2IM2A

Crystal structure of poliovirus polymerase complexed with utp and mg2+
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Stabilization of Poliovirus Polymerase by NTP Binding and Fingers-Thumb Interactions.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
molecule keywords poliovirus polymerase
total genus 138
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 2im2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2im2A02
5DQIA 1JLCA 1S9EB 1S1WB 3C6TA 2VA3A 3TAMB 5J2PA 5HROA 2AGPA 4QWBA 3MR6A 2W9AA 1S9GA 5C24A 3KK1A 2W7OA 2IM3A 5KT5A 4RNFA 4NRUA 1RDRA 4IG3B 2ASJA 4FS1A 1JLAB 1EETB 2R2SA 1N5YB 2W8KA 2HNDA 2YNIB 1EP4A 5DG9A 3IS9B 3C6UB 3LP2A 3RB4A 2OPQA 3IGNA 1S1UA 2W9CB 4GC6A 1HNIB 4WFZA 2BQUA 2GIRA 2HNZB 2IC3A 1FK9A 1IKXA 3DLEB 2BQRA 2ZE2B 3RBEA 2WRMA 3DRSA 3OSPA 4HKQA 3ISND 4WYWA 3H2LA 3QGHA 4H4MA 3OSNA 3N6NA 1HYSB 1JLGA 3CDEA 2RKIB 3FFIA 3ITHB 3T1AA 4X2BA 4MFBA 5KFMA 4J9SA 4ECTA 3KMQA 2FLPA 4K4XA 1TP7A 1IKVA 1RT6A 4KKOA 5C42A 1C0UB 1W25A 3V6HA 4ECYA 1MMLA 4KO0B 3I5CA 4LQ3A 4RU9A 4J9MA 1JXLA 1VRUB 1HQEB 2OPQB 4K4WA 1XR7A 2E9ZA 1RTIB 4J9QA 1FK9B 3DLEA 1LW2A 3RB3A 4J9PA 4B3OB 5KFGA 3D28A 1DTQB 1RT4A 2I5JA 5L1LA 2J6SA 5FDLB 4DL4A 3I0RB 3NBPB 2ZE2A 2E9RX 1HQUB 3DRRB 2BR0A 1RTDA 2IMWP 1S1TB 4KAIA 3LALA 3T5KA 3KK2B 2DPIA 4NRTA 1J5OA 3MR3A 5J2NB 4F50A 5CYMA 4QWEA 5D3GB 4F4WA 4Q0BB 5KG5A 3OHBA 1VRUA 2XGPA 2V4RA 3GV8B 2J6TA 5KG4A 1JKHB 2ZKUA 5I42B 1R0AB 4PWDB 1TV6A 3Q8SB 2BRLA 1S97A 1BQNA 2FVQA 4KB7A 1HQEA 3LAMA 3I5AA 1IKYB 4TN2A 4GC7A 1LWFB 3DI6A 3E01A 5KFLA 2YKNA 4J9NA 1IM4A 4ICLB 1JLQB 4KHMA 2FVRA 4IOBA 5KFKA 4EO8A 2HNYB 3JYTB 3RAQA 2FVCA 1C1CA 4PWDA 3FSIA 4WE1B 1IKXB 3UDLA 1UWBB 2FJWA 4K4TA 4PQUA 4ZMMA 4I7FA 5J2QB 4MKBA 3MR2A 1JLQA 4J9RA 3V6JA 3I0SB 5DQGA 3DOKB 3H5SA 5C25B 2JC1A 2XC9A 3M9NB 1NHUA 2JC0A 2AGQA 1N5YA 2YNHA 1LW0A 1N48A 5T14A 1S1VB 4H4OA 5HBMA 4O4GA 3BJYA 4RW7B 3H5UA 4WZMA 5J1EA 4NYZA 3JSMB 1D1UA 3JYTA 3MFHA 3DLKA 3DRPA 4NLYA 4LSLA 1T05A 3TVKA 3DLGA 3KMSA 1QE1B 1LW0B 4TQRA 3SFUA 5KFAA 5DG8A 4ECQA 2UVWA 5KFZA 2VG5A 2D7SA 1S6PA 3CJ2A 4EBEA 2YNFB 2RDJA 5KG3A 4R5PA 4PQUB 2FVSA 1DTQA 1RT4B 4EBDA 4ZVHA 3DMJB 2IAJB 4Q8FA 3FQLA 5C5JA 2BE2A 2OH2A 1SUQA 3SFGA 4TYAA 4O3PA 4U6PA 3RBDA 3BGRB 4R0EA 3Q8PB 3IRXA 2HNZA 4HYKA 4QWDA 4DL5A 2BANA 2YKMA 3UR0A 4ED6A 4FBUA 3DLGB 3GQCA 1S1XA 4Y34A 1BQNB 4KHRA 2CKWA 1RT1B 4ZPAA 1RTJB 3NAIA 4G1QA 1HNVB 5KG7A 1JKHA 1EETA 2D3UA 2RKIA 4EYHB 5I42A 1T94A 1R0AA 4WFXA 3H98A 5KFTA 5L1IA 2OPRB 1RT3A 3Q8RB 4ED2A 2FJXA 5KFJA 4ZP6A 3N6LA 4ECRA 2C2DA 3BGRA 4ZP9A 2IC3B 4MKAA 1JIHA 4IH5A 5F9NA 3MEEA 4TY8A 3Q8QB 4ED7A 3PW7A 4ECUA 2ZD1B 2IA6A 4IR9A 3EPGA 2IAJA 3GV7B 1RT5A 1JLGB 1RTIA 1IKVB 2AX0A 3OL8A 2IJNA 4KKOB 4O44A 4J9LA 4IDKB 3FRZA 1LWEA 3HHKA 5EWGA 2R2RA 3DRSB 3GIKA 1FKPB 1ZTTA 1RYSA 5KFYA 5F9LA 5KFWA 5C42B 4H4MB 5KFOA 4I2QB 4KV8B 1RYRA 2V0NA 4ZPBA 2E9TA 1KLMA 2WB4A 3E51A 5KT4A 4IH7A 5KT3A 2R8KA 2O5DA 1D0EA 5HP1A 2FLNA 2B43A 1DLOB 1RT6B 1ZETA 4IH6A 4RW7A 4Y2CA 5K14B 1T03B 3KK3B 4PUOB 4RNOA 3DDKA 2VG7B 4ZVGA 5KFXA 3BQ2A 2JEJA 1RT2A 2F8EX 4O44B 5KFBA 1QE1A 3BSNA 1S9GB 2W9BB 1RTHA 5F8NA 4IFYA 4ZHRA 3E01B 3JSMA 1S1WA 2C28A 4IR1A 3M9MB 2R2TA 1HMVA 1S10A 1HQUA 2B6AB 4PUOA 3LP2B 3QIPB 3H59A 4QWAA 4NLSA 4Y2AA 5CYQA 3H5YA 3DM2B 2XCPA 1JLAA 5KFRA 4MK7A 1TL3B 1DLOA 4TXSA 1TQLA 2BRKA 5F8GA 2DPJA 1FKOB 4Q8EA 4JV1A 4IFYB 2R8IA 1T03A 1RTJA 4YMEA 1IKYA 4ECXA 5J2QA 4IG0B 3IG1B 5JXSA 2BANB 1K1QA 2WK4A 1TV6B 1HARA 2QE5A 3LP0A 2OPSB 1SH0A 1GX6A 4R8UB 1JX4A 2XGQA 2HNYA 5KG2A 3BR9A 1C0TB 3M8QB 4RUAA 1UWBA 5DG7A 5HLFA 3KLIA 2HWHA 2B6AA 2ZD1A 3NKYA 5EDWA 5EWFA 2B5JA 3TQ1A 3LP1A 1RAJA 4F4ZA 3OL6A 4Q44A 3CJ3A 3KLGA 3PW5A 4NLVA 1SH2A 2VG6A 4DL3A 1TKTB 3T19A 1TL3A 2RF2A 4IDKA 2HWIA 2UUTA 3DRPB 1LW2B 3NBPA 4EO6A 2YNIA 4YP3A 1RTDB 2UVUA 1C1BA 2I5JB 3OLBA 4IG3A 2HMIB 4DL7A 4O3RA 1TVRA 3NL0A 1SUQB 5F8HA 3LP1B 3BQ0A 1GX5A 1NNDA 5I3UA 5HLFB 2V4QA 1EP4B 2AU0A 3KK3A 4NLTA 4EBCA 2ASDA 2VG5B 2R8HA 4O4RA 4MFBB 4NCGA 2J6UA 3QYYA 1S6QA 5J2MA 3OL7A 5KFUA 2C2RA 4O3NA 1JLFB 4KO0A 4IRKA 4URSA 1K1SA 4NLPA 1FKOA 4MK8A 1JLBA 4YR3A 4XO0A 4ECZA 2JEFA 3GV5B 4IG0A 3CJ0A 4ZP8A 3UQSA 4JUZA 1Z4UA 2CJQA 3LP0B 3KHRA 2ALZA 1S1XB 2YNHB 3PJWA 2IM1A 2IM0A 1TL1A 3H5XA 3FDSA 5CYQB 3I0SA 2UVVA 3DRRA 3VQSA 2UUWA 3IS9A 5L1KA 4DL2A 2ATLA 3OLAA 4RW8B 4ECWA 3GIJA 1SV5A 2FVPA 3DLKB 3PR5B 2HNDB 5KFNA 2XI3A 3KLEA 2C22A 1S9FA 5KT6A 5F8JA 3QGIA 3DYAA 1QAIA 2AGOA 1TKTA 2AX1A 4G3IA 3MEDA 4FBTA 2VG6B 2R8JA 4O3QA 1YVFA 3PW0A 2D41A 1NHVA 4IRDA 5HP1B 4ED1A 3I5BA 4ICLA 4KBIA 1C0UA 4TQSA 3V4IA 3HVAA 2QV6A 3ITHA 5K14A 3NGDA 2EC0A 3ICLA 3DM2A 3CO9A 4RW4B 3MEGA 4DG1A 1RT2B 4NLUA 4F4YA 4ZP7A 3PW4A 3EPIA 4WE1A 3FFIB 1VRTB 3OHAA 4IKAA 1TKXA 4RW8A 5KFDA 3N6MA 1REVB 2WHOA 3H4BA 5DQHA 3HVTB 3I0RA 5KFIA 4JV2A 3KLHA 5I3UB 1TVRB 4NCGB 5KFFA 2UVRA 1RT3B 1WNEA 3KK2A 2RDIA 4ED0A 3DYAB 4O3OA 2C2EA 4NZ0A 3NMAA 5CYMB 5FDLA 4QW9A 3V6DB 2VA2A 4ED3A 3PVXA 4J9OA 4U7CA 4LSNB 1RT5B 4IQXA 5KG0A 2ILYA 5J2PB 4XPCA 2XI2A 1TKXB 2WTFA 5KT7A 5J2MB 2JEIA 4MH8A 1LWEB 3KHGA 3DOLB 1XR5A 4K4ZA 1S0OA 2B5JB 4IFVA 1U09A 4R8UA 4RZRA 4F4XA 3IRXB 3KLHB 4M95A 2YKNB 4DEZA 1HPZA 1C0TA 1ZTWA 2YNFA 5KG1A 1I6JA 4M94A 2XWYA 4NLGA 3CDWA 1KHWA 4KE5A 1J5OB 2AQ4A 3LAKA 2BE2B 3HVWA 3IN5A 4XPEA 1QAJA 1HNVA 4O4GB 4KSEB 5KFEA 5HROB 3V4IB 4IRCA 1S4FA 2RF2B 2W7PA 3G6XA 2R2UA 2YKMB 4O3SA 4Q45A 2IJFA 1TKZB 5DLFA 3KHLA 1N4LA 4FS2A 3MEDB 4WXWA 2YNGA 3RB6A 2IBKA 3GYNA 3H4DA 2OPRA 1DTTB 3KJVB 3CJ4A 3T5JA 1S49A 4H54A 4QPXA 3HVTA 3M8QA 4MIAA 1IKWB 3M8PA 4K4UA 5J1EB 3M9OB 1JLBB 1N6QA 5KFHA 5KFSA 3LANA 4ZPDA 5F8IA 3CDUA 1HNIA 3CVKA 4URQU 3TAMA 2GIQA 5KT2A 3QZ8A 3MTKA 3KLGB 1XR6A 4ECSA 3QGGA 2IM2A 4LQ9A 1S6QB 4KFBB 2VG7A 3DI6B 4ZVEA 3QO9A 4NLRA 4KV8A 2YNGB 4R5PB 2FLLA 2D3ZA 3QLHA 3GIIA 2HAIA 3ISNC 3OL9A 1C1CB 1RA6A 1LWFA 3MECB 4RW9B 1RT7A 4RW6A 5EUHA 1S0MA 1RTHB 2GC8A 5KFVA 4ZHRB 2WOMA 3PJXA 4NLXA 3T5HA 5F8MA 1OS5A 3KOAA 1SV5B 1TL1B 5KFQA 5DGBA 3QZ7A 1HMVB 4RNHA 3KLVA 1S1TA 3DOLA 4NLWA 1C1BB 4ZVFA 3PR4A 4TLRA 4QWCA 5J2NA 4Q43A 4I2PB 3V81B 5KG6A 1JLEB 3PW2A 4RW6B 3MEEB 4TY8B 5D3GA 4B3OA 3BSCA 3FQKA 2WOMB 3H40A 1BQMA 4IFVB 3EZUA 3RAXA 4K4VA 4WYLA 3MECA 4RW9A 1HPZB 2FJVA 4K50A 3IGVA 4NLDA 4RNNA 3QLHB 1FKPA 3DMJA 3PHEA 3CJ5A 1JLFA 2AWZA 5EWEA 4TY9A 3QIDA 4K4SA 3GILA 5JUMA 1HYSA 1S1UB 5DLGA 2W9CA 2WONB 1S48A 3UPFA 3M8PB 4YQWA 3V6DA 3C6UA 4NLQA 4Y3CA 1C2PA 5KFCA 1MU2A 3KLFA 2ILZA 1S0NA 3D5MA 2WCXA 3G86A 2W8LA 1JLEA 1IKWA 3MF5A 3RB0A 4QW8A 3SI8A 3QIPA 1QUVA 1BQMB 1S1VA 4G1QB 4H4OB 5HBMB 3MFIA 3V6KA 4OL8A 5L1JA 3NAHA 4DL6A 3BSAA 3BREA 3CIZA 2JEGA 2I1RA 3DOKA 5C25A 4WZQA 4EEYA 2OPPB 2W9BA 2XCAA 1RT1A 4EYIB 4YR2A 4ID5B 3KNAA 1JLCB 1S9EA 4LSNA 2R8GA 2HMIA 4MIBA 4J9KA 4RUCA 1T3NA 2BQ3A 3KLEB 2JLEA 2OPSA 1LWCB 5C24B 3KK1B 4WXOA 5F8LA 1MU2B 4KFBA 3KLFB 4DG1B 3MR5A 4I7FB 1KHVA 1CSJA 3KHHA 3C6TB 3T5LA 3BSOA 2WONA 4TYBA 1RA7A 1RT7B 3QO9B 3KJVA 2ASLA 4ZPCA 3GIMA 3G6VA 5DGAA 1N56A 3BQ1A 2V9WA 4WFYA 1KLMB 3CWJA 3PZPA 4NLOA 1REVA 4RNMA 5KFPA 4RW4A 3IG1A 4I2QA 4I2PA 3V81A 3HKWA 4LSLB 1T05B 1S6PB 5L9XA 1LWCA 1VRTA 4MK9A 4URGA 3KLIB 4ED8A 1SH3A 4K4YA 3MEGB 4Q0BA 4ID5A 4YR0A 4JV0A 2OPPA 4ECVA 1TKZA 1N6QB 1DTTA 3G6YA
chains in the Genus database with same CATH superfamily
1MROB 2CJXB 2K2PA 3CCLS 4UUXA 5LMNF 1YHQS 1NRKA 4WKRA 4LJMA 1LXJA 1Q0NA 2W9AA 3EJMA 2CRLA 3KK1A 2W7OA 4Q5VA 3CCJS 1WDTA 4WU2A 3K5LA 4PAAA 5GADI 2ASJA 1EETB 1F60B 2R2SA 1HNWF 2W8KA 1IQTA 4DR1F 3C6UB 4YB6A 1F0XA 1SIWB 4HDHA 4AQYJ 3RB4A 2R7SA 4CH0S 2NS1B 4EGLA 3W3SA 4WFZA 2EI5A 2AV5A 2YTCA 1FK9A 1IKXA 3DLEB 7FD1A 4CM0A 3MMBB 1NB2A 3T9ZA 3VVUA 2HGNA 4C3MA 4WCEQ 2QA4S 2DNKA 3QGHA 4ZLPA 2EPIA 1YJWS 4DV1J 2K06A 2MQLA 3D1QA 4U96A 2YVSA 4NA2A 5KFMA 3MURP 4J9SA 1MSWD 4DR5J 2M3DA 3KMQA 2Z8QA 3AXMA 4HTJA 2UUAF 1RWWB 3L7UA 4HEA9 4HHJA 4KKOA 4DBQA 5C42A 1C0UB 3V6HA 4HLBA 3SV3A 2W2OP 2KHCA 2J0XA 4LQ3A 1HNZJ 3OTCA 1HQEB 1EB0A 2JNJA 2VASA 2GMHA 5B7WA 2Y8WA 1RTIB 2OIHA 1FK9B 3DLEA 1LW2A 3MPUB 4Y6IA 1DURA 5E0OA 4C8NA 1NHKL 4M5IA 1S6OA 1TL7A 2ZH8A 1RT4A 2MMYA 2FDNA 1U4BA 4V19J 1OIAA 4OZNA 5L1LA 2XMMA 4BS2A 4DL4A 1SPBP 2V9KA 4ZK7M 3ONQA 2FZKB 3MMBA 3DRRB 4NEZA 4CDIA 2BR0A 3CNQP 2IVFB 2LQBA 3H7HB 1O51A 4KAIA 3CMAS 3T5KA 2WVDA 2PI4A 2VDIA 4EU0A 1VFJA 4JV5J 4ZIVA 4QWEA 2DRAA 2CPZA 4OX6A 2QLJB 2J6TA 2JH3A 1ZM3A 5KG4A 4P73A 1R0AB 1BD6A 4LF2A 3K0JA 3VV2B 4F36A 2MLXA 3LGHA 4CI0B 4JI8F 2HQIA 3CCVS 1HW8A 1IKYB 2AEFA 3JTNA 1LWFB 2W25A 5HI7A 2BOAA 4J9NA 3IP0A 1AXQA 5JMNA 2U1AA 2FVRA 2KKHA 3LF0A 2OGUA 5B0GA 5KFKA 4DQIA 1R8HA 3NNHA 1FF2A 4NA1A 3GMGA 3RAQA 2IRUA 4PWDA 2KZMA 3FSIA 3M6UA 2KVIA 4WE1B 3UDLA 4X66J 3G8QA 4KGVB 2DJWA 5A2QY 4X4SA 1WEZA 2NXCA 3VWSA 3MR2A 3OJSA 1ZS6A 1WUUA 5E3PA 2XC9A 2JC1A 1N5YA 4U8YA 2QG9B 4PPDA 5LM7E 2BACA 5T14A 4LRDA 2N3OA 3GPAA 3FVYA 3Q89A 4YB1P 3OUYA 3BH7B 4LF1A 3K5OA 4DFJA 3HK2A 2XO6A 2VFTA 2ASYA 4HHHA 3W2VA 4DN9A 3PX4A 1HD1A 3Q0AA 2E1MC 4LSLA 4ECQA 4DUTA 2CDQA 1RHUB 4W4MA 1WC6A 2J9EA 2VG5A 2WSEC 1UWAA 4C8OA 3AOCA 5KOXA 3TUPA 4EBEA 3Q8VA 4LR8A 3T6BA 2EKNA 2ZBIA 4OMFG 1DTQA 1SKRA 4JI3J 2V2KA 1NZAA 2P9CA 3R27A 3C66A 4LF5J 4DV5F 5C5JA 2YBVA 3EE3A 4GRSA 2OH2A 2C2NA 1U1MA 1FRLA 1HQ2A 1QAXA 2EK1A 4TYAA 3RTVA 4QPTA 3RBDA 4HYKA 4R0EA 2UUBJ 4ERDA 1UL3A 3IFEA 4CM2A 2RHQB 2HK2A 4BHQA 5A8RB 2BANA 2Z56B 3GFXA 1WD6A 5J1PA 4ED6A 5M2UA 1XN9A 3B78A 4RBUA 2CKWA 2BV3A 4ZPAA 1RXOB 4G1QA 1FWLA 1C4AA 2Z4PA 2D3UA 5KG7A 2XY5A 3FBCA 3GFZA 1R0AA 1NSKL 4N41A 1YBTA 4ZCLA 3EUNA 3IBFB 4Y2MA 1SKWA 4I6YA 2H54B 1K73T 3J80U 2EK6A 2NXNA 3GP9A 2IC3B 1JIHA 3DCAA 4IH5A 4OX9J 1MNEA 3AX2A 1WC5A 2RT3A 2ZD1B 3DC2A 2LQJA 3FEYB 2IA6A 4DR3F 4ER8A 1YTYA 1VCTA 1JLGB 1XK8A 1IKVB 2LXFA 3OL8A 4J9LA 2CG8A 3M2VB 1YJVA 4YEAA 5DDOC 1FNMA 1TL7B 3AJ2A 2YX1A 3DGPB 3DRSB 3HHKA 4OHVA 3GIKA 2PEBA 2EBEA 1HBNB 1WOPA 1TMMA 2G13A 5F9LA 3B4DA 5IQQA 4H4MB 5KFWA 2X3DA 5H9EJ 1KLNA 4KPYA 1RYRA 2B7CB 2F8MA 2B4PA 2E9TA 1KLMA 2WB4A 3M30B 1Y11A 1XWLA 5KT3A 3CCES 2KFZA 2LCWA 2O5DA 3OR1B 3UCUP 2VICA 2B43A 1HIYA 3UN5A 2HWTA 3KDNA 4IH6A 4PG4A 2RDDA 2ZBRA 1T03B 3DLHA 2Q79A 1XNQJ 2AD9A 4F4WA 3WC0A 5KFXA 2R7XA 3OR2A 3HHNB 2Z0GA 4F7VA 4C97A 4O44B 3OTBA 3MEKA 4KC5A 1NPPA 2VBWA 3TEHB 3JAMY 4JI6J 4ZHRA 4IFYA 2RU3A 1S99A 2CPIA 1S1WA 2H9ZA 2VBZA 4E98A 2R42A 3LUYA 3P5TL 3TUZC 4PXBA 3R5JB 1HMVA 4LFAF 2UXCF 2HBYB 2B6AB 4PUOA 5FJ4A 3QIPB 3H59A 4QWAA 4JI2F 5CCLA 1NLKL 3ADAC 2RQKA 5D77A 4C9DA 4LREA 2EBGA 2KM8C 4A8FA 1DLOA 4TXSA 3R1LA 5F8GA 2X1BA 2BA9A 1GFWB 1YJUA 2I6WA 3TP2A 3U1MA 3H25A 1XMQF 1RTJA 1IKYA 2PMWA 3JXOA 5SZTA 3M7VA 2OTLS 3R2DJ 5JXSA 1H3DA 2QMUB 2QO3A 1DY3A 4DU7A 2D9OA 3NCPA 1X60A 4HACB 1HARA 3DHWC 5EX0A 4TU7A 1SH0A 4DSKA 3HX9A 3X1LB 1Q95G 2YKOA 4ZKAA 2XGQA 4ANDA 2E5LF 2B4VA 3MMCB 1IVZA 4KGZB 4C0BA 5HQ8A 1HWUA 3R5AA 3FRYA 3W7BA 5ETMA 4DV0F 3NGKA 3QFWA 3KLIA 4PQAA 5HLFA 2B6AA 1UP1A 2KXFA 3LP1A 3EGZA 1R89A 1NPKA 2P6SA 3OL6A 1R6YA 1ZM2A 5BYSA 2HQFA 3BZQA 4RBVA 4A8YA 5CYJA 2ZFHA 4A8KA 3MCMA 4DQPA 1NSAA 5ETQA 2M9KA 3IR6B 3OTOF 3FEXB 1YDLA 2BJ1A 3NOCA 1LW2B 3W2WB 4EO6A 2Y9HA 1WC0A 4WTYA 1M1KT 2X7IA 3QMQA 5CH7B 4B3TF 3KUHA 4IG3A 1VBXA 3DU5A 1VQPS 2CZ9A 3RR7A 2NXEA 4PABA 5BXIA 2L3MA 3M30A 3NEKA 2FIUA 1OQ6A 2DGQA 2N82B 3DLJA 4LRAA 1FD2A 4IYQA 4CO3A 3LP1B 3CJQA 4A8OA 5KTQA 3Q24A 1X7VA 1P9QC 2RSQA 1L3VA 2FY8A 3GU0A 5I3UA 4IUFA 5HLFB 1JXEA 4M5KA 4Q2LA 4ED5A 4NLTA 3QAUA 3GR1A 4NL5A 2EFQA 2Q43A 3GR0A 4EBCA 2OHDA 4MFBB 4NCGA 2K1RB 2E1PA 3I4PA 3QSYB 1P27B 2J6UA 5B09A 3W62A 5J2MA 3WIVA 3OL7A 5E3RA 2LXIA 3W5XA 2C2RA 2CPJA 1DZ5A 1UW4A 1HHQA 4KO0A 4GO5X 4U7UD 1K1SA 1TAQA 3CJTA 1JLBA 1X4FA 3H2VE 4XO0A 4C48A 3FNNA 4NXNF 2GA7A 1FVQA 2J7WA 3CJ0A 2HG4A 3B4MA 4ZP8A 3UQSA 1FESA 2CQ2A 2VOOA 1Z4UA 2B8PA 2V5HG 3GONA 2ALZA 3LP0B 2GCFA 1U1QA 2YNHB 4XAKA 5CCMA 4LF7J 1SJ3P 2IM0A 1U1RA 1U48A 1I94F 3I0SA 3PFOA 3VQSA 2XZWA 5H9EK 3K7RA 1OSDA 2HS3A 1O8BA 4DMZA 2PA3A 5ITHA 1NJYA 1F2HA 2LQ8A 4NX9A 5GADU 1RHQB 4ELTA 2WSCC 5ETRA 3CJ8A 1FFGB 1RWOB 1GAOA 3POTA 2AMCB 4DZ6A 3GIJA 3DNCA 2ABYA 3EDRB 5I3PA 5AJ3J 2C22A 1RTZA 2KO1A 2BJ7A 2QMWA 3IO1A 3U7JA 2LEBA 1T8EA 3THPA 3TANA 1QAIA 2HFOA 2LLZA 1FRXA 3NRBA 4M63A 2NPFA 4LF8F 2HURA 2W01A 2WVCA 4OZJA 2VQEJ 3TUJC 2DCUB 4IRDA 5HP1B 2N7CA 2PIIA 3I5BA 4TQSA 4ILLA 4M5GA 2ACMA 2OELA 1Q1KA 3EX7B 2JHEA 3NGDA 4RU2A 4DR4F 1N54B 3MPDA 1VOMA 2W4CA 4ZP7A 3EPIA 4WE1A 3FFIB 3POTB 3CD7A 2KH9A 4DCOB 1TKXA 1YITS 2Y8YA 1VGYA 5KFDA 4YHHF 1REVB 2WHOA 3TR5A 1N33J 5ETVA 4TU8A 3HJVA 2KN4A 5HK4A 1TKDA 4NZ6A 3RRKA 3GYGA 2RDIA 5A8KB 4DSFA 1IBMF 4GVLA 2J76E 2VPWB 4QW9A 1NXIA 1Q79A 2L48A 2WB1D 4ZLLA 4HR2A 4ED3A 2VA2A 2F8HA 1VQMS 1G4CA 1D09B 3KDOA 4OHYA 5DZ6A 1RT5B 4IQXA 1HNXJ 3HFVA 1YX2A 3NWGA 3MOZA 3QWPA 4OZ1A 2KJVA 2ZWOA 4M5DA 3WZ0A 1TKXB 2AKWB 5GAGU 5J2MB 3DLBA 3C46A 2XULA 2DNLA 3K59A 2JEIA 4X64F 1FTRA 4D3HA 3WX4A 2E66A 3DHXA 4PXEA 4X4NA 3TZXA 1KKHA 3DN9A 3C16A 1PBUA 3D0IE 3ZZTA 3H2UB 2DNHA 4R8UA 4ZPVR 2KB2A 2M88A 3IRXB 3N4WA 4OLPA 1IM6A 2G1DA 1YJ7A 2GNKA 1HPZA 2FJDB 3MD3A 2CIMA 5B0EA 4ZVRB 3S7RA 3HJFA 2YNFA 5KG1A 1OYDA 3FMBA 4GKKF 3CMQA 5GVQA 2V4JA 3IAM9 1WTFA 3HHEA 3D0GE 3KUEA 3VAIA 3CDWA 1KHWA 3SBMA 4OYBA 2AQ4A 4LF9J 2CQ4A 3HHLA 5F0UA 4LMZA 4DN0A 3EZ5A 4KSEB 1R0BG 8RUCA 3BGFA 2CWXA 4PRFA 4RNFA 2R2UA 1IJFB 2IJFA 1TKZB 4B3SF 1Y5IB 2LA4A 1QJHA 3GTYX 1N4LA 1OY8A 2ZUAA 2YNGA 2XY7A 2IBKA 2F4VF 3GYNA 5L39A 1WHVA 2CPDA 2M5YA 2OPRA 1DTTB 3KJVB 2XB2D 4F02A 1NBEB 3I87A 1O6XA 3O6QA 2OJ3A 4MIAA 1LWXA 1LK5A 1FRHA 4P2MA 2QFJA 1LOUA 5J1EB 1XMOJ 1JLBB 1ZPWX 1KN6A 1TZ0A 3A8IA 3I96A 4I56A 5EX3A 5KFSA 5F8IA 3D66A 4LT6A 3TX0A 2R7TA 3MTKA 2E1RA 1KFSA 3NP5A 2EG1A 2Z2LA 2IM2A 3G2XA 4J91A 1DHMA 4AL5A 1M5OC 3DI6B 4ZVEA 4ZCIA 2EW9A 5HMWA 3A3NB 1WSVA 4U95A 1S0OA 1U26A 1KQGB 3F41A 3MPWA 2DEIA 1N5VA 4KV8A 4L73A 3NS6A 2KG1A 4GVBB 5D0HA 3IM9A 3GIIA 2GVZA 4CYUA 4N5SA 3NNCA 2OD4A 2HGMA 4RW9B 1CJVA 4I4BA 3PXGa 5IC6B 3HXMA 3C3LA 3K17A 2JOQA 1S0MA 4ZHRB 1RAGB 3PJXA 2VJVA 3CGIA 5F8MA 1OS5A 1SV5B 1TL1B 2POKA 5KFQA 1HMVB 2O3DA 2B9WA 4Y65A 2MB0B 4FF1A 2E5HA 1WDDA 3W65A 1BQXA 4ZVFA 3CCZA 4TLRA 1IN0A 1LEOA 1JXVA 2Y1JA 5D6GA 1IBLJ 1WC3A 3E2EA 2HZVA 1V9OA 1M5KC 4TY8B 1BMQB 2BW7A 4KRWA 2VC1A 3NOGA 2RH3A 2AP6A 1Q4RA 1CS4B 2RILA 1CQNA 4K4VA 3OD2A 2KG0A 1M5VC 4KIAA 4RW9A 3MM6A 4OI4A 1HPZB 2FJVA 1VIOA 1T3OA 5THWA 1B0TA 2AF6A 2YKPA 4JI1F 1VMBA 3LO3A 4DV2J 1A0OB 3TA1A 1G1XA 3QIDA 2NLWA 4K4SA 4OYPA 5DM7Q 4LFCF 1HBNA 5JUMA 2Y0SD 3CPWR 1HYSA 4ATNA 2AJFE 1YJ9S 2DGOA 1U0HB 1RU2A 2NUHA 2NZCA 1RAHB 4X62F 4X4TA 2UZAA 2EEYA 3C6UA 3KFWX 1E6YB 3PTWA 4BLGA 1MU2A 2XM3A 2V6AA 2HQ3A 3KLFA 1MWZA 3DLLQ 3GIRA 2DYAA 2OSQA 2WCXA 1HWLA 4NPOA 2W8LA 3BBFA 1M5HA 3MF5A 4DPTA 2NSBA 4O0IA 3SI8A 3QIPA 3MM8B 3VAGA 5E2QA 4G1QB 3GG0A 2MKIA 3M8YA 4P2FA 4OL8A 1KEKA 2DK2A 4HH0A 3H90A 2G0CA 3CIZA 5BR8F 5A8RA 2I1RA 3DOKA 4WF9Q 5CD4H 4EEYA 1VK8A 4ZPWR 5BYRA 1X9WA 2XCAA 2RQMA 4EYIB 3NS7B 1JLCB 1S9EA 2ZOMA 3MD1A 4OJHA 3UN2A 1HWKA 4CWBA 4X4RA 4J9KA 2HMIA 2JL9A 4C3KA 2L9NA 4EI2A 2BQ3A 2E5JA 5F8LA 1MU2B 4OJ3A 3KLFB 3Q23A 4ECZA 3KHHA 3MOJB 1OJ4A 2A1BA 3CIMA 2FB0A 4TYBA 2HBZB 1RA7A 1N56A 2ASLA 1PILA 4DL0C 4OYZA 5H9FJ 5B08A 1KLMB 3BV8A 2V4JB 3CWJA 2XLJA 3PZPA 2A10A 4NLOA 1JB0C 3IG1A 1WJ9A 1X8DA 4I2PA 4J37A 3HKWA 4LSLB 3BB5A 4NE9C 4PG7A 2U2FA 1WG5A 1VRTA 3D6HB 3P6YC 3CE8A 3AAWB 2H48B 3D54A 2GFFA 4ID5A 4YR0A 4CNZA 2HFUA 3AA9A 3FKBA 2OPPA 1BC6A 3CB4A 3J7Z5 1S77D 3MAAB 4ES1A 2Z2MA 4NYPA 2QGFB 3A8KA 2P5VA 1JLCA 1LXNA 1S9EB 4ECXA 2VA3A 3CCWA 2Z58B 3R5CA 1UPMB 2V8HA 4WKYA 8ATCB 5E7OB 4MYUA 1J5EJ 1S9GA 2QA2A 4BDPA 2G4BA 3PNIA 1R8BA 2FHKA 2VDHA 2HS0A 1PJ7A 3CW2C 3GJRB 3ILIA 3BS9A 4QIGA 5D0GA 4G1IA 4OYOA 4LRFA 5HMYA 4P75A 3WDOA 5A0YB 4FYDA 1N5YB 4RO0A 3UVJA 2HNDA 3MZIA 2X3GA 3TUIC 3LP2A 1RGVA 2IDLA 5E41A 1D9DA 1LFPA 2W9CB 4CNYA 2YQ1A 1CJVB 2BQRA 3U02A 2DO0A 3HDSA 1D9AA 1E6YA 2WRMA 1UKUA 2YWKA 3BDEA 4HKQA 3IBCB 2Q6CA 1YG0A 4F0HA 4CLFA 4WYWA 2OUGA 3FMWA 3H2LA 3R7NB 3OSNA 3I82A 2E1CA 1HYSB 1G7CB 4YB7A 1P6TA 4M5NA 2DNYA 3FFIA 3ITHB 1H73A 4MFBA 3T41A 4USMA 5L9NA 1SL2A 5IT9Y 3NGSA 1H2UX 4L72B 1X0PA 2GJIA 2V8DA 3D3CJ 4TU9A 1PG5B 3SCKE 1DQ9A 1VC6A 1R8AA 1MMLA 3QJLA 1JXLA 2WBMA 3JSRA 3CJKB 2OPQB 2G2YA 1H2TZ 4OFZA 2UU9F 2E9ZA 1SXLA 3OQ2A 3CD5A 1SL0A 2BBEA 4C7QA 2DHHA 4FXWA 3J81j 2C3MA 3UD3P 1DQ8A 1SC1B 2B9EA 2GV1A 5FDLB 3I0RB 2GX8A 2ZE2A 1HQUB 2IIHA 1XC9A 3AH6A 2IMWP 1VC0A 2O66A 3PRBA 3T1HJ 2GMJA 2DNZA 5E3AA 4NRTA 2CZVC 2JFDA 1J5OA 4B3RF 3P96A 4Y0FA 4NXMJ 5CYMA 4CO0A 2HRTA 4USHA 1GQEA 3UO0A 3QFHA 2P8IA 3W2WA 2QA4G 4A46A 2XMWA 2CNNB 4CLKA 5KG5A 4A48A 2V4RA 2QLXA 3GV8B 3JSMA 1ZZNA 4KHPF 4Q0BB 1OY9A 2ZKUA 4DV6F 4PWDB 1TV6A 1RAOA 1S97A 1I51B 2FVQA 2DGSA 3QATA 3CJKA 3LAMA 4B3MF 4ELVA 3CCQS 1K44A 3PO5A 3DI6A 1QTNB 3ZZZA 4ICLB 1JLQB 1RWKB 4P74A 4RJVA 5HANA 1K8AT 4IOBA 4EO8A 3OV7A 4F0KA 3GJTB 1XNRJ 1KR4A 2DH7A 2ZUGA 3V5RA 3WBZA 1IKXB 4HACA 3BKFA 3ZZUA 3CXCR 4ZMMA 4H4KA 2XEXA 4WIIA 4MKVA 4MKBA 1JLQA 3D9BA 4G65A 1T9TA 5DQGA 3H5SA 5C25B 5LSRA 3M9NB 3V6JA 1FDAA 1LW0A 3ET6A 1S1VB 4H4OA 2MHNA 2VPYB 2CNKB 2A18A 4G6VB 4TKTA 3CUNA 1GMWD 4WWSA 1GNKA 4CO4A 3JSMB 2HIYA 4A4JA 2W2PP 4M5JA 3JYTA 2HK3A 3DLKA 4NLYA 3C15B 4YOEA 3D3BJ 5KFAA 2LEPA 2MQMA 3ZTRA 5IWAF 4ZS6A 1OMSA 2UVWA 5KFZA 2DHGA 2EFPA 1S6PA 1Q8IA 2YNFB 3JS9A 4ECUA 4R5PA 1VQ7S 4P7TA 2FVSA 4PQUB 1CPZA 4F4AA 2DIUA 1X5OA 1BE4A 3RBXA 3FQLA 4TNOA 5IZHA 3BPSP 2L9DA 4UTGA 1TL4A 5E3QA 5HAOA 1SUQA 1I5OB 3DKDA 1OPZA 4UOCA 4QBUA 3IRXA 4DL5A 4OHXA 2ZH1A 5AE1A 2M52A 4DR1J 1KOHA 2HZCA 3DLGB 3GQCA 4AQYF 3M2UB 1BQNB 3D6MB 4KHRA 1RTJB 5G0RA 4DZDA 4ES3A 5H1SV 4N56A 5LMUF 2Y1LB 1JKHA 1EETA 2M7SA 1F5BA 2Z30B 3FCWA 5I42A 2FJBB 4WFXA 4CTAB 2RQ4A 3RRHA 2FJXA 2DH8A 1PCAA 3G96A 4ECRA 1SKSA 1E6VA 2ZH3A 1R8CA 2IDEA 3CO0P 4OV1A 3ETOA 4MKAA 2XQCA 2UXBJ 3Q8QB 3PW7A 4JI0J 2F1FA 2UUAJ 3E8OA 2CVIA 2ZC4A 1UEVA 2AX0A 2D1CA 4OHWA 1VHFA 2RS8A 4O44A 4RUBA 3FRZA 2C3YA 3U1NA 1QSLA 1LWEA 5IT0A 5EWGA 1WTBA 4K2JA 5HL7Q 4JI4F 4OI0A 5AXMA 2HKEA 1Q7YT 3KJNB 2HPUA 3OPKA 1GXTA 5KFOA 1R8PA 3GFYA 4JYAJ 1ITPA 1RE1B 4DUZJ 4CIOA 1UVJA 3SCLE 2V0NA 2CADA 5KT4A 5DS7A 3MAAA 4OJGA 4DV7F 4IH7A 1BY9A 4HDGA 2R8KA 2RAQA 3U27A 5HP1A 4JOUA 1OSCA 1RT6B 1ZETA 2VJUA 4ITSA 1JWWA 1GXLA 5CA5A 3LGNA 4Y2CA 3PYGA 1GTHA 1VQ9S 4C8MA 2XMUA 4CO2A 3DDKA 5LSLA 5CHCB 2BJDA 5KFBA 2DGVA 3BSNA 2PC6A 3EGVA 3HSZA 1QVFR 1NK4A 5F8NA 1OY6A 2GIFA 1UMJA 3J80Y 1NM2A 1ZAVA 4PYAA 2MGZB 3R8YA 4C98A 2I9SA 3M9MB 5GAGI 2E7WA 2PO4A 3C15A 4FPRA 5AT1B 3ZO7A 3FK4A 2NREA 4NLSA 3H5YA 3DM2B 5KFRA 4MK7A 1FE0A 1TQLA 5HSPA 1AZSB 1OWXA 3K2YA 3DFEA 2V63A 3OXGA 1SJ4P 2ACYA 3M05A 2R8IA 2UUCF 4YMEA 1FXDA 4NMXA 4DSJA 4C0OC 1N34J 2BANB 3MPVA 3P45B 3LP0A 3BGLA 4N8OA 2ZZNA 1AFIA 3PM9A 1GX6A 1S79A 2ZJRQ 1JX4A 2PGCA 3I55S 3PYEA 2ZDPA 4P7VA 4I6WA 1WWHA 5AXLA 3BR9A 4DR6F 2YQ3A 3FBFA 4I1TA 5DG7A 5HATA 4MAKA 5EWFA 1GMUA 4F4ZA 1RAJA 4F26A 1N36J 1U0HA 5IOLA 3RAMA 1I3OB 5DDPC 3PW5A 1SH2A 3O2IA 3F56A 4DL3A 3G8SA 3IWNC 1CULB 3TOQA 1NUEA 1TKTB 2H4WB 2HFSA 4B02A 4QIVA 2MZRA 4YY3J 4IDKA 2DKOB 5K8OA 2YNIA 1C4CA 4I0WA 2BJ8A 1B70B 4PUOB 1N0UA 4HL9A 3MAQA 3OLBA 1D3WA 1FCAA 1GMVA 4O3RA 2B4UA 1RISA 4ALZA 2R3VA 2XMVA 4A8WA 3QBCA 1SUQB 1HBUB 2NXJA 3EZOA 3HHDA 1S57A 3W63A 2CQHA 4LR7A 1Q5YA 2BJ3A 2XZDB 1GX5A 4DV5J 1CJUA 3EGWB 4S0MA 1T11A 3IMQJ 2YY3A 1M1HA 2LP4A 2Q6BA 3PG9A 2OFGX 3HT3A 2PFFB 3LQVA 5B0FA 5G4DA 5LSOA 2H5IB 2R8HA 1NK7A 3QT7A 4J7CA 3CULA 4C8YA 2XLKA 5E33A 4O3NA 4CLYA 2IVMA 2YWGA 2UXDF 4UQGA 4MK8A 1CJKB 1FKOA 2HSEB 2XYGB 3D4JA 4EMDA 1HBOA 4YR3A 3IAS9 4XIUA 3GV5B 2JEFA 3LTOA 1S4EA 4N77A 1QY7A 4LRBA 4XK8C 1DJ0A 1NDPA 1ZPVA 2IYGA 2L9WA 4ZCKA 4OX9F 1N88A 3UCZP 3KHRA 3JQJA 4C8ZA 4CLLA 3IA0A 3PJWA 5C7PA 1QAYA 2IM1A 2DEJA 4EFAC 2NUUG 4E8UA 2WAQD 3L3CA 1HR0J 4F0MA 1U1OA 1NO8A 3SCJE 2W7AA 1X9MA 2UUWA 1JQGA 5L1KA 1MW7A 2CPXA 2GGPB 4K0KJ 2EFNA 4RW8B 4ECWA 4FDFA 3OXLA 3V4MA 1HW9A 2M70A 4OV6A 4ANEA 3KNGA 2FVPA 2GHPA 1FKAF 3SDEB 4KGKA 2HNDB 4FVMA 2XI3A 3D6FB 5KFNA 3KLEA 4IOAQ 2DNQA 5F8JA 1RAFB 3IWLA 4I64A 3J7ZT 3AX5A 1PIEA 4DX7A 4X84A 1X5PA 2OMLA 2VG6B 4KPCA 5LJ5Y 2R8JA 1XNQF 4ZJLA 1URNA 4AL7A 2HBRB 4ED1A 3OR2B 1C0UA 3HVAA 2B4OA 4RKUC 1DARA 3DDNA 3H8YA 5ADZA 2MPUA 3DM2A 3ICLA 2ZOFA 1Q8KA 2QSFA 4LRCA 4NLUA 3MI7X 4PZVA 4USKA 3CC2S 3PW4A 2P9GA 1VRTB 2HZAA 3OHAA 2C1EB 3GG1A 1RBOB 2MYFA 2RRAA 4E2FB 3H4BA 3Q8SB 2NXUA 2M0GB 3HVTB 3I0RA 4IOCQ 1WORA 4WFNQ 3X3UA 3VAFA 1RT3B 1WNEA 2CJBA 3KK2A 4ED0A 1UVLA 2HHXA 1Q82T 2JVRA 2BJ9A 4LVNP 2C2EA 3NMAA 1X4GA 2YH1A 4LFBJ 1YBUA 3V6DB 3HHLC 3CD0A 2XYHB 2ZM6J 1KBRA 4U7CA 3CCRS 1AUDA 4FKYA 4L3KA 3VGUA 2IFXA 2ILYA 2OFHX 2Z57B 3ZZPA 1SKUB 3HD2A 1ACMB 2DHXA 2FHJA 5K5MA 5F3ZA 1VQ6S 5KT7A 1HHSA 1GK8A 1HLWA 2ADCA 6FD1A 4ETZA 3W64A 5GAHU 4NCAA 2HFZA 4MH8A 4NWBA 1LWEB 1U49A 3FCVA 3MM5A 4CP5A 3BR8A 2B5JB 4IFVA 3SMZA 4RZRA 4F8RA 3AD9C 3AQOA 5GMEA 3OTOJ 2OI2A 3OFFA 4DEZA 2K8GA 1C0TA 2G2OA 2GW8A 2V34A 2CQIA 4M94A 4PG8A 2X1GA 2XWYA 5HJXA 4NLGA 2UV8A 5T7LA 2CDRB 1WKJA 2MY8A 4RR5A 2QA1A 4QOTA 2B3TB 2C42A 4U9RA 3IC1A 1SQFA 4UZBA 1R0CB 1HBMA 4Z7YA 3HVWA 3TO8A 1NDCA 3EGNA 1B0PA 5JJBA 3NNAA 4DR7F 1V6HA 5KFEA 2C3UA 2CFXA 3M6VA 1FJCA 3ZTQA 2RF2B 5HJYA 1Y4ZB 1MLAA 3NG8A 2DD8S 3KJQB 3W1YC 4Q45A 4KR0B 1VQOS 4O3SA 2DR5A 1OO0B 3MCNA 2MQ8A 4KTQA 1H2VZ 2H65B 3KHLA 1FT8A 2R4FA 3CJ4A 2ZJPQ 4OYIA 4QPXA 1KOOA 3HVTA 3M8QA 2CQDA 1TK0A 2OKQA 1WACA 2N4CA 1X5TA 4C6AA 2V8PA 1NJZA 2VKRA 2F3JA 1S6UA 5T7LB 1RWNB 2GHWA 1FVSA 1HNIA 3LANA 1KQKA 4URQU 3TAMA 2IA0A 2MZSA 5A2QU 2CJ9A 2V2ZA 1R27B 3Q86A 2A0FB 2HEKA 1FE4A 2E29A 3QGGA 3J81Y 2ZHAA 2VG7A 3L7PA 3T6JA 4B9NA 2VB6A 3QO9A 1IBKJ 4NLRA 2FPHX 3ZTOA 3CEDA 2QYCA 2OMOA 3LH2S 4OI3A 4UZCA 2FLLA 2XS7A 2D3ZA 1F9HA 2CQ0A 1JNZB 4FF3A 4P71A 3PDNA 1LWFA 2PN6A 3MECB 4W90B 4P10A 4RW6A 3K89A 2GGPA 4L76A 4LIWA 5EUHA 3PHTA 1RTHB 2GC8A 3H0PA 3QWUA 2WOMA 1ZAXA 3EM1A 3RU0A 2GAHC 5KFVA 4F3OA 2DXFA 1UUJA 1Q5VA 3KLVA 3DOLA 4ANCA 2KZZA 1YIJS 2APOA 1WC4A 2ZITA 4F04B 3J7YI 3R6LB 4QWCA 3F73A 4Q43A 1WEXA 1JLEB 5KG6A 4RW6B 3I9ZA 3MEEB 1X4HA 5D3GB 3FQKA 2BKOA 2WVEA 1VS3A 1K9MT 1TUVA 4C11A 3RAXA 4J9MA 1XTZA 5E5NA 4JI5F 4JI7F 1YKWA 2HVDA 2JRSA 2KJWA 3IGVA 5AXNA 1VC5A 1V5VA 3QLHB 2J8AA 1Z2ZA 2BEFA 3PHEA 1IUJA 1QM9A 4YDXA 2AWZA 1R3NA 2F40A 2ZH5A 2GJ2A 3FCHA 1RLDA 2GZOA 2ZNZA 1NK9A 2IBOA 4B9LA 4ZVOB 3TI0A 2NQPA 1WHXA 1M0SA 2XO7A 1Y00A 2QJ3A 3Q8YA 2QEXS 2WONB 2HQDA 3R5DA 4ZIWA 4M1KA 4BC7A 4DV1F 3N79A 4AFFA 2XS2A 1ELOA 1JLEA 2ZEJA 2VL1A 2J7KA 1UPPA 3KG4A 3C16B 4DV3J 3RB0A 1RI7A 2HHSA 1P1TA 1QUVA 1S1VA 2DNGA 4H4OB 3MFIA 4X64J 2HS4A 5L1JA 4DL6A 4DF8A 2PMHA 5C25A 1R43A 1VYAA 1HNZF 2F65A 2W9BA 1Y10A 2AEJA 1K0VA 2QYGA 1U0SA 2DB1A 2R8GA 2CQ1A 4USTA 1GH8A 3AT1B 2F9DA 2HRUA 1UCNA 2XZTB 5IXUA 1FJGF 2MKYA 1LWCB 3KK1B 1B99A 2KDOA 4I7FB 1KHVA 2EVZA 4DX5A 2XMTA 2IMOA 3BSOA 2LVWA 3IR5B 1FEEA 3QO9B 2DR9A 5U47A 1TUGB 3MUVP 1N5QA 3K5NA 5DGAA 1K47A 2EWHA 1P1LA 4WFYA 1BLUA 1REVA 4WBFA 5IV3A 4RW4A 3N5FA 4V19X 4I2QA 2DNOA 3V81A 4FN5A 5HMXA 1T05B 4AXIA 5L9XA 2HW3A 3PEHA 1CJTB 4MK9A 2PA8D 1YQHA 4DSIA 2OO4A 2ZJQQ 4Q0BA 1EARA 2LECA 2NZ4A 2QN6B 3NGTA 1F9EB 3MHYA 4JV0A 2F4VJ 4HH1A 1HHTP 2FTRA 4IRCA 5LOQA 4ECVA 1TKZA 3THVA 4YS2A 3RW6A 3GB0A 5DQIA 3KUGA 4DS5A 3QRPA 4ILMA 1VLOA 2KXHA 4LR9A 2AGPA 2HIQA 3MR6A 5B0AA 5C24A 3VALA 5KT5A 1YRTA 1TUWA 5DRKA 4NRUA 1OM2A 1RDRA 1U2CA 2DHAA 1JLAB 3NCRA 3TQEA 4DFMA 1Y3KA 2YNIB 1EP4A 5DG9A 1NU4A 3M32B 3UN3A 2ADBA 2BM0A 1XEZA 2OPQA 4AUKA 1S1UA 1MG7A 1YBAA 2VV5A 4GC6A 5CAAA 2GIRA 2HNZB 2IC3A 2LU1A 2MQOA 3PX0A 3T1YJ 1RWMB 3EICA 3RBEA 4OHZA 3DGPA 3DRSA 1ZYQA 2KT2A 4DSEA 2XSJA 4L6V3 1I1GA 2R9LA 3HO1A 3S6EA 1IXKA 1JLGA 3RZAA 1OYEA 3W8PA 1YK9A 3T1AA 2W2MP 2HHUA 5A76A 3MM8A 1RWUA 1NMEB 2F9JA 3DXBA 4DS4A 1SI9A 2O1PA 1NEEA 2DXDA 3RG6A 1W25A 2LXUA 1FRMA 4ECYA 4KO0B 3I5CA 2Y1IA 4LF6F 4RL1A 1IBLF 3M1VB 2FLOA 5F3TA 3N28A 1CC7A 4C0HA 2XMKA 1RADB 4I67A 4JI3F 1IWAA 1S59A 1F1BB 1DTQB 4DX8H 2I5JA 1WF2A 2J6SA 4OYMA 1SQGA 1U2RA 3NMRA 3LGMA 2PI5A 3PO4A 1RTDA 3M2UA 5G0RB 2H5EA 4MT1A 3LALA 4ZA1A 3KK2B 4DFPA 1U47A 2MJNA 2DPIA 1JMTA 4W98A 2RRNA 2BE9B 2HAFA 5JVGQ 5A6PA 3KJFB 1N32F 3PRDA 5IC4B 1H0HB 1FO1A 1VISA 4HHUA 3OHBA 1VRUA 3D2WA 2IRXA 5DDQC 3SZ2A 1KTVA 5HVGA 1Y0HA 1H6KX 2UV8G 3N01A 2F7VA 4WP3A 2DNMA 2DGWA 3GJQB 2XTCA 1X5SA 3MM6B 4DOZA 5B0DA 5GAHI 2AYGA 1HQEA 1U02A 4ZVQB 2YWFA 4TN2A 5KFLA 1UJ6A 3E01A 3QAEA 2YKNA 2JLGA 1IM4A 2LU2A 3FSYA 3K58A 4KHMA 1TK5A 3C8YA 2EG2A 3W2VB 1ZAWA 2MTLA 3TEGA 1VQ8S 4N7TA 5GMDA 4CH1A 4HVZA 1NSQA 3PIPQ 2J0QD 2CQBA 3JYTB 4CYUB 5BYQA 1N5TA 1HNWJ 1W7WA 4A47A 2FJWA 4GVBA 2CVEA 3MCOA 4I7FA 2ROEA 4HI2A 3JSYA 5J2QB 1MMDA 3L7OA 1XQIA 4J9RA 3IBWA 3I0SB 3DOKB 7FDRA 2YNHA 4ID8A 2AJQA 2VUGA 2LDIA 4O4GA 3BJYA 2Q1LA 2YPYA 4RW7B 1YGYA 4WZMA 5EGYA 5CD4A 4OJ1A 5J1EA 2VONA 1R6VA 2KTQA 1CULA 1PAEX 1WOSA 2EFVA 2CPEA 2RMLA 4PG6A 4FF4A 3DRPA 3TVKA 3DLGA 3KMSA 2J0SD 1QE1B 4PR6A 1JJ2R 2VOPA 5LJ3Y 2F5GA 2VBYA 1MROA 2Z2ZA 3PACA 2C2KB 3B6BA 4EZ6A 3W5ZA 1EKRA 4DWIA 2UXCJ 4X4VA 4J9VA 1RT4B 3R3TA 4ZVHA 2IAJB 3QT5A 1RHMB 4KY3A 3SSQA 4Q8FA 1G6BA 2QC3A 3CTRA 2MLZA 3HLUA 3SFGA 4UOHA 5LXRA 4U6PA 3BGRB 4CLTA 4QWDA 5C2CA 4PXDA 2VQFJ 1NKEA 1S1XA 1GT8A 1RT1B 1QD1A 3GYXB 4YFUA 4B9SA 4OQJA 4EYHB 2CPYA 1J5OB 4W92B 1T94A 3H98A 3M4XA 4DV0J 4ED2A 3Q8RB 2A6OA 4R25A 3N6LA 3TYTA 3BGRA 4ZITA 2MEWA 4UW2A 3UWTA 3ENWA 4KH0B 4DR2F 4RWWA 2BMBA 3MEEA 5CQGA 4CT8A 1FA0A 3EXYA 3UE2A 3UCGA 4IR9A 2CXEA 3K5MA 2IAJA 1B7YB 4C4WA 1RT5A 4F50A 2H4YB 2FYXA 3BBBA 4WK1A 4IDKB 3VF0B 3Q22A 4C8LA 2Q66A 3FJ2A 4X4OA 3HPOA 3M2RA 1VQYA 1WI6A 2P2CB 1FKPB 2DGXA 3PIOQ 1ZTTA 3ELHA 4OLOA 4LF4J 3AXKA 4USUA 2COLA 2V50A 4NEYA 1GXUA 1MN9A 5KFYA 3TWZA 3MCSA 4YUDA 3GE9A 4ZPBA 2ZHOA 1IR2A 1HI0P 3LA0A 1J27A 2QMXA 1RAAB 1DLOB 3VAMA 3RW7A 1L3SA 2XSFA 4RW7A 4DXLA 4O0NA 4P2SA 3KK3B 3I56S 2J5AA 2CAJA 2VG7B 4FZVA 4ZVGA 3JAMU 4RNOA 2M8HA 2RIJA 3BQ2A 3QJJA 4G1PA 5M2RA 2XMAA 4NXMF 4B3RJ 2XWXA 1TAUA 4DPYA 1S9GB 1ZM4A 2NCKL 2XTJP 3ZZRA 3O1LA 2J9DA 1XBWA 5IM0B 1TELA 2KRRA 2OEKA 3E01B 3I4HX 2KYZA 4DV6J 1NJIT 4KGMA 2G2ZA 2LYVA 1S10A 2OAUA 1HQUA 4ZJOA 4X65F 3CMES 1AFJA 4YB5A 2ZH4A 1DRZA 4Y2AA 3HHLB 3JTPA 1T0TV 2KT3A 5CYQA 2XCPA 1JLAA 1PJ5A 3TZZA 4B9VA 1TL3B 2BRKA 1HA1A 2C3PA 4LF5F 2E7XA 4WTOB 3C14B 4Q8EA 1ZA1B 2QRRA 4IG0B 1I94J 3IG1B 1HWJA 3TVZA 4ZDNA 4AE5A 1VBYA 2UUBF 3AHPA 2ZBCA 2ZBPA 4QR1A 1ROFA 2VIHA 1U25A 2HVEA 3HT0A 2QLWA 5ETLA 4EWTA 2HNYA 4R8UB 2R7RA 2VKZG 4F2RA 1FNOA 1C0TB 3ZNUA 2ROPA 3IM8A 5L38A 1FEHA 2ZD1A 3CCMS 5EDWA 1U1NA 2B5JA 5IQ6A 2AYEA 3TX8A 4Q44A 1QVGR 3CJ3A 3OFGA 1RB0A 4CLWA 1U8WA 1X31C 3KLGA 4DFKA 4LF8J 2VG6A 3WHIA 2FGCA 3AODA 2XLIA 4DJBA 1M5PC 3QT6A 2HGLA 2CPHA 4DHVA 4ELUA 4DR3J 1RHKB 1V3RA 4DLEA 3T19A 1VQ4S 1AYEA 2UUTA 2BABA 2HWIA 4LSZB 2PEHA 3I9V9 3NBPA 4IO1A 1VDHA 5CZXA 2HHHJ 1W2BR 4F3QA 1C1BA 1FX4A 2RD5C 1FXLA 3QRQA 2RB7A 2VH7A 2MJUA 3ET6B 4FXDA 4DL7A 2Y3YA 1TU0B 3HI9A 3LW5C 2ZH6A 3L09A 3J7AN 1YZ7A 1WSRA 3BQ0A 4P52A 2MXYA 1X0FA 4FP9A 1M90T 1EP4B 2VFSA 3UNGC 2QL5B 1IBMJ 1RHRB 2E44A 4FYXB 1U24A 4I69A 2ASDA 2VG5B 2YX4A 4O4RA 1NDKA 4KGXB 1SCJB 3QYYA 1A7GE 1S6QA 1VLYA 4JI6F 4WFBQ 4DU8A 5KFUA 3T3FA 4DF4A 3AD7C 4QJVA 1RQ0A 1KRPA 1HNXF 1CS4A 1DQAA 4X4UA 4Y2KA 3PFEA 2OTJS 4IRKA 4URSA 4NLPA 3C14A 2GMLA 3MUTP 1U6FA 3L95X 2GO8A 4JI2J 3T9NA 3OUYB 3FUYA 4JUZA 4GKJJ 5BJRA 3TW0A 1N5SA 4USVA 1DFDA 2CJQA 2A2DA 1S1XB 2KU7A 2PE8A 1TL1A 3MMCA 1VBZA 2UVVA 4DL2A 3IS9A 2ZH9A 2VU5A 3BDPA 1FWKA 3L4BC 4JI4J 4KQZA 2RS2A 2ATLA 1EZZB 3OLAA 3F0NA 3ZXWA 2D69A 3VGVA 4ED4A 5MAOA 2E5LJ 4JYAF 1SV5A 3MAHA 4QIWD 4DV4J 3PR5B 1FJ7A 1U45A 1S9FA 4TVAB 3HSDA 3N0VA 1AA1B 5H9FK 1TKTA 3OJUA 1KQSR 4FBTA 3UD5A 3K57A 3EWGA 3Q83A 2CQGA 1YVFA 3PW0A 2FHOB 3QQCD 3PEJA 2DITA 4OZLA 1KP6A 3O5TB 3CJSA 1TK8A 4ICLA 2MSTA 4KBIA 3V4IA 1QLNA 1PGZA 4DSLA 3ITHA 3UDCA 4FPIA 5K14A 4WK3A 1B3TA 1SB6A 2C2MB 1D8YA 2RVJA 1FWPA 3CO9A 4DG1A 3MEGA 4L3NA 3RYLA 4F4YA 1WKKA 1XMOF 2IRYA 3TVYA 1A9NB 2RHSB 1SJQA 4P2XA 3V2UC 2H51B 2VODA 1EKSA 4FYYB 1VQLS 4DUYF 3MWBA 3K8WA 1M1GA 3DYAB 4O3OA 1XJWB 5D0EA 1T9UA 2FHMA 3BGUA 4KT0C 3LPYA 5CYMB 5FDLA 1KQFB 5HN0A 1CJUB 4X4QA 2IJRA 1TL5A 5D8HB 1HD0A 3D1OA 3PVXA 1L3UA 3MGJA 1BGXT 2FZGB 2X1FA 4J5OA 4LSNB 1LNQA 4ZOSA 1RSCA 3KG1A 4DDFA 3NXZA 2B8QA 5KG0A 4DR6J 1W2IA 3BKTA 5J2PB 1RK8A 1MWYA 6AT1B 2Y1RI 4QU6A 4I6AA 3D67A 3FZ2A 2CNLB 3CDBA 1VQKS 4F4KA 1VQSA 3ZTPA 2KFYA 1IJEB 3M8RA 3LWMA 1Z1ZA 2L41A 1YRXA 4Y28C 1KNZA 3DOLB 2A3JA 1XR5A 4K4ZA 1HBMB 4CH7A 1FD8A 2QLFB 1U09A 3CCTA 4C11B 2BYCA 4YY3F 3KWMA 1YJTA 2XNQA 3MM9B 3JB9k 3KLHB 2O67A 4OYWA 3WX8A 1UVKA 1ZZFA 5RUBA 3BF4A 1ZTWA 1F5AA 2QSWA 5ETNA 4DLGA 1U1KA 3TJAA 1D9FA 1QDUB 1FHTA 4HT5A 4B9UA 3LOUA 2OD6A 3FSXA 3BYPA 4KE5A 2CYYA 4CLUA 1H7XA 5C2GA 8AT1B 4JI1J 4O4GB 2G9OA 4DV2F 4U7UK 1U1LA 2ALYB 4PXCA 1AZSA 1VR6A 2WBRA 5AXKA 4F25A 5EHHA 2ROGA 2W7PA 3G6XA 3PJ9A 3RUBL 4IQMA 2VQEF 5DLFA 4LFCJ 3BKUA 1RJJA 2DGUA 3UR3C 4H4KC 3UVJB 5IS2A 3MEDB 4FS2A 3RB6A 3D0HE 3SV4A 3H4DA 4YN3B 4OZ0A 3T5JA 4CO1A 4DR4J 3R97A 2GVDA 4DX6A 2MKHA 2L08A 4ZVTB 2KT5A 5LMNJ 2UXDJ 1IKWB 2OSRA 1X4DA 4K4UA 2NR0A 1NDLA 4J9UE 2CQCA 2D9PA 3O44A 1IR0A 1R31A 1WC1A 3A3PB 2KVQE 4MMOA 4ZPDA 1CC8A 3CDUA 1PC4A 3AJDA 2ZNYA 2JEJA 3NGUA 1XR6A 1KVKA 2AT1B 4K5SA 4KFBB 4R0JA 1S6QB 3IRWP 3JTOA 1MMNA 2XY6A 4B08A 2VPZB 1UEUA 2JX2A 3K5PA 2PT0A 3IXQA 3MMAB 4LBHA 1HR0F 2HHVA 1PSDA 3NY0A 3OTEA 4R5PB 3O8WA 3G9CA 4U8VA 3UW1A 2B7BB 2RNEA 2HAIA 3OL9A 1F5CA 1RA6A 2JJ4D 3UI3A 1T7PA 4M5DB 3VZHA 3U1LA 3OT9A 4DR5F 1EAYC 5IM0A 2MZQA 3G71S 5K9FA 4F67A 5HQMA 1KONA 3R5BA 4B17A 2FLNA 3KOAA 5DGBA 3QZ7A 2QLBB 4FVCA 1WF1A 1S1TA 3MM5B 4NLWA 1ZM9A 2CJAA 2V1TA 1C1BB 1CJTA 3OFHA 4OX8A 3PR4A 1E6VB 1PJ6A 5J2NA 3HSGA 4MIWA 3V81B 3ZZ0A 1UFLA 2C2OB 3PW2A 2NYIA 1WF0A 1KD1T 1NAQA 6FDRA 4CLZA 3M6XA 4B3OA 2ZVIA 4CRJA 1PYTA 4ENOA 3H40A 4IO9Q 1S76D 4IFVB 3EZUA 2CJKA 2ZVSA 3ISZA 1G3OA 3W9JA 4L74A 4ETXA 2CG4A 1FX2A 3MR7A 1RCXB 1F9FA 1SQEA 2V8VA 3GLJA 1FKPA 2OEMA 5HVFA 1FFSB 3J81U 3TRGA 1V3ZA 1BXNA 2M2BA 4GO7X 1TMJA 3Q2TC 4TY9A 4UQTA 4XDDA 2DGTA 3HFKA 4JV5F 1T9VA 5GAEI 5KAKA 1NSPA 3GILA 2N4DA 4B3SJ 3DGVA 3ZNJ1 1S1UB 3ZTSA 5DLGA 4LFBF 1YLXA 1EQ0A 3ENAA 1AROP 3V6DA 5GAEU 4X4PA 2KFNA 1C2PA 5KFCA 2KRBA 4JI8J 3BM7A 7AT1B 1IKWA 1PC5A 2HHPA 3G82B 4N8NA 4UOFA 2JVOA 3V6KA 1AW0A 1KWMA 3NAHA 2UP1A 4M8LA 1N52B 1Q16B 2RE1A 3A4TA 4NZ7A 1HBUA 4QR0A 4BWMA 4Y00A 4X66F 4CCHA 2HHQA 4XDCA 1OPIA 1RT1A 4YR2A 1NB7A 2QIFA 4ZPTR 4AXJA 2NPIA 4K5RA 2JLEA 2OPSA 3KLEB 5MLCV 4J9QA 1Y5NB 1B0VA 4QYRA 3PCOB 4DG1B 3MR5A 1CSJA 2CA9A 3C6TB 3T5LA 4E0DA 4ZPCA 1Q78A 3LWLA 3GIMA 5HMZA 3G6VA 3BQ1A 2KM8B 1UZDA 3AB2B 4CO5A 3OW2R 2YWHA 3T1HF 5KFPA 2QTWA 3BBCA 2W2NP 1UAWA 1LWCA 3FEZA 3QNWB 1B7FA 2Q3PA 4URGA 5L46A 1TR0A 3EXCX 3M2RB 2H1YA 4ED8A 5CXTA 4QYZK 4Z7CA 5A6WA 1LQ9A 1EX8A 1CEZA 1FJEB 1DTTA 2YWEA 4NMLA 3KJVA 2X1AA 3G6YA 2W2QP 2A2CA 1TTHB 5D4LA 1S1WB 3C6TA 3TAMB 5J2PA 5HROA 4QWBA 2BXJA 4UF4A 2IM3A 9RUBA 4AD6A 1XNRF 2V8GA 4IG3B 5M2PA 3PYFA 4FS1A 2BDPA 1NK5A 4WJBA 5D4NA 4B9MA 4DQRA 3IS9B 4ZVSB 1WOOA 4ES2A 3SYZA 3IGNA 5ETKA 2G1HA 4ILRA 1HNIB 2MY7A 2V94A 1RWPB 2AZ3A 1PKUA 4K2XA 2QZ8A 3HM9A 2BQUA 4B3TJ 2ZE2B 4PKDB 4X62J 2ZDOA 3I6PA 3ZZYA 3OSPA 3RBZA 3ISND 1AUSL 2F63A 4V1Ak 2LQ9A 3SSSA 4H4MA 3N6NA 3CDEA 2D68A 2RKIB 4K7QA 1S7IA 4X2BA 2QT7A 2ZKTA 2RJZA 3JSBA 2HQCA 4ECTA 1X4AA 3SEOA 3ZZOA 1NK0A 4WPAA 2FLPA 4K4XA 1V5IB 1F3FA 1TP7A 3P8BB 1IKVA 1H74A 1RT6A 3HZEA 3KXDA 3AOAA 4RX6A 4WP9A 3SCIE 1FNXH 2LDYA 5BR8J 3NCQA 4KJIA 1VI7A 1DAXA 1IR1A 2R7OA 1VRUB 4RU9A 3PKYA 3KYLA 3GCWP 4K4WA 1XR7A 2B0GA 5HVHA 3G8TA 1T02A 4J90A 4RUHA 3RB3A 2BJEA 4UUWA 2E7VA 5I3QA 5KFGA 4J9PA 2W24A 4NI2A 3D28A 2CJYB 4B3OB 1JNRB 2DIVA 1KVJA 3ILJA 2AJ4A 5A8WB 5K20B 4JI7J 4CZCA 3AY0A 2DO4A 3NBPB 2E9RX 4BBYA 2OLWA 2KXNB 2RQCA 2EFOA 1S1TB 3R1HA 1UVNA 4OIXA 3M1VA 3JQMA 4Q2MA 2O01C 1TFYA 4PCQA 1NZ8A 5J2NB 1Q7LB 3MR3A 2VFVA 4M5LA 4PPZA 4DI6A 2GJFA 1AT1B 1VHIA 2DY9A 3M8WA 3W5YA 3OVSA 4XTTA 3W61A 5LMUJ 3VHQA 5B0CA 2C2ZB 4CQ1A 2B9YA 4DCPB 2XGPA 3CT9A 4Z2XA 1QTMA 1JKHB 5I42B 1S12A 3WC2A 1L3KA 2BRLA 1O0PA 2V69A 4LFAJ 1BQNA 4KB7A 4OI2A 2BX6A 4QQBA 1RWXB 1CBKA 3I5AA 4GC7A 2XTEA 4FKXA 1X9SA 3GSDA 2K1RA 2DR8A 4B9TA 2AHOB 3MM7B 2HFVA 1XMQJ 2R7UA 1KS2A 2HNYB 1YJRA 2FVCA 1C1CA 2KI2A 2WSFC 3MMAA 4LUBA 3HMJG 4JI5J 2XS5A 2IY5B 1UWBB 2GS8A 4K4TA 2J9DE 1U8SA 1URRA 3P3DA 2XTDA 3H20A 4PG5A 1TFWA 4PQUA 1CQMA 1QSYA 2RUSA 3FBBA 4MTPA 2MKJA 1FJGJ 2J0WA 3BN7A 1EHWA 1NHUA 2JC0A 4P6QA 4D3GA 2AGQA 2DCLA 1N48A 1P9YA 1GMWA 1RACB 2B56A 3B8HA 5HBMA 5LL6d 2VFRA 3HSJA 1Q8LA 2GVDB 4JP8A 4OZ2A 3VCDA 3H5UA 1Y3JA 2BVZA 3THTA 3MM7A 1NJXA 5DDRC 5ETSA 4NYZA 3HCXA 1FRJA 1T95A 3CJRA 1D1UA 4QU7A 3MFHA 5CZVA 2XNRA 2KYXA 1HKAA 1WKLA 1AB8A 2K3IA 2MKSA 3GFHA 9ATCB 1T05A 1LW0B 2FD2A 3SFUA 5DG8A 4TQRA 3QJPA 5DETA 3TJ9A 1NCLA 1YSJA 2DBBA 2D7SA 5A8WA 1SC6A 3CJ2A 3DRYA 1F6TA 5FLXY 2RDJA 5KG3A 3D68A 2DR6A 1LK7A 2HYIB 1VRQC 4EBDA 2MZJA 3DMJB 2CPFA 4O23A 1CG2A 2GQCA 4PWUA 5AE2A 3Q2SC 4LIRA 2Z2YB 2B51A 2IVYA 2FZCB 2BE2A 3TJ8A 1NJWA 2AZ1A 3N5BA 4HT7A 4MJKA 4U67Q 2UUCJ 4USWA 4O3PA 2I2YA 1BWVA 1SIZA 2B9XA 4C8KA 3Q8PB 2WZ1A 2HNZA 3MM9A 4QIFA 1NK8A 3BPDA 3I32A 3AWRA 3UR0A 2YKMA 3BN4A 4FBUA 3IWXA 1B4SA 2EC2A 4Y34A 3M6WA 3D7SB 3NAIA 2G0IA 3MTJA 1HNVB 5F41A 1Z2LA 2RKIA 2BM1A 3AJ1A 1SJFA 4N76A 1NH7A 5KFTA 5L1IA 2OPRB 1RT3A 2WVFA 2NYHA 3G6ES 5KFJA 4ZP6A 2YXLA 2C2DA 3MPYA 1H38A 3HD1A 2W1BA 4B3MJ 1N8RT 3CC7S 4NXNJ 1XMBA 2WW4A 3F44A 3GSIA 4ZP9A 2DT9A 2D74B 1NH8A 5F9NA 4TY8A 4ED7A 1KTQA 2HLTA 3P4UB 4QZVB 3G87A 3RGIA 4C3LA 5K8NA 2JDJA 5FIIA 1RLCL 4OI6A 5IT4A 1T9YA 3EPGA 3GV7B 4LF7F 1RTIA 1EJ7L 2N7YA 4KKOB 2IJNA 2ZZTA 3PYDA 3W66A 2H5JB 3ZC4A 4LF6J 3HZGA 1J2VA 1VBKA 2V2QA 1U2FA 2V68A 2R2RA 1KSPA 1RYSA 2E1AA 1RU1A 5C42B 3OVBA 4I2QB 4KV8B 4OYAA 4NASA 5LT5A 1P8GA 2LA6A 1VJQA 2EFGA 1KFDA 1ZOTA 2QL7B 3E51A 3I31A 3FC9A 5AJ3F 2GVZB 2XHWA 4BCAA 4USJC 4HTIA 1D0EA 2MQPA 4KYZA 2KL8A 2HVZA 3ZFVA 2AYMA 2ZWPA 2XMJA 5K14B 3W60A 4EUVA 2MLYA 2M8DB 3AFGA 1RT2A 2W4PA 2F8EX 1EIYB 4CLPA 4LBIA 1QE1A 3SQGA 1N32J 1M5SA 2W9BB 2LMIA 1RTHA 1SJ1A 1OQ3A 3TZYA 2DNNA 3NLCA 1SJRA 4RBTA 2C28A 4IR1A 1SL1A 5ETPA 2R2TA 2NSCA 2HLUA 3HULA 4DPXA 4QR2A 2DNPA 2PD1A 3LP2B 3SXLA 4BWJA 4Z37A 2HHTA 4A8SA 1X4CA 4YHHJ 1UVMA 3UDVA 1N33F 2JWNA 4ZLNA 3EVOA 2DPJA 1CJKA 1FKOB 2VC0A 1UA1A 2PDAA 4JV1A 4IFYB 5E3CA 1RHJB 1T03A 3J7A1 4TLQA 5J2QA 2DISA 4ZN1A 2CUYA 1YZ6A 1S72S 3TZWA 2LEAA 1K1QA 2W4DA 2WK4A 1TV6B 2QE5A 2OPSB 2GQQA 3KTQA 3QT8A 1ICEB 4DCJB 1LV5A 5KG2A 4OYXA 3HP6A 1PAUB 3LPEA 3M8QB 2RRBA 4RUAA 1UWBA 2AYBA 3GCXP 2HWHA 3C2PA 2BE7D 3B82A 3NKYA 2MQNA 2VHGA 1RWVB 4QIEA 1FTCA 3TQ1A 3S01A 2HVIA 2F4FA 4PEOA 2QX0A 1UW9A 2UXBF 3GZ7A 1WEYA 4NLVA 1PYSB 4JI0F 1JJ4A 4QCLA 2C3OA 2R7VA 2FQQB 5IT9U 2IYIA 2XZ2A 2ZBQA 1TL3A 2RF2A 3M2VA 3QGPA 4C2MA 3DRPB 2G0JA 5IFMA 4YP3A 3PV8A 1RTDB 2UVUA 4NCBA 4RLEA 3R9LA 4UY8T 2E5IA 1Q8BA 4GKKJ 2PFDA 2I5JB 2MDAA 2HMIB 3SIPB 1QSSA 1TVRA 3NL0A 5LXYA 2BUNA 1S7HA 5D4PA 5DZ7A 5F8HA 2ZOGA 4L75A 5A8KA 2BW2A 4DV7J 4A8MP 4A8QA 4LF9F 2JFKA 5B0BA 3HVRA 1NNDA 3BO2A 1L5UA 2V4QA 1R7IA 3KK3A 3NS5A 2AU0A 3BO4A 3DU6A 3A1YG 5ETTA 2YQ0A 2MQQA 4RPFA 3UNYA 4CTAA 3CF5Q 1NK6A 5L8RC 3CD6S 2VQFF 1KC8T 1ZBTA 4M5HA 2JSXA 3HF5A 3A8JA 3W9IA 1APSA 2XSJB 4NA3A 1HI1A 4F3MA 1JLFB 2VD3A 4ZLJA 1K0TA 2FJEB 4WP8A 4FF2A 3S8SA 1D8ZA 3P5BP 3RRGA 4HI1A 1BUXA 1RBAA 2CZ4A 4IG0A 4YDDB 4DR2J 3VQTA 3TAPA 2WW8A 2P9EA 3UFCX 3OVAA 3Q8UA 3DDIA 1UTAA 3FGVA 1RZMA 1HI8A 3CCUS 3FDSA 3AX3A 3H5XA 1VIXA 2P6TA 3EMTA 5CYQB 5ETOA 1N34F 1XERA 3DRRA 3M32A 2ZZMA 2VBXA 4LF4F 2R7QA 1HWIA 4F2SA 2KHDA 4DQSA 1GTEA 3P49B 4FYWB 3TAQA 3DLKB 2AW0A 5CABA 2GHVC 2BKNA 3SQOP 2YX7A 5KT6A 3QGIA 3HHLD 3RJMB 4DR7J 2LFVA 3DYAA 3R5GA 2AGOA 4G3IA 2AX1A 1V3SA 1HL6A 3L9ZA 3MEDA 1N36F 1RBLA 4DPUA 5HQLA 2SXLA 2R7WA 2RU9A 4ZVUB 4O3QA 3US5A 1YRUA 2D41A 1NHVA 4OX7A 5J1NA 3C19A 2JZ5A 2ZH2A 3J7YU 4QYZJ 2J8SA 1FI4A 2BZ2A 2LKZA 2QV6A 1G2EA 1A6LA 2DHSA 4AL6A 1CVJA 3PKMA 2X51A 2EC0A 4AYBD 4RW4B 2HVHA 1RT2B 3A13A 3KG0A 5D15A 3G4SS 2QL9B 3OBIA 4X65J 5D0RA 4IKAA 1YI2S 1CLFA 4UOGA 3DOMA 4RW8A 1RAEB 2YKAA 3R7BB 3N6MA 1BHNA 1ZA2B 3WIUA 4CLSA 5DQHA 3PY8A 3KKFA 5KFIA 3KLHA 5I3UB 3SDEA 4JV2A 1TVRB 4NCGB 5KFFA 3SQGB 3WQPA 2MZ1A 2UVRA 1IWGA 1H7WA 3TA0A 2MSSA 4NI2B 3MXHP 1FRKA 3GWCA 2V67A 5JVHQ 3VZIA 2DRBA 4NZ0A 3M8SA 1RCOB 2DRDA 3FZBA 3CC4S 1Q81T 3HFZB 3DRXA 4J9OA 2VF3A 1HBOB 1H72C 1MWQA 3DXSX 2D3O1 1JJHA 1WG1A 3W8GA 1YJNS 2J7UA 1NPRA 1QUPA 2HQGA 2AJ1A 1WI8A 2XI2A 4XPCA 2WTFA 4EZ9A 4DQQA 3W9HA 2ZC3A 1JK9B 5SUHA 2FC9A 2K3KA 3G82A 4N47A 3VGTA 3KHGA 3CCSS 1FXRA 2RUGA 4F4XA 2ERRA 2MZTA 5DM6Q 3OR1A 3TNVA 1VJWA 2FY1A 2YKNB 4OI1A 3MUMP 4WFAQ 4DUZF 2HHHF 4M95A 3AB4B 2MHEA 3CDAA 1I6JA 4K0KF 1SBRA 2ZHBA 1UA0A 3D1HA 2GO9A 1RAIB 2BOPA 2AJ2A 3TA2A 2XYPB 1W26A 3LAKA 2BE2B 3IN5A 4ZCMA 4XPEA 4Q7AA 3AOBA 1QAJA 1HNVA 2QFIA 4Y2IA 1T9WA 2WVBA 4UT4A 3EDQB 4K59A 1WELA 4ZN3A 4ZJQA 5HROB 3V4IB 1S4FA 2E5GA 2YKMB 3MMJA 4LVOP 1RUSA 3IR7B 5D78A 1S0VA 2XG8A 1UVIA 3H42A 3BEGB 4WXWA 2DTJA 2M4MA 1Y9OA 4DPWA 2HBQB 1S49A 3N9UC 4H54A 1KDNA 2K7JA 3TARA 2K7KA 1RP5A 5DO2A 2OEJA 3ILLA 3VVTA 5A0YA 1FDBA 2VZ9A 3M8PA 2PMZD 4DV3F 4EK2A 1NKCA 1J5EF 1FDNA 3DOMB 3M9OB 2YKQA 3NWRA 3OXFA 4OZ3A 1SC3B 1N6QA 5KFHA 1FRIA 5EN1A 1LFWA 4GKJF 4P72A 1EQMA 1LKZA 3CVKA 4PYDA 5KT2A 3ETMA 3KLGB 2GIQA 4ECSA 3QZ8A 4MKYA 3BH6B 2HFNA 4LQ9A 3O3LA 5FD1A 1YWXA 1T9XA 3ULHA 3UDEA 2DH9A 4NOHA 1HFEL 2BKPA 1S5ZA 3R6GB 4RWXA 2YNGB 1L3TA 3QRRA 1Q86T 2ZM6F 3QLHA 3BO3A 3UD4P 2FGOA 2I38A 3ISNC 1C1CB 3PRVA 1RKJA 4DV4F 1GEHA 1RT7A 2CQ3A 3VR1A 3A8EA 3T5HA 4NLXA 1VK3A 2HRYA 2EXUA 1ZH5A 3OTDA 1UETA 2YPZA 3BYRA 4RNHA 1U6ZA 3SSRA 3S1TA 1RKIA 1PYOB 3OFEA 2AIRB 1WHYA 2XBPA 3D6TB 2VPXB 4NYOA 2VFUA 2AEMA 5AE3A 2UU9J 4FNIA 2FC8A 3B54A 3JQKA 4I2PB 1XIQA 1PO6A 4JB8B 5D3GA 3ENQA 3BSCA 4LBPA 1U6BA 2WOMB 1VQNS 1BQMA 1REGX 3CSKA 3FBEA 4FYVB 4KH1B 5F0WA 5IV4A 2YH0A 1F3VA 4WYLA 1SVDA 1ULRA 3MECA 2J9CA 5HO4A 4AT1B 4K50A 4FXVA 1KVIA 4NLDA 4RNNA 5D4OA 1NKBA 5GMKa 3DMJA 2I0XA 3CJ5A 2DR7A 2HHWA 2MKCA 1JLFA 2N3LA 1MN7A 4OZ5A 5EWEA 5FLXU 3K8VA 4DUYJ 4USIA 2EKYA 4I68A 5K8MA 2W9CA 4KHPJ 1H98A 2Y0BB 4MYTA 3T1YF 1S48A 3UPFA 1X4EA 1PBAA 2I8EA 2GAGC 4NLQA 4Y3CA 3ENVA 3AA8A 3M8PB 4YQWA 1Q53A 1UJ4A 2YWWA 1F2GA 2ILZA 3ILOA 3EVWA 1UFWA 3D5MA 4BC9A 3G86A 1S0NA 3R7SB 5I4MA 1WHWA 1VQ5S 1UJ5A 4QW8A 3AD8C 3BGOP 4WIQA 2ZH7A 1N0VC 4FNHA 1BQMB 5HBMB 4GMKA 2PSZA 3MDFA 1U7LA 1U1PA 2DXEA 2IHR1 3BSAA 2MGZA 3VAKA 3BREA 2JEGA 1UZHA 2V1SA 1Y7PA 3VTIA 4WZQA 2OPPB 3EYZA 1JJCB 2JLFA 3QPIA 1BWEA 1O5JA 4WU3A 3A3OB 4ID5B 3KNAA 4LSNA 4CT9A 2IPOB 5T41A 4MIBA 2ATCB 1IBKF 4RUCA 2DVIA 1T3NA 2D3OR 1UFKA 2CWKA 3GJSB 5C24B 3VAJA 4WXOA 4JBCA 4PWWA 4KFBA 3PX6A 2DY1A 2CQPA 1FERA 1WG4A 2A6MA 2FHJD 2LQ5A 1SC4B 2WONA 1B64A 1RT7B 2GQ2A 5K8PA 3M8ZA 5DJBA 2V9WA 3RR8A 3VGSA 4P9SA 2XHCA 3R2CJ 1UEKA 2OP5A 1FFWB 4DPOA 3A12A 1X4BA 3AQPA 3E3XA 3QSIA 4RNMA 2MKKA 1FDDA 4K8RA 1S6PB 4M5MA 3NGRA 2FUG9 5KOWA 3KLIB 3VAHA 1SH3A 5IWAJ 4K4YA 2AJ0A 2V2VA 3MEGB 1DBDA 2CNOB 2H3EB 1IQZA 4UY85 2FJAB 1Y5LB 4A8XA 2DNRA 1IBCB 4ZVPB 1N6QB 3HKZD 1RABB 3EVMA
chains in the Genus database with same CATH topology
1MROB 2K2PA 3CCLS 4UUXA 5LMNF 1YHQS 1NRKA 4LJMA 1LXJA 2W9AA 3KK1A 2CRLA 2W7OA 4Q5VA 3CCJS 4WU2A 3K5LA 5GADI 2ASJA 1EETB 1F60B 2R2SA 1HNWF 2W8KA 1IQTA 4DR1F 3C6UB 4YB6A 1F0XA 1SIWB 4HDHA 3RB4A 2R7SA 4CH0S 2NS1B 4EGLA 3W3SA 4WFZA 2EI5A 2AV5A 2YTCA 1FK9A 1IKXA 3DLEB 7FD1A 3MMBB 3T9ZA 2HGNA 4C3MA 4WCEQ 2QA4S 2DNKA 3QGHA 4ZLPA 2EPIA 1YJWS 3D1QA 2MQLA 1MSWD 2YVSA 4NA2A 5KFMA 4J9SA 2M3DA 3KMQA 2Z8QA 4HTJA 2UUAF 4HEA9 4HHJA 4KKOA 4DBQA 5C42A 1C0UB 3V6HA 4HLBA 3SV3A 2KHCA 2J0XA 4LQ3A 3OTCA 1HQEB 2VASA 5B7WA 2GMHA 1RTIB 2OIHA 1FK9B 3DLEA 1LW2A 4Y6IA 5E0OA 1DURA 4C8NA 2N3OA 2ZH8A 4DUZF 1S6OA 3TANA 1RT4A 2MMYA 2FDNA 1U4BA 4V19J 1OIAA 4OZNA 5L1LA 2XMMA 4BS2A 4DL4A 2V9KA 4ZK7M 3ONQA 3MMBA 3DRRB 2BR0A 2IVFB 2LQBA 4KAIA 1O51A 3CMAS 3T5KA 2PI4A 4EU0A 1VFJA 4QWEA 2DRAA 2CPZA 4OX6A 2J6TA 2JH3A 1ZM3A 5KG4A 3K0JA 1R0AB 1BD6A 4CI0B 4JI8F 2HQIA 3CCVS 1HW8A 1IKYB 3JTNA 5HI7A 1LWFB 2W25A 4J9NA 1AXQA 2U1AA 2FVRA 2KKHA 3LF0A 5B0GA 5KFKA 1R8HA 3NNHA 1FF2A 4NA1A 3GMGA 3RAQA 2IRUA 4PWDA 2KZMA 3FSIA 3M6UA 2KVIA 4WE1B 3UDLA 3G8QA 2DJWA 5A2QY 4X4SA 1WEZA 3VWSA 3MR2A 3OJSA 5E3PA 2XC9A 2JC1A 1N5YA 4PPDA 2BACA 5T14A 3FVYA 4YB1P 3OUYA 4DFJA 3K5OA 3HK2A 2VFTA 2ASYA 3W2VA 4DN9A 3PX4A 1HD1A 3Q0AA 2E1MC 4LSLA 4ECQA 2CDQA 2J9EA 2VG5A 2WSEC 4C8OA 5KOXA 4EBEA 3T6BA 2ZBIA 1SKRA 4OMFG 1DTQA 2V2KA 1NZAA 2P9CA 3R27A 3C66A 4DV5F 5C5JA 2OH2A 1U1MA 1FRLA 1QAXA 2EK1A 4TYAA 3RTVA 4QPTA 3RBDA 4HYKA 4R0EA 4ERDA 1UL3A 3IFEA 4BHQA 5A8RB 2BANA 3GFXA 4ED6A 1WD6A 5M2UA 1XN9A 3B78A 4RBUA 2CKWA 2BV3A 4ZPAA 4G1QA 2Z4PA 1C4AA 5KG7A 2D3UA 2XY5A 1R0AA 3GFZA 4N41A 4ZCLA 3EUNA 4Y2MA 1SKWA 4I6YA 1K73T 2EK6A 2IC3B 1JIHA 3DCAA 4IH5A 1MNEA 3FEYB 2RT3A 2ZD1B 3DC2A 2LQJA 2IA6A 4DR3F 1YTYA 1XK8A 1JLGB 2LXFA 1IKVB 3OL8A 4J9LA 3M2VB 1YJVA 4YEAA 5DDOC 1FNMA 3HHKA 3AJ2A 2YX1A 3DRSB 4OHVA 3GIKA 2EBEA 1HBNB 2G13A 5F9LA 3B4DA 5IQQA 4H4MB 5KFWA 5H9EJ 1KLNA 4KPYA 1RYRA 2B7CB 2F8MA 2B4PA 2E9TA 1KLMA