1VR6A 1RT1B 2FJDB 1BGXT 3D1HA 1UW9A 3GWCA 2OD4A 5KFFA 3OVBA 3M2VA 4QIGA 1WJ9A 1Y9OA 1IM4A 3QGHA 3DXSX 1U48A 3KK3B 4P72A 5FDLA 3CCUS 3UCUP 5EWGA 2G0JA 2J9CA 3MCOA 1EKRA 2RKIA 1WHXA 3QATA 1XTZA 3QWUA 3ZNJ1 1IR1A 4DR1J 3TANA 3GTYX 2XCPA 4M5DA 2QMXA 4P9SA 3J81j 4NXNF 2V8DA 4QWCA 4J9UE 3IN5A 1RT7A 4PABA 2K3KA 2V50A 1S1TB 2KRRA 2OH2A 5IT9Y 2QC3A 3HHLB 4J91A 1B99A 4N8NA 4P52A 3SBMA 4WYWA 5C7PA 3O44A 4FVMA 1VRUB 3TVKA 5A76A 2W7OA 2YX4A 2XBPA 3SCIE 2DNQA 1FJ7A 3J80U 4F04B 1CG2A 1RHQB 1Y4ZB 3DGPB 1EX8A 5HMZA 2AKWB 4ZHRA 4H4MB 2ZH5A 4KH0B 4KT0C 2HK2A 2VICA 1B64A 4NLOA 1Q7LB 2B8PA 5FLXU 1SL0A 1TV6A 2BKNA 3DHXA 5DG8A 4PWDB 2DNOA 2ZC3A 3CJQA 2VQFJ 4MH8A 4UF4A 4U67Q 2JVRA 3T9NA 1K1SA 1DQ9A 3BR8A 2UXDF 5J2MA 4O3PA 2MKCA 4C3MA 5CA5A 4OLOA 2R3VA 4RPFA 5IZHA 4Q2LA 5K5MA 2IJRA 1U0HA 3QRPA 4G1QB 3JTNA 4I7FB 2KHDA 2FHOB 1QSYA 1FHTA 2WHOA 1HQUB 4MYUA 1V6HA 4I68A 1FFWB 3BQ2A 5K14B 3UR3C 1HWLA 5F8LA 3NP5A 4N7TA 3MR2A 3O8WA 4DR6F 4JI0J 1X4GA 2EC2A 4TU7A 2BJ3A 4A8XA 1CPZA 4DX5A 1XR5A 2JOQA 1NEEA 2O67A 4KC5A 2ZH6A 3QZ7A 2ZJPQ 2YKAA 1YJRA 3LAKA 1NJXA 2FJWA 1HYSB 5F8GA 4FNIA 2JEGA 4NZ7A 3KLHB 1FRKA 3R5AA 4LR7A 4U8YA 3FNNA 2QN6B 2JEIA 2BJ1A 1S1WA 3T5HA 2DIUA 1MMLA 1LXJA 4B3SJ 3US5A 4LF8F 1T3NA 1U6BA 4GKJF 2F65A 1U0SA 3N79A 1Q8LA 2ZJQQ 1S4EA 1CC7A 4FS2A 2VFUA 2JLEA 3MEGA 3MMJA 2XYPB 3A8JA 3AOAA 4KGZB 2XWYA 5ETKA 4DR5F 2Z2LA 4DV5J 1NKBA 3FZBA 2G13A 2IHR1 4CLSA 5HMYA 2GQ2A 1U1NA 4B02A 1X5OA 1HW9A 1KTQA 2VG6B 3J80Y 1TVRB 4JI1F 2EFPA 5IFMA 2HS4A 3MECB 4QR2A 4GKKF 5CH7B 4XDCA 1I1GA 4YB7A 2GJFA 4HHUA 4PKDB 3TW0A 4CYUA 3JAMY 4DSFA 4J9MA 2ZHAA 1ITPA 4HT7A 2ZBPA 1NHKL 4WJBA 1QUVA 3PFEA 4TLQA 3TRGA 5LJ3Y 4K8RA 2E1AA 4JI2F 4B9LA 3QIDA 3NWGA 4TQRA 5B0FA 4EGLA 4EEYA 2WONA 3CMAS 4BLGA 3PV8A 3G9CA 5H9FJ 3QRRA 3OHBA 2BJ9A 4ILMA 1X9SA 1MROB 1U0HB 4NRUA 1H2UX 1F5CA 1FXDA 2DBBA 2OMLA 2XMVA 2J76E 1S6QA 3DRRB 3EWGA 2LYVA 3SDEA 5FJ4A 3DI6B 3CC7S 2CPJA 2V9WA 3F44A 2OHDA 1V3ZA 1CQMA 3CD0A 4QR0A 5DZ6A 3VF0B 3QNWB 4J9NA 6AT1B 2IAJA 2WAQD 2I5JB 4P2FA 2Y1JA 1REVB 2AJ2A 2HNZB 4BCAA 2R8KA 1V5VA 4ZVPB 3H8YA 4TN2A 1T8EA 2CG8A 2DGXA 1KDNA 1WOPA 4C9DA 1Q81T 3LP2B 3PIOQ 3P8BB 4P2SA 2OTJS 1I5OB 3AD7C 1KP6A 4JB8B 2MHNA 2HHWA 2SXLA 3MPDA 1C1BA 4QOTA 5HL7Q 3GIMA 5L1KA 3LGMA 5KFOA 2DNYA 3CIZA 1VRUA 2HFVA 2QL9B 3M8WA 3R7BB 4OIXA 3T1AA 2R2RA 1ZETA 4BBYA 2A0FB 2MZRA 3M32A 3JTOA 3M8QB 4RKUC 5E41A 2YNFB 1M5SA 4BC7A 2J0XA 5LT5A 3OL8A 2COLA 4OV6A 5HMWA 2NSCA 3W62A 1W25A 2KM8C 3MZIA 2YNGB 3ZZTA 4ED8A 1S76D 1VQPS 1FKAF 1RJJA 1GXUA 4KAIA 1BQMB 3KLIB 2HVIA 2Q6CA 3EGWB 4AUKA 5B0GA 1IWAA 2CDRB 1B7YB 4LJMA 4DR4J 2FUG9 1S1VB 2HHSA 2JC1A 3Q24A 1DFDA 1DJ0A 3OBIA 2UXCF 3W8GA 4KGKA 3MI7X 4USKA 1HARA 2WZ1A 2XSJA 1VGYA 4CQ1A 4X66F 2MKIA 4IFVB 2FLOA 3R7NB 3MM6A 4USUA 2CPHA 1R27B 2AU0A 1VI7A 4RUCA 2F63A 3IRWP 1U6FA 2R7OA 1Y11A 3FCVA 3RAXA 5JXSA 4FF3A 2F4VJ 4LUBA 3CXCR 2JLGA 3HFKA 2GJ2A 5KG1A 1RP5A 4XO0A 4HEA9 2EC0A 4RW8A 1S0OA 3IM8A 1S1UB 3FDSA 7AT1B 2ZM6F 2VJUA 3HHLC 4AQYJ 4QU7A 4M94A 5AXMA 3MMBA 3L7OA 3DRYA 4ZCKA 3R5JB 1HWJA 4LF7F 5HAOA 2J7WA 1SKUB 2O3DA 3FRYA 2FVRA 3VAIA 1L3SA 4DPXA 2J9DE 2OMOA 4ECRA 3LUYA 2PE8A 3QLHA 1J27A 2MSTA 2YNGA 1OQ3A 2FZGB 1S4FA 3CC2S 1M5OC 1T95A 2RNEA 2YKPA 4DL0C 1VQMS 3FC9A 5CYQB 1KONA 3F73A 5KFMA 2WBRA 2WRMA 3AB4B 1UVLA 3C6TA 2DEIA 2HHHF 4DFPA 2RDDA 3PO4A 4J9RA 4PQUA 3G6YA 4M5KA 5DZ7A 1WI6A 1P6TA 2RE1A 3L4BC 3T19A 8AT1B 1NB7A 3DLLQ 2AYMA 4HHJA 2OEMA 3MM6B 1SKWA 3M6WA 4KRWA 2EFVA 2Q6BA 4NLUA 3BKFA 4NI2A 2CWXA 4USTA 2CAJA 4KBIA 5MLCV 2ZH2A 3PVXA 2R7VA 1ZM3A 2WW8A 2L9NA 5EDWA 3H7HB 3K57A 4OYIA 2E1CA 2HQCA 4FS1A 5F8MA 3I6PA 4PPZA 4P2MA 5IT9U 1HL6A 3AD8C 2JC0A 1WELA 4USIA 1X0PA 2AQ4A 5CAAA 5LL6d 1VYAA 1VBKA 5F0UA 5GAHI 2XC9A 1X9MA 2K1RB 3GFYA 4ECVA 4O0IA 1XJWB 2RIJA 4Q2MA 5K9FA 5KFAA 4Z7CA 3NNHA 4EYIB 3N28A 2HKEA 5EN1A 4FVCA 2MXYA 3IBFB 3DRSB 3JXOA 5D0HA 2X1FA 3AX5A 5LSRA 2B4OA 3MCMA 3K5MA 3MD1A 3QYYA 3UCGA 2EG1A 2B9YA 3HKZD 2EFNA 2BEFA 2GVDB 3HZGA 2ZITA 3GYXB 3GFZA 4NLXA 4FYXB 5KFXA 2CQGA 3W9IA 3LP0A 2V2QA 3D1QA 5HI7A 4KGVB 1V3SA 2CQ4A 3ZZZA 5KOWA 5LMNJ 2ZDOA 1RWXB 4Y2KA 2W8KA 1GT8A 1NDLA 4FKXA 2OJ3A 2HHVA 1L3VA 4C3LA 2G9OA 1RA6A 3ILOA 2HS0A 3CDWA 4NA1A 2ZH4A 1I94J 2HNDA 5A8KB 4AYBD 2XGQA 4WYLA 2W2OP 2MDAA 5B0CA 5F8HA 4QPXA 3GU0A 2BA9A 2R42A 3IO1A 4GO5X 4M5HA 5IV3A 1IKYB 5IWAF 3OQ2A 1HWIA 2J6UA 3JQMA 1HWKA 1H72C 3AX2A 3RBDA 1ULRA 4FYVB 4ZLLA 2EKNA 2N82B 4J9KA 2AYBA 5SUHA 4JI6J 2VFVA 3JB9k 1RT2B 2CUYA 3M2UA 2LEBA 5ETQA 2A2CA 2JFKA 3BO4A 3ETMA 4LMZA 3NS6A 4LRCA 1RWPB 4MIBA 4CLPA 4GKJJ 2ROEA 4Q44A 3M4XA 5CD4H 4URGA 4QIWD 1S6PA 5DG9A 2OPPB 2XI3A 3P6YC 2X51A 4URQU 3VCDA 4DUTA 5F3ZA 4OLPA 2Z0GA 4PEOA 1FE4A 1RHJB 4X64J 5ETVA 4JYAJ 4ZVUB 3EDRB 4PXDA 1UP1A 4QW9A 3D28A 1MSWD 4X4UA 2ZH7A 1G2EA 3E01A 3C19A 5A0YA 3TNVA 1M1KT 3Q8UA 2BXJA 1TKXB 2CZ9A 3TZYA 2FVPA 2IMWP 4NLSA 3BO2A 2AJFE 4O3OA 3BBFA 3G96A 4NI2B 2B43A 2IM2A 2DR9A 4LIWA 4RBVA 4PXEA 3SMZA 2DR7A 2VC0A 2P5VA 2RU9A 2JJ4D 2DRBA 2M3DA 4FXWA 4U7UK 4QIFA 1RTHA 2DB1A 2QX0A 3A4TA 3AQOA 1JLCA 5EWFA 1NHUA 1UTAA 3M1VA 5LXYA 3MUTP 5J2QB 3HZEA 1R8HA 3NCPA 2R2TA 4MIWA 2BMBA 2FD2A 1Q0NA 2YWGA 3AJ2A 3OR2A 4WFNQ 2HNDB 3FFIB 1DZ5A 3EGZA 1PAEX 2AX1A 4QJVA 2BUNA 2XTEA 2HFNA 2QRRA 4LFBF 3HJFA 2KH9A 2VV5A 1TFYA 3BSCA 3QBCA 4H4OB 1AZSA 1FCAA 3OLAA 1SC6A 3K7RA 5E3PA 3FCHA 4B17A 1MMDA 1RWUA 3PHTA 1ZAVA 4F4ZA 2W24A 2XI2A 3C3LA 3NNAA 1UMJA 3MMCA 1RT3A 5E3QA 2FVCA 1KVJA 4LBIA 2QA4S 2GGPA 2RRNA 2Y3YA 3Q86A 1U2CA 3FSXA 3EPGA 2XZDB 2ZNZA 2JLFA 1UFKA 3C16A 3ZTOA 3T1HF 4GVLA 4X4NA 3CTRA 4LIRA 4NYOA 3TUZC 3KDNA 2DHHA 5LM7E 4JI3J 3JSMB 2GO9A 1TL7B 1G7CB 3TUIC 3UI3A 2E1MC 2PEBA 3CMQA 2BJEA 4DHVA 4LSLB 4K5RA 2VD3A 3CCTA 4CNZA 2AJ4A 4ZCIA 5A8KA 1S1TA 4PPDA 1TKDA 3AFGA 1ZA2B 3DYAA 3OFHA 2P2CB 1RYRA 4YB6A 3VZHA 4B3OA 2H5EA 3IS9B 4OX9F 2HQDA 1UEKA 4IYQA 2R4FA 1I3OB 1X4BA 3SQGA 5C42A 3W64A 5DJBA 1HFEL 2BACA 2EEYA 4DZDA 1S0NA 4MK7A 3AA8A 3C8YA 2JHEA 4RLEA 2MJUA 2YX7A 1TKTA 1NSPA 5A6WA 4RNFA 1J5OB 2Y8WA 4U7CA 1XN9A 2V2ZA 3L3CA 1HKAA 1LWCB 1AROP 2N3LA 2NSBA 3N01A 3T6JA 4X4TA 1M1HA 2YNFA 2ZOMA 2VHGA 2XY7A 1EP4B 1S12A 3RAQA 2V8PA 1WTBA 2X7IA 4NMXA 3A3OB 1DTTA 2HLTA 4USWA 3I32A 2RDJA 3RRKA 4UZCA 5A8RA 1SV5B 3TJ9A 3VGSA 3FEYB 1OYEA 2CIMA 5BXIA 2W7PA 1PSDA 4R25A 5KFLA 2R7QA 5HK4A 3PKYA 3PX0A 4P73A 5FIIA 3N9UC 2PN6A 4CNYA 1RHKB 2X1BA 4A8SA 1A9NB 2OI2A 5DM7Q 4ZP7A 1XBWA 4LF7J 1D3WA 3PM9A 1ICEB 1VQOS 1RAHB 1RU2A 2YNHB 1RAAB 2J8AA 1RWWB 2RQCA 1WI8A 1LK5A 2AT1B 6FDRA 3IM9A 5KFPA 4DG1A 3F0NA 1LEOA 3RYLA 5CZVA 2LDIA 1FDBA 4QIVA 4ZVRB 2XLIA 1YJWS 3EUNA 2F9DA 4RW8B 1Y5IB 1YI2S 1XWLA 1PYOB 3QIPA 3DNCA 2PGCA 1IBCB 5GAGU 5KFUA 1TELA 4QYRA 4Q43A 2KYXA 3O2IA 3G6VA 5F8NA 1KS2A 3O6QA 3FBFA 1S7HA 4U8VA 3RBXA 5AXNA 5KFVA 2HRYA 1YIJS 4PUOB 1RQ0A 4NLDA 1XMQF 1DBDA 1GK8A 4HT5A 2VFSA 4RU2A 1KOHA 2E29A 4OHXA 3D3BJ 3U1LA 3U02A 3ILLA 3W61A 2V2VA 2PMZD 4B9TA 3HFVA 2KVQE 3OL7A 5G4DA 2R8IA 3TARA 1Q5YA 3O1LA 2VA2A 4OJHA 5FDLB 4X62F 4Q8FA 1RT5A 1SIZA 4KIAA 2XLKA 3P45B 2B6AA 1AUSL 4G6VB 3U1MA 3UW1A 3TAQA 2HMIB 4DSLA 1JWWA 5ETOA 1TKZA 2XZWA 3MM7B 2CNNB 2Z58B 2CNOB 3G8QA 3TJAA 5LMUJ 4HI1A 2LFVA 4IH7A 2HFZA 2NUUG 4LSLA 3TQ1A 2V8GA 1OIAA 1CLFA 4DPYA 1VRTB 1HBUB 4RNOA 1TL7A 3SFUA 2XLJA 5CYMB 3LWMA 3H25A 2WVEA 1TMMA 3BZQA 2RSQA 3QJJA 5AE1A 4ETZA 1NXIA 2PA3A 2QL7B 2APOA 3CE8A 3GV8B 4LF8J 3Q83A 1CJKA 5M2RA 4JI8F 1JB0C 4WZQA 3HXMA 1NK9A 4QBUA 3FKBA 4CP5A 2MKYA 1D8YA 1RT3B 2WB1D 1NK4A 2CJQA 1W26A 4FYYB 1P27B 1RWNB 4OYBA 3HT0A 4ES2A 3C15A 5KFHA 3QSIA 2GMHA 4TU9A 1FJGF 3TVZA 2HHHJ 3D7SB 3PRBA 1LWXA 3A8EA 1AT1B 2JL9A 4TY8B 2GAGC 4ZMMA 4LREA 2YBVA 3HD1A 5KFYA 5J1EB 2V2KA 2FLNA 1OYDA 3BB5A 1T7PA 1DTQA 1JLQB 3CJ0A 3LPYA 1T9TA 2KXHA 4CO5A 1VISA 1SKSA 2UVRA 4PAAA 5HP1B 2AJ1A 3QWPA 2AJQA 4ZVEA 4ECSA 1S72S 2KZZA 1URNA 1G3OA 3DDNA 3I0SA 2ASJA 2KO1A 1NDCA 1TU0B 3CUNA 3HSDA 1E6YA 1FD8A 3HVWA 4OZ3A 1B4SA 2MKSA 4RNNA 1RABB 1YBTA 5I42A 1SH3A 1SVDA 2DRAA 1WC0A 4NEYA 1EIYB 2KT5A 3QFWA 1XK8A 3TP2A 3JQKA 2LQ5A 3UD4P 3U27A 2MQOA 4Y6IA 4LRAA 4J9OA 5KFIA 3Q89A 1QSSA 3VAMA 5J1PA 1WG1A 4ZDNA 3D1OA 1NDKA 4ILRA 1J5EJ 1U8SA 3ISZA 3KMQA 3DOMB 2YKQA 3VVTA 3CD6S 5B09A 2LDYA 1RAGB 2DGVA 3FJ2A 4O4GB 1HHSA 3SCJE 1XIQA 3D6FB 2B6AB 1M5HA 3M2RB 4A46A 4OYWA 2DR6A 3EVOA 1TK5A 4NLRA 2MQ8A 1FEEA 2P6SA 3QO9A 2PA8D 3I55S 5JJBA 2QEXS 4WIIA 1QD1A 2YXLA 3V2UC 4EWTA 1EETB 4NLYA 1X8DA 1S97A 2R7WA 3CJ2A 1NSQA 1K9MT 4ECXA 1LKZA 2BE2B 2W2QP 1SC4B 4K4YA 3M6XA 4ZHRB 2NXNA 4P71A 3G4SS 1CJUA 2IC3A 3W5YA 4N56A 1N32F 2EW9A 1RAOA 2DD8S 1X5PA 3O3LA 1IKYA 2G0IA 2QLBB 4KY3A 2DY1A 3DFEA 3FSYA 1CS4A 4DPTA 1FERA 1TL5A 3OV7A 4ZS6A 1JLEB 1DURA 2HQGA 1OJ4A 2VB6A 1QVFR 3NCQA 2ALYB 5JVHQ 3IXQA 3V6DA 5EX0A 2OP5A 4M5DB 4HACB 4LF9J 2Z2MA 2BQRA 2GGPB 2W9CB 1RE1B 1Q5VA 2NZCA 1X4EA 1JNRB 3N0VA 5K20B 1R89A 2HWTA 3MFIA 4UZBA 4LRFA 2QG9B 4DFMA 3Q2TC 4K4ZA 2E5JA 3DGPA 1I6JA 2G1DA 3R27A 1PYSB 4IH5A 4J37A 3DMJB 1R6YA 2HAIA 5T7LA 1UCNA 4DV7F 1R6VA 3BM7A 1R43A 4DL4A 3MPYA 5L38A 2FTRA 3M32B 4M8LA 1RTZA 5HROB 4L73A 2BABA 2QTWA 3M8ZA 5HQLA 1CULB 4M1KA 3PX4A 2ZZNA 2DCUB 2VDHA 2E9RX 1CJTA 1TUGB 1ZTWA 1JLGB 3MEKA 1SL2A 1G4CA 2BM0A 2NS1B 3EMTA 2DNHA 4WP9A 2YKMA 5CYJA 4WE1A 3CF5Q 1KKHA 3H2UB 4KKOA 3W5ZA 3ELHA 4IFVA 5KTQA 1RBAA 2V9KA 1ZAXA 2PSZA 3QLHB 2ERRA 1F6TA 3NBPA 1HQEB 1Q8IA 3KDOA 1N6QA 4JI7F 4NLVA 3L95X 4ZKAA 4PWWA 3B78A 5DDQC 4DLGA 1RAFB 3CJ4A 2MY8A 1FNMA 1TFWA 2CDQA 2I1RA 5I4MA 1FVQA 1Q95G 3GP9A 1X4FA 4NCGB 3W2WA 5B08A 2NUHA 3V6DB 2GS8A 1YJNS 1C0TB 3NGDA 3RB0A 4DV5F 4ZIWA 1GMWA 3GMGA 3LP1B 4NXMJ 2WBMA 4PG5A 1I51B 4HLBA 2R9LA 4B3MJ 4PXBA 3HVTA 4RW6B 3TX0A 2L08A 5A8RB 2OEKA 1Z4UA 1CULA 2IMOA 2B51A 1JK9B 3MMAA 5AXLA 3TAMA 3CMES 3RR7A 1C0UA 4UOGA 3V4IB 3J7AN 4DOZA 5KFTA 5HJYA 1HBMA 4R5PA 4B9UA 3HSJA 3CJTA 2B7CB 4TYBA 4LQ9A 4URSA 4I6WA 4NX9A 3PXGa 1WF1A 2BM1A 4N41A 3R5CA 4ECZA 2FZCB 1VC6A 2IJFA 4B9SA 4F2RA 3R9LA 2HVDA 3LGHA 3E51A 3NGKA 4CH7A 4F7VA 1KOOA 3PG9A 4FP9A 3CC4S 2E7WA 2EFQA 2CG4A 1ZTTA 3BEGB 1U1KA 1VBYA 3CDEA 3K59A 2QV6A 1VRQC 3DXBA 5JUMA 5D4LA 3MOJB 1M5PC 1Y5LB 1S6OA 3CEDA 1QJHA 4J9PA 2BW2A 4Q45A 5AT1B 3J7A1 4OHVA 2YVSA 2XYHB 3DRRA 3K5NA 5GMKa 2B4VA 2V4JA 4ZVHA 1T03A 5DDRC 4IQXA 3R5BA 4MKBA 5HBMA 1VJWA 1UUJA 1CSJA 3HVRA 2P9GA 1RACB 3OLBA 2BE2A 1JLBB 2XMUA 2QFJA 1NZ8A 4C0HA 1N33J 1UFLA 1Y7PA 2MZSA 1X0FA 2LEPA 1KQFB 4C8MA 3KLFA 1GX5A 4D3GA 1JX4A 3IR7B 1YRUA 2RDIA 1T9VA 3G82A 1NPRA 2CQHA 1NSAA 3LAMA 2MQLA 4GO7X 3UE2A 2R7RA 1RWMB 3K8WA 2J7KA 2QL5B 4LF5F 1RHMB 4IOBA 3MR7A 2KB2A 3RUBL 3WDOA 5DQGA 4DFKA 4UOHA 1FJCA 4B9NA 2UXDJ 2VPWB 1FWLA 2D68A 4K4WA 2QYCA 4ZPWR 2AZ1A 3AJ1A 5IOLA 4DQSA 4H54A 4ZVSB 4DN0A 4ID8A 4DX8H 3VAKA 3VAJA 2XMKA 2QA4G 5F8IA 3H40A 4ED0A 3GYGA 2D3UA 3NS5A 4KHRA 3GFXA 4XPEA 1QTNB 3RGIA 4PWDA 4K50A 4UOFA 3KFWX 3SCLE 2F4VF 3R2CJ 4ICLB 2OUGA 1RGVA 3D3CJ 3IWLA 5KFCA 3LWLA 5KFWA 1YVFA 3CDAA 1IBLJ 3HHEA 4K2XA 5AE3A 4L74A 1EJ7L 4NMLA 1U1OA 4W90B 1MU2B 3G8TA 4C11B 3H59A 1CVJA 1TKXA 4B3TJ 4G3IA 1CJVB 3ZTSA 1UPPA 2NREA 1BQNB 1F9HA 2VG7A 5HP1A 2K06A 3G6ES 1KNZA 1TZ0A 1RCXB 3AOCA 1VQ5S 3C14B 1OY8A 2CPXA 2VUGA 1Q7YT 1SQFA 1R8AA 1RAIB 4DR5J 1K0TA 3M7VA 4DXLA 4C2MA 1XNRF 3ENVA 3MM9B 5GAGI 2RKIB 3UPFA 2C2OB 4FXVA 3HHLD 1XR7A 2BRLA 3CT9A 3PR4A 2R7TA 4OZJA 2GQQA 1KFDA 1YGYA 2VBZA 4TYAA 4U95A 4ZPDA 1N32J 1KQGB 1TK0A 1WNEA 2HEKA 3MAAA 2KKHA 2IA6A 1A6LA 5KAKA 1TAQA 3P5TL 1RHRB 2V68A 3KG0A 2VF3A 1VBZA 4Z37A 2AHOB 1HNWF 5DQIA 1MW7A 2BANB 3TI0A 4Y65A 1VQKS 2VG6A 3H5YA 4ZCLA 1UA1A 3LALA 2HIQA 2OEJA 4ZJLA 2H51B 3OUYB 3GE9A 4O3SA 2XB2D 4OX8A 4RW7B 1CQNA 4DCJB 4U6PA 3SI8A 3AT1B 2ZFHA 1SUQB 2Q79A 4QWDA 2CNKB 4FPRA 3IG1B 1TL1A 2HHXA 2EVZA 2FDNA 4DL5A 1KBRA 4LVNP 2IY5B 1S7IA 1JXVA 2QE5A 3MTJA 4F3OA 3E2EA 2NZ4A 2ADBA 2LVWA 1S1WB 5JMNA 4X66J 2KDOA 2HYIB 1PIEA 4CLYA 2RH3A 2XTDA 1XERA 2B3TB 2QLJB 2GIRA 3H2LA 4C6AA 3UN5A 2VIHA 3NRBA 3TEHB 1JJCB 2JX2A 2LXUA 3UN3A 2KM8B 3K5LA 2B0GA 3ONQA 3EVMA 1VMBA 5F3TA 2HWIA 1VQSA 4JI4J 2B7BB 2RAQA 4FYWB 1UL3A 2ZKUA 3CDBA 2FPHX 5D78A 1Z1ZA 3PYGA 4YDDB 2J0QD 4IRDA 1APSA 1MN9A 2WSFC 4RO0A 3ZTRA 1RWVB 5KFGA 2QIFA 1D09B 3TOQA 1DTTB 5D0GA 4YB5A 4F50A 1NKCA 1S79A 2PC6A 4IFYA 1UAWA 2ACMA 1T05B 2A2DA 5HQ8A 3T6BA 2KFNA 2WB4A 2RRAA 2I9SA 2HQIA 2Y8YA 2OD6A 2ASYA 2KG0A 3HSZA 3T1YJ 1HNZJ 2MQNA 4FF2A 5M2PA 2D9PA 3BR9A 2QA1A 2D3OR 4Y2CA 3EXYA 3AOBA 1MG7A 2OFHX 4E0DA 2WOMB 4OX6A 1B70B 5HLFB 3EZUA 1Z2LA 3Q8PB 2KTQA 2L41A 1KLMB 2G2ZA 2DO4A 3D4JA 3LANA 1KQKA 4DV7J 3N5BA 1JLEA 4L75A 4FBUA 2CQIA 2GAHC 4HH0A 2GHPA 5IQ6A 3RZAA 2BKPA 4F8RA 3EDQB 1CJTB 3Q2SC 3HPOA 2FLPA 4OI1A 1ZM2A 1Q16B 4X4SA 3QZ8A 3M30B 1XNRJ 1WSVA 1HR0J 1CJUB 1LXNA 2IC3B 4Z2XA 2M70A 4KH1B 4MJKA 1YKWA 4TU8A 5I3PA 1VHFA 2E5LF 2W7AA 2EFGA 2Z4PA 3B4MA 2FQQB 1R8CA 2HZAA 3B8HA 4P6QA 1X5SA 3H42A 3IGNA 5HATA 4BHQA 4CLWA 2ZEJA 5KT7A 4X4RA 2KJWA 2BE9B 4O23A 3THPA 3QT6A 2V4RA 2AW0A 2OAUA 5D15A 3IRXB 2PDAA 4NE9C 4UOCA 4X4QA 4F4XA 2XCAA 3HF5A 4EUVA 4ZLNA 1N56A 3W7BA 1NK0A 1HI8A 2PMWA 4X2BA 1MWZA 3H90A 2GIFA 1H2VZ 5DM6Q 3OR2B 2IRXA 4WCEQ 1X4DA 3FSIA 3TJ8A 4ED3A 1YG0A 5IM0B 5E3CA 3QSYB 3NXZA 1FNXH 1YJTA 3EGNA 3GZ7A 2FC9A 1KN6A 3BYRA 2AGOA 3CW2C 3LP1A 1R0AA 4DV0J 2VASA 4ES1A 1SB6A 3JSRA 4DV6F 2M8DB 4G1PA 4Y2IA 4C0BA 5DDPC 4E8UA 3QT8A 3TA2A 4ZPAA 4DR7F 3DLEB 1HBOA 5EUHA 4GVBB 4UQTA 2FY1A 3TO8A 5FLXY 4QIEA 1N0UA 4L6V3 4NA2A 1XQIA 4ZVTB 3HCXA 3VZIA 5IQQA 3HO1A 1HW8A 2ZBQA 2OLWA 3M8PA 2HLUA 3UDCA 4CH1A 3LQVA 4Q8EA 5JVGQ 1TL1B 4OI0A 2AEJA 2UUCF 1JLGA 1UWAA 2ATLA 3T5LA 3OHAA 1X4CA 1H2TZ 2HFUA 1RTIB 2DH7A 4IFYB 3U1NA 2VBWA 2LMIA 1WF2A 1S99A 1WG4A 2HHPA 4CDIA 4ECQA 1KSPA 4IRKA 2P9CA 2X1AA 1HQ2A 2GJIA 5GADU 5D0EA 4KO0B 2HW3A 1D9AA 2RF2B 1LNQA 4PG6A 1TQLA 1IJFB 3CJ5A 3OFEA 2DKOB 4O0NA 5I3UA 3I0RA 2ZH8A 4BS2A 4HKQA 2H1YA 5I42B 2DNLA 4CT9A 4NLQA 2AMCB 4F0KA 2MZJA 4J9SA 2IBKA 2B5JB 4YFUA 1QAYA 3CDUA 1Y3JA 1EQ0A 4A8WA 5IT0A 1QLNA 4HTJA 4NXMF 4AXJA 2CQ0A 3EICA 2RU3A 2XO7A 1X9WA 4AL5A 2GMJA 1JXEA 2V4JB 3I87A 1T03B 4I2QA 3WC2A 2GX8A 3GJSB 2FYXA 4USVA 4NZ0A 3ETOA 3PY8A 4HHHA 4FPIA 4DMZA 1RTIA 1YTYA 5J1EA 1IBKF 1U4BA 3ENQA 3PYFA 3UFCX 2XNQA 4ZVFA 2YQ3A 4GC6A 1VQLS 1S49A 2E44A 4Z7YA 1YDLA 3UNGC 2B4UA 3PZPA 3MR6A 3FEXB 2JWNA 3PO5A 3QRQA 3KLHA 2X3GA 2ZVIA 5IXUA 2O1PA 3IR6B 3SEOA 4F02A 4IO9Q 1F3VA 4DV2J 2WW4A 4JV5F 3OD2A 3A3NB 2K8GA 2IIHA 2DRDA 2GVZA 4OI6A 3BS9A 3HHDA 3MGJA 3VTIA 3ZFVA 4HYKA 4F4KA 4K4XA 2RB7A 3MM5A 4RW4A 5KFEA 4F2SA 3KHLA 4QZVB 4N47A 3UR0A 1XC9A 4FF4A 2C3YA 1UWBA 1CC8A 2KN4A 1QY7A 2MSSA 2U2FA 2VPXB 2ZOFA 3F41A 3GJTB 2PEHA 3OTDA 1NLKL 4I6AA 4XIUA 1C1CA 2HQ3A 5IM0A 1K44A 3BO3A 3MEEA 3KLEB 1XNQJ 2C1EB 3TQEA 1S9GA 4Y3CA 3C14A 1N5QA 3Q8YA 3CCES 2FJVA 4NLGA 4LRDA 3OJUA 2VODA 3A12A 5J2PB 4J9QA 4C48A 1TKZB 1RHUB 3F56A 1ZOTA 4HH1A 2ZH3A 4RX6A 3A1YG 2JVOA 1LW0B 2HS3A 2I38A 4XAKA 3IFEA 1RT5B 1LW2B 2R8JA 2YNHA 1HBNA 3T9ZA 2QSFA 4LF5J 4I1TA 4JP8A 3KTQA 2ZC4A 4FYDA 2BV3A 4P2XA 4G1IA 4HDHA 4LR8A 3UDLA 1VHIA 3OL6A 2DGUA 3PFOA 2O66A 3PHEA 5CYMA 1JXLA 2XQCA 2DNZA 2XGPA 2CQDA 1M90T 3PX6A 3GIIA 2B9EA 3V4IA 1FKOB 1WDTA 2E5HA 1GFWB 5E5NA 1YBUA 2POKA 1EP4A 3BQ1A 2G1HA 1K73T 2HGLA 5T7LB 1X60A 2GA7A 8ATCB 2IPOB 2FHKA 2YQ0A 5L46A 2CJBA 1VOMA 3HJVA 1JJHA 4JV1A 2RUSA 1U02A 4HL9A 1KLMA 4K4VA 1XR6A 5DGBA 1JMTA 2OFGX 3QFHA 4UTGA 2AD9A 4FZVA 3CCMS 1FTCA 2IRUA 4PYAA 1YZ6A 3D68A 3EGVA 3P3DA 1KVIA 4LF1A 2LU1A 4RUHA 1W2IA 1QDUB 3BREA 2RS2A 1RK8A 4C4WA 1NH8A 1BMQB 1C4AA 3WIUA 4FXDA 2UXCJ 1DQ8A 4I69A 2GQCA 3LH2S 5HANA 4BC9A 2A6MA 3FCWA 1SC3B 1OPZA 1YLXA 3CO9A 3R2DJ 2LXIA 1D0EA 1RTDA 1RADB 3MMAB 4HI2A 4X4VA 2V63A 1VLYA 3GPAA 1R0CB 1ZPWX 5IC4B 4YHHJ 3QPIA 4LF6F 4ED4A 4UT4A 3CJ3A 4CWBA 5D4OA 1MWQA 3MAHA 4LQ3A 2MPUA 3VAGA 3ZXWA 1U1PA 2FHJD 2QMWA 4DSEA 1HD0A 3DMJA 4C8ZA 3BGRA 3P4UB 2BR0A 1FRMA 3IRXA 4LF4F 3K5PA 4WFBQ 4O3RA 4X4PA 1VQYA 1HPZB 4JV0A 2FHJA 3TZZA 3CJSA 1U7LA 3PCOB 4RR5A 3KK3A 5KG0A 1Q8KA 1NMEB 2CQCA 2H4WB 2VPZB 4O44A 3KUHA 5I3QA 3I5CA 2AV5A 1WC5A 1YK9A 2KT2A 1H0HB 3QAUA 5BYQA 3MDFA 2N3OA 1H73A 3RBEA 3D67A 5E0OA 2L48A 2DY9A 2ADCA 3KYLA 1GX6A 3R97A 3RBZA 5H9FK 3TUJC 4C3KA 2W01A 3FFIA 1XNQF 4AXIA 5B7WA 2V8VA 1HMVA 4OZLA 3V5RA 4RZRA 3ZZUA 2BJDA 3L9ZA 1FKOA 5F9NA 4IR9A 1NK5A 3M1VB 1EARA 2F5GA 5KFQA 2AGQA 3AA9A 2CVIA 2A3JA 4YB1P 1FRIA 3V81B 1K47A 4RJVA 1VS3A 4EI2A 1C0TA 5KT3A 2XS2A 3IBCB 4KFBB 1GEHA 4EO8A 4S0MA 4ANEA 5C5JA 5A8WB 4JBCA 1LW2A 3TA0A 2KFZA 1HHTP 4DV3J 3DRXA 3DC2A 3SCKE 2VC1A 1U09A 1FTRA 1T9WA 2DHGA 2AWZA 2QGFB 2BKOA 3MMCB 3OTEA 1Z2ZA 3AXMA 4RL1A 3TR5A 4H4KC 4CO4A 4CT8A 3ZTQA 5C2CA 4DUZF 5EGYA 1YBAA 2P8IA 4NCAA 4YDXA 1IVZA 2OIHA 2VQEJ 2DHSA 3SSRA 3ZNUA 4WKRA 1H6KX 2WVDA 2CQ2A 2MY7A 1TUVA 2LQ9A 2Z56B 4U9RA 2CJ9A 3S1TA 3KG1A 3CWJA 3EVWA 3QMQA 5KT5A 1S5ZA 1N33F 1VIOA 1SQGA 1QSLA 1C4CA 3SSQA 3PNIA 2VBYA 4DQPA 2VJVA 2GHWA 4MK9A 2QZ8A 3UD5A 1ZZNA 2R7UA 1PG5B 2CJXB 3FMBA 2Y0SD 3HVAA 1NDPA 3MAAB 3RB4A 3CB4A 2DITA 1PBAA 4WIQA 3QO9B 4OYOA 1VQNS 4UQGA 4USHA 2ZKTA 3PW0A 2LQBA 2XHCA 4ZA1A 4DJBA 3GIKA 1TVRA 1YJUA 2BJ8A 2IAJB 2OPRB 4W4MA 4DX7A 3Q22A 4ETXA 5BJRA 4Y34A 1FK9A 1T94A 3MHYA 1H7WA 3NOCA 3R5GA 1S6QB 2L9WA 1NAQA 3SDEB 3QAEA 5DGAA 4JI4F 3QGIA 4B3RF 4GMKA 3Q8VA 1N34J 3W60A 2IYIA 2LKZA 3FRZA 4J9VA 3Q23A 2DIVA 4C98A 2EG2A 1ACMB 1IQZA 1NPKA 1U24A 4MT1A 3KMSA 2JEFA 1T11A 1RISA 4DV4F 4LF4J 3T5JA 5K8PA 4IUFA 2AX0A 4YP3A 3MTKA 2E66A 4NL5A 4DPOA 4C8LA 5D6GA 3HHNB 4W92B 1T9XA 3KLFB 1R7IA 1U25A 4F0HA 5F9LA 3I0RB 4F4YA 2D1CA 4OZ1A 1UA0A 3O5TB 3MPWA 5G0RB 3OR1B 4EO6A 3MURP 1PAUB 1JKHB 1NU4A 3AHPA 1UJ5A 2H3EB 4RBUA 3LOUA 4TLRA 1UFWA 3BKTA 1Q53A 1S0MA 1Y10A 2WTFA 4Y2AA 3P96A 4B9MA 3KWMA 1NSKL 2BQ3A 1IKWA 2BJ7A 2EKYA 4JI5F 4OHYA 1HNZF 5KFJA 4USMA 2C3PA 4X64F 4ED5A 3KK1B 1F5AA 2DEJA 2Y1RI 4JYAF 2HHTA 4A8FA 3K0JA 1ZYQA 4LFCJ 1BQNA 4J9LA 4E98A 3NOGA 4DG1B 4N76A 3H4BA 2NLWA 4K0KJ 2ROGA 2P6TA 2CZVC 3TZWA 1WF0A 2FIUA 4QQBA 3EPIA 1FE0A 2RILA 3LP0B 2D41A 3UDEA 2CWKA 3MR5A 3VAFA 4DR1F 3UD3P 3OXGA 4C7QA 5KFBA 3MEDB 4Q5VA 4B3MF 3NAIA 1KFSA 4I67A 2YKMB 4KYZA 4L76A 2KG1A 1U6ZA 4K5SA 4RU9A 1HBUA 2V0NA 1SV5A 1VRTA 4DDFA 3UVJA 5T14A 1RI7A 3GIJA 3OL9A 3RRGA 5KG5A 1AB8A 2DGOA 1FWKA 2DO0A 2HNYA 1HMVB 3TAMB 5IV4A 2DVIA 4CO0A 3HVTB 4RW6A 2IVFB 2XMJA 1VC0A 1J5EF 3OTCA 3M9NB 1WWHA 4WZMA 3NGUA 3QIPB 3WZ0A 1S6PB 4CH0S 3HI9A 4E2FB 4WU3A 2F7VA 2UUWA 1RU1A 1IBMF 2RUGA 3T41A 3CCQS 3NWRA 3G87A 2BZ2A 4ZP6A 4ZN3A 2ZUAA 2ZNYA 4X84A 1LFWA 2DR5A 5ETNA 1GTHA 3K58A 2CQBA 4IQMA 4C8OA 1CJKB 2NXCA 2ZZMA 2QA2A 3HKWA 4UY8T 2MJNA 1PJ6A 4RNMA 4OV1A 4DS5A 2XEXA 3NG8A 3TX8A 3T1HJ 2Y1IA 5ETPA 4WFYA 3R5DA 4ZN1A 2ALZA 4WE1B 1IJEB 3MUVP 1U47A 3BSNA 4WFZA 2UU9F 2FC8A 2DGSA 3H5SA 4B9VA 3X1LB 2CJAA 3UWTA 2CQPA 2UUBF 1RZMA 1FXRA 2DNKA 1Y0HA 3HLUA 1H3DA 2FY8A 3N6LA 3DLGA 3HHLA 4O3NA 2CJKA 3GONA 4CLUA 4LBHA 2K7KA 4KSEB 2VFRA 2UUAF 2C2ZB 4NCGA 3W2WB 2EFOA 3W2VB 2J9DA 1S1XB 2WOMA 2E9ZA 2WVBA 5HLFA 1O51A 3FEZA 1N5YA 4YUDA 1SH2A 2CKWA 3S01A 4ZLPA 3SZ2A 3RB6A 1HD1A 4PWUA 3POTB 2JZ5A 3RW7A 1YSJA 2ZD1A 3DOKA 2V67A 4DV1F 1KVKA 3M9OB 1REGX 1ZZFA 2KXNB 1GXLA 2VU5A 1WDDA 3DOMA 5ITHA 1DARA 4MIAA 2FLLA 2NXUA 3BH7B 4DR2J 2CRLA 1RSCA 2WVFA 3IMQJ 4WWSA 1NJIT 4WTYA 3TVYA 2VG7B 1WKLA 3GFHA 3FVYA 5IWAJ 4XTTA 3ET6A 3RG6A 2C2KB 4TQSA 3JSMA 5LMUF 3HFZB 4DUYF 2X1GA 1WC6A 2LA6A 4QYZK 3TEGA 4I2PB 4DSJA 1UZHA 3OFFA 5GAEI 2IVMA 1KQSR 3KHHA 2V1TA 1RLDA 3OJSA 2VBXA 3KKFA 1X5TA 1HR0F 3W3SA 3HMJG 2FJBB 4C97A 2MZ1A 2DH9A 1JJ2R 2R7XA 5KT2A 2ZJRQ 1VBXA 4RUBA 1LV5A 5FD1A 1KR4A 2ASDA 1AZSB 2U1AA 5KFKA 3TYTA 3CIMA 1F60B 4DV2F 1DTQB 1JLQA 2GHVC 4O4GA 2QYGA 5D4NA 4JV5J 4IDKA 2MMYA 4YR2A 4WP3A 2YWWA 4RNHA 5C25B 1EQMA 5SZTA 2NQPA 3C6TB 2Q66A 5ADZA 2XSFA 2BANA 4K59A 1UVMA 4DR7J 2HURA 2C2MB 4JI7J 1FEHA 3B6BA 1HNVB 3PJWA 1RWOB 2GW8A 3RW6A 4CI0B 3NY0A 3AQPA 4K4TA 2KVIA 3MXHP 1EETA 2CPZA 2ZVSA 2DHXA 3OTBA 1FT8A 4ZITA 2MGZA 1OPIA 2D69A 1S48A 3CD5A 2DXDA 4ZOSA 7FDRA 4KV8A 4HR2A 3MM8B 3D6TB 3SIPB 3MAQA 3Q8SB 2M5YA 2GNKA 3IS9A 2E9TA 1RKIA 3IBWA 1DQAA 4F4WA 4M95A 2OSRA 1V3RA 4OI2A 3ADAC 5BR8F 4YR3A 4MTPA 1CS4B 2VDIA 2BOPA 1FO1A 3AAWB 1IXKA 5HN0A 4DFJA 3J7YU 1MROA 3GSDA 1GNKA 3GILA 2YKNB 2W8LA 3DLBA 2FJAB 4DEZA 4GKKJ 5D0RA 4OYPA 2CVEA 1T02A 3BDEA 2H5IB 3G2XA 3J7Z5 3D6MB 2IYGA 4LR9A 1YJ7A 4KHPF 1EB0A 1N52B 5ETLA 1K8AT 3IC1A 4DR4F 2GFFA 1WD6A 3CSKA 2HAFA 4ANDA 4QWEA 2RRBA 2I6WA 3DLKA 3DN9A 3BN7A 3VV2B 3AB2B 1OQ6A 3T1YF 2J9EA 2VOOA 4HVZA 2DHAA 5E33A 1NH7A 2F40A 4KO0A 1KEKA 1BQXA 4H4OA 4Y0FA 4MKVA 2HG4A 3D5MA 2DPJA 4IG3A 3OPKA 1HHQA 3M6VA 4JOUA 3CCWA 4EZ9A 1FF2A 1WOSA 1UEUA 1S0VA 3ITHA 3KK2B 5C25A 4ZVGA 1OMSA 3B82A 5LXRA 1YX2A 3PTWA 4OHWA 2ILYA 2DNRA 1N54B 1O6XA 2NXJA 2YTCA 2LP4A 3MF5A 3MM7A 4GRSA 4ATNA 4BDPA 2XMWA 4LT6A 5KG3A 2Z30B 3QJLA 4KHPJ 4CZCA 3JTPA 3BBCA 4ED1A 2VKRA 3HT3A 1HNXF 1TAUA 1S9EB 4Q0BA 1X7VA 1UW4A 2B5JA 3EJMA 2QLWA 2K2PA 2EK1A 2W2NP 3EZOA 4H4MA 3AXKA 2C3OA 4MYTA 4ECWA 2OTLS 4EBCA 2DGTA 4ZPVR 4YQWA 3NL0A 2HRUA 3KJQB 1QE1A 4DQIA 5T41A 1FFSB 1HNVA 3ISNC 1VIXA 5A0YB 4YHHF 1YHQS 4DF4A 1MWYA 3KUGA 4M5MA 2MLXA 2LU2A 1N5TA 2W4PA 3R8YA 3ZTPA 3SFGA 2HVZA 5J2NA 4JI1J 1EAYC 1O8BA 4ED2A 3LGNA 2DXEA 5D8HB 1R8BA 2KFYA 3H0PA 4G1QA 3IR5B 2GC8A 1N8RT 3PRDA 3IWXA 5L9XA 1RTJB 1Q86T 3ICLA 3LA0A 1RUSA 2ZH9A 1NO8A 1UZDA 2GIQA 1QTMA 5HO4A 3NNCA 4ID5B 4EU0A 4O44B 1BD6A 2LA4A 1K0VA 1U1RA 2YKOA 4CO3A 2BE7D 4IOAQ 4ED6A 5B0BA 1YITS 4GVBA 3AJDA 3VALA 1RLCL 4MFBB 2A1BA 5GADI 4A8QA 5CXTA 2Q43A 3CJRA 1Q82T 1IQTA 4OZNA 1IN0A 1T3OA 1KRPA 3H20A 5BR8J 5DG7A 4YY3J 3OSNA 2M9KA 4FKYA 2UP1A 4MMOA 1P1LA 3D0GE 1GXTA 2IM1A 1BUXA 2PIIA 2RQ4A 2R8HA 1A0OB 4M5LA 3RR8A 2DTJA 2BBEA 4ES3A 4DQRA 2DJWA 3GR1A 2XZTB 4TKTA 2UUCJ 4FF1A 4KGXB 1NNDA 2AYEA 3J81Y 3H5UA 2LQJA 4AL6A 3QT5A 3MEGB 4ED7A 4DL2A 4OMFG 2CNLB 3NLCA 2C2DA 2J6SA 3PW4A 3R1HA 1B7FA 2QLXA 2HZVA 3I31A 4PG7A 1LWCA 4KTQA 2YQ1A 3GCWP 1J2VA 1WUUA 3NS7B 2RQMA 1BLUA 3I96A 4WU2A 1UVKA 4ECUA 1QAJA 4MAKA 2UUTA 1VDHA 2F9JA 2EWHA 4RW9A 4WK1A 3DLJA 1IM6A 2MGZB 2E5LJ 3OSPA 2OKQA 1HWUA 1XMOF 3W8PA 4CO1A 3L09A 5IS2A 1D9FA 2VONA 1FRXA 3BGRB 3CGIA 4WFAQ 2FJXA 3BGFA 2NPFA 1TTHB 4P10A 3KLVA 1CBKA 3GLJA 4DQQA 1FNOA 1S1UA 3CO0P 1AXQA 3DLGB 5THWA 4WKYA 1RT6B 4YS2A 4WPAA 1YRXA 2QJ3A 2QSWA 5E3RA 3IAM9 4ZCMA 1VQ9S 1B0PA 3AWRA 1TUWA 2KHCA 4P74A 5A2QY 1VQ7S 3A3PB 1VC5A 1WHWA 3GYNA 4LFBJ 1QE1B 3NMRA 3DGVA 1MMNA 1SC1B 1FWPA 1V9OA 1WORA 3ISND 2XULA 5DS7A 2F1FA 5E3AA 4EK2A 4EYHB 2XZ2A 4AL7A 3R6GB 1N34F 3IA0A 4L3KA 5AE2A 2CYYA 4PCQA 2W9BA 5K8MA 1H98A 2HVHA 4NLPA 1H7XA 1SBRA 1GMWD 1RXOB 1SJRA 3W2VA 2I5JA 3V6HA 1Y3KA 2Z2YB 4DPUA 3I56S 2HHUA 5D3GB 4MKAA 3KNAA 2X3DA 5CQGA 1QAIA 4KFBA 4NZ6A 3DYAB 3I4PA 2ZBCA 3PYDA 4EMDA 2MKJA 4NASA 2D7SA 1PCAA 2FZKB 3IG1A 4A48A 3CCZA 3TUPA 3H98A 2ROPA 1SJ1A
chains in the Genus database with same CATH topology
2OPSB 2G0CA 2YWHA 4QU6A 1RYSA 4JI0F 4FN5A 5KFRA 4EBDA 2BYCA 4DV3F 2J6TA 2M88A 2EPIA 2VL1A 3GR0A 3E3XA 1ZPVA 2WSCC 4O3QA 2KJVA 3H5XA 1Q8BA 1S9EA 5CZXA 4ID5A 4LFCF 4DLEA 1SI9A 4QPTA 2M2BA 4NA3A 2RQKA 1S10A 3E01B 4Y00A 3N4WA 3BQ0A 1VQ8S 3U7JA 2MYFA 2AF6A 2YWEA 3BF4A 3MEEB 3KLEA 3J7ZT 2KYZA 4MK8A 1IKXA 1OSCA 1N5SA 2OPRA 2PT0A 2BVZA 3N5FA 1QAXA 5J1NA 1E6YB 2HFOA 1KC8T 3DU6A 2DNGA 1Y00A 4GC7A 2C28A 5CCLA 3OFGA 1N36F 2K7JA 4C8YA 2MZQA 1X4HA 2DCLA 2UV8A 3M05A 3UQSA 3PW7A 3M2RA 3PR5B 4KHMA 4ELUA 4ALZA 4PQAA 1HQUA 1SJ3P 6FD1A 1ZH5A 4BWJA 2YKNA 2AP6A 3K2YA 4AE5A 4ZPBA 3M8QA 1SJQA 2JRSA 2GCFA 2OPSA 4TY8A 1UVJA 3K5OA 3OVSA 5J2QA 3NAHA 2P9EA 3KHRA 4N77A 2BRKA 2E5GA 1UETA 4H4KA 2F8MA 2QO3A 2BQUA 1KHVA 1X4AA 3DLKB 3D0HE 5B0EA 4B08A 1U45A 5AXKA 4IKAA 3TAPA 1BY9A 3OVAA 2ZHBA 1LW0A 3G71S 4PRFA 4RUAA 5H1SV 2M52A 1GH8A 3VQSA 2DNPA 2HZCA 3SSSA 5E7OB 3M6UA 1ELOA 3M8RA 3KK1A 2RMLA 2MQPA 4TNOA 4C8KA 5IT4A 5D4PA 1NJWA 2JDJA 4K0KF 2WSEC 3NKYA 1HA1A 3PEHA 2IA0A 3CCVS 3H2VE 3JSBA 4N8OA 2PO4A 2WONB 4IRCA 1YWXA 3G6XA 2WK4A 2EK6A 3KG4A 2N7YA 1UVNA 3CULA 1TKTB 1FDAA 2MHEA 2M4MA 2XG8A 4F67A 1HPZA 3PW5A 1C2PA 3SQGB 1F0XA 2MKHA 4OJ3A 1WHVA 4ZPCA 1HNIB 4N5SA 5K14A 1FVSA 3M30A 5KG7A 4EZ6A 4B3SF 1O5JA 5DQHA 2HHQA 2LEAA 2KI2A 3PEJA 3C66A 4PQUB 3CCLS 2ZE2A 1RTDB 3EX7B 3SV3A 1KD1T 1TK8A 5CYQA 3MFHA 4NWBA 3SXLA 1RT4B 1Q78A 1BC6A 4DR3F 2A10A 2HWHA 2YX1A 3MPVA 2V4QA 1U1LA 3J7YI 2KT3A 3POTA 1S77D 4FBTA 1ZM4A 1F5BA 5A8WA 1TL4A 2D74B 3I5AA 2YH1A 1LWFB 4XDDA 4OZ5A 2UVWA 4ITSA 1S1XA 5L39A 3BJYA 3RTVA 7FD1A 1QVFR 4DBQA 3V81A 2DGQA 3HHKA 2EBEA 3D54A 3LW5C 1LQ9A 4PUOA 5K8OA 2CQ1A 2HNYB 3KNGA 3VWSA 4L72B 3CCSS 5HROA 3ZZOA 3FQLA 1SXLA 1SJFA 3Q8RB 2XS5A 3G86A 1U2FA 2VOPA 2UXBF 4OL8A 3GG1A 1P9QC 2CPYA 4A8YA 3G8SA 1SH0A 3RB3A 3LP2A 5U47A 1LK7A 3PJXA 4OJ1A 4ILLA 4QYZJ 1N5YB 1SKRA 4O4RA 2W9CA 1VK8A 2DNMA 4DN9A 1ZBTA 2W9BB 4WF9Q 3FGVA 3QGGA 3ULHA 1FA0A 4DSKA 3ZZRA 1SIWB 3DI6A