2IM2A

Crystal structure of poliovirus polymerase complexed with utp and mg2+
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
461
structure length
457
Chain Sequence
b'GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords poliovirus polymerase
publication title Stabilization of Poliovirus Polymerase by NTP Binding and Fingers-Thumb Interactions.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
total genus 138
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 2im2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2im2A02
3M9OB 3MR2A 1SH0A 5J2PA 1TVRB 4PQUB 5CYQA 3Q8PB 1RT4B 5F8MA 3CDWA 4NLUA 1RTJA 5HBMB 1HQUB 2WTFA 1IKVA 1MU2B 3M9MB 4ED0A 4M94A 4RZRA 3OLAA 4YR3A 5J2NA 3MEGA 3LP0B 4IR1A 2HNDB 5L1KA 1DTQA 5KFFA 4R5PB 2B43A 3V6DB 4RUCA 1QAJA 4ZP9A 4FBTA 3UPFA 1IKXA 4K4XA 4F4XA 4QW9A 4IH7A 4ED6A 3KHGA 4ECSA 2VA2A 1HPZB 3E01A 3MEEA 1TV6B 5L1LA 4NLRA 3DLKB 5KFSA 4RW6A 5DGAA 2VG6A 3H98A 5C25B 4M95A 1XR7A 2YNHB 4LSLA 1LWEB 2C2DA 1ZETA 1ZTWA 1N4LA 2JEJA 3QGIA 2RKIA 2UVVA 4I7FB 1QAIA 4R8UB 2YNFB 3H59A 4RUAA 3DOKB 3LALA 2FVSA 2VG7B 4MIBA 4TYAA 4ZPBA 2JC0A 4MFBB 4I2QB 3KK1B 2DPJA 4B3OA 1HQEA 4RW4B 4K4SA 4ID5A 5KT3A 4NRUA 5KFGA 4IDKB 3V6KA 1HNVB 4O3QA 5C5JA 4JUZA 3IS9A 3DLEB 2QE5A 3ISND 4IQXA 2D41A 5EWFA 1S6PA 3BSCA 4WXOA 5DGBA 4ZPAA 3OL8A 4KV8A 1LWCA 5HP1A 4K4WA 3CDUA 3KNAA 3BGRA 1RT5A 1DLOA 2J6TA 1IKWA 4NLXA 1JKHB 4ED7A 3BQ1A 1TL3A 2OPSB 3M8PB 1REVA 4ZPCA 2ILYA 4KO0A 3NAHA 2VG5B 1JLBB 2ZD1A 1JLQB 4K4YA 4KFBA 3RB0A 2IC3A 4ZP8A 3PHEA 3HVTA 3KHRA 5CYMA 1HMVA 5DQIA 3MFHA 3RB4A 1QE1B 5T14A 4RW7A 4Q8EA 1C0UB 3KLFB 1LW2B 4HYKA 3PW0A 4FBUA 4G3IA 1SUQB 2HNDA 1S1UB 1YVFA 3DRSA 2UUWA 4Q45A 2YNGA 2XI3A 1VRTA 1JLGB 3V6DA 4WE1B 3RAQA 2R8JA 3FDSA 4RNHA 3VQSA 4PUOA 4K4UA 2B5JB 4RNOA 5F8NA 3M9NB 2WOMA 2IBKA 4MKAA 3HHKA 2C28A 1VRUB 3DI6A 5KFKA 3JYTA 1HPZA 2FLNA 5J2PB 3EPGA 5J2QB 4PWDB 5L1JA 5CYQB 4ED8A 4EBDA 3CIZA 1RTJB 2YNHA 1IKVB 4ZVEA 2HNZB 3LAMA 4JV0A 2C2RA 2RDIA 4I7FA 1HYSA 1RT3A 2WHOA 4RNFA 2YNFA 2ZE2A 3GIMA 3MEGB 2VG7A 4K4VA 1TKXA 2BQUA 1DTQB 5DLFA 3OHBA 5KFWA 3UDLA 3QGGA 2HWHA 4RW4A 3PW2A 1JIHA 1IKXB 3EPIA 2JEFA 2FVPA 3KMSA 3DLEA 4RNNA 2BANA 2WONA 4NLTA 3LP2A 4ECVA 3GIKA 3E01B 4MKBA 3MEEB 5HROA 3V6HA 4RW6B 2VG6B 5KG5A 4DL6A 1TP7A 4LSLB 4GC6A 3GYNA 2D3ZA 4O3PA 2RKIB 5KFPA 4KKOA 3Q8SB 2OPSA 2VA3A 4KBIA 5KFVA 1KLMA 3CDEA 3Q8QB 2OH2A 2QV6A 2UVRA 2HAIA 4K4TA 2IAJA 3TAMA 4B3OB 4KHMA 5KT4A 5F8IA 1HQEB 4DL7A 3SFGA 4NRTA 4ID5B 2BRLA 4WFXA 2R8KA 1T94A 2BE2B 3LAKA 1LW2A 2FVRA 2E9ZA 3OL7A 1C1BA 1S48A 4MIAA 1S1UA 3MECA 3BR9A 1BQMB 1S6PB 4IH6A 5JXSA 1JLGA 1S4FA 4KV8B 4WE1A 1LWCB 5DG8A 4TXSA 4KAIA 5HP1B 3HVWA 1IKYA 1RT5B 1DLOB 3GIIA 3MF5A 1IKWB 3KHHA 3CVKA 4J9NA 3T5KA 2R8HA 1HNIB 2R2RA 1TKTA 4NLGA 1TL3B 4PWDA 5J2QA 1W25A 5EWGA 1REVB 3GILA 4F4WA 4KO0B 2ZD1B 4KFBB 5FDLA 3H5YA 2V9WA 2IC3B 2W8LA 3HVTB 1SV5A 5CYMB 2HNZA 3OL6A 5KFQA 1HMVB 4LSNA 4RW7B 3BJYA 3H40A 2JC1A 5DG9A 2IM0A 4KB7A 3IGVA 2JLEA 1EETA 3DYAB 4G1QA 3DRSB 4Q0BA 3KK3A 2AGQA 4HKQA 2YNGB 1VRTB 3NGDA 4J9KA 4U7CA 4DG1A 3IG1B 3QO9A 5KT5A 4PUOB 3G6XA 3ITHA 2XGPA 2WOMB 3G6VA 3PW5A 2ATLA 2RDJA 2UVUA 1TL1A 2ASJA 3DI6B 3JYTB 4EBEA 4NLOA 3BSOA 2R2TA 3MTKA 4TYBA 4QWAA 4WZMA 3I0RA 5KFLA 1HYSB 4ED1A 2CJQA 1RT3B 2BR0A 1SH2A 5F8HA 2ZE2B 2ZKUA 3FRZA 2V4RA 5J2MA 1J5OA 4MK8A 5EUHA 2J6SA 2R8GA 3H2LA 2D3UA 4QWDA 1TKXB 2BQ3A 3QGHA 1S1TB 2XGQA 2WCXA 4J9LA 1RTDA 5KFDA 2BE2A 4NCGA 3C6TA 4MK7A 1IM4A 1S9EA 4I2PA 2BANB 2WONB 3LP2B 1N5YA 1BQMA 5HROB 1FKPA 5KG6A 2UUTA 1TKZA 4FS2A 5I3UA 4O4GB 4FS1A 3GQCA 2R2SA 3PR4A 1RYSA 3HKWA 4IG3A 5C42A 4K50A 4TN2A 1HNIA 4KKOB 5F8LA 5KG3A 2XC9A 4MH8A 2UVWA 4KE5A 4J9RA 2AQ4A 1R0AA 1KLMB 4NLYA 3QZ7A 2IAJB 1S10A 3I5BA 4YP3A 3TAMB 3JSMB 3V6JA 5KFZA 4TLRA 2W9BA 5D3GA 2IJFA 2V4QA 1T05A 2HWIA 3BSAA 1C1BB 3DYAA 5KFTA 3KLGA 1S0MA 3QIPA 3OLBA 1T03B 3MECB 4YQWA 3SI8A 3KLEA 1JLEA 3PW4A 2I5JA 3H5UA 3IG1A 2W9CA 1IKYB 2GC8A 1S9FA 1RT6A 3FQLA 5KFJA 1S1WA 5K14A 4WFYA 5KFYA 4YMEA 1S0OA 1JXLA 1TKTB 2I1RA 2OPRA 1SH3A 4O3NA 3C6UB 1JLFA 5FDLB 5C24A 4R0EA 5KFIA 3OSNA 2XCAA 1SV5B 4ZVHA 4ECXA 1UWBA 4TQSA 3LANA 4GC7A 4LSNB 1C1CA 3IGNA 1EETB 3I5CA 4G1QB 4Q0BB 1S1TA 3KK3B 4YR0A 3TQ1A 4DG1B 1KHWA 4ZHRA 3QO9B 3RB6A 4NLDA 1ZTTA 2AX1A 3IN5A 4ED2A 3ITHB 2FLLA 2CKWA 4EYIB 5DLGA 3IRXA 3I5AA 4H4OA 1TL1B 4NLSA 3SFUA 4TY8A 3OHAA 2FVCA 4Y2AA 1KHVA 2XWYA 3GIJA 3NL0A 1EP4A 4O4GA 3MEDA 3I0RB 2ASDA 2IM1A 4NLQA 4URQU 5I42A 2YKNA 4IG0B 3DOLA 4ZVGA 3FFIB 4O44A 5J2MB 5KFEA 1J5OB 4J9PA 2OPPB 3V4IA 2F8EX 2OPQB 3GV5B 3MFIA 3JSMA 4EYHB 4JV2A 5F8GA 4ZVFA 4ZMMA 3RAXA 1RTDB 3BSNA 1RTIA 4EO8A 4NCGB 4ICLB 3C6TB 1S1VA 2ILZA 3DMJA 1S9EB 4I2PB 4O3SA 4RW8B 3QZ8A 4ECTA 1T03A 1N5YB 2HNYA 3HVAA 3G86A 1FKPB 5JUMA 4Y3CA 1TKZB 4IR9A 3TVKA 5I3UB 1JX4A 3LP1A 2FVQA 4RW9A 1T3NA 4ECYA 2IMWP 1RT7A 2AX0A 3D5MA 3DRRA 4H54A 4IG3B 4ECUA 2R8IA 4O4RA 5C42B 3DLGA 3RBDA 4H4MA 5KFMA 5F8JA 2GIRA 4F50A 5KFOA 3PJWA 3C6UA 1R0AB 2XI2A 1C2PA 2JEGA 4DL3A 4O3RA 2YNIB 4IRKA 4IFVA 3GV8B 3KK2A 2IM2A 4ED3A 1XR6A 2YKMA 2W9BB 5D3GB 1LW0B 2C2EA 2HMIA 3KHLA 3I0SA 4XPCA 1BQNA 1CSJA 3T5JA 1T05B 1RDRA 3E51A 3KLHA 5HLFA 3KLGB 3QIPB 4WYWA 4KHRA 3KLEB 1JLEB 5J1EA 2I5JB 2W9CB 2RF2A 1RT6B 5KFAA 5DQHA 1S1WB 5K14B 3PW7A 2XCPA 2OPRB 1N6QB 4IFYA 1RYRA 1S6QB 1RT1A 1JLFB 3T5LA 4ZP7A 3KOAA 5C24B 2J6UA 5KG0A 4F4ZA 1UWBB 3H4DA 4IG0A 1D0EA 4QWCA 3FSIA 3KJVA 5EDWA 1C1CB 3FFIA 4RNMA 2W7OA 4F4YA 5L1IA 2IM3A 2OPPA 3NBPA 1XR5A 1I6JA 2WRMA 2FJWA 1LWFA 2OPQA 3QIDA 3KLVA 5KG7A 5KFCA 3M8QA 4ECZA 3DDKA 4ZHRB 2AWZA 1Z4UA 4IKAA 1WNEA 4IH5A 2ASLA 1S1XB 2GIQA 4ICLA 4YR2A 1K1SA 2O5DA 2W8KA 4QPXA 1U09A 3EZUA 4NLPA 3IRXB 4H4OB 4RW8A 4O3OA 3T19A 4TY8B 4DL2A 4J9QA 4K4ZA 5EWEA 4NLVA 1EP4B 4KSEB 4IRDA 3MEDB 3ICLA 4QWEA 5KFHA 4J9SA 5I42B 3MR5A 2YKNB 3CJ3A 4LQ9A 5KFXA 3DOLB 4URSA 1JLCB 1JLAA 1FKOA 4O44B 3H4BA 5KFBA 2D7SA 1HARA 2YNIA 1DTTA 1RT2A 3V4IB 3ISNC 3UQSA 1S9GA 4MK9A 4XPEA 4Q44A 2IA6A 1D1UA 4EO6A 5KG4A 3QYYA 2AU0A 1LW0A 1GX5A 1RTIB 4NYZA 1FK9B 1S1VB 3BQ2A 3DMJB 3V81A 1N48A 4Q43A 4ZP6A 2IJNA 1MMLA 4XO0A 2B6AB 2W9AA 4NZ0A 1RTHA 2HNYB 4DL4A 3DRPA 2C22A 3QLHA 5KFNA 5KG1A 3N6NA 3LP1B 4RW9B 3KLIA 1RT7B 4QW8A 3DRRB 4NLWA 3DLGB 3OL9A 1K1QA 4H4MB 1TVRA 1N6QA 4PQUA 3DM2B 5F9NA 3OSPA 1S6QA 3KLIB 3NMAA 1RT4A 3CJ5A 5HBMA 5KFUA 1HQUA 3T1AA 1MU2A 5L9XA 4Q8FA 2AGOA 4IFVB 2W7PA 3KK2B 3PJXA 2DPIA 3UR0A 3CO9A 2YKMB 4QWBA 2HMIB 1C0TB 3I0SB 1BQNB 3LP0A 3KLHB 3MR6A 3RB3A 5HLFB 2R2UA 4J9MA 4EBCA 2V0NA 5DQGA 4R5PA 1N56A 5J1EB 4Y2CA 3CJ0A 1RA7A 2RF2B 1TQLA 1S1XA 2E9TA 3KMQA 5DG7A 4JV1A 1RAJA 3N6MA 3D28A 1NNDA 3T5HA 2AGPA 1TV6A 2FJVA 4IFYB 3DLKA 1RT1B 2WK4A 5C25A 3BREA 3G6YA 4RU9A 1LWEA 4ZPDA 4OL8A 3PZPA 1QUVA 4R8UA 1S49A 4TY9A 3KJVB 3DOKA 3FQKA 1JLCA 5J2NB 2BRKA 4J9OA 2BQRA 4DL5A 3NBPB 1NHVA 1LWFB 4MFBA 3KK1A 4I2QA 3NAIA 3PVXA 3M8QB 4ECWA 1GX6A 4IDKA 1HNVA 4WZQA 1S0NA 2EC0A 1FK9A 3H5SA 3RBEA 3MR3A 2B6AA 4X2BA 3PR5B 4IOBA 4URGA 4LQ3A 3BQ0A 4WFZA 1JKHA 2JEIA 3M8PA 2ALZA 3DM2A 4ECRA 2VG5A 1FKOB 3N6LA 3NKYA 1JLBA 1JLAB 5KT6A 2WB4A 3Q8RB 1JLQA 3H5XA 5KFRA 5KT2A 1S97A 1DTTB 1RT2B 1RA6A 1S9GB 4U6PA 3CJ2A 5KG2A 3GV7B 1QE1A 1C0TA 1C0UA 4WXWA 3KLFA 2FLPA 3IS9B 5F9LA 1SUQA 3V81B 3CWJA 5KT7A 4IRCA 4Y34A 4ECQA 4EEYA 1RTHB 4TQRA 3DRPB 2FJXA 3CJ4A 4WYLA 3QLHB 2B5JA 3BGRB 1OS5A 2E9RX 1NHUA 1VRUA 4DEZA
chains in the Genus database with same CATH superfamily
4DPXA 1TAQA 4PQUB 1F60B 4FXVA 4ED0A 2I2YA 4RR5A 3GU0A 2QYCA 3TVYA 2JX2A 1DTQA 3OQ2A 2MQ8A 2HWTA 3R7NB 1NXIA 1G2EA 3TVZA 1FTRA 4DQPA 3WIVA 1ZTWA 1WEZA 3DGPB 1VQNS 2FVSA 1T9VA 3ISZA 3UNGC 2YVSA 1YJ7A 1ICEB 4USHA 3OUYA 3VAJA 3BGRA 2QMUB 3A8JA 1JKHB 2HURA 2BKPA 1M5OC 4UTGA 2WBMA 3BB5A 2N4CA 2LXUA 4DR1F 3HP6A 3PW0A 4Q45A 2ZUGA 3M7VA 1NJXA 2RIJA 3MCNA 1SJFA 3HHKA 2VOPA 1EQ0A 4PWDB 2LQ9A 1PGZA 4EBDA 2DNYA 5B08A 3G8TA 3AOAA 2M2BA 3UD3P 4RW4A 4C7QA 2CJBA 5CAAA 4DMZA 1HNXJ 2X1AA 4ANEA 4QBUA 3K5NA 2RKIB 4ID8A 2OH2A 1FX4A 3Q23A 3B4MA 2HGLA 4RUHA 5M2UA 4WE1A 1LWCB 5HP1B 3GIIA 3MF5A 4J9NA 4R25A 1Y11A 1FDDA 3J81j 3QATA 5KFQA 4ZLJA 4RW7B 2GIFA 2YKAA 5DM6Q 4OYWA 2VBWA 3HD1A 2H48B 4LJMA 2RDJA 3DI6B 3EUNA 3M2UA 2XS2A 3W9IA 5EUHA 5BYRA 3EM1A 4E98A 1WOSA 2VQFJ 2QA1A 2XY6A 4NCGA 2IYGA 1PC4A 2BANB 1IR2A 1P27B 3QZ7A 5KFZA 4NCBA 5LMUF 1T03B 3SI8A 1JLEA 3A12A 3FBBA 2MQOA 1NHKL 4B9VA 4CO3A 1QUPA 4D3HA 2X1BA 1ZA1B 4TQSA 1Q8BA 1C1CA 2KI2A 5LJ3Y 1ZA2B 2MMYA 2G13A 4N77A 3QO9B 3UCUP 4H4OA 4XDCA 2KT3A 2V63A 2XWYA 5BJRA 3MEDA 4Q7AA 4U8VA 2HVZA 5MLCV 1TMJA 2WSCC 1RWPB 1XK8A 4O23A 4DX6A 1RTIA 5HSPA 1X8DA 3QZ8A 3E8OA 4K0KF 3TVKA 3BR8A 1AXQA 3N79A 4ZJOA 2XI2A 1C2PA 1WG5A 3L7PA 4ZOSA 3WZ0A 2IM2A 2ADBA 2AJ0A 2W9BB 1LW0B 1HR0J 1B7YB 3T5JA 1T05B 3ZZPA 4CTAB 4PPZA 3ENVA 3CCMS 2CQ4A 2RF2A 3M8RA 5DQHA 2E5JA 3NMRA 3HULA 4B9SA 4F3QA 2A6MA 3IMQJ 2BE7D 3FVYA 5C24B 4F4ZA 3MM6B 1D0EA 4DN0A 4F4YA 3R5DA 2CJKA 3FBFA 3HHNB 3JTPA 4YR2A 2C3OA 3IRXB 1U09A 2EEYA 4LUBA 1QTMA 5FD1A 2LXFA 3ICLA 1VQ6S 5LT5A 1S76D 3FBEA 4O44B 3H4BA 2PI4A 1YRTA 2YNIA 1RT2A 1D8YA 2XLKA 2EBEA 3LGHA 4DOZA 2DNHA 3DLHA 2EC2A 2NREA 1WI6A 4C0HA 2DNKA 2IDLA 1EKRA 2AEMA 1V3ZA 3M2RA 4H4MB 5HBMA 2CA9A 1AFIA 3QWPA 2K06A 3CJRA 2VH7A 1NKEA 3OXLA 4OZJA 2QGFB 1B0VA 3UNYA 5A2QU 2HS0A 1X9WA 1WDTA 2F7VA 5AXNA 2EVZA 3AXMA 3BO3A 2J5AA 2DTJA 1S49A 3C46A 2KG0A 1FWKA 3AFGA 4E8UA 1KVKA 4DR4F 3QT8A 1K8AT 4LREA 1S0NA 4P6QA 4PG5A 2B6AA 4CRJA 2Q66A 1KKHA 3GYGA 4LF9F 3LWLA 4YEAA 3U02A 3IBFB 5A8KA 4CT8A 2XSJB 1ZBTA 1C0UA 5HVHA 4CLPA 4X4PA 1U48A 3C8YA 2E44A 2JRSA 2YWHA 3SSQA 1RT4B 1RTJA 1HQUB 1FNXH 4YR3A 2LQ8A 5L1KA 4F2RA 1R31A 4L75A 4CO5A 2B56A 3MEEA 4KC5A 2OJ3A 3EVWA 1ZETA 1YBAA 4I7FB 3P4UB 4X62J 1NLKL 3OD2A 3Q0AA 4F04B 4WU3A 1HNVB 3Q2TC 1W2BR 4HEA9 3W5ZA 3KNAA 2J8SA 3M8PB 3NAHA 2IDEA 4C3KA 3HSJA 2QA2A 1N52B 1U1QA 1S1UB 1CJVB 1FNMA 3MM9B 2PA8D 1HA1A 4CIOA 3PYFA 1TMMA 3MCSA 4I69A 1JJ4A 5E2QA 2H4WB 4K4VA 2YWKA 3CEDA 3F44A 5KFWA 4KGKA 4EWTA 2XZ2A 2A1BA 1YK9A 3F41A 1U49A 2G4BA 3D0GE 4GC6A 2DR9A 4BLGA 2RRAA 3W2VB 1KLMA 3CDEA 1N5SA 1ZS6A 1WKLA 2HAIA 1HWKA 3O1LA 1Q7LB 5F8IA 1HQEB 2ZJRQ 4HH0A 2BE2B 3VAGA 2MJNA 5FIIA 4KAIA 4OI6A 4W4MA 2OI2A 2PFFB 1TKTA 3ZZUA 2U1AA 1LFPA 1FI4A 3D6MB 1RAGB 2HK3A 4Q0BA 2YNGB 2XO7A 4U7CA 4MTPA 2XGPA 1WEYA 3BYPA 1U1NA 4XIUA 3PFOA 2V4RA 1MG7A 4DWIA 2MEWA 1VOMA 3FKBA 3M30B 4FS2A 2UUTA 5AJ3F 3HKWA 4N8NA 4MAKA 5KG3A 5F8LA 4CM2A 1HL6A 4NLYA 2WZ1A 4ZA1A 2DGUA 5E33A 2D74B 5C2CA 1S0MA 3QIPA 2GMLA 4ZCLA 4UQTA 1N54B 1Y00A 3QFHA 1VBXA 1K9MT 2VFVA 3QJPA 1SH3A 2IYIA 2V68A 4OHWA 1SV5B 1UWBA 3GLJA 3E3XA 2AYGA 5HAOA 2FDNA 3UD4P 1U7LA 3OHAA 4Y2AA 2QIFA 2QSFA 2IM1A 3BDPA 4C4WA 3EE3A 4B3MF 1AZSA 3VALA 1H73A 3BSNA 1MWQA 3L95X 4C98A 4RW8B 2FHJD 4BHQA 1RACB 5JUMA 3KUEA 1FJGF 4IG3B 4B9UA 2B9YA 2CQGA 3GV8B 4N5SA 4ELVA 2YKMA 1TFYA 1FESA 4PRFA 3M8WA 5J1EA 1LKZA 2I5JB 3L4BC 2CPFA 4ANDA 3AOBA 2XCPA 2GCFA 2KM8B 5L8RC 3NGRA 1E6YA 1VQ4S 4NMXA 4DLGA 3M1VB 1I6JA 1YX2A 2ZOMA 2RS8A 4IH5A 2L3MA 4HHJA 4NLVA 3RW6A 4IRDA 1X5PA 3QFWA 3VV2B 1HBMB 5KFBA 5A8WB 2Y9HA 3BKFA 2AYBA 3SCJE 3V81A 4ZP6A 1MMLA 2HG4A 3HZEA 3M8YA 3TUIC 4WFAQ 1CJUA 5L39A 3OL9A 1K1QA 2FHKA 1TVRA 5KFUA 2OAUA 3N5FA 4ZIVA 3MR6A 1QTNB 1VQ7S 5HLFB 2V4JA 4PAAA 2AP6A 1U1PA 1KOOA 3I9ZA 1KLNA 3LGMA 4ZPDA 2ZH5A 4TY9A 4B17A 2BRKA 3DXBA 2RDDA 3ZNUA 1Y3JA 2JL9A 1ACMB 5L38A 3LWMA 2FD2A 2ZVIA 3IAS9 1FE0A 4CCHA 1OQ6A 3Q8RB 2GA7A 8RUCA 2JWNA 4U6PA 2O1PA 1QE1A 4RUBA 3IS9B 1SUQA 3CWJA 4QR1A 1IR0A 2C3MA 3TWZA 4C0OC 2ROPA 3P8BB 3QLHB 2DHHA 2WSFC 1YJ9S 1YJNS 1SH0A 5CA5A 3Q8PB 1RADB 4X4SA 5F8MA 3G2XA 3HSZA 3OLAA 3CCJS 3N0VA 2DNZA 3OTOF 5ETSA 1VQOS 1U1RA 4JI5F 4P10A 1QLNA 1KBRA 1WF2A 1JK9B 1NBEB 1Q53A 1FRMA 1U0HB 2GS8A 2C2DA 1QAIA 2XTJP 3D6FB 4MFBB 3KXDA 4ID5A 4NRUA 2NCKL 1CULB 2MHNA 5EWFA 4K5RA 1H98A 5BR8F 1DLOA 2Z2ZA 2LQ5A 4WIQA 4ZPCA 2RUGA 1JLBB 2NUUG 2AU0A 3TUJC 1TFWA 2RU9A 2MLYA 2X7IA 2M3DA 2HBZB 1JLGB 2V1SA 4PUOA 1OYDA 4ZLPA 4DFMA 2FJBB 4DF4A 1VIXA 4KH0B 1C4AA 2RDIA 1KQSR 4Y00A 3PW2A 1C4CA 4NXMF 2FB0A 2RU3A 1RWNB 3GJQB 2QFJA 5A2QY 5KFVA 4KJIA 1I94J 4DL7A 1RWVB 3SFGA 3OL7A 1TK8A 3HHLA 3MPYA 2BJ9A 3CCZA 1IKYA 2G1DA 2QN6B 2VIHA 2GAGC 1IM6A 4ZPVR 5K8OA 4G1QA 2V34A 2HBRB 3G8QA 3KNGA 2LECA 5ETMA 4C8ZA 2OTJS 3I0RA 2DHAA 2ZE2B 1TUVA 1J5OA 2DGWA 2KYXA 3MD3A 5AE2A 4CYUA 2GFFA 3C6TA 3UDCA 4I6YA 3G6ES 2CQCA 5HROB 1HNXF 4K8RA 1WHYA 1U2RA 4H4KC 2FPHX 2A2DA 2XC9A 3TA2A 1NPKA 2RMLA 4PG7A 2PMHA 3MM7B 2ZOFA 1BGXT 2FJEB 1CS4B 2CQIA 3MM5A 2ZH7A 1S9FA 4RX6A 3CCVS 2ZHOA 4JI6J 4XK8C 4ECXA 5F3TA 3AX3A 4GC7A 2OMOA 1XJWB 4C8OA 4DR2J 1HD1A 2IRUA 3J7YU 1FD2A 2IJRA 2FLLA 2XNRA 1D9AA 3CD0A 5F41A 2AJ4A 2VL1A 3GFXA 2YKNA 1NZAA 4P71A 1SC4B 3BPDA 2VQFF 3RAXA 3AQOA 2GHVC 1JNRB 2QJ3A 2Q43A 2DGXA 3RU0A 3G86A 1W7WA 4A8MP 3FJ2A 5I3UB 1N5QA 2AX0A 2YQ3A 3DRRA 4KIAA 4ZK7M 3C6UA 2QYGA 1R0AB 4A8XA 3G96A 4OHVA 4FF3A 2FTRA 2M7SA 5HK4A 2D1CA 2BXJA 1N6QB 4OZ5A 1X0FA 5KOXA 4O0IA 3UO0A 3NXZA 2NSCA 3NBPA 3VGSA 2KXHA 2CPDA 4PR6A 1Z4UA 1ZM4A 4P52A 1NSPA 3SV4A 2Q6BA 4M1KA 2FY8A 1XNRJ 1BD6A 3QNWB 1JLAA 2MGZB 1IBMJ 1VQYA 1DTTA 3FZ2A 2DGVA 2BYCA 1T02A 1X9SA 3AT1B 2EFGA 3SMZA 2CQ3A 1P6TA 5KG1A 3U1MA 2ZH4A 5IQQA 3NS6A 4NZ7A 3KK2B 2HMIB 3M05A 2JSXA 1GH8A 4JI7J 2QRRA 2O3DA 3DN9A 1HR0F 1Q16B 2CJYB 4P74A 5DG7A 3N6MA 3H90A 2X3GA 3P45B 2WW8A 3DLKA 3TZZA 1AA1B 1HBUB 4CH1A 1YGYA 2PA3A 3SQGB 5J1PA 3KK1A 2K1RB 1G3OA 1MW7A 1CQNA 2EC0A 1RWOB 3QMQA 1FK9A 5D4NA 3KG1A 3CJSA 2CQDA 4DR6J 1X31C 1FKOB 4P75A 2WB4A 3EICA 3GV7B 1H6KX 1VQ5S 5LJ5Y 2WSEC 5F9LA 4JV5J 3BBCA 4C9DA 2RE1A 3BPSP 3A8IA 5EX3A 5J2NA 1X4GA 2KVIA 2HNDB 1UWAA 4GKJJ 4F3OA 4F4XA 1U4BA 4M5DA 3KHGA 1HPZB 4NLRA 2QMXA 4M95A 4R8UB 2F9DA 1IJEB 2I9SA 4DQQA 3RZAA 3MAAA 4DCJB 4KV8A 3LQVA 2OPSB 4I56A 3IM8A 2EPIA 3PHEA 3MFHA 2CDRB 1LW2B 4YB5A 3KG4A 3TANA 3T1HJ 4C2MA 4NEZA 2WOMA 2C28A 5KFKA 3JYTA 5J2PB 4DS5A 2HVEA 2YNHA 4XTTA 2BKOA 1RT3A 2YNFA 2W01A 4C8YA 3A3NB 1Q82T 3KDNA 3QGGA 5IFMA 3EPIA 1H38A 4FKXA 3G87A 4NLTA 1X7VA 4KPYA 3HFKA 3AX2A 3OFFA 1ZAVA 3QJLA 2GHPA 4USUA 2RS2A 4B3OB 3EWGA 4X62F 5KT4A 4WTOB 2MZTA 2R8KA 1FJCA 4YUDA 2LP4A 5ETRA 1S4FA 3NS5A 3ZTRA 1TL3B 1WORA 3GILA 1REVB 4F4WA 2QSWA 4PG6A 4J7CA 2NQPA 4F8RA 1TZ0A 1EHWA 5HL7Q 2ATLA 3I56S 1FFSB 2AIRB 2AT1B 3TI0A 1CJTA 4TYBA 3K8VA 1X5TA 2BR0A 2GQQA 1R0CB 2R8GA 1LK7A 1S1TB 1RTDA 1FRHA 1GQEA 4HT5A 2YKOA 4I2PA 1RU1A 2WONB 5DM7Q 1DQ9A 2HRTA 3PO4A 2KTQA 3MR7A 5C42A 2GV1A 2AQ4A 4FN5A 4NX9A 3GWCA 2PI5A 2IAJB 3V6JA 2ZJQQ 3DYAA 3K59A 4QYZK 3H5UA 3R5CA 1ZPWX 3S6EA 5K14A 4YMEA 4WFYA 3GR1A 1KTQA 4GRSA 4WK1A 2GAHC 3CD7A 3EGWB 2YH0A 4FNHA 2QA4S 1KC8T 2A3JA 4ZJLA 1E6VA 1OY9A 3PKYA 1EZZB 2A0FB 3NGTA 2ASDA 4IG0B 2YXLA 5DETA 1X5OA 5J2MB 2E1AA 3NWRA 4EYHB 3PX0A 1YTYA 4YDDB 1SC1B 4LFCJ 2ACYA 3GP9A 4F0KA 4KT0C 4CO2A 1BLUA 9ATCB 1RT7A 3F73A 4O4RA 2XTCA 3ZFVA 2HFSA 2W2MP 4Y2MA 3C14A 3CB4A 1UFLA 4XPCA 1VJQA 4K5SA 3IA0A 2IBOA 3MMCA 3KLEB 3SXLA 4X4TA 2CZVC 2E7WA 4IFYA 3DFEA 4PEOA 3T5LA 1B0TA 1DRZA 2QTWA 5KG0A 2QL9B 1N36J 4OV6A 2R3VA 3FFIA 3CIMA 4JI2F 4QIVA 1NJIT 1F5CA 1HQ2A 2C22A 1S1XB 2CJXB 3M2VA 2UU9J 1ZH5A 2K3KA 2B8QA 2YPZA 4OHXA 5KFXA 3HM9A 3MOZA 1SJ4P 4WK3A 4N41A 1WELA 1RTHA 2GQCA 4D3GA 2ZVSA 3T9ZA 5I3PA 4FZVA 4AXJA 2CPIA 2HVDA 5DQGA 4Y6IA 1EJ7L 7AT1B 1SIZA 3I55S 3B82A 4OLOA 1FVSA 3PZPA 3FGVA 5G0RB 2N82B 1NJYA 3HO1A 3IC1A 2M0GB 1TUGB 5B0GA 4EGLA 3O5TB 1PAUB 2ZEJA 4URGA 2MXYA 1FERA 3GB0A 2VG5A 3OW2R 4B3SJ 3R3TA 1S97A 2KRRA 1YJWS 2DRBA 2HHVA 2AV5A 3DRPB 1V3SA 4CLZA 3CDWA 3LTOA 2F63A 3V2UC 4TU8A 2XLJA 4ZJQA 4CNZA 1DQ8A 5D8HB 3HT0A 3BO4A 2V2QA 4CM0A 4LRFA 4X4NA 4L73A 4F0MA 3DOKB 3MURP 4TNOA 2C1EB 5IV4A 2DPJA 3GJTB 5KT3A 4JUZA 2J76E 4R0JA 3IBCB 3IRWP 1A9NB 2WVFA 2QG9B 4FBUA 1O6XA 2NS1B 2NSBA 5AXMA 3NNHA 2B5JB 1N5VA 3I4PA 4ED8A 3CIZA 4ZLNA 3W5XA 3S7RA 4ZVEA 4YB7A 2FUG9 4DCPB 2KKHA 5A0YB 3K58A 4NE9C 4TKTA 2NXJA 1IKXB 1RJJA 4HR2A 3LP2A 2ZUAA 4DSFA 2P9CA 5KG5A 1TP7A 4LSLB 2KJWA 3GYNA 2QO3A 4WBFA 5IOLA 2BV3A 3Q8QB 4BWMA 4F02A 3H2UB 3C15B 1YBUA 3R2CJ 3QPIA 2JVRA 1BQMB 2MKYA 3AD7C 2H54B 4RBTA 2OKQA 4PWDA 4I4BA 1V9OA 2B4VA 1UKUA 1NK9A 4A8WA 3Q2SC 2NUHA 3ZZOA 3IGVA 4OV1A 1R8HA 3PKMA 2LYVA 4ILRA 3G6XA 3PW5A 1TL1A 4DPTA 4OYZA 3RRKA 3THTA 4LF5J 1BC6A 1UJ5A 1FKAF 3H2LA 2C2MB 3UW1A 2K2PA 1RGVA 2G2OA 1S9EA 2JJ4D 2C2OB 1S77D 4LRCA 1FDAA 1HHSA 3R7BB 4KKOB 1WI8A 2NZ4A 3OXGA 4ZDNA 3P6YC 4RWXA 4TLRA 1I94F 1WF0A 3C19A 3SCLE 2HWIA 5DZ7A 3ET6A 3D67A 4EFAC 1PKUA 1R7IA 5KFYA 3R1HA 1KOHA 2I1RA 2OPRA 2XCAA 5GVQA 3A8EA 1LNQA 3I6PA 1VIOA 3K8WA 1DURA 3L09A 5D0RA 3D7SB 5A6PA 2OHDA 1HBOA 2VU5A 1EKSA 2OPPB 2B51A 3FCWA 4JV2A 1GEHA 4C6AA 4OYIA 2UP1A 1T03A 1N5YB 5EN1A 1TKZB 1T3NA 4S0MA 4USKA 1KWMA 2QEXS 1OPIA 3Q22A 4NMLA 2DEJA 2CPYA 1BQNA 2EFNA 5LL6d 3EVMA 5GAEI 3KLGB 5E3AA 1PC5A 5FJ4A 2BJEA 2R7XA 3IAM9 1O8BA 1RT1A 3KOAA 4JI6F 3H4DA 1IUJA 1URNA 1UJ4A 1XR5A 1U25A 4DR2F 3O6QA 4OI3A 3CJ8A 4NLPA 3T19A 3JXOA 5A8RA 3GIRA 2V2ZA 4CO4A 2AYEA 2AKWB 1SB6A 5HQMA 1FCAA 3B6BA 5DDPC 2NPFA 3MMBA 2MYFA 2J0QD 1LW0A 1U1KA 3DMJB 2IJNA 4AD6A 4I67A 3IP0A 3N6NA 3VHQA 1LWXA 1YZ7A 2FGOA 3DLGB 3EJMA 7FDRA 2PMWA 1HKAA 1UETA 1N33J 1NK8A 2JLFA 4IFVB 2AYMA 2RQMA 4U96A 4NPOA 2DRDA 1GFWB 4HDGA 2R2UA 2CNNB 2V8DA 2VB6A 4ZVQB 2E9TA 2Z30B 2HQGA 5B0DA 3CMQA 2J9DE 1QY7A 3HX9A 3M8QB 3PIPQ 1GX6A 4ECWA 4JI0J 5C2GA 2MZQA 2AJFE 1YZ6A 4L6V3 5A6WA 1UP1A 4LF2A 2BJ7A 3BGLA 1XNRF 2ALZA 3GSDA 3RW7A 1IBMF 2FLPA 3Q8UA 2CADA 3CMES 5HMXA 4X4VA 3IWXA 3CJTA 3QRPA 1BHNA 3MR2A 3DC2A 2Y0BB 1RKJA 3WIUA 4N7TA 1VQSA 4LVNP 2DR6A 2GQ2A 4JI7F 3W60A 4R5PB 4RUCA 4FBTA 5BYQA 2VHGA 3O44A 4JP8A 4IH7A 2N3OA 4KHPJ 1RWXB 4RW6A 3U27A 1K0VA 3NWGA 1U6FA 2VFTA 5CXTA 5DJBA 2XSJA 3N9UC 4ZPBA 3N01A 4DV0J 1R8BA 3SDEA 2CQHA 4J9UE 3AQPA 5DO2A 2JVOA 1NSKL 1VQ9S 1U1MA 4DX8H 4KR0B 4DR6F 4F0HA 2DNQA 3TYTA 1Y5LB 4CO0A 4Q8EA 2C3YA 3AB4B 4PKDB 1HI0P 2XI3A 4JV5F 2RQ4A 1VRUB 4JYAJ 2DGQA 1NK4A 2EFPA 5FLXY 4K59A 4I7FA 2DEIA 1HFEL 1ZPVA 1DTQB 5DLFA 2HZVA 3UDLA 1PJ7A 1AROP 1WG4A 4M5LA 4ELUA 4GKJF 4UOCA 3GIKA 1PYOB 4L3NA 1AYEA 3ENWA 4O3PA 1KTVA 3ZZ0A 4A8FA 3NRBA 1JB0C 2KN4A 2FVRA 1UEKA 1S48A 1S1UA 4ZVOB 3OUYB 4RBUA 1Q0NA 5F0WA 2DITA 2UZAA 3PYEA 3BJYA 3VGUA 5DG9A 4FF1A 3NEKA 3T1HF 5HN0A 4QU7A 4DQRA 2CNKB 3PG9A 4FF2A 1XTZA 3DRYA 1VLYA 3IR6B 3KTQA 2VUGA 1MWYA 3W2VA 2AJ1A 2FJDB 1F1BB 2M8HA 3L7UA 1TL4A 1X4BA 2BE2A 2MZJA 3FCHA 2W7AA 1FKPA 4JB8B 5KG6A 4NXNJ 2UXCJ 1UJ6A 1R43A 1VRQC 1T9UA 5E5NA 5I3QA 1AFJA 1AT1B 4DCOB 2LU1A 2XY7A 2KU7A 4ITSA 2OELA 2W24A 4WP8A 3R1LA 1NMEB 1VK8A 2V8HA 5K8NA 2FYXA 2DVIA 3BH7B 1D8ZA 1Q95G 3OSNA 3UD5A 1K44A 4ILMA 2MQMA 1UVLA 1NB7A 3RB6A 2KXFA 2MB0B 5DLGA 3I5AA 1RHKB 4FXDA 4NLSA 2FVCA 1KHVA 3Q8VA 3M2UB 4LF6J 1H72C 1NEEA 4ZIWA 5IC4B 2M70A 1WOOA 2F8EX 1U47A 5L9NA 3TARA 4NCGB 5ETLA 1S1VA 3NGKA 3G8SA 3POTA 4RW9A 3OVSA 2F8HA 8AT1B 1NAQA 2QX0A 3C16A 3BH6B 4Q2LA 3TX8A 4BC9A 3KLHA 2V8PA 1HBNA 2B7CB 1JLEB 4WP3A 2DNPA 3GFYA 1HHTP 2DH7A 2DISA 1C1CB 2MKKA 2RILA 3WC0A 3CCQS 3QIDA 2ASLA 4WIIA 4H4OB 4RW8A 4YOEA 3GG0A 4NWBA 1LXNA 2LU2A 4OZ0A 3MEDB 2PIIA 2JNJA 4J9SA 3MR5A 4J90A 2D7SA 4I6WA 1Y9OA 3LA0A 4A47A 3JSYA 1NK6A 1RTIB 1X4CA 5DZ6A 4LFCF 1VR6A 3KLIA 4M5IA 1MNEA 2APOA 3MCMA 2NXEA 1IBLJ 1MU2A 2AGOA 3UR0A 3FMWA 1C0TB 1IBKJ 5HMYA 4M5GA 3I4HX 2RF2B 2E1MC 3KMQA 3HLUA 1AUSL 3T5HA 3U1NA 4LFAJ 2MQQA 1Q8LA 5E7OB 1N36F 2NYIA 1UVJA 4I2QA 2POKA 3C2PA 2AD9A 1S99A 1ZM9A 4QOTA 4X2BA 4JOUA 4DV1J 2UU9F 3SZ2A 2DBBA 3PJ9A 5KT6A 1JLQA 5KT2A 3AA8A 1RT2B 5KG2A 4LR9A 1J27A 1NPRA 4ECQA 2UXBJ 1Q79A 1MROA 2P8IA 1GK8A 4P7VA 3NGUA 1NHUA 3M2RB 4LT6A 4I6AA 5AXKA 5HBMB 4NLUA 2CPHA 1WTFA 3KJNB 1RE1B 4USIA 3MEGA 1KD1T 3ONQA 2YWWA 3E01A 1HW9A 2ZFHA 2JEJA 1CJKA 4UZCA 1EIYB 2CPXA 4TYAA 5K9FA 3K5OA 2Z57B 1H2UX 1GAOA 3IS9A 3LPEA 2ZKTA 4C48A 1CLFA 1RT5A 1OPZA 1X4DA 4ED7A 3HKZD 2WW4A 5A8KB 1X5SA 3BBFA 4KFBA 2R7TA 5EX0A 4B3SF 1HMVA 2ZZTA 2YY3A 1TAUA 1C0UB 4G65A 2XHWA 2UUWA 3M6WA 3P49B 2G0JA 3Q86A 4CDIA 2BKNA 3H0PA 3QSIA 1RTJB 3SSRA 2VJVA 3B8HA 4HL9A 3MEEB 1NCLA 2EKNA 4JI1J 2J0XA 4KRWA 2VA3A 2DCUB 2QLWA 5CZXA 2ZNZA 3CCWA 2GGPA 3PDNA 3BR9A 4BCAA 1JLGA 4TXSA 3KHHA 5AXLA 1RAHB 1HNIB 4N8OA 4LF1A 2EWHA 3ZTQA 3MUMP 4LSNA 2D3OR 3ZO7A 4KB7A 3CE8A 1KNZA 4I1TA 2NPIA 2MZ1A 1RHQB 2CPZA 1HHQA 5DDQC 3AJ1A 1OWXA 3ENQA 1B99A 4WZMA 5GMEA 2ACMA 2KL8A 4DJBA 1SI9A 3UR3C 2XGQA 2X1GA 3R6GB 4LF8J 4PQAA 1SKSA 2DIVA 2LEAA 1KONA 4HLBA 3K5LA 1FHTA 1KLMB 3HVRA 5D3GA 1GNKA 1V5IB 2VONA 4OJGA 2DD8S 3MAQA 2VBZA 1RT6A 2F4FA 1TKTB 4P9SA 3PYDA 2MJUA 2VC1A 2DNOA 1M90T 2RSQA 5HJXA 3IGNA 4DPOA 4L72B 1WHVA 4Q0BB 4YR0A 1RB0A 1NJWA 1ELOA 4HHUA 1FWLA 3DHWC 4LF5F 2YQ1A 1KP6A 2ZNYA 3MPUB 1FEHA 3CF5Q 2ILZA 4QQBA 1B3TA 3NS7B 3LP1A 3TO8A 2HKEA 2GIRA 2JEGA 2AF6A 5HVGA 4ED3A 3K89A 3KJQB 1CSJA 3QIPB 4WYWA 2L9WA 1U2CA 1UUJA 1P1LA 2QZ8A 3AJ2A 4YN3B 4ZCIA 1UWBB 2MQNA 3P5BP 1UPMB 1RHRB 5EDWA 2E1CA 2IM3A 4X4RA 4U7UK 2FJWA 2YBVA 1K1SA 4QPXA 3BKTA 3F56A 4DL2A 1VBYA 1RAOA 4OQJA 1F5AA 2B0GA 3BS9A 3LO3A 1AZSB 3UQSA 3M6VA 1GTHA 3HFVA 2XZWA 2E5HA 3LPYA 1IWAA 4NLWA 2QT7A 1L3SA 1N6QA 1G6BA 4UOGA 2YKMB 3EGNA 6FDRA 4RU2A 1FFGB 4EBCA 1N56A 2YX1A 3ZZTA 5J1EB 1TQLA 2L41A 2J7KA 5C25A 4NASA 1E6YB 4QPTA 1UPPA 2KDOA 2LEBA 1PBAA 1VQ8S 4J9OA 1V6HA 4BDPA 4KPCA 4OYPA 2QL5B 4CQ1A 3DDNA 3VCDA 4LR8A 4PPDA 3PR5B 1U24A 2BE9B 2DJWA 2ABYA 2QLFB 3CC4S 4CLFA 3CUNA 2XSFA 2HRUA 2NXUA 1TTHB 3HJFA 3V81B 2CZ4A 2FJXA 4ZITA 1CJUB 2J6UA 2C2RA 1TVRB 5CYQA 3M9MB 1T9TA 1N33F 1HBUA 4AL5A 1W26A 4EZ6A 3KUGA 2V4JB 4DX7A 2B43A 4DS4A 2K1RA 4WFNQ 5LSLA 4K4XA 2OSQA 3T6JA 1URRA 1UEUA 2E5LJ 1PYTA 5CZVA 1FXRA 4QCLA 3H98A 3QGPA 1JJCB 5C7PA 4F26A 3DKDA 3BF4A 4JI0F 1KQFB 4IQXA 4GKKJ 3MD1A 1VHFA 4K4WA 3CDUA 2HS4A 3A4TA 1JQGA 3LW5C 3MPWA 4OIXA 1PJ5A 2ZC4A 2XHCA 2ZD1A 4K4YA 2IC3A 1XNQJ 3VGTA 5B0AA 1QE1B 4V19J 1S72S 4V19X 4HYKA 4G3IA 1SUQB 2HNDA 4LRBA 2HHTA 3DRSA 2XM3A 3MXHP 4LF4J 2FLNA 1HPZA 2G0CA 5L1JA 2LDIA 1R0BG 4DR5J 2HIQA 4CNYA 1UZHA 3KFWX 2Y8WA 2BMBA 5ETKA 1SKRA 5GADU 1JXVA 4UY85 3L9ZA 5D4LA 1SC3B 4OYBA 3GYXB 4AQYJ 4KHPF 2HFUA 2OPSA 1RABB 5T7LA 2QV6A 5ETVA 4ID5B 1T94A 4DV0F 1LW2A 1WC5A 1C1BA 4YFUA 3IO1A 1Q78A 1FTCA 1DLOB 2VKRA 1WF1A 2PMZD 5IM0B 2V9WA 3H5YA 3AOCA 4B9NA 2HHQA 2JLEA 4OJ1A 4GO5X 4TVAB 3K5MA 4USTA 1WSRA 3IG1B 1NKBA 4PUOB 4EI2A 3ITHA 2O66A 1JMTA 3OT9A 4EBEA 1S59A 4JYAF 2DHXA 5HI7A 2J7WA 2Z8QA 2GHWA 3CC2S 1W2IA 1DY3A 3P96A 2BVZA 5KFDA 1H2VZ 3FSYA 1HWLA 1IM4A 3MUVP 1YSJA 5T41A 5ETTA 1RHUB 4K50A 5H9FJ 4MH8A 1MSWD 4J9RA 4OLPA 1X4AA 2QC3A 4DZ6A 2IJFA 5K20B 1VGYA 2VPZB 3HHLB 3A3OB 4FXWA 1IKYB 5CQGA 4PCQA 1S0OA 5CYJA 3TAQA 3HF5A 3D9BA 3D0HE 4LFBJ 4G1QB 1S1TA 1XWLA 4ZHRA 3FNNA 4ED2A 4ENOA 2DT9A 1FNOA 3SFUA 2KHCA 2AZ1A 3I0RB 5KFEA 1J5OB 2KFYA 2OPQB 2NYHA 3CCSS 4CYUB 1LK5A 3C6TB 4DDFA 4FYDA 5IZHA 2P6TA 2IVYA 4GO7X 5SZTA 3D5MA 1LEOA 4NXNF 2UXCF 3UFCX 1M1KT 5AE3A 1GMUA 1XR6A 1IN0A 3KHLA 3I0SA 1YJTA 4KHRA 3MTJA 4UY8T 3MM5B 1P8GA 1S6QB 5GMKa 1CVJA 2R7UA 3HDSA 3I31A 4IG0A 1WC3A 1VK3A 2CPEA 3DLLQ 1CQMA 3DDKA 1WTBA 2V94A 4YHHJ 1S7IA 2O5DA 2J0WA 3TZWA 2DR7A 1U1OA 2RB7A 1IXKA 1KVJA 2H5IB 4LF6F 2YKNB 3MOJB 4NA2A 4LBPA 4MK9A 1U8WA 2V8VA 3QYYA 1RXOB 4NYZA 4ES1A 4Q43A 4DL4A 3DRRB 1TKDA 1FRLA 1NRKA 1TL5A 5F9NA 3T1AA 4K2XA 3LP0A 4J9MA 4Y2CA 2QFIA 3NGSA 1S1XA 2N4DA 3TA0A 1KQKA 5K8MA 3VR1A 3NBPB 3SYZA 3PVXA 2PFDA 3MMJA 4IDKA 1SC6A 4C97A 4PYAA 3MR3A 1H74A 2CQPA 2W4PA 3NOGA 1ZOTA 2Z58B 1JLAB 1SIWB 1DTTB 1GT8A 2Q79A 4WXWA 1Z2ZA 2D9PA 2QMWA 4L3KA 4OZ3A 4CLYA 1IKVA 1IBLF 2LKZA 2MLZA 2CZ9A 3ILOA 1IBKF 4IR1A 1M5PC 2B7BB 3V6DB 1QVGR 4ED6A 2VQEF 4DFPA 2DNNA 2VA2A 2VZ9A 3DLKB 1QJHA 4LFAF 2VDHA 2XMAA 4PWWA 4HACA 2FZKB 4DSKA 2FC8A 4MIBA 2E29A 3KK1B 1S4EA 2HVIA 3A13A 4JI3J 1YG0A 3X3UA 2HAFA 1IKWA 4DV1F 3MM8B 1PILA 2Y0SD 4KO0A 3RB0A 5CYMA 3JAMU 2EK6A 1M1GA 2M4MA 2UXBF 1ZZNA 2HVHA 1V3RA 2Y3YA 3BO2A 3NY0A 2VKZG 2HNZB 1HYSA 1XC9A 3GIMA 3BM7A 4FYYB 1S57A 2FVPA 1Y3KA 4M5DB 5E3CA 3CD6S 1F3VA 5IC6B 2KVQE 5IT0A 3AD9C 4QJVA 3GR0A 1N8RT 3UE2A 3MAAB 4KV8B 2HLUA 4GVLA 5D78A 3CVKA 3PRDA 1Q5VA 1W25A 1O0PA 1WOPA 2MKIA 4NYPA 5ETPA 2XMVA 1VQLS 2W2PP 2WOMB 3JYTB 2AMCB 4NLOA 4PABA 2BA9A 1RT3B 3CCLS 4MK8A 4B3TJ 2J6SA 1MN7A 3M32A 3MWBA 1FX2A 2XO6A 3IR7B 2WBRA 1FVQA 2MQLA 1BQMA 1NZ8A 3AHPA 2HZCA 4IYQA 2J7UA 2HFZA 4G1IA 3I5BA 1XMOJ 2IRYA 2OO4A 4OHYA 2ZWPA 2JFKA 2W4DA 1YITS 1XBWA 1JLFA 5BXIA 2UXDJ 1WHWA 3DLJA 4NL5A 2PGCA 2FQQB 3R7SB 2KFNA 3I96A 1RAIB 1YRXA 4OI2A 3NCRA 3NL0A 3R6LB 1CJTB 2MLXA 4RJVA 5I42A 5D4OA 1F2GA 5KTQA 1HD0A 3HSDA 3JS9A 3MEKA 4J9VA 1RTDB 2PDAA 4I2PB 4LF8F 3DCAA 3H20A 4LIRA 1I1GA 3S01A 1VYAA 5C42B 5F8JA 2F65A 1F3FA 4DV3J 4ED4A 1UA0A 1Q8IA 2DY9A 2BM1A 2I0XA 2Q3PA 5K14B 3VF0B 4KH1B 2VC0A 2HHUA 4QIWD 1EAYC 3IM9A 3O2IA 3CC7S 2OPPA 2Z2MA 3NP5A 1VS3A 5DRKA 1E6VB 3UDEA 2XMUA 2XZTB 1TL7A 2LQBA 2I38A 2R7WA 1S9GA 2IA6A 3W2WA 3B78A 4N56A 4DSJA 2HBQB 4USVA 2I8EA 1ZYQA 1M5SA 1RT7B 4EK2A 1RWKB 2J0SD 4A8KA 3M8ZA 4AUKA 1AB8A 2W7PA 2DGTA 5SUHA 1SJ3P 4DFJA 3IFEA 1LV5A 2MQPA 4DV7J 5D6GA 1RAJA 2AZ3A 4IFYB 2D9OA 4LRDA 4RU9A 3OFEA 3BKUA 3MMAA 1YIJS 3OFHA 1NHVA 2BOPA 5JMNA 2CJ9A 1IQTA 3M2VB 3FUYA 2KYZA 4WWSA 3T6BA 4F4KA 2J9DA 4P73A 4OI1A 3V4MA 3DXSX 3KLFA 4W98A 3D3CJ 1KQGB 1U8SA 1RTHB 5LMNJ 4HTIA 4WYLA 1JNZB 1KDNA 3JSRA 2YX4A 3TEHB 2OSRA 4HT7A 1UMJA 3GONA 3BV8A 1QAJA 4PXBA 4DV5J 5KFSA 2CQ0A 2KT2A 3QGIA 4M8LA 4W92B 3H59A 4CZCA 1QD1A 2VG7B 1RI7A 3D1QA 2RUSA 4K4SA 2G2YA 5C5JA 3MAHA 2HHXA 1S6PA 3BSCA 5DGBA 3BDEA 4OX9J 1RBAA 3QRQA 1F5BA 4NLXA 1KN6A 1APSA 2ILYA 1AUDA 2VG5B 1IJFB 2LFVA 2B4OA 4KGVB 3NCQA 3RB4A 4NOHA 2B9XA 2VICA 2B9EA 3I87A 2R8JA 1B7FA 1T0TV 1QM9A 3DU5A 1S5ZA 3R97A 5GAHU 4QIGA 4OI0A 1NK0A 1P9YA 2WHOA 1FXDA 3OR1A 3HJVA 2OEMA 1TKXA 2GMJA 3EX7B 4OFZA 3KMSA 2VOOA 2EFQA 2HFNA 1M5KC 1RP5A 5B0EA 2E5LF 4RBVA 2VFRA 2FIUA 3VVUA 3HHEA 3H25A 3LAKA 3T41A 1RTZA 2P9EA 1FJEB 5JXSA 1J2VA 4GKKF 1SVDA 2R2RA 4RLEA 2NXCA 3SCIE 3CT9A 5FDLA 5H9EJ 4TLQA 1XNQF 2IM0A 1M5HA 1Y4ZB 1EETA 2V5HG 3KK3A 4NXMJ 4HKQA 2XTEA 4OX8A 3G6VA 4LF4F 2ASJA 3GMGA 3BSOA 3GTYX 1P1TA 3Q89A 2JZ5A 4DR5F 4A4JA 1UVIA 2WCXA 4YY3J 3C3LA 2ZH1A 2L48A 3LP2B 3CJKA 2M8DB 1J5EJ 4O4GB 3PR4A 1T7PA 4AQYF 4HI2A 4MIWA 1WHXA 1X4FA 5E0OA 3K0JA 1X4EA 3UCGA 3KJFB 1U0SA 2XMKA 2W9CA 3TEGA 2GC8A 3GJRB 2H1YA 2D3O1 1TELA 1H7WA 2B8PA 4C11B 1X4HA 2DNGA 2VASA 1KHWA 4NLDA 2AX1A 4EYIB 3JAMY 1N5TA 1TL1B 4TY8A 4QU6A 1JXEA 4ALZA 1EP4A 1SJ1A 1M5VC 2WAQD 3DOLA 2OTLS 4DHVA 3V4IA 2R4FA 4OZLA 5KAKA 1S9EB 4O3SA 4ECTA 2WVEA 4OZ2A 2M52A 2KB2A 2HNYA 3PACA 4OX6A 3G82B 1JX4A 3TZYA 7FD1A 4F7VA 3D66A 5U47A 3ET6B 3O3LA 5KFAA 2OPRB 1XN9A 4CI0B 1R8CA 1UZDA 2BJ1A 2W2OP 3LF0A 3FSIA 4RNMA 3TUPA 3VAKA 4M5HA 1LWFA 4LFBF 2GVZA 2DHGA 2AWZA 1MN9A 2GIQA 2B4PA 2CNOB 1ULRA 4TU7A 2RAQA 3T9NA 2KJVA 1HBOB 2IVFB 1SBRA 4WPAA 3ETMA 4HHHA 4X64J 4ZN3A 2P5VA 1MLAA 1N32J 1KFDA 1BQNB 4LR7A 1KRPA 4RL1A 1GXTA 3W1YC 1TV6A 2KXNB 1RT1B 3WQPA 2NXNA 1LWEA 3ZTPA 4OYAA 3BYRA 2KM8C 3HMJG 2JFDA 5J1NA 5CCMA 2PSZA 4EMDA 2MKCA 4YHHF 1F2HA 5A8RB 3R5AA 1YI2S 1RA6A 2L9NA 3GSIA 3MMBB 1C0TA 2P2CB 4OZ1A 3MGJA 3W62A 4TQRA 4GVBB 2X1FA 1CG2A 3CMAS 1R6YA 9RUBA 4GMKA 2AGPA 2HW3A 1Y10A 3OR2A 4DV4J 2RD5C 3AJDA 1RBOB 1BUXA 1PBUA 5KFFA 2FHMA 2M88A 4C3MA 1T8EA 5ITHA 2DB1A 3DRXA 4MYTA 3OPKA 4ZCKA 2HK2A 2VG6A 2WB1D 3GZ7A 3WDOA 2QLXA 5I4MA 5B0FA 4P2FA 3ISND 4YB1P 2BJ8A 3P5TL 4ANCA 1FRIA 3RG6A 3OVAA 1QSSA 2J6TA 3R8YA 4X65J 2M5YA 3HVTA 3VVTA 2QLJB 4DQIA 1TK5A 1VRTA 3VQSA 4RNOA 2CJAA 1L3KA 4P2MA 2IBKA 4MKAA 3J81Y 3TRGA 2E7XA 3US5A 3HFZB 3V5RA 5LM7E 4ZPTR 2OMLA 2C2NA 2YX7A 2BQUA 3OHBA 3UWTA 2QA4G 4A46A 4RNNA 4ECVA 1PIEA 2HRYA 1Q81T 1FF2A 4RW6B 2F4VJ 2IY5B 3Q8SB 4DUYJ 2CUYA 3TAMA 4KHMA 3SDEB 1D9DA 2DGSA 4JI3F 4MIAA 3MECA 2CDQA 4M5MA 5DG8A 4Z7CA 2UV8A 5EWGA 4DI6A 2MZRA 1SQFA 2XBPA 3IR5B 2XMJA 4LSZB 2PO4A 3GFHA 4DG1A 5KT5A 2VPXB 2CIMA 1LOUA 3JQKA 3MTKA 1QAYA 2CQ1A 4DSEA 2CG8A 4ED1A 3IWLA 4DX5A 2KFZA 3THPA 4ZN1A 3DOMB 2O01C 1CBKA 2IVMA 1I5OB 2BM0A 4CLWA 5RUBA 4M63A 3SBMA 4U9RA 2RQKA 1HNIA 4N76A 2OGUA 4MMOA 2BBEA 1S10A 3JSMB 1SJQA 2HSEB 5FLXU 4KGZB 5KFTA 5LXRA 1S1WA 2KZMA 2G0IA 2HGNA 2E1PA 4DQSA 2NR0A 4Z7YA 3LANA 1N88A 3U7JA 2VF3A 5D77A 1ITPA 4OYMA 1A0OB 2LVWA 2DK2A 3ZTOA 4NI2B 4DPWA 2XMMA 4UQGA 4J37A 4YDXA 4B3TF 3MFIA 1S6OA 4ZVFA 5IT9U 2ZH6A 2XB2D 1Q8KA 1FKPB 5IWAJ 4UUWA 2EFOA 1F0XA 2LQJA 4H54A 3VQTA 5KFMA 4ES2A 3TZXA 3J80Y 2C2EA 1XMOF 3PO5A 1RDRA 2IHR1 4DN9A 4F67A 2HZAA 2KHDA 5GAGI 1T11A 3PHTA 1OSCA 1FRXA 2V67A 1NSQA 2UXDF 3KJVA 1NK5A 2AEFA 2R9LA 3KLVA 3E2EA 2XYPB 4ECZA 2DH8A 2V9KA 2F8MA 3LOUA 4PXDA 5EWEA 1WKKA 4KSEB 3AY0A 2BEFA 1P9QC 3FRYA 2ZM6J 1HARA 1BY9A 3HT3A 3ISNC 4XPEA 1D1UA 1YJVA 5KG4A 1S1VB 5ETQA 4UOFA 4NZ0A 3POTB 3UN5A 4RW9B 1FXLA 1VMBA 1CEZA 1PJ6A 4PQUA 3OSPA 3C16B 1FT8A 2X51A 3TJ8A 4QWBA 4DV3F 4JI2J 1GXUA 3GJSB 3KLHB 3HSGA 1HBNB 4A8OA 4G6VB 4FPRA 5CH7B 2CAJA 3D54A 3UN2A 1K0TA 4Z2XA 3BREA 3NG8A 4EZ9A 3DGPA 4DPYA 2ROEA 3NAIA 3JQMA 4OX7A 3RRHA 1CPZA 3K57A 2Z56B 3KG0A 2ZZMA 2VFSA 4IOBA 1GMWD 1SJRA 1JKHA 1FDBA 2XG8A 1VJWA 1PO6A 2XNQA 3UCZP 1N34J 3MHYA 1XERA 3CJ2A 4G1PA 3JTNA 2F9JA 3PFEA 3AWRA 1JJHA 3KLIB 4AL6A 3M9OB 2E7VA 2I6WA 2DO4A 2XTDA 4B9MA 4M94A 1MU2B 2R7OA 2WVDA 4UF4A 2DNRA 4ZP9A 3UPFA 4QW9A 4DV7F 4DU7A 2IA0A 2HYIB 2JHEA 3UDVA 1SL0A 3N4WA 4L74A 1N4LA 2OEKA 2RKIA 3CXCR 3R5JB 2FZCB 2A6OA 4I2QB 4O3QA 2N3LA 3DLEB 2GJ2A 1FFWB 1VBKA 3W8GA 3AODA 2BOAA 1LWCA 4ER8A 5HP1A 2HHHJ 3FCVA 3BQ1A 3A3PB 2XULA 2YQ0A 1JLQB 2YH1A 4OZNA 1NU4A 3H7HB 2GNKA 4WJBA 1RHJB 4RW7A 3TA1A 3J7A1 1D3WA 2MDAA 1UA1A 2FLOA 1MROB 3W66A 4RNHA 3JSBA 5LMNF 3M9NB 3DI6A 5J2QB 4IQMA 4MKYA 5E41A 2RNEA 3ZC4A 3KUHA 3MEGB 2Y8YA 2HWHA 4MJKA 3B54A 4XAKA 2GO9A 2DNLA 2C3PA 1MWZA 2HQ3A 2JEFA 5K5MA 2BANA 2UUCJ 3E01B 1FRJA 4DV5F 4CH7A 4Y65A 2EW9A 1CJKB 5KFPA 3DGVA 1F9EB 4KBIA 3UVJB 4K4TA 3CDBA 2XLIA 4DUTA 4ELTA 1SPBP 2GVDB 1RZMA 4OX9F 1RT5B 2R7RA 2XY5A 5IQ6A 3T5KA 1RUSA 4KFBB 1RK8A 3G9CA 1FRKA 1HMVB 4V1Ak 3M6XA 2JC1A 3D1OA 1YKWA 3R5BA 3QO9A 2LMIA 2Y1RI 4DL0C 2UVUA 3ADAC 1XMQJ 4QWAA 1WG1A 5KFLA 2MSTA 5F8HA 2ZKUA 3FRZA 3TOQA 2BUNA 2L9DA 2RHQB 3QGHA 3AAWB 3MUTP 5H1SV 4HVZA 4LBHA 2V2VA 3EXYA 1X60A 1RYSA 1WDDA 3B4DA 4AT1B 3PEHA 3FBCA 2YPYA 3UN3A 2OFGX 5IM0A 2CVEA 4YP3A 1WUUA 4X4QA 2W9BA 4B3RJ 1T05A 2GGPB 1UW4A 1NO8A 1YJRA 3BEGB 4CTAA 2CYYA 3OTDA 1QAXA 3PW4A 3IG1A 3CCRS 5B0BA 2FZGB 3PM9A 1PSDA 5C24A 2HQIA 3MM6A 4LSNB 3I5CA 2VBXA 3IRXA 1T95A 3PX4A 1PYSB 4L76A 4DF8A 3RGIA 4DLEA 4NLQA 1VCTA 3K17A 2FHJA 2GZOA 4O44A 4C8MA 1HNWJ 2J8AA 1N0UA 3QJJA 4ZMMA 4X66J 4EO8A 4YY3F 4ICLB 4IOCQ 4QR0A 4ECUA 3RBDA 1J5EF 2DYAA 4H4MA 3A1YG 1IR1A 1IBCB 3FEZA 5KFOA 2W4CA 5HJYA 5D3GB 1IQZA 1EQMA 5HMZA 2C2ZB 3QWUA 2PEBA 3RBZA 2HQFA 4UT4A 1KEKA 3CPWR 1RT6B 3LGNA 3PW7A 1YHQS 3ILLA 4X84A 3SCKE 1F9FA 3PIOQ 2IRXA 1BMQB 1OY8A 1RWUA 1SQGA 2WRMA 2OPQA 4X4OA 3M4XA 3CCUS 4IKAA 1NKCA 2DNMA 2H5JB 3VWSA 1ZAXA 2ZJPQ 2MY8A 2H51B 3TNVA 1JLCB 1VQMS 1RWWB 1R6VA 2G1HA 2ZBPA 3AH6A 2V1TA 3W3SA 1KVIA 1IVZA 2UUBJ 2KRBA 3LP1B 2Q1LA 3IWNC 4UZBA 5CCLA 3DM2B 2EKYA 1S6QA 1RT4A 1HQUA 4O0NA 4P72A 3CO9A 4A8YA 4NCAA 3KWMA 2V6AA 4DXLA 2V0NA 4ZLLA 3LUYA 3TP2A 3TQEA 2ATCB 3FZBA 2VDIA 1X9MA 3BBBA 1R3NA 2P6SA 5D0HA 1UW9A 1RAFB 2BQRA 3SIPB 2ZH2A 4CLSA 3R27A 5IV3A 3GPAA 4LRAA 1PG5B 1HNVA 1VQPS 4U8YA 2K7KA 2HPUA 2C42A 2H65B 1OO0B 2JEIA 3M8PA 2K8GA 4FP9A 3GFZA 3A8KA 3J7AN 1OM2A 4HDHA 4ILLA 2JDJA 1UVNA 1HWIA 2ZDOA 3ZNJ1 2AW0A 3BGRB 1CJVA 3MM9A 2KT5A 1F9HA 5IT9Y 4K7QA 1YRUA 4EU0A 4X64F 4OYXA 1N32F 5MAOA 4F36A 2MSSA 2GW8A 2BZ2A 4UW2A 2YKQA 2V2KA 2J9CA 5C25B 1XR7A 5HQLA 1YJUA 4A8SA 1L5UA 1NDPA 1HQEA 4RW4B 2EFVA 2QE5A 3TJAA 1NUEA 4ZPAA 1U6BA 1RBLA 1WSVA 1ROFA 4B9TA 3VAHA 1Y0HA 3O8WA 3R2DJ 4ZP8A 3KHRA 3G4SS 3BGUA 5T14A 1Q86T 3FSXA 2PN6A 2YNGA 3V6DA 4WE1B 2HS3A 2ZDPA 5F8NA 3EPGA 4JBCA 5CYQB 3DLBA 3MPDA 1UTAA 3QRRA 4RNFA 1O51A 1NK7A 4CLUA 4DV4F 4BWJA 1FEEA 3M30A 3HXMA 4MKBA 5CABA 1X0PA 4ES3A 4NA1A 4CLLA 3MM8A 1T9YA 2ZH8A 2UVRA 4NRTA 1YWXA 1H3DA 3HVWA 5ETNA 3NCPA 3WX4A 4LF7J 1UFWA 4XDDA 1R8PA 1Y5IB 4X65F 4UUXA 5IT4A 5F3ZA 2ZD1B 2IC3B 4F25A 1SV5A 2HNZA 3S8SA 3H40A 3I82A 2VODA 3DRSB 2YTCA 2AGQA 4DU8A 4J9KA 2Z2YB 1RLDA 4A48A 4Y0FA 2EXUA 4ETZA 4B02A 1K73T 1SL2A 2CJQA 1SH2A 1DARA 4BBYA 1S7HA 2BQ3A 3M8SA 3CO0P 1HNZJ 4MK7A 2XEXA 5LSOA 3K2YA 4FS1A 4IG3A 3VZHA 2F4VF 1EARA 2ASYA 5T7LB 4KYZA 4ZCMA 4DUYF 3EGZA 4QIFA 2D69A 1C1BB 2LEPA 2ADCA 3OLBA 2ZZNA 1Q4RA 2UUAJ 2I5JA 1SQEA 3Q8YA 4P2SA 5B7WA 4JI8J 3BN4A 3THVA 1JXLA 4O3NA 1FO1A 3D3BJ 1T9XA 5E3PA 2LA6A 1VDHA 3M1VA 1U6ZA 3SQOP 3ITHB 4ED5A 1Q7YT 4PG8A 2R7QA 3GIJA 2L08A 3PCOB 2ZWOA 4ZVGA 1HBMA 5A8WA 1MMNA 4C8KA 4M5NA 3GV5B 2AHOB 1YBTA 2ALYB 2FVQA 2R8IA 1D09B 1S6UA 2DR5A 3PJWA 4DL3A 4O3RA 2YNIB 3J7Z5 1DHMA 2CRLA 4PWUA 2ZOGA 3E51A 5HLFA 1WC6A 2EG2A 3OJSA 1DFDA 2OP5A 3LH2S 4CP5A 5L1IA 5KFCA 2BDPA 4ZHRB 1B64A 1WEXA 2W8KA 2W1BA 1H7XA 2ZBCA 4DR3J 3CULA 3N5BA 1OY6A 3CJ3A 4RWWA 3D4JA 4FKYA 5DS7A 3PNIA 4Q44A 4EO6A 4USMA 2W2QP 2V8GA 3HK2A 3VAFA 2IPOB 4XO0A 2B6AB 3OBIA 1S0VA 1NM2A 3QLHA 5KFNA 3R9LA 5IWAF 4C0BA 1FDNA 3CJ5A 2ZH9A 5L9XA 2GX8A 3RR7A 2M9KA 3I0SB 1D9FA 4CH0S 2HBYB 1BWVA 3CJ0A 2JOQA 4JV1A 2BACA 1NNDA 4BC7A 2KZZA 3OTBA 1L3TA 1U0HA 5HO4A 2EBGA 2XWXA 3FQKA 3OXFA 3T3FA 2QL7B 4MFBA 3OTEA 3I9V9 3RBEA 1CULA 2BABA 3H42A 8ATCB 3U1LA 3BQ0A 4WFZA 3QQCD 3Q24A 1JLBA 1UL3A 4IUFA 2ZM6F 5CD4H 2E5IA 2BJ3A 5KT7A 4Y34A 4NYOA 2FC9A 2E9RX 3IBWA 3ILJA 4PZVA 1Q1KA 2WVBA 3K5PA 4RZRA 5E3QA 2XS7A 3WC2A 3LP0B 2WVCA 1V5VA 5AE1A 4CT9A 1RU2A 1ZM2A 2DIUA 3CD5A 2EI5A 3NNCA 2BX6A 1VISA 1PAEX 2UVVA 3J7ZT 2RRNA 4PXCA 5KFGA 4IDKB 1RISA 3OL8A 2LXIA 5D0GA 1ZM3A 2FJAB 1VHIA 3MCOA 1YLXA 5D15A 1N34F 2X3DA 2CWXA 1NPPA 2JH3A 2PEHA 4W90B 3FDSA 3QT6A 1IKVB 2XYGB 3LAMA 4JV0A 2ZE2A 4P7TA 2HFVA 2VG7A 3FMBA 2HLTA 1WC1A 1YDLA 2CG4A 3I32A 3RTVA 5HROA 1SCJB 5D0EA 1TUWA 2OUGA 4DL6A 2CQ2A 2RHSB 3T1YJ 4HACB 3MM7A 2U2FA 2BRLA 2R7SA 3AXKA 1UEVA 1CS4A 2PT0A 4IH6A 2NZCA 1RWMB 2HHHF 1IKWB 2H9ZA 1FWPA 3W63A 4NLGA 3ZZZA 3W64A 5DDRC 2MZSA 4KO0B 4NA3A 1UAWA 5CYMB 3AA9A 4JI4J 4Q5VA 4A8QA 3VTIA 3OFGA 5GADI 4QYZJ 2A2CA 4QIEA 4WTYA 2R7VA 4PYDA 2O67A 2CWKA 4HH1A 1HYSB 3BZQA 4YB6A 3P3DA 1TR0A 2D3UA 1A7GE 1IWGA 1NH8A 4X4UA 4J9LA 4Q2MA 1MMDA 2D68A 3CTRA 2YWEA 1VI7A 4QYRA 3EGVA 2UUCF 5I3UA 1S79A 3GQCA 2R2SA 3ZXWA 1DQAA 2UVWA 1R0AA 1BWEA 5JVGQ 4M5KA 1OYEA 3W65A 1HLWA 5B0CA 1VQKS 1UFKA 1U26A 3VZIA 5KFJA 3EXCX 4DSLA 1RCOB 3WBZA 2ERRA 2E66A 2CNLB 4F3MA 3EYZA 3ELHA 4AXIA 1YQHA 2VJUA 4DV2J 5K8PA 1SKUB 3QSYB 6FD1A 4O4GA 2F3JA 3DNCA 5H9FK 1XMQF 3JB9k 2OD6A 3Q83A 2MGZA 3ULHA 4J9PA 3M32B 1SL1A 5F8GA 3DU6A 2IMWP 5G4DA 1R89A 2RVJA 4DR7J 4IRKA 1UCNA 3KK2A 4C11A 2HMIA 4WF9Q 2OEJA 4B3RF 2DHSA 2MKJA 3OTCA 5A76A 1RYRA 1NDCA 1RCXB 1JLFB 1T9WA 4OHZA 4ZP7A 2FHOB 4AYBD 4FYVB 2Z0GA 3OVBA 4QWCA 4DV6J 1LQ9A 3SQGA 4YS2A 2CQBA 2DH9A 1WNEA 3PEJA 4O3OA 4J9QA 3G82A 4K4ZA 4DUZJ 5I42B 1JJ2R 4LQ9A 3TAPA 4URSA 1FKOA 3D68A 4OMFG 1HNWF 2JLGA 1RHMB 4ZKAA 4X66F 4OYOA 2LCWA 4QW8A 4OJ3A 4OJHA 1VC6A 3NMAA 2BW2A 5EHHA 5LOQA 2DPIA 2Y1JA 3RB3A 1OMSA 1XEZA 3RR8A 5GAGU 3D28A 2FJVA 2HHWA 3GG1A 3C66A 3UI3A 2W25A 4OL8A 4R8UA 3ETOA 4DL5A 2CFXA 2DY1A 2CXEA 6AT1B 3H5SA 1XQIA 3ENAA 4LMZA 3QT7A 4FYWB 3MPVA 3TR5A 1TL7B 1U2FA 3BGOP 3N6LA 3NKYA 3VAMA 4DR1J 1F6TA 5KFRA 4WFBQ 1S9GB 3W2WB 2HGMA 3BGFA 2H3EB 3FEYB 1LXJA 1GTEA 1OQ3A 3NOCA 4DEZA 2UUBF 5J2PA 1QVFR 3W9HA 4WCEQ 4FVMA 5M2PA 5CD4A 1KR4A 3CJQA 2RT3A 2XMTA 2ROGA 5L1LA 1BQXA 1R27B 1NSAA 4U7UD 3MMAB 3PRVA 3LALA 1TU0B 3SSSA 4ZPWR 4B3OA 1L3UA 5E3RA 1SKWA 3TX0A 3V6KA 2D41A 4ERDA 4GVBA 1JWWA 1TL3A 1REVA 2C2KB 5B09A 3PTWA 2XZDB 4KQZA 1SXLA 5HANA 3KLFB 4ZVSB 3BN7A 3FK4A 3DDIA 1NDKA 3PV8A 2UV8G 1WKJA 4ETXA 3ZTSA 3G71S 2MKHA 1GMWA 4CLTA 1Z2LA 4B9LA 1A6LA 2WONA 5AT1B 3H2VE 2MTLA 3RUBL 2N7YA 3IXQA 3GCXP 3RBXA 2IAJA 4ZVPB 3JQJA 3QAUA 1HWUA 5LMUJ 1B4SA 2E9ZA 4P2XA 1S6PB 3PXGa 2NLWA 1T3OA 2R8HA 5LSRA 4F4AA 4MYUA 3OL6A 1HW8A 4Y2KA 3EZOA 1O5JA 3NGDA 2Q6CA 4H4KA 3W5YA 3HI9A 1EB0A 3F0NA 3AX5A 3OR1B 2V69A 5J2MA 2XMWA 4QWDA 1TKXB 1Y7PA 4K0KJ 4KTQA 5M2RA 2XQCA 3PYGA 4TN2A 3JTOA 3HHDA 5CHCB 1WJ9A 4NZ6A 3NNAA 2V4QA 3S1TA 3BSAA 1ZZFA 4YQWA 3KLEA 3FQLA 3ZZYA 1NH7A 4LF7F 2Z4PA 3C6UB 3MDFA 5FDLB 5KFIA 4R0EA 4ZVHA 1OIAA 4DPUA 1EETB 5GAEU 3KK3B 3DOMA 2MKSA 2DXEA 2B3TB 4WU2A 5D4PA 2Z2LA 1ZTTA 3IN5A 4WKYA 2CKWA 2ZBRA 4FVCA 3H8YA 3KDOA 1QSLA 2DO0A 5HATA 3JSMA 1DBDA 3FC9A 1FJ7A 3OV7A 2DXDA 1I51B 1HNZF 3HVAA 2DCLA 3CJKB 1L3VA 4Y2IA 3VGVA 2H4YB 4I0WA 3CCTA 3D1HA 2OLWA 4I64A 5HMWA 3HPOA 3ILIA 2EK1A 4ZVRB 1FE4A 2W9CB 2UUAF 4DFKA 4HTJA 5F0UA 4JI8F 2LDYA 2QLBB 4NI2A 2IMOA 4MT1A 3CW2C 5G0RA 4DR4J 4AL7A 5KG7A 2A10A 3QT5A 2F40A 2F5GA 1HWJA 4TY8B 1Q5YA 1G4CA 3W61A 4WKRA 4LF9J 1EP4B 4LIWA 1WWHA 4IO1A 3DOLB 3V4IB 2BJDA 3OJUA 1GXLA 2XS5A 2CVIA 1FK9B 1HIYA 2W9AA 4KY3A 1TK0A 2HNYB 3DRPA 3PX6A 1NB2A 4QZVB 3ZZRA 2AJQA 2RH3A 4C3LA 1WC4A 3W7BA 1WD6A 5EGYA 3TW0A 2EG1A 1G1XA 1DJ0A 1RA7A 2BW7A 3SV3A 3M6UA 4M5JA 2WK4A 3G6YA 3X1LB 3DOKA 5J2NB 3VAIA 1S12A 4DZDA 1GMVA 3CGIA 1LWFB 1VC5A 2GVZB 2LLZA 5JJBA 3AD8C 4WZQA 2DR8A 4PXEA 4EUVA 4CWBA 2W2NP 4DR3F 3RYLA 3HCXA 5HQ8A 2HIYA 4FDFA 1FA0A 4IRCA 4KGXB 4EEYA 2B5JA 2ZC3A 1OS5A 2HEKA 1OJ4A 4C8NA 1DAXA 2WTFA 3HHLD 3K7RA 2AJ2A 5A0YA 5JVHQ 2G2ZA 1RAEB 4E0DA 1OSDA 3SEOA 1Y5NB 1IKXA 4RPFA 4LBIA 5DDOC 3EMTA 2MPUA 4ECSA 2VBYA 1TV6B 1HI1A 5DGAA 2DKOB 2YNHB 1LWEB 4LSLA 2YNFB 1WC0A 1U1LA 4RUAA 3CDAA 5ADZA 2JC0A 3C15A 1DZ5A 3TUZC 4J91A 4WXOA 2YKPA 3EVOA 2FY1A 2KG1A 1N0VC 3WHIA 1RQ0A 4JI1F 5KOWA 3MZIA 2VPWB 4RKUC 2K3IA 1RKIA 5DQIA 4FNIA 3EDRB 4FPIA 1B70B 1YVFA 2CPJA 1RLCL 4RO0A 3QAEA 3RAQA 3D6HB 1CC8A 2VQEJ 4K4UA 5BYSA 1EX8A 1VC0A 1RSCA 2B9WA 2ZHBA 1B0PA 3HD2A 4LVOP 3OR2B 4U95A 1ZAWA 2COLA 1CC7A 1JIHA 1KS2A 4ZVTB 3DLEA 3CCES 3RJMB 3V6HA 4UOHA 5AJ3J 2N7CA 2VG6B 2D3ZA 2GJIA 4KKOA 2OFHX 4KGMA 2ZBQA 2E5GA 2HHPA 2HHSA 4WFXA 2VFUA 2HFOA 4CLKA 1WACA 2V50A 2SXLA 4Y28C 1KFSA 5GAHI 3RAMA 5J2QA 2W8LA 3HVTB 3WX8A 4BS2A 3J7YI 3DYAB 1G7CB 3L7OA 1VRTB 1FD8A 2ZBIA 3TJ9A 3PY8A 1VLOA 4QR2A 1VBZA 2YWFA 3EZ5A 3DHXA 1XMBA 2RJZA 4DSIA 2R2TA 5GMDA 4B08A 5IXUA 4B3MJ 1QSYA 2PD1A 3UVJA 2P9GA 1M1HA 1AW0A 2HQDA 2ZHAA 3W9JA 4AFFA 1N5YA 2GVDA 1TKZA 1FJGJ 4AE5A 4KE5A 4OI4A 1H2TZ 3T1YF 2OIHA 5H9EK 4NEYA 3J81U 3TAMB 1BXNA 5ETOA 2VPYB 3KLGA 2DGOA 3MECB 1Z1ZA 4FF4A 3KKFA 2IFXA 2XYHB 5THWA 2IIHA 3HZGA 3AB2B 2Y1IA 3C14B 4JI4F 1KSPA 4C8LA 2R42A 2KO1A 3MMCB 3TQ1A 2RRBA 4DG1B 4E2FB 4CO1A 1XIQA 4URQU 2K7JA 2C3UA 1I3OB 3FFIB 5IS2A 2YWGA 4PG4A 2RQCA 3RRGA 3D0IE 3DMJA 4IR9A 4FYXB 2KH9A 4Y3CA 4K2JA 4ECYA 2GMHA 3DLGA 4F50A 4IFVA 4USJC 1LFWA 3EDQB 2OD4A 4MKVA 4N47A 2Y1LB 1NDLA 4IO9Q 2HQCA 1S1WB 4DBQA 3HHLC 3L3CA 4USWA 2W7OA 2H5EA 1UVKA 3M8QA 1QDUB 2MHEA 3D2WA 4ICLA 5HVFA 4F2SA 3EZUA 2DXFA 3QBCA 1K47A 4DV2F 4QWEA 5KFHA 2FGCA 4ATNA 2A18A 1VFJA 3W8PA 2DRAA 1GX5A 2LA4A 2MY7A 3BQ2A 1N48A 2VD3A 2G9OA 3MI7X 5LXYA 3PRBA 1BE4A 4Q8FA 4DR7F 2F1FA 3PJXA 1HI8A 2E1RA 4IOAQ 3FEXB 2AEJA 3OTOJ 4JI5J 3NLCA 2B4UA 4R5PA 2VV5A 1U45A 1H0HB 1U02A 2GJFA 4WP9A 4ZS6A 1QUVA 3KJVB 1JLCA 1REGX 1NJZA 1RAAB 4DV6F 4Z37A 1R8AA 4J5OA 3CNQP 3CSKA 4TU9A 4I68A 3GCWP 3R5GA 5L46A 5BR8J 3J80U 4ZVUB 4LQ3A 3GE9A 4HI1A 4DUZF 1PCAA 3DM2A 4ECRA 3H5XA 3N28A 4U67Q 2GO8A 3D6TB 2ZITA 1UVMA 2J9EA 2ZH3A 2PC6A 3CJ4A 1M0SA 3KYLA 2PE8A 1VRUA
chains in the Genus database with same CATH topology
3MM9A 1TAQA 2KT5A 4PQUB 1F60B 5IT9Y 1YRUA 4EU0A 3CDWA 4X64F 4FXVA 1IKVA 4ED0A 1IBLF 2LKZA 3V2UC 2I2YA 4TU8A 1N32F 5MAOA 2QYCA 2XLJA 1IBKF 4IR1A 3TVYA 2JX2A 1DTQA 3OQ2A 1M5PC 2B7BB 2HWTA 3V6DB 1QVGR 4CNZA 1G2EA 2MSSA 1DQ8A 4ED6A 2VQEF 4DFPA 3TVZA 2DNNA 2GW8A 2BZ2A 5D8HB 2VA2A 4UW2A 1FTRA 2YKQA 2V2KA 2J9CA 2VZ9A 3DLKB 4DQPA 3BO4A 5C25B 1QJHA 1XR7A 4LFAF 1ZTWA 1YJUA 4X4NA 4A8SA 1WEZA 4DSKA 2FC8A 1L5UA 3DOKB 3MURP 1VQNS 4TNOA 2FVSA 4MIBA 2E29A 3ISZA 3UNGC 3KK1B 2DPJA 2HVIA 1HQEA 4RW4B 2EFVA 5KT3A 2YVSA 4JUZA 2J76E 4R0JA 2QE5A 4USHA 3OUYA 3VAJA 4ZPAA 1YG0A 3X3UA 3IRWP 1U6BA 3BGRA 1ROFA 1IKWA 3VAHA 1JKHB 1Y0HA 4DV1F 4B9TA 1M5OC 3MM8B 1PILA 1A9NB 2Y0SD 2WBMA 4KO0A 3BB5A 3O8WA 2N4CA 3RB0A 4ZP8A 2LXUA 3KHRA 5CYMA 4DR1F 3G4SS 3BGUA 2EK6A 5T14A 3HP6A 1Q86T 3FSXA 3PW0A 4FBUA 2M4MA 4Q45A 2NS1B 2NSBA 2PN6A 2YNGA 2ZUGA 3V6DA 4WE1B 1NJXA 5AXMA 2HS3A 2UXBF 2ZDPA 1ZZNA 2B5JB 3NNHA 5F8NA 2RIJA 1SJFA 3HHKA 2HVHA 1N5VA 2VOPA 1V3RA 4PWDB 3BO2A 2LQ9A 3EPGA 1PGZA 3I4PA 4JBCA 5CYQB 4ED8A 4EBDA 2VKZG 3DLBA 3CIZA 2DNYA 3S7RA 4ZVEA 5B08A 4YB7A 2HNZB 3G8TA 1HYSA 2FUG9 4RNFA 1O51A 1XC9A 3GIMA 2KKHA 2M2BA 5A0YB 1NK7A 3BM7A 3K58A 4DV4F 3UD3P 4BWJA 4TKTA 1FEEA 4RW4A 4C7QA 2CJBA 1IKXB 1RJJA 2FVPA 1Y3KA 3M30A 4DMZA 4M5DB 3HXMA 3LP2A 5E3CA 2X1AA 4MKBA 4DSFA 2P9CA 1X0PA 3CD6S 4ES3A 4NA1A 5KG5A 1TP7A 4LSLB 2KJWA 3GYNA 4QBUA 3K5NA 2RKIB 3MM8A 2ZH8A 2QO3A 2BV3A 4ID8A 3Q8QB 4BWMA 2OH2A 5IT0A 4F02A 4QJVA 3H2UB 2UVRA 3Q23A 3B4MA 3QPIA 4NRTA 2HGLA 3GR0A 2JVRA 1N8RT 4RUHA 3UE2A 5M2UA 1BQMB 1YWXA 4KV8B 4WE1A 2HLUA 1H3DA 1LWCB 5HP1B 3HVWA 4RBTA 2OKQA 3NCPA 3WX4A 1UFWA 4XDDA 5D78A 3MF5A 3GIIA 3CVKA 4J9NA 4R25A 4PWDA 3PRDA 1W25A 1R8PA 4I4BA 1V9OA 2B4VA 1Y5IB 1FDDA 1O0PA 4UUXA 5F3ZA 2ZD1B 5IT4A 4X65F 1UKUA 1NK9A 2IC3B 4F25A 1SV5A 2HNZA 3Q2SC 2NUHA 5KFQA 3ZZOA 4A8WA 3S8SA 4RW7B 2MKIA 3H40A 2YKAA 4NYPA 3IGVA 3I82A 5DM6Q 2VODA 4OV1A 3DRSB 2VBWA 2YTCA 2AGQA 1R8HA 3PKMA <