2IMIA

Structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt-detoxifying activity
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
SNLVLYTLHLSPPCRAVELTAKALGLELEQKTINLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITESHAIMIYLVTKYGKDDSLYPKDPVKQARVNSALHFESGVLFARMRFIFERILFFGKSDIPEDRVEYVQKSYELLEDTLVDDFVAGPTMTIADFSCISTISSIMGVVPLEQSKHPRIYAWIDRLKQLPYYEEANGGGGTDLGKFVLAKKEENAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epsilon-class Glutathione S-transferase
publication title Structure of an insect epsilon class glutathione S-transferase from the malaria vector Anopheles gambiae provides an explanation for the high DDT-detoxifying activity
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transferase
total genus 83
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2imiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2imiA01
1K0CA 5ECHB 4DSRA 2IFQB 2UZ8A 3IC4A 2X99A 3H4KA 3ZIVA 3UIWA 2LS5A 2LJAA 2YNXA 2OA7A 3ZREA 4KUNA 13GSA 1V40A 2F51A 2YP6A 4K9ZA 2MZCA 3KTBA 2P5RA 1MD4A 3PH9A 6GSSA 2C0DA 2OJLA 1DUGA 1YEXA 3C71A 2NDOA 1M2BA 1T4YA 4BL7A 4HZ4A 2IJYA 1KEBA 5F0GA 1AUCA 3IPZA 1F2EA 2B3SA 1B48A 4ZL7A 3KIJA 3UBLA 2DLXA 1K3YA 4OFMA 1M9AA 2LUSA 1GNEA 2DJ3A 3GRXA 3J7Yk 1DE2A 2TIRA 3VI7A 4MF6A 4IQAA 2YN1A 5B6NA 4KB3A 5F8BA 1GSSA 5G5FA 3C1RA 1ILOA 3PPUA 5D93A 3ERWA 2RUFA 4TXOB 3WGEA 5KN0A 1Z9HA 3VWUA 1FHEA 1ZYEA 5IMAA 3GTUA 2N5FA 3ZVJA 2GZYA 3LEFA 3ZZXA 2AAWA 2VCVA 5DJLA 3ZMLA 2C0GA 1ERWA 2QKEA 1Z5YE 1OVNA 2EC4A 2YWOA 3GL5A 4ACSA 5JWOB 1WIKA 2HRAA 2L57A 3VFIA 2DMMA 4K7IA 1XZOA 5IMDA 1EOGA 2DSAA 2L6DA 3QMXA 3DVWA 2ES7A 1OC9A 4L0WA 2CV4A 4J57E 2VIMA 2H70A 3FYGA 1MDKA 4ZL9A 2IMFA 3WGDA 3GIXA 3W8JA 1FVJA 2WULA 1SL1B 2K18A 1X9SB 1T1VA 3TRQA 2M46A 5GSTA 4MZBA 1TKDB 4KX4A 2YV7A 1GLQA 3L0HA 2PWJA 1J0FA 2PN8A 5D9WA 3IAM2 4DEJA 2JADA 4IKHA 3VWXA 4F0CA 1ZYQB 1A0FA 2MBSA 2IPAA 3CTGA 2MMOA 2Z9SA 4POKA 3CTFA 1EEJA 2GLRA 5GSSA 3ZVJD 3FR6A 5IM9A 3Q6OA 3PGTA 3US3A 3O6TA 2XPDA 4YAVA 3HA9A 1HQOA 2I3YA 3BD2A 3ME8A 5ECOB 1HYUA 3ME7A 2X8HA 3CSIA 4IJ3A 3C1SA 2HRKB 1X5EA 2I9HA 3M8NA 2H74A 4GQCA 2F8FA 4XS4B 4JBBA 4ZBBA 3TOTA 2YV9A 4X43A 3DD3A 3L9VA 2KP2A 4LLRA 2IFQA 4XRDA 4DSSB 4NAXA 1PQNA 3HKRA 2GT6A 3GA4A 5ENUA 5C04A 1SYXA 1O73A 3HYPA 3M9KA 2C80A 4O5RA 3A3TA 1K0BA 2E2GA 4WF5A 2REMA 1XW6A 3W8SA 1TI1A 3GX8A 1F3BA 3FZ5A 3HDCA 5DQSA 3DKSA 3HZ4A 3KH9A 3D4TA 4JR4A 1RK4A 3QDNA 5LNKe 2V1MA 4V2LA 3CXGA 2L5LA 4G0LA 2ALBA 4F82A 3TJGA 1QMVA 2GGTA 3IE3A 3KMOA 18GSA 1HNAA 2E0QA 5A4UA 1YF0A 1MDJA 2RUEA 3L78A 3GSSA 3DXBA 4IELA 4F0BA 2H75A 1VRSD 4HJMA 2V6OA 5A4WA 4HI7A 2JL4A 2LTKA 5HFIA 4IP1A 3UEMA 4TXOA 5CO3A 5DALA 4EUYA 1F37A 1NSWA 1URMA 5FHIA 1UN2A 5G31A 2IMIA 3U6VA 3GSTA 2JSYA 4JE1A 3GMFA 3LSZA 5ID2B 3ZIJA 3VPQA 2H0HA 2LRNA 5JWQB 4Q5FA 3Q18A 1TU8A 3UJ1A 5KN1A 3UMAA 1F9MA 1GSYA 3IR4A 2V41A 4MPFA 2R37A 4OMVA 1SJ6A 6GSXA 2IMDA 1GSQA 1NM3A 5IQYA 1J9BA 1Z3EA 1TOFA 3QD9A 5G2ZA 4HUAA 1XWGA 3BJ5A 3KH7A 5B7CA 4PX1A 1Z6NA 3F4SA 1J08A 1XVQA 4ML1A 4IS0A 4F2IA 2O87A 3IRAA 1XW5A 3A2XA 3IOSA 2RM5A 3F4RA 4QL9A 3F9UA 1MEKA 4WETA 5ELAA 1EGRA 1ZL9A 2VM1A 1OC8A 1MD3A 1AC1A 1B4PA 1JLVA 3JCML 1XWBA 2H66A 5CRHA 2C0FA 2LV3A 1S3CA 2IL3A 1ZOFA 4MK3A 5IPHA 2V32A 4EF0A 3DIEA 2RM6A 1THOA 4ZL8A 1PKZA 1ERTA 4L5LA 3FY7A 2HZFA 3CRTA 2H1BA 2P0GA 3GTUB 1U87A 2OE3A 1T3BA 1XWCA 2KP1A 1YY7A 3NZNA 5B8BA 2WS2A 2GS3A 2HRKA 2JSZA 3LGCA 3I43A 4DVCA 2JZSA 2XBQA 3TKPA 1EWXA 1Z7RA 3OR5A 2X8GA 4L8EA 3EE2A 4XS4A 4MZCA 1T7PB 2YWIA 1TK5B 1LJRA 5JCWA 1U88A 11GSA 1T4ZA 1EV4A 1BQ7A 2B5YA 4F9ZA 3EC3A 4LMVA 1XOAA 1WOUA 3VURA 4DSSA 1PX6A 4MABA 1PKWA 1K0OA 1U3IA 1KBNA 4K0GA 4KW6A 4D73B 1YEPA 2PERA 4FH8A 1FOVA 2F9SA 2CQ9A 3TJJA 4J2FA 2H0GA 3GV1A 3WD6A 1O7UA 1R5PA 4O7HA 5E4WA 2YJ7A 4KSOA 3DVXA 4E8EA 2NPBA 2V6KA 4GTUA 2I4AA 1VF3A 2L6CA 5GZZB 5FT3A 3BCIA 2MBTA 3GL3A 2DIZA 2LQOA 2LJKA 1TRUA 2ZNMA 4Q5NA 2DJKA 4FIWA 2X8CA 5IMVA 4TRXA 1VF4A 1B8XA 3S9FA 1QXHA 1V58A 2VAFA 4XRAA 5IOWA 5ABRA 2VLVA 3GYKA 1A8LA 5A4VA 1NHYA 3GH9A 5D73A 2WJUA 2PMTA 2IMKA 16GSA 3GKMA 1VF1A 1GWCA 2VCTA 1S3DA 1VGLA 2PPTA 1BYEA 3GUSA 6GSYA 2VCQA 1TK0B 1QFNA 5CNWA 2AB6A 1WRYA 4G2EA 1BAYA 3LG6A 2HSMB 3GKXA 5ID2A 2KLXA 4KDUA 5AGYA 4WF4A 1GSUA 4ZB9A 4ID0A 1CQHA 1LBKA 14GSA 4KF9A 1Q4JA 2LEGA 3K8NA 3WGXA 2C3TA 1K0DA 5IMZA 2OKAA 5LCZA 2FCHA 2L5OA 3HZ8A 2JU5A 4NWYA 3HHVA 1BX9A 2RIIA 4L5OA 4K7NA 4QL7A 4ZIJA 4K2DA 4JRRA 3C7MA 3HVSA 2H6ZA 1AQWA 5GAPD 1ST9A 4MDCA 1K0MA 2MMNA 1GUMA 3GHAA 1PSQA 2HYXA 2XC2A 1Z6MA 2FNOA 4KGIA 3VPTA 3AY8A 1WP0A 1K0NA 4GSSA 5IMCA 4OO5A 2FWFA 1I9DA 4ECCA 4TR3A 2YCDA 3KP8A 4IJIA 1EZKA 1EP8A 3DRNA 3LFLA 3EU4A 3IXRA 5CP1A 1XVWA 3W6GA 5DQYA 4K0NA 3DEXA 2OBIA 2WFCA 4USSA 4O32A 4ILFA 1TW9A 1GNWA 4G0IA 2I81A 4KE3A 1MDIA 2CVBA 4GCIA 4PNGA 2HRFA 1HD2A 5DALB 1K3LA 4TW5A 4F03A 1GTAA 4NHWA 5ECMB 3APOA 3UL3A 1A2LA 3ZITA 4PQ1A 1O8XA 1RQMA 3Q74A 3FKFA 3TCOA 1PN9A 2FWEA 4V2NA 5G1LA 5ECPB 3Q19A 4MJCA 3GNJA 4LMWA 1AW9A 1YF1A 1SENA 4ZBAA 7GSSA 2D2ZA 3TB2A 2DIYA 1OAZA 4GSNA 2KUCA 2R4VA 4CDOA 1ZZYA 3GKNA 1GP1A 4G9HA 4HDEA 3EVIA 2B5EA 4OCFA 3RHCA 4GLTA 1PMTA 4D73A 4MJEA 2WCIA 3M1GA 1XWAA 4MA9A 5D96A 4FYBA 5IMFA 3QAGA 2GDRA 4IVFA 2WZ9A 3GFKA 5IIZA 2HZEB 4ULXA 2B7KA 4PUAA 5LD0A 1HNCA 2IIYA 4TXVA 2CZ3A 5CRDA 20GSA 1JZDA 1GSFA 2F3MA 4MJAA 5F05A 3RBTA 1M9BA 1GTIA 1JZRA 5JCGA 5IOXA 4OFTA 2H1GA 4BVXB 2AV4A 4IHUA 4TR1B 2EIRA 3ZTLA 2VL9A 4KCEA 4Q5RA 1FB6A 1S3AA 2FWHA 4I8BA 2LRTA 2VUPA 1OKDA 1ZGNA 2WRTA 3C8EA 4IN0A 3N9JA 2DJJA 2P31A 4EC0A 3J7Yb 1GUHA 3H93A 2HXKA 2PVQA 3QFAC 4XIHA 2HSMA 3D4MA 2LNTA 2DJ2A 1DE1A 2OE1A 2B6MA 1SKRB 3IAS2 2VCZA 3TOUA 2DMLA 4POBA 2NVLA 1QGVA 2ZUPA 5H5SA 4TKYA 2GSSA 5JCUA 1G0TA 1FVKA 2XBIA 2OADA 3VK9A 2NBSA 3R2QA 3UOMA 1Q98A 3ZMKA 3G9BA 2IWTA 4ECIA 1WWJA 5ELGA 3FZ9A 3U5RE 3HJMA 2H6XA 1R4WA 5AIVA 3O76A 4MH2A 4N11A 1TJDA 5GAND 4WR5A 1TK8B 2BMXA 1F6MC 3M3MA 3QFBC 1XOBA 4HJ2A 2VCWA 2XHFA 3M9JA 3UAPA 1SK1A 1THXA 5ECNB 2GQMA 2IN3A 3IHQA 4K1FA 1BG5A 2QGVA 2GSRA 1XFLA 1WMJA 1M2AA 3FR3A 1WJKA 2CVKA 4L0UA 3H8QA 1GSEA 4EVMA 2M72A 3CBUA 4WKWA 1PA3A 1FG4A 4E8HA 1GRXA 2B7JA 2L4QA 4KSMA 6GSUA 1GULA 1WE0A 1U6TA 1AXDA 3KEBA 4MPGA 3MDKA 2VD0A 4XCSA 3H79A 4LL4B 3ISOA 4OFNA 5C00A 2B1KA 1KNGA 1LU4A 2FD3A 4KCAA 5CRGA 1FO5A 1ERVA 1TRVA 3UVHA 3GKKA 3QPMA 3F6DA 2AHEA 4N0VA 3L9UA 2WGRA 4N30A 3HD5A 3G7YA 3F4TA 1O6JA 5DCHA 3LJRA 3R3EA 1TRSA 2HZEA 4BWSA 4ECJA 1QQ2A 5D9VA 5J41A 4I2UA 1IYHA 3D21A 4PUFC 3PINA 5IO0A 1V98A 2C4JA 2I1UA 1MTCA 4FYCA 2LJRA 2LQQA 4IP6A 4YAPA 1GH2A 3IK7A 3BBYA 1K3OA 4KA0A 2AJQB 3TKSC 3ZLPA 3BOAA 1TP9A 3HJPA 3IK9A 5KN2A 4BVXA 3LWAA 4TR1A 2NTOA 1G7EA 3FEUA 1XXUA 4LA1A 3QCPA 3KP9A 4Q5QA 4AF2A 4MP4A 4NHZA 3CYNA 3FW2A 2L4CA 1USBA 2CX4A 1JFUA 5D9XA 4GSTA 2CVDA 1UVZA 2KHPA 3HJOA 4YH2A 1FB0A 2LNSA 1SJZA 5COHA 1GTBA 3FZ4A 4MH3A 4ZB6A 2VOCA 6GSWA 4RUVA 2VD1A 2VLTA 2R5GA 1SYRA 1UA5A 22GSA 2JACA 4TVEA 3O3TA 4TR0A 3LQ7A 8GSSA 1X9WB 3KXOA 3TUEA 2FWGA 5CAXA 1EOHA 1SK2A 2C0EA 3A2VA 2QC7A 1PGTA 2VCXA 2GT5A 4ZILA 2C1YA 2FA4A 3TJBA 4EE0A 1Y25A 4BVYB 4YQMA 1W89A 4LL1B 3F6FA 3EWLA 2AUVA 2H73A 1PL1A 1HNBA 4ISDA 1XBSA 1UC7A 3KZQA 1TXXA 2GQLA 6GSTA 1TTZA 2EIQA 3FRCA 4OWYA 1M0UA 2DBCA 3UVTA 2WDUA 1TI3A 1TDIA 4P3YB 4G0KA 2FHEA 2YANA 3N5OA 1PD21 1FW1A 5DVBA 2L59A 3UARA 2YPMA 2N5AA 1TU7A 3L4NA 3CSJA 4KNDA 1ML6A 3MSZA 2X64A 3I9V2 3WT1A 3WYWA 2VL2A 4ZBDA 1SKWB 5AISA 4GF0A 1T8EB 5D9TA 4EXJA 3RHBA 2CAQA 5B8AA 3E0UA 2MMZA 2GSQA 4PGTA 2HSHA 2HFDA 4X1UA 1GUKA 4RQXA 2GVPA 5HR1A 3KGKA 4MZWA 1X0RA 2GSTA 4HU9A 1FAAA 3EINA 3C73A 4HEA2 3LORA 2VLUA 3H1NA 1E2YA 4KAEA 1A8YA 2O89A 3GN3A 1F3AA 2A4VA 1PX7A 1YKAA 4PQIA 5DDLA 4NXIA 3TKSA 2YJHA 2K9FA 2YWNA 4NV5A 4K7OA 2G2QA 3KM6A 2VM2A 3I6AA 1A24A 4HS1A 2ON5A 3P8WA 2KOKA 5CYYA 2FA8A 4KDXA 3KCMA 1O8WA 3TDGA 3TGZA 1SKSB 2B5XA 2H19A 2OE0A 2J23A 3EMXA 3HVVA 1O85A 1IYIA 1QUWA 1R7HA 5J9CA 12GSA 1KTEA 2R2JA 2HLSA 5CREA 3NOFA 2CZ2A 3E3EA 1JZOA 1OE8A 4BA7A 4AGSA 2H71A 3VWWA 4ML6A 5F07A 1V2AA 4JZQA 4O92A 2DJ1A 1SD9A 2N5BA 2DJ0A 2HSNB 3F3RA 1YJ6A 1YZXA 3RPPA 4N10A 5EY6A 2HE3A 1E6BA 2HNLA 3I69A 4I2TA 1XIYA 5KEJA 1T00A 2H01A 3TKQA 5J5NA 4POLA 3IV4A 3HVXA 2IMEA 2BTOT 2DC5A 1YQ1A 2JZTA 1O81A 1ZMAA 3KTLA 2HQTA 3P7XA 2K6VA 1B9YC 4GRFA 2PU9C 1X5CA 4BWQA 1OC3A 2CT6A 1R5AA 2RLIA 2FUG2 2H8LA 5AN1A 2PUKC 5A5KA 3ERGA 4GXZA 4XHMA 1CQGA 1BJXA 4MLYA 4NMUA 3EURA 4BVYA 4MJBA 5B6MA 4CHSA 4WEYA 3TJKA 3ZRDA 1R26A 4I6XA 2HSYA 3P90A 4EL1A 3WT2A 1YKCA 2WB9A 2R3XA 1JLWA 4FQUA 1GTUA 1AAZA 4TOPA 4OO4A 4KDYA 1VF2A 2FGXA 2R6KA 1ON4A 2H6YA 2YWMA 19GSA 1XCCA 1EEMA 1XWKA 9GSSA 2O85A 4J56E 2E2MA 3ZYWA 4H86A 2PBJA 4G19A 4AJ7A 1N8JA 2GTUA 2CA8A 3L9SA 1NW2A 1Z7PA 4HOJA 1BEDA 6GSVA 5CRWA 5EVOA 3D22A 5L71A 4KH7A 4RI7A 1XW9A 1SD8A 4TN8A 1EV9A 3KJYA 3LYKA 4HZ2A 2MYGA 3E9JB 2FY6A 2P5QA 3HXSA 3GX0A 2V2GA 4FO5A 3ED3A 2E7PA 5DCGA 2PGTA 3MWHA 1TRWA 5G1KA 2A2RA 3SWLA 1B9XC 4V1Ag 3TJFA 5ECRB 3TRXA 3NIVA 5ECLB 2F8AA 4PTSA 4NV2A 4RI6A 4K8MA 1ACVA 4MF5A 4GWRA 2CAIA 4MF7A 1WPIA 2H1DA 5E59A 2CX3A 4GQFA 1JZWA 5BMUA 1M2DA 5HFGA 4Z7XA 4ZB8A 3DYRA 4AJ8A 3GURA 2HRNA 2OBKA 2O7KA 3VWVA 1PL2A 3CMIA 1QK8A 2LSTA 5EPFA 1ZCPA 1DSBA 4IBPA 5FWGA 2GZPA 4HQSA 4XS6A 4DSQA 5EL8A 1DBYA 3LYPA 2GZZA 4JEDA 5H5RA 5J4UA 3QR6A 2TRXA 1M99A 3SBCA 2O8VB 3A2WA 3RDWA 3KMNA 4V1Ap 5ECIB 3QAWA 5DJMA 3CRUA 1GL8A 2PVOC 2GQKA 4HU7A 3M0FA 2HI7A 1G6WA 3TKRA 3F3QA 3CSHA 1A2MA 2EIOA 5ECKB 5HR3A 4PQHA 4N0ZA 2VO4A 5DAKB 1OKTA 5G5EA 4WBRD 2C3QA 4WBJA 2VL2C 5HQPA 3D6IA 2MMAA 3DGQA 3MAKA 1NHOA 3FHKA 2LRCA 1C72A 3IA1A 1X5DA 2K8SA 3LXZA 2H30A 1M7TA 4YQUA 2G0FA 5IO2A 5J3RA 3APSA 4ZXGA 1XPVA 3IC8A 1YDKA 2ZCTA 5JWRB 1SL2B 1RW1A 4BL7B 3ZFBA 2YZHA 1I5GA 3QOUA 1A2JA 3UBKA 1V57A 2YOIA 1SL0B 17GSA 2JZRA 3F8UA 4IQ1A 3HCZA 2AYTA 3ZFLA 4EO3A 3VLNA 1K0AA 4G10A 1U3AA 3RAZA 4AJ6A 5IPGA 3GH6A 1N2AA 3LXTA 3TRPA 5D8IA 3V1WA 3FZAA 4QQ7A 3VI5A 2YZUA 4HQZA 3APQA 2XPEA 2QSIA 4WR4A 1H4OA 2M80A 3TKSE 3IBHA 4EKZA 1OE7A 3EYTA 4V2MA 5F06A 1ERUA 4WXTA 4CW9A 2LKUA 4EDZA 1OC9B 1EP7A 3ZL5A 1SJIA 2K8VA 1GSDA 3MNGA 3A5WA 1Y6EA 1JHBA 1AIUA 2HT9A 3RPNA 2H76A 2H0IA 3HY2A 5HR2A 5DBQA 5ECSA 3QAVA 3D0ZA 3G7JA 5H5QA 5INYA 4ECBA 1G6YA 2VL3A 3IDVA 2FLSA 4PXOA 3PR8A 1X9MB 3DMLA 3D5JA 2H1AA 3EU3A 2ON7A 3KD0A 4FYUA 4X0XA 4JR6A 1GLPA 1B4QA 1AQVA 3FR9A 1OYJA 4YQVA 2C8UA 1A0RP 3F0IA 2H72A 5KN3A 3F63A 4MMMA 1V9WA 1A23A 2J9HA 3FK8A 1W4VA 4OD7A 1AQXA 1EGOA 3ERFA 2A2SA 4RQRA 3P2AA 1SK0A 1H75A 1ABAA 4MCUA 1PRXA 4I97A 2C3NA 4XS1A 2BJXA 4NPBA 3BCKA 1G7OA 5J9BA 5G30A 5AIXA 4IW9A 4I5QA 5HFKA 1SU9A 3EMPA 10GSA 3DWVA 2TRCP 4OCEA 4JU5A 4TR4A 5HR0A 4K6XA 4BPYA 4XTSA 4IGJA 3G7IA 2B1LA 2OACA 4PNFA 4POMA 5ECQB 4EDYA 4PURA 5DAKA
chains in the Genus database with same CATH superfamily
1K0CA 5ECHB 4DSRA 2IFQB 2UZ8A 3IC4A 2X99A 3H4KA 4AKHA 3ZIVA 3UIWA 2LS5A 2LJAA 2YNXA 2OA7A 1YEWC 3ZREA 4KUNA 13GSA 1V40A 2F51A 2YP6A 4K9ZA 2MZCA 3KTBA 2P5RA 1MD4A 3PH9A 6GSSA 2C0DA 2OJLA 1DUGA 1YEXA 3C71A 2A2PA 3FMWA 2NDOA 1M2BA 1T4YA 4BL7A 4HZ4A 2IJYA 1KEBA 5F0GA 1AUCA 3IPZA 1F2EA 2B3SA 1B48A 4ZL7A 1ZYPA 3UBLA 3KIJA 2DLXA 1K3YA 4OFMA 1M9AA 2UV8G 2LUSA 1GNEA 2DJ3A 3GRXA 3J7Yk 1DE2A 4EIQA 2TIRA 3VI7A 4MF6A 4IQAA 2YN1A 5B6NA 4KB3A 5F8BA 1GSSA 5G5FA 3C1RA 1ILOA 3MIXA 3PPUA 5D93A 3ERWA 2RUFA 4TXOB 3WGEA 5KN0A 1Z9HA 3VWUA 1FHEA 1ZYEA 5IMAA 3GTUA 2N5FA 3ZVJA 2GZYA 3LEFA 3ZZXA 2AAWA 2VCVA 5DJLA 4K5SA 3ZMLA 2C0GA 1ERWA 2QKEA 1Z5YE 1OVNA 2EC4A 2YWOA 3GL5A 4ACSA 5JWOB 1WIKA 2HRAA 2L57A 3VFIA 2DMMA 4K7IA 2EFEA 1XZOA 1EOGA 5IMDA 2DSAA 2L6DA 3QMXA 3DVWA 2R0GA 2ES7A 1OC9A 4L0WA 2CV4A 4J57E 2VIMA 2H70A 3FYGA 1MDKA 4ZL9A 2IMFA 3WGDA 3GIXA 3W8JA 1FVJA 2WULA 1SL1B 2K18A 1X9SB 1T1VA 3TRQA 2M46A 5GSTA 4MZBA 1TKDB 4KX4A 2YV7A 1GLQA 3L0HA 2PWJA 1J0FA 2PN8A 5D9WA 3IAM2 4DEJA 2JADA 4IKHA 3VWXA 4F0CA 1ZYQB 1A0FA 2DKIA 2MBSA 2IPAA 3CTGA 2MMOA 2Z9SA 4FXYP 1PN0A 4POKA 3CTFA 1EEJA 2GLRA 5GSSA 3ZVJD 3FR6A 5IM9A 3Q6OA 3PGTA 3US3A 3O6TA 2XPDA 4YAVA 3HA9A 1PFOA 1HQOA 2I3YA 3BD2A 3ME8A 5ECOB 1HYUA 3ME7A 2X8HA 3CSIA 4IJ3A 3C1SA 2HRKB 2VKZG 1X5EA 2I9HA 3M8NA 2H74A 4GQCA 2F8FA 4XS4B 4JBBA 4ZBBA 3TOTA 2YV9A 4X43A 3DD3A 3L9VA 2KP2A 4LLRA 2IFQA 4XRDA 4DSSB 4NAXA 1PQNA 3HKRA 2GT6A 3GA4A 5ENUA 5C04A 1SYXA 1O73A 3HYPA 3M9KA 2C80A 4O5RA 3A3TA 1K0BA 2E2GA 4WF5A 2REMA 1SVLA 1XW6A 3W8SA 1TI1A 3GX8A 1F3BA 3FZ5A 3HDCA 5DQSA 3DKSA 3HZ4A 3KH9A 3D4TA 4JR4A 1RK4A 3QDNA 5LNKe 2V1MA 4V2LA 3CXGA 2L5LA 4G0LA 2ALBA 1BG1A 5KOWA 3MYDA 4F82A 3TJGA 1QMVA 2GGTA 3IE3A 3KMOA 18GSA 1HNAA 2E0QA 5A4UA 1YF0A 1MDJA 2RUEA 3L78A 3GSSA 3DXBA 4IELA 4F0BA 2H75A 1VRSD 4HJMA 2V6OA 5A4WA 4HI7A 2JL4A 2LTKA 5HFIA 4IP1A 3UEMA 4TXOA 5CO3A 5DALA 4EUYA 1F37A 1NSWA 1URMA 5FHIA 1UN2A 5G31A 2IMIA 3HMJG 3U6VA 3GSTA 2JSYA 4JE1A 3GMFA 3LSZA 5ID2B 3ZIJA 3VPQA 2H0HA 2LRNA 3CHXC 5JWQB 4Q5FA 3Q18A 1TU8A 3UJ1A 5KN1A 3UMAA 1F9MA 1GSYA 3IR4A 2V41A 4MPFA 2R37A 4OMVA 4E68A 2WW3A 1SJ6A 6GSXA 2IMDA 1GSQA 1NM3A 5IQYA 1J9BA 1Z3EA 1TOFA 3QD9A 5G2ZA 4HUAA 1XWGA 3BJ5A 3KH7A 5B7CA 4PX1A 1Z6NA 3F4SA 1J08A 1XVQA 4ML1A 4IS0A 4F2IA 2O87A 3IRAA 1XW5A 3A2XA 3IOSA 2RM5A 3F4RA 4QL9A 3F9UA 1MEKA 4WETA 5ELAA 4YKFA 1EGRA 1ZL9A 2VM1A 1OC8A 1SVMA 1MD3A 1AC1A 1B4PA 1JLVA 3JCML 1XWBA 2H66A 4G01A 5CRHA 2C0FA 2LV3A 1S3CA 2IL3A 1ZOFA 4MK3A 5IPHA 2V32A 4EF0A 3DIEA 2RM6A 1THOA 4ZL8A 2H1LA 1PKZA 1ERTA 4L5LA 3FY7A 2HZFA 3CRTA 2H1BA 2P0GA 3GTUB 1U87A 2OE3A 1T3BA 1XWCA 2KP1A 1YY7A 3NZNA 5B8BA 2WS2A 2GS3A 2HRKA 2JSZA 3LGCA 3I43A 4DVCA 2JZSA 2XBQA 3TKPA 1I1IP 1EWXA 1Z7RA 3OR5A 2X8GA 4L8EA 3EE2A 4XS4A 4MZCA 1T7PB 2YWIA 1TK5B 1LJRA 5JCWA 1U88A 11GSA 1T4ZA 1ZYNA 1EV4A 1BQ7A 4W66A 2B5YA 4F9ZA 3EC3A 4LMVA 1XOAA 1WOUA 3VURA 4DSSA 1PX6A 4MABA 1PKWA 1K0OA 1U3IA 1KBNA 4K0GA 4KW6A 4D73B 1YEPA 2PERA 4FH8A 1FOVA 2F9SA 2CQ9A 3TJJA 4J2FA 2H0GA 3GV1A 3WD6A 1O7UA 1R5PA 4O7HA 5E4WA 2YJ7A 4KSOA 3DVXA 4E8EA 2NPBA 5J4VA 2V6KA 4GTUA 2I4AA 1VF3A 2L6CA 4Z2UA 2QA1A 5GZZB 5FT3A 3BCIA 2MBTA 3GL3A 2DIZA 2LQOA 2LJKA 1TRUA 2ZNMA 4Q5NA 2DJKA 4FIWA 2X8CA 4PHZC 5IMVA 4TRXA 1VF4A 1B8XA 3S9FA 1QXHA 1V58A 2VAFA 4XRAA 5IOWA 5ABRA 4AKXB 2VLVA 3GYKA 1A8LA 5A4VA 1NHYA 3GH9A 5D73A 2WJUA 2PMTA 2IMKA 16GSA 3GKMA 1VF1A 1GWCA 2VCTA 1S3DA 1VGLA 2PPTA 1BYEA 3GUSA 5BRTA 6GSYA 2VCQA 1TK0B 1QFNA 5CNWA 2AB6A 1WRYA 4G2EA 1BAYA 3LG6A 2HSMB 3GKXA 5ID2A 2KLXA 4KDUA 5AGYA 4WF4A 1GSUA 4ZB9A 4ID0A 1CQHA 1LBKA 14GSA 4KF9A 1Q4JA 2LEGA 3K8NA 3WGXA 2C3TA 1K0DA 5IMZA 2OKAA 5LCZA 2FCHA 2L5OA 3HZ8A 2JU5A 4NWYA 3HHVA 1BX9A 2RIIA 4L5OA 4K7NA 4QL7A 4ZIJA 4K2DA 4JRRA 3C7MA 3HVSA 2H6ZA 1AQWA 2R0CA 5GAPD 1ST9A 2QA2A 4MDCA 1K0MA 2MMNA 1GUMA 3GHAA 1PSQA 2HYXA 2XC2A 1Z6MA 2FNOA 4KGIA 3VPTA 3AY8A 1WP0A 1K0NA 4GSSA 5IMCA 5J4YA 4OO5A 2FWFA 1I9DA 4ECCA 4TR3A 2YCDA 3KP8A 4IJIA 1EZKA 1EP8A 3DRNA 3LFLA 3EU4A 3IXRA 5CP1A 1XVWA 3W6GA 5DQYA 4K0NA 3DEXA 2OBIA 2WFCA 4USSA 4O32A 4ILFA 1TW9A 1GNWA 4G0IA 4AKGA 2I81A 4KE3A 1MDIA 2CVBA 4GCIA 2WVXB 4PNGA 1FOHA 2HRFA 1HD2A 5DALB 1K3LA 4TW5A 4F03A 1GTAA 4NHWA 5ECMB 3APOA 3UL3A 1A2LA 3ZITA 4PQ1A 1O8XA 1RQMA 3Q74A 3FKFA 3TCOA 1PN9A 2FWEA 4V2NA 5G1LA 5ECPB 3Q19A 4MJCA 3GNJA 4LMWA 1AW9A 1YF1A 1SENA 4ZBAA 7GSSA 2D2ZA 3TB2A 2DIYA 1OAZA 4GSNA 2KUCA 2R4VA 4CDOA 1ZZYA 3GKNA 1GP1A 4PI2C 4G9HA 4HDEA 3EVIA 2B5EA 4OCFA 3RHCA 5A5HB 4GLTA 5A1NB 1PMTA 4MNNA 4D73A 4MJEA 2WCIA 3M1GA 1XWAA 4MA9A 5D96A 4FYBA 5IMFA 3QAGA 2GDRA 4IVFA 2WZ9A 3GFKA 5IIZA 2HZEB 4ULXA 2B7KA 4PUAA 5LD0A 1HNCA 2IIYA 4TXVA 2CZ3A 5CRDA 20GSA 1JZDA 1GSFA 2F3MA 4MJAA 5F05A 3RBTA 1M9BA 1GTIA 1JZRA 5JCGA 5IOXA 4OFTA 2H1GA 4BVXB 2AV4A 4IHUA 4TR1B 2EIRA 3ZTLA 3CWGA 2VL9A 4KCEA 4Q5RA 1FB6A 1S3AA 2FWHA 2LRTA 4I8BA 2VUPA 1OKDA 1ZGNA 2WRTA 3C8EA 4IN0A 3N9JA 2DJJA 2P31A 4EC0A 3J7Yb 1GUHA 2WW2A 3H93A 2HXKA 2PVQA 3QFAC 4XIHA 2HSMA 3D4MA 4Z2TA 2LNTA 2DJ2A 1DE1A 2OE1A 5J47A 2B6MA 1SKRB 4ICYA 3IAS2 2VCZA 3TOUA 2DMLA 1M3IA 4POBA 2NVLA 1QGVA 2ZUPA 5H5SA 4TKYA 2GSSA 5JCUA 1G0TA 1FVKA 2XBIA 2OADA 4A5PA 3VK9A 2NBSA 3R2QA 3UOMA 1Q98A 3ZMKA 3G9BA 2IWTA 4ECIA 1WWJA 5ELGA 3FZ9A 3U5RE 3HJMA 2H6XA 1R4WA 5AIVA 1XG8A 3O76A 4MH2A 4N11A 1TJDA 5GAND 4WR5A 1TK8B 2BMXA 1F6MC 3M3MA 3QFBC 1XOBA 4HJ2A 2VCWA 2XHFA 3M9JA 3UAPA 1SK1A 1THXA 5ECNB 2GQMA 2IN3A 3IHQA 4K1FA 1BG5A 2QGVA 2GSRA 1XFLA 1WMJA 1M2AA 3FR3A 1WJKA 2CVKA 2WVXA 4L0UA 3H8QA 1GSEA 4EVMA 2M72A 3CBUA 4WKWA 1PA3A 1FG4A 4E8HA 1GRXA 2B7JA 2L4QA 4KSMA 6GSUA 1GULA 1WE0A 1U6TA 1AXDA 3KEBA 4MPGA 3MDKA 2VD0A 4XCSA 3H79A 4LL4B 3ISOA 4OFNA 5C00A 2B1KA 1KNGA 1LU4A 2FD3A 4KCAA 5CRGA 1FO5A 2WVZA 1ERVA 1TRVA 5A5HA 3UVHA 5A1NA 3GKKA 3QPMA 3F6DA 2AHEA 4N0VA 3L9UA 2WGRA 4N30A 3HD5A 3G7YA 3F4TA 1O6JA 5DCHA 3LJRA 3R3EA 1TRSA 2HZEA 4BWSA 4ECJA 1QQ2A 1YVLA 5D9VA 5J41A 4I2UA 1IYHA 3D21A 4PUFC 3PINA 5IO0A 1V98A 2C4JA 2I1UA 2O5VA 1MTCA 4FYCA 2LJRA 2LQQA 4IP6A 4YAPA 1GH2A 3IK7A 3BBYA 1K3OA 4KA0A 2AJQB 3TKSC 2WW1A 3ZLPA 3BOAA 1TP9A 3HJPA 3IK9A 5KN2A 4BVXA 3LWAA 4TR1A 2NTOA 1G7EA 3FEUA 1XXUA 4LA1A 3QCPA 3KP9A 4Q5QA 4AF2A 4MP4A 4NHZA 3CYNA 3FW2A 2L4CA 1USBA 2CX4A 1JFUA 5D9XA 4GSTA 2CVDA 1UVZA 2KHPA 3HJOA 4YH2A 4GDFA 1FB0A 2LNSA 1SJZA 5COHA 1GTBA 3FZ4A 4MH3A 4ZB6A 2VOCA 4BIKA 6GSWA 3HVNA 4RUVA 2VD1A 2VLTA 2R5GA 1SYRA 1UA5A 22GSA 2JACA 4AI6A 4TVEA 3O3TA 4TR0A 2O3EA 3LQ7A 8GSSA 1X9WB 3KXOA 3TUEA 2FWGA 5CAXA 1EOHA 1SK2A 2C0EA 3A2VA 2QC7A 1PGTA 2VCXA 2GT5A 4ZILA 2C1YA 2FA4A 3TJBA 4EE0A 1Y25A 4BVYB 4YQMA 1W89A 1M3JA 4LL1B 3F6FA 3CQFA 3EWLA 2AUVA 2H73A 1PL1A 1HNBA 4ISDA 1XBSA 1UC7A 3KZQA 1TXXA 2GQLA 6GSTA 1TTZA 2EIQA 3FRCA 4OWYA 1M0UA 2DBCA 3UVTA 2WDUA 1TI3A 1TDIA 4P3YB 2OT3A 4G0KA 2FHEA 2YANA 3N5OA 2O36A 1PD21 1FW1A 5DVBA 2L59A 3UARA 3RGBC 2YPMA 2N5AA 1TU7A 3L4NA 3CSJA 4KNDA 2EFDA 1ML6A 3MSZA 2X64A 3I9V2 3WT1A 3WYWA 4CY6A 2VL2A 4ZBDA 1SKWB 5AISA 4GF0A 1T8EB 1S4BP 5D9TA 4EXJA 3RHBA 2CAQA 5B8AA 3E0UA 2MMZA 4AKIA 2GSQA 4PGTA 2HSHA 2HFDA 4X1UA 1GUKA 4RQXA 2GVPA 5HR1A 3KGKA 4MZWA 1X0RA 2GSTA 4HU9A 1FAAA 3EINA 3C73A 4HEA2 3LORA 2VLUA 3H1NA 1E2YA 4KAEA 1A8YA 2O89A 2EFHA 3GN3A 1F3AA 2A4VA 1PX7A 1YKAA 4PQIA 5DDLA 4NXIA 5BMUB 3TKSA 2DKHA 2YJHA 2K9FA 2YWNA 4NV5A 4K7OA 2G2QA 5A34B 3KM6A 2VM2A 3I6AA 1A24A 4HS1A 2ON5A 3TU3B 3P8WA 2KOKA 5CYYA 2FA8A 4KDXA 3KCMA 1O8WA 3TDGA 3TGZA 1SKSB 2B5XA 2H19A 2OE0A 2J23A 3EMXA 3HVVA 3LW9A 1O85A 1IYIA 1QUWA 1R7HA 5J9CA 12GSA 1KTEA 2R2JA 2HLSA 5CREA 3NOFA 2CZ2A 3E3EA 1JZOA 1OE8A 4BA7A 4AGSA 2H71A 3VWWA 4ML6A 5F07A 1V2AA 4HSCX 4JZQA 4O92A 2DJ1A 1SD9A 2N5BA 2DJ0A 2HSNB 3F3RA 3RFRC 1YJ6A 1YZXA 3RPPA 4N10A 5EY6A 2HE3A 4EIPA 1E6BA 2HNLA 3I69A 4I2TA 1XIYA 5KEJA 1T00A 2H01A 3TKQA 5J5NA 4POLA 3IV4A 3HVXA 2IMEA 2BTOT 2DC5A 1YQ1A 2JZTA 1O81A 1ZMAA 3KTLA 2HQTA 3P7XA 2K6VA 1B9YC 4GRFA 2PU9C 1X5CA 4BWQA 1OC3A 2CT6A 1R5AA 2RLIA 2FUG2 2H8LA 5AN1A 2PUKC 5A5KA 3ERGA 4GXZA 4XHMA 1CQGA 1BJXA 4MLYA 4NMUA 3EURA 4BVYA 4MJBA 5B6MA 4CHSA 4WEYA 3TJKA 3ZRDA 1R26A 4I6XA 2HSYA 3P90A 4EL1A 3WT2A 1YKCA 2WB9A 2R3XA 1JLWA 4FQUA 2X49A 1GTUA 1AAZA 4TOPA 4OO4A 4KDYA 1VF2A 2YWMA 2R6KA 1ON4A 2H6YA 2FGXA 19GSA 1XCCA 1Y1UA 1EEMA 1XWKA 9GSSA 2O85A 4J56E 2E2MA 3ZYWA 4H86A 2PBJA 4G19A 4AJ7A 1N8JA 2GTUA 2CA8A 3L9SA 1NW2A 3IHGA 1Z7PA 4HOJA 1BEDA 6GSVA 5CRWA 5EVOA 3D22A 5L71A 4KH7A 4RI7A 1XW9A 1SD8A 4TN8A 1EV9A 3KJYA 3LYKA 4HZ2A 2MYGA 3E9JB 2FY6A 2P5QA 3HXSA 3GX0A 2V2GA 4FO5A 3ED3A 2E7PA 5DCGA 2PGTA 3MWHA 1TRWA 5G1KA 2A2RA 4X4JA 3SWLA 1B9XC 4PI0C 4V1Ag 3TJFA 5ECRB 3TRXA 3NIVA 5ECLB 2F8AA 4PTSA 4NV2A 4RI6A 4K8MA 1ACVA 4MF5A 4GWRA 2CAIA 4MF7A 1WPIA 2H1DA 5E59A 2CX3A 4GQFA 1JZWA 2WVYA 5BMUA 5J40A 5A34A 1N25A 1M2DA 5HFGA 4Z7XA 4ZB8A 3DYRA 3EPTA 4AJ8A 3GURA 2HRNA 2OBKA 2O7KA 3VWVA 1PL2A 3CMIA 4ZB7A 1QK8A 2LSTA 5EPFA 2A4HA 1ZCPA 1DSBA 4IBPA 5FWGA 2GZPA 4HQSA 4XS6A 4DSQA 5EL8A 4K2XA 1DBYA 3LYPA 2GZZA 4CY8A 1S3RA 2R0PA 4JEDA 5H5RA 5J4UA 3QR6A 2TRXA 1M99A 1BF5A 3SBCA 2O8VB 3A2WA 3RDWA 3KMNA 4V1Ap 5ECIB 3QAWA 2HSNA 5DJMA 1SVOA 3CRUA 1GL8A 2PVOC 2GQKA 4HU7A 3M0FA 2HI7A 1G6WA 3TKRA 3F3QA 3CSHA 1A2MA 2EIOA 5ECKB 5HR3A 4PQHA 4N0ZA 2VO4A 5DAKB 5KOXA 1OKTA 5G5EA 4WBRD 2C3QA 4WBJA 2VL2C 5HQPA 3D6IA 2MMAA 3DGQA 4O5QA 2WZSA 3MAKA 1NHOA 3FHKA 2LRCA 1C72A 3IA1A 1X5DA 2K8SA 3LXZA 2H30A 1M7TA 4YQUA 2G0FA 5IO2A 2EFCA 5J3RA 3APSA 4ZXGA 1XPVA 3IC8A 1YDKA 2ZCTA 5JWRB 1SL2B 1RW1A 4BL7B 3ZFBA 4O5UA 2YZHA 1I5GA 3QOUA 1A2JA 3A5IA 3UBKA 1V57A 2YOIA 1SL0B 17GSA 2JZRA 3F8UA 4IQ1A 3HCZA 2AYTA 3ZFLA 4EO3A 3VLNA 1K0AA 4G10A 1U3AA 3RAZA 4AJ6A 5IPGA 3GH6A 1N2AA 3LXTA 3TRPA 5D8IA 3V1WA 3FZAA 4QQ7A 3VI5A 2YZUA 4HQZA 3APQA 2XPEA 2QSIA 4WR4A 4N3ZA 1H4OA 2M80A 3TKSE 3IBHA 4EKZA 1OE7A 4K5RA 3EYTA 4V2MA 5F06A 1ERUA 4WXTA 4QMKA 4CW9A 2LKUA 4EDZA 1OC9B 1EP7A 3ZL5A 1SJIA 2K8VA 1GSDA 3MNGA 3A5WA 1Y6EA 1JHBA 1AIUA 2HT9A 3RPNA 2H76A 2H0IA 3HY2A 5HR2A 5DBQA 5ECSA 3QAVA 3D0ZA 3G7JA 5H5QA 5INYA 4ECBA 1G6YA 2VL3A 3IDVA 2FLSA 4PXOA 3PR8A 2WW0A 1X9MB 3DMLA 3D5JA 2H1AA 3EU3A 2ON7A 3KD0A 4FYUA 4X0XA 2X4AA 1GLPA 4JR6A 1B4QA 1AQVA 3FR9A 1OYJA 4YQVA 2C8UA 1A0RP 3F0IA 2H72A 5KN3A 3F63A 4MMMA 1V9WA 1A23A 4Z2RA 2J9HA 3FK8A 1W4VA 4OD7A 1AQXA 1EGOA 3ERFA 2A2SA 4RQRA 3P2AA 1SK0A 1H75A 1ABAA 4MCUA 1PRXA 4I97A 2C3NA 4XS1A 2BJXA 4NPBA 4YKGA 3BCKA 1G7OA 5J9BA 5G30A 5AIXA 4IW9A 4I5QA 5HFKA 1SU9A 3EMPA 10GSA 3DWVA 2TRCP 4OCEA 4JU5A 4TR4A 5HR0A 4K6XA 4BPYA 1TXUA 4XTSA 4IGJA 3G7IA 2B1LA 2OACA 4PNFA 4POMA 5ECQB 4EDYA 4PURA 5DAKA
chains in the Genus database with same CATH topology
1K0CA 5ECHB 4DSRA 2IFQB 2UZ8A 3IC4A 2X99A 3H4KA 4AKHA 3ZIVA 3UIWA 2LS5A 2LJAA 2YNXA 2OA7A 3ZREA 4KUNA 13GSA 1V40A 2F51A 2YP6A 4K9ZA 2MZCA 3KTBA 2P5RA 1MD4A 3PH9A 6GSSA 2C0DA 2OJLA 1DUGA 1YEXA 3C71A 2A2PA 3FMWA 2NDOA 1M2BA 1T4YA 4BL7A 4HZ4A 2IJYA 1KEBA 5F0GA 1AUCA 3IPZA 1F2EA 2B3SA 1B48A 4ZL7A 1ZYPA 3UBLA 3KIJA 2DLXA 1K3YA 4OFMA 1M9AA 2UV8G 2LUSA 1GNEA 2DJ3A 3GRXA 3J7Yk 1DE2A 4EIQA 2TIRA 3VI7A 4MF6A 4IQAA 2YN1A 5B6NA 4KB3A 5F8BA 1GSSA 5G5FA 3C1RA 1ILOA 3MIXA 3PPUA 5D93A 3ERWA 2RUFA 4TXOB 3WGEA 5KN0A 1Z9HA 3VWUA 1FHEA 1ZYEA 5IMAA 3GTUA 2N5FA 3ZVJA 2GZYA 3LEFA 3ZZXA 2AAWA 2VCVA 5DJLA 4K5SA 3ZMLA 2C0GA 1ERWA 2QKEA 1Z5YE 1OVNA 2EC4A 2YWOA 3GL5A 4ACSA 5JWOB 1WIKA 2HRAA 2L57A 3VFIA 2DMMA 4K7IA 2EFEA 1XZOA 1EOGA 5IMDA 2DSAA 2L6DA 3QMXA 3DVWA 2R0GA 2ES7A 1OC9A 4L0WA 2CV4A 4J57E 2VIMA 2H70A 3FYGA 1MDKA 4ZL9A 2IMFA 3WGDA 3GIXA 3W8JA 1FVJA 2WULA 1SL1B 2K18A 1X9SB 1T1VA 3TRQA 2M46A 5GSTA 4MZBA 1TKDB 4KX4A 2YV7A 1GLQA 3L0HA 2PWJA 1J0FA 2PN8A 5D9WA 3IAM2 4DEJA 2JADA 4IKHA 3VWXA 4F0CA 1ZYQB 1A0FA 2DKIA 2MBSA 2IPAA 3CTGA 2MMOA 2Z9SA 1PN0A 4POKA 3CTFA 1EEJA 2GLRA 5GSSA 3ZVJD 3FR6A 5IM9A 3Q6OA 3PGTA 3US3A 3O6TA 2XPDA 4YAVA 3HA9A 1HQOA 2I3YA 3BD2A 3ME8A 5ECOB 1HYUA 3ME7A 2X8HA 3CSIA 4IJ3A 3C1SA 2HRKB 2VKZG 1X5EA 2I9HA 3M8NA 2H74A 4GQCA 2F8FA 4XS4B 4JBBA 4ZBBA 3TOTA 2YV9A 4X43A 3DD3A 3L9VA 2KP2A 4LLRA 2IFQA 4XRDA 4DSSB 4NAXA 1PQNA 3HKRA 2GT6A 3GA4A 5ENUA 5C04A 1SYXA 1O73A 3HYPA 3M9KA 2C80A 4O5RA 3A3TA 1K0BA 2E2GA 4WF5A 2REMA 1SVLA 1XW6A 3W8SA 1TI1A 3GX8A 1F3BA 3FZ5A 3HDCA 5DQSA 3DKSA 3HZ4A 3KH9A 3D4TA 4JR4A 1RK4A 3QDNA 5LNKe 2V1MA 4V2LA 3CXGA 2L5LA 4G0LA 2ALBA 1BG1A 5KOWA 3MYDA 4F82A 3TJGA 1QMVA 2GGTA 3IE3A 3KMOA 18GSA 1HNAA 2E0QA 5A4UA 1YF0A 1MDJA 2RUEA 3L78A 3GSSA 3DXBA 4IELA 4F0BA 2H75A 1VRSD 4HJMA 2V6OA 5A4WA 4HI7A 2JL4A 2LTKA 5HFIA 4IP1A 3UEMA 4TXOA 5CO3A 5DALA 4EUYA 1F37A 1NSWA 1URMA 5FHIA 1UN2A 5G31A 2IMIA 3HMJG 3U6VA 3GSTA 2JSYA 4JE1A 3GMFA 3LSZA 5ID2B 3ZIJA 3VPQA 2H0HA 2LRNA 5JWQB 4Q5FA 3Q18A 1TU8A 3UJ1A 5KN1A 3UMAA 1F9MA 1GSYA 3IR4A 2V41A 4MPFA 2R37A 4OMVA 4E68A 1SJ6A 6GSXA 2IMDA 1GSQA 1NM3A 5IQYA 1J9BA 1Z3EA 1TOFA 3QD9A 5G2ZA 4HUAA 1XWGA 3BJ5A 3KH7A 5B7CA 4PX1A 1Z6NA 3F4SA 1J08A 1XVQA 4ML1A 4IS0A 4F2IA 2O87A 3IRAA 1XW5A 3A2XA 3IOSA 2RM5A 3F4RA 4QL9A 3F9UA 1MEKA 4WETA 5ELAA 4YKFA 1EGRA 1ZL9A 2VM1A 1OC8A 1SVMA 1MD3A 1AC1A 1B4PA 1JLVA 3JCML 1XWBA 2H66A 4G01A 5CRHA 2C0FA 2LV3A 1S3CA 2IL3A 1ZOFA 4MK3A 5IPHA 2V32A 4EF0A 3DIEA 2RM6A 1THOA 4ZL8A 2H1LA 1PKZA 1ERTA 4L5LA 3FY7A 2HZFA 3CRTA 2H1BA 2P0GA 3GTUB 1U87A 2OE3A 1T3BA 1XWCA 2KP1A 1YY7A 3NZNA 5B8BA 2WS2A 2GS3A 2HRKA 2JSZA 3LGCA 3I43A 4DVCA 2JZSA 2XBQA 3TKPA 1EWXA 1Z7RA 3OR5A 2X8GA 4L8EA 3EE2A 4XS4A 4MZCA 1T7PB 2YWIA 1TK5B 1LJRA 5JCWA 1U88A 11GSA 1T4ZA 1ZYNA 1EV4A 1BQ7A 4W66A 2B5YA 4F9ZA 3EC3A 4LMVA 1XOAA 1WOUA 3VURA 4DSSA 1PX6A 4MABA 1PKWA 1K0OA 1U3IA 1KBNA 4K0GA 4KW6A 4D73B 1YEPA 2PERA 4FH8A 1FOVA 2F9SA 2CQ9A 3TJJA 4J2FA 2H0GA 3GV1A 3WD6A 1O7UA 1R5PA 4O7HA 5E4WA 2YJ7A 4KSOA 3DVXA 4E8EA 2NPBA 5J4VA 2V6KA 4GTUA 2I4AA 1VF3A 2L6CA 4Z2UA 2QA1A 5GZZB 5FT3A 3BCIA 2MBTA 3GL3A 2DIZA 2LQOA 2LJKA 1TRUA 2ZNMA 4Q5NA 2DJKA 4FIWA 2X8CA 5IMVA 4TRXA 1VF4A 1B8XA 3S9FA 1QXHA 1V58A 2VAFA 4XRAA 5IOWA 5ABRA 4AKXB 2VLVA 3GYKA 1A8LA 5A4VA 1NHYA 3GH9A 5D73A 2WJUA 2PMTA 2IMKA 16GSA 3GKMA 1VF1A 1GWCA 2VCTA 1S3DA 1VGLA 2PPTA 1BYEA 3GUSA 5BRTA 6GSYA 2VCQA 1TK0B 1QFNA 5CNWA 2AB6A 1WRYA 4G2EA 1BAYA 3LG6A 2HSMB 3GKXA 5ID2A 2KLXA 4KDUA 5AGYA 4WF4A 1GSUA 4ZB9A 4ID0A 1CQHA 1LBKA 14GSA 4KF9A 1Q4JA 2LEGA 3K8NA 3WGXA 2C3TA 1K0DA 5IMZA 2OKAA 5LCZA 2FCHA 2L5OA 3HZ8A 2JU5A 4NWYA 3HHVA 1BX9A 2RIIA 4L5OA 4K7NA 4QL7A 4ZIJA 4K2DA 4JRRA 3C7MA 3HVSA 2H6ZA 1AQWA 2R0CA 5GAPD 1ST9A 2QA2A 4MDCA 1K0MA 2MMNA 1GUMA 3GHAA 1PSQA 2HYXA 2XC2A 1Z6MA 2FNOA 4KGIA 3VPTA 3AY8A 1WP0A 1K0NA 4GSSA 5IMCA 5J4YA 4OO5A 2FWFA 1I9DA 4ECCA 4TR3A 2YCDA 3KP8A 4IJIA 1EZKA 1EP8A 3DRNA 3LFLA 3EU4A 3IXRA 5CP1A 1XVWA 3W6GA 5DQYA 4K0NA 3DEXA 2OBIA 2WFCA 4USSA 4O32A 4ILFA 1TW9A 1GNWA 4G0IA 4AKGA 2I81A 4KE3A 1MDIA 2CVBA 4GCIA 4PNGA 1FOHA 2HRFA 1HD2A 5DALB 1K3LA 4TW5A 4F03A 1GTAA 4NHWA 5ECMB 3APOA 3UL3A 1A2LA 3ZITA 4PQ1A 1O8XA 1RQMA 3Q74A 3FKFA 3TCOA 1PN9A 2FWEA 4V2NA 5G1LA 5ECPB 3Q19A 4MJCA 3GNJA 4LMWA 1AW9A 1YF1A 1SENA 4ZBAA 7GSSA 2D2ZA 3TB2A 2DIYA 1OAZA 4GSNA 2KUCA 2R4VA 4CDOA 1ZZYA 3GKNA 1GP1A 4G9HA 4HDEA 3EVIA 2B5EA 4OCFA 3RHCA 5A5HB 4GLTA 5A1NB 1PMTA 4MNNA 4D73A 4MJEA 2WCIA 3M1GA 1XWAA 4MA9A 5D96A 4FYBA 5IMFA 3QAGA 2GDRA 4IVFA 2WZ9A 3GFKA 5IIZA 2HZEB 4ULXA 2B7KA 4PUAA 5LD0A 1HNCA 2IIYA 4TXVA 2CZ3A 5CRDA 20GSA 1JZDA 1GSFA 2F3MA 4MJAA 5F05A 3RBTA 1M9BA 1GTIA 1JZRA 5JCGA 5IOXA 4OFTA 2H1GA 4BVXB 2AV4A 4IHUA 4TR1B 2EIRA 3ZTLA 3CWGA 2VL9A 4KCEA 4Q5RA 1FB6A 1S3AA 2FWHA 2LRTA 4I8BA 2VUPA 1OKDA 1ZGNA 2WRTA 3C8EA 4IN0A 3N9JA 2DJJA 2P31A 4EC0A 3J7Yb 1GUHA 3H93A 2HXKA 2PVQA 3QFAC 4XIHA 2HSMA 3D4MA 4Z2TA 2LNTA 2DJ2A 1DE1A 2OE1A 5J47A 2B6MA 1SKRB 4ICYA 3IAS2 2VCZA 3TOUA 2DMLA 4POBA 2NVLA 1QGVA 2ZUPA 5H5SA 4TKYA 2GSSA 5JCUA 1G0TA 1FVKA 2XBIA 2OADA 4A5PA 3VK9A 2NBSA 3R2QA 3UOMA 1Q98A 3ZMKA 3G9BA 2IWTA 4ECIA 1WWJA 5ELGA 3FZ9A 3U5RE 3HJMA 2H6XA 1R4WA 5AIVA 3O76A 4MH2A 4N11A 1TJDA 5GAND 4WR5A 1TK8B 2BMXA 1F6MC 3M3MA 3QFBC 1XOBA 4HJ2A 2VCWA 2XHFA 3M9JA 3UAPA 1SK1A 1THXA 5ECNB 2GQMA 2IN3A 3IHQA 4K1FA 1BG5A 2QGVA 2GSRA 1XFLA 1WMJA 1M2AA 3FR3A 1WJKA 2CVKA 4L0UA 3H8QA 1GSEA 4EVMA 2M72A 3CBUA 4WKWA 1PA3A 1FG4A 4E8HA 1GRXA 2B7JA 2L4QA 4KSMA 6GSUA 1GULA 1WE0A 1U6TA 1AXDA 3KEBA 4MPGA 3MDKA 2VD0A 4XCSA 3H79A 4LL4B 3ISOA 4OFNA 5C00A 2B1KA 1KNGA 1LU4A 2FD3A 4KCAA 5CRGA 1FO5A 1ERVA 1TRVA 5A5HA 3UVHA 5A1NA 3GKKA 3QPMA 3F6DA 2AHEA 4N0VA 3L9UA 2WGRA 4N30A 3HD5A 3G7YA 3F4TA 1O6JA 5DCHA 3LJRA 3R3EA 1TRSA 2HZEA 4BWSA 4ECJA 1QQ2A 1YVLA 5D9VA 5J41A 4I2UA 1IYHA 3D21A 4PUFC 3PINA 5IO0A 1V98A 2C4JA 2I1UA 2O5VA 1MTCA 4FYCA 2LJRA 2LQQA 4IP6A 4YAPA 1GH2A 3IK7A 3BBYA 1K3OA 4KA0A 2AJQB 3TKSC 3ZLPA 3BOAA 1TP9A 3HJPA 3IK9A 5KN2A 4BVXA 3LWAA 4TR1A 2NTOA 1G7EA 3FEUA 1XXUA 4LA1A 3QCPA 3KP9A 4Q5QA 4AF2A 4MP4A 4NHZA 3CYNA 3FW2A 2L4CA 1USBA 2CX4A 1JFUA 5D9XA 4GSTA 2CVDA 1UVZA 2KHPA 3HJOA 4YH2A 4GDFA 1FB0A 2LNSA 1SJZA 5COHA 1GTBA 3FZ4A 4MH3A 4ZB6A 2VOCA 6GSWA 4RUVA 2VD1A 2VLTA 2R5GA 1SYRA 1UA5A 22GSA 2JACA 4AI6A 4TVEA 3O3TA 4TR0A 3LQ7A 8GSSA 1X9WB 3KXOA 3TUEA 2FWGA 5CAXA 1EOHA 1SK2A 2C0EA 3A2VA 2QC7A 1PGTA 2VCXA 2GT5A 4ZILA 2C1YA 2FA4A 3TJBA 4EE0A 1Y25A 4BVYB 4YQMA 1W89A 4LL1B 3F6FA 3EWLA 2AUVA 2H73A 1PL1A 1HNBA 4ISDA 1XBSA 1UC7A 3KZQA 1TXXA 2GQLA 6GSTA 1TTZA 2EIQA 3FRCA 4OWYA 1M0UA 2DBCA 3UVTA 2WDUA 1TI3A 1TDIA 4P3YB 2OT3A 4G0KA 2FHEA 2YANA 3N5OA 1PD21 1FW1A 5DVBA 2L59A 3UARA 2YPMA 2N5AA 1TU7A 3L4NA 3CSJA 4KNDA 2EFDA 1ML6A 3MSZA 2X64A 3I9V2 3WT1A 3WYWA 4CY6A 2VL2A 4ZBDA 1SKWB 5AISA 4GF0A 1T8EB 5D9TA 4EXJA 3RHBA 2CAQA 5B8AA 3E0UA 2MMZA 4AKIA 2GSQA 4PGTA 2HSHA 2HFDA 4X1UA 1GUKA 4RQXA 2GVPA 5HR1A 3KGKA 4MZWA 1X0RA 2GSTA 4HU9A 1FAAA 3EINA 3C73A 4HEA2 3LORA 2VLUA 3H1NA 1E2YA 4KAEA 1A8YA 2O89A 2EFHA 3GN3A 1F3AA 2A4VA 1PX7A 1YKAA 4PQIA 5DDLA 4NXIA 5BMUB 3TKSA 2DKHA 2YJHA 2K9FA 2YWNA 4NV5A 4K7OA 2G2QA 5A34B 3KM6A 2VM2A 3I6AA 1A24A 4HS1A 2ON5A 3TU3B 3P8WA 2KOKA 5CYYA 2FA8A 4KDXA 3KCMA 1O8WA 3TDGA 3TGZA 1SKSB 2B5XA 2H19A 2OE0A 2J23A 3EMXA 3HVVA 3LW9A 1O85A 1IYIA 1QUWA 1R7HA 5J9CA 12GSA 1KTEA 2R2JA 2HLSA 5CREA 3NOFA 2CZ2A 3E3EA 1JZOA 1OE8A 4BA7A 4AGSA 2H71A 3VWWA 4ML6A 5F07A 1V2AA 4JZQA 4O92A 2DJ1A 1SD9A 2N5BA 2DJ0A 2HSNB 3F3RA 1YJ6A 1YZXA 3RPPA 4N10A 5EY6A 2HE3A 4EIPA 1E6BA 2HNLA 3I69A 4I2TA 1XIYA 5KEJA 1T00A 2H01A 3TKQA 5J5NA 4POLA 3IV4A 3HVXA 2IMEA 2BTOT 2DC5A 1YQ1A 2JZTA 1O81A 1ZMAA 3KTLA 2HQTA 3P7XA 2K6VA 1B9YC 4GRFA 2PU9C 1X5CA 4BWQA 1OC3A 2CT6A 1R5AA 2RLIA 2FUG2 2H8LA 5AN1A 2PUKC 5A5KA 3ERGA 4GXZA 4XHMA 1CQGA 1BJXA 4MLYA 4NMUA 3EURA 4BVYA 4MJBA 5B6MA 4CHSA 4WEYA 3TJKA 3ZRDA 1R26A 4I6XA 2HSYA 3P90A 4EL1A 3WT2A 1YKCA 2WB9A 2R3XA 1JLWA 4FQUA 2X49A 1GTUA 1AAZA 4TOPA 4OO4A 4KDYA 1VF2A 2YWMA 2R6KA 1ON4A 2H6YA 2FGXA 19GSA 1XCCA 1Y1UA 1EEMA 1XWKA 9GSSA 2O85A 4J56E 2E2MA 3ZYWA 4H86A 2PBJA 4G19A 4AJ7A 1N8JA 2GTUA 2CA8A 3L9SA 1NW2A 3IHGA 1Z7PA 4HOJA 1BEDA 6GSVA 5CRWA 5EVOA 3D22A 5L71A 4KH7A 4RI7A 1XW9A 1SD8A 4TN8A 1EV9A 3KJYA 3LYKA 4HZ2A 2MYGA 3E9JB 2FY6A 2P5QA 3HXSA 3GX0A 2V2GA 4FO5A 3ED3A 2E7PA 5DCGA 2PGTA 3MWHA 1TRWA 5G1KA 2A2RA 4X4JA 3SWLA 1B9XC 4V1Ag 3TJFA 5ECRB 3TRXA 3NIVA 5ECLB 2F8AA 4PTSA 4NV2A 4RI6A 4K8MA 1ACVA 4MF5A 4GWRA 2CAIA 4MF7A 1WPIA 2H1DA 5E59A 2CX3A 4GQFA 1JZWA 5BMUA 5J40A 5A34A 1N25A 1M2DA 5HFGA 4Z7XA 4ZB8A 3DYRA 3EPTA 4AJ8A 3GURA 2HRNA 2OBKA 2O7KA 3VWVA 1PL2A 3CMIA 4ZB7A 1QK8A 2LSTA 5EPFA 2A4HA 1ZCPA 1DSBA 4IBPA 5FWGA 2GZPA 4HQSA 4XS6A 4DSQA 5EL8A 4K2XA 1DBYA 3LYPA 2GZZA 4CY8A 2R0PA 4JEDA 5H5RA 5J4UA 3QR6A 2TRXA 1M99A 1BF5A 3SBCA 2O8VB 3A2WA 3RDWA 3KMNA 4V1Ap 5ECIB 3QAWA 2HSNA 5DJMA 1SVOA 3CRUA 1GL8A 2PVOC 2GQKA 4HU7A 3M0FA 2HI7A 1G6WA 3TKRA 3F3QA 3CSHA 1A2MA 2EIOA 5ECKB 5HR3A 4PQHA 4N0ZA 2VO4A 5DAKB 5KOXA 1OKTA 5G5EA 4WBRD 2C3QA 4WBJA 2VL2C 5HQPA 3D6IA 2MMAA 3DGQA 4O5QA 3MAKA 1NHOA 3FHKA 2LRCA 1C72A 3IA1A 1X5DA 2K8SA 3LXZA 2H30A 1M7TA 4YQUA 2G0FA 5IO2A 2EFCA 5J3RA 3APSA 4ZXGA 1XPVA 3IC8A 1YDKA 2ZCTA 5JWRB 1SL2B 1RW1A 4BL7B 3ZFBA 4O5UA 2YZHA 1I5GA 3QOUA 1A2JA 3A5IA 3UBKA 1V57A 2YOIA 1SL0B 17GSA 2JZRA 3F8UA 4IQ1A 3HCZA 2AYTA 3ZFLA 4EO3A 3VLNA 1K0AA 4G10A 1U3AA 3RAZA 4AJ6A 5IPGA 3GH6A 1N2AA 3LXTA 3TRPA 5D8IA 3V1WA 3FZAA 4QQ7A 3VI5A 2YZUA 4HQZA 3APQA 2XPEA 2QSIA 4WR4A 4N3ZA 1H4OA 2M80A 3TKSE 3IBHA 4EKZA 1OE7A 4K5RA 3EYTA 4V2MA 5F06A 1ERUA 4WXTA 4QMKA 4CW9A 2LKUA 4EDZA 1OC9B 1EP7A 3ZL5A 1SJIA 2K8VA 1GSDA 3MNGA 3A5WA 1Y6EA 1JHBA 1AIUA 2HT9A 3RPNA 2H76A 2H0IA 3HY2A 5HR2A 5DBQA 5ECSA 3QAVA 3D0ZA 3G7JA 5H5QA 5INYA 4ECBA 1G6YA 2VL3A 3IDVA 2FLSA 4PXOA 3PR8A 1X9MB 3DMLA 3D5JA 2H1AA 3EU3A 2ON7A 3KD0A 4FYUA 4X0XA 2X4AA 1GLPA 4JR6A 1B4QA 1AQVA 3FR9A 1OYJA 4YQVA 2C8UA 1A0RP 3F0IA 2H72A 5KN3A 3F63A 4MMMA 1V9WA 1A23A 4Z2RA 2J9HA 3FK8A 1W4VA 4OD7A 1AQXA 1EGOA 3ERFA 2A2SA 4RQRA 3P2AA 1SK0A 1H75A 1ABAA 4MCUA 1PRXA 4I97A 2C3NA 4XS1A 2BJXA 4NPBA 4YKGA 3BCKA 1G7OA 5J9BA 5G30A 5AIXA 4IW9A 4I5QA 5HFKA 1SU9A 3EMPA 10GSA 3DWVA 2TRCP 4OCEA 4JU5A 4TR4A 5HR0A 4K6XA 4BPYA 1TXUA 4XTSA 4IGJA 3G7IA 2B1LA 2OACA 4PNFA 4POMA 5ECQB 4EDYA 4PURA 5DAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0C A;  5ECH B;  4DSR A;  2IFQ B;  2UZ8 A;  3IC4 A;  2X99 A;  3H4K A;  3ZIV A;  3UIW A;  2LS5 A;  2LJA A;  2YNX A;  2OA7 A;  3ZRE A;  4KUN A;  13GS A;  1V40 A;  2F51 A;  2YP6 A;  4K9Z A;  2MZC A;  3KTB A;  2P5R A;  1MD4 A;  3PH9 A;  6GSS A;  2C0D A;  2OJL A;  1DUG A;  1YEX A;  3C71 A;  2NDO A;  1M2B A;  1T4Y A;  4BL7 A;  4HZ4 A;  2IJY A;  1KEB A;  5F0G A;  1AUC A;  3IPZ A;  1F2E A;  2B3S A;  1B48 A;  4ZL7 A;  3KIJ A;  3UBL A;  2DLX A;  1K3Y A;  4OFM A;  1M9A A;  2LUS A;  1GNE A;  2DJ3 A;  3GRX A;  3J7Y k;  1DE2 A;  2TIR A;  3VI7 A;  4MF6 A;  4IQA A;  2YN1 A;  5B6N A;  4KB3 A;  5F8B A;  1GSS A;  5G5F A;  3C1R A;  1ILO A;  3PPU A;  5D93 A;  3ERW A;  2RUF A;  4TXO B;  3WGE A;  5KN0 A;  1Z9H A;  3VWU A;  1FHE A;  1ZYE A;  5IMA A;  3GTU A;  2N5F A;  3ZVJ A;  2GZY A;  3LEF A;  3ZZX A;  2AAW A;  2VCV A;  5DJL A;  3ZML A;  2C0G A;  1ERW A;  2QKE A;  1Z5Y E;  1OVN A;  2EC4 A;  2YWO A;  3GL5 A;  4ACS A;  5JWO B;  1WIK A;  2HRA A;  2L57 A;  3VFI A;  2DMM A;  4K7I A;  1XZO A;  5IMD A;  1EOG A;  2DSA A;  2L6D A;  3QMX A;  3DVW A;  2ES7 A;  1OC9 A;  4L0W A;  2CV4 A;  4J57 E;  2VIM A;  2H70 A;  3FYG A;  1MDK A;  4ZL9 A;  2IMF A;  3WGD A;  3GIX A;  3W8J A;  1FVJ A;  2WUL A;  1SL1 B;  2K18 A;  1X9S B;  1T1V A;  3TRQ A;  2M46 A;  5GST A;  4MZB A;  1TKD B;  4KX4 A;  2YV7 A;  1GLQ A;  3L0H A;  2PWJ A;  1J0F A;  2PN8 A;  5D9W A;  3IAM 2;  4DEJ A;  2JAD A;  4IKH A;  3VWX A;  4F0C A;  1ZYQ B;  1A0F A;  2MBS A;  2IPA A;  3CTG A;  2MMO A;  2Z9S A;  4POK A;  3CTF A;  1EEJ A;  2GLR A;  5GSS A;  3ZVJ D;  3FR6 A;  5IM9 A;  3Q6O A;  3PGT A;  3US3 A;  3O6T A;  2XPD A;  4YAV A;  3HA9 A;  1HQO A;  2I3Y A;  3BD2 A;  3ME8 A;  5ECO B;  1HYU A;  3ME7 A;  2X8H A;  3CSI A;  4IJ3 A;  3C1S A;  2HRK B;  1X5E A;  2I9H A;  3M8N A;  2H74 A;  4GQC A;  2F8F A;  4XS4 B;  4JBB A;  4ZBB A;  3TOT A;  2YV9 A;  4X43 A;  3DD3 A;  3L9V A;  2KP2 A;  4LLR A;  2IFQ A;  4XRD A;  4DSS B;  4NAX A;  1PQN A;  3HKR A;  2GT6 A;  3GA4 A;  5ENU A;  5C04 A;  1SYX A;  1O73 A;  3HYP A;  3M9K A;  2C80 A;  4O5R A;  3A3T A;  1K0B A;  2E2G A;  4WF5 A;  2REM A;  1XW6 A;  3W8S A;  1TI1 A;  3GX8 A;  1F3B A;  3FZ5 A;  3HDC A;  5DQS A;  3DKS A;  3HZ4 A;  3KH9 A;  3D4T A;  4JR4 A;  1RK4 A;  3QDN A;  5LNK e;  2V1M A;  4V2L A;  3CXG A;  2L5L A;  4G0L A;  2ALB A;  4F82 A;  3TJG A;  1QMV A;  2GGT A;  3IE3 A;  3KMO A;  18GS A;  1HNA A;  2E0Q A;  5A4U A;  1YF0 A;  1MDJ A;  2RUE A;  3L78 A;  3GSS A;  3DXB A;  4IEL A;  4F0B A;  2H75 A;  1VRS D;  4HJM A;  2V6O A;  5A4W A;  4HI7 A;  2JL4 A;  2LTK A;  5HFI A;  4IP1 A;  3UEM A;  4TXO A;  5CO3 A;  5DAL A;  4EUY A;  1F37 A;  1NSW A;  1URM A;  5FHI A;  1UN2 A;  5G31 A;  2IMI A;  3U6V A;  3GST A;  2JSY A;  4JE1 A;  3GMF A;  3LSZ A;  5ID2 B;  3ZIJ A;  3VPQ A;  2H0H A;  2LRN A;  5JWQ B;  4Q5F A;  3Q18 A;  1TU8 A;  3UJ1 A;  5KN1 A;  3UMA A;  1F9M A;  1GSY A;  3IR4 A;  2V41 A;  4MPF A;  2R37 A;  4OMV A;  1SJ6 A;  6GSX A;  2IMD A;  1GSQ A;  1NM3 A;  5IQY A;  1J9B A;  1Z3E A;  1TOF A;  3QD9 A;  5G2Z A;  4HUA A;  1XWG A;  3BJ5 A;  3KH7 A;  5B7C A;  4PX1 A;  1Z6N A;  3F4S A;  1J08 A;  1XVQ A;  4ML1 A;  4IS0 A;  4F2I A;  2O87 A;  3IRA A;  1XW5 A;  3A2X A;  3IOS A;  2RM5 A;  3F4R A;  4QL9 A;  3F9U A;  1MEK A;  4WET A;  5ELA A;  1EGR A;  1ZL9 A;  2VM1 A;  1OC8 A;  1MD3 A;  1AC1 A;  1B4P A;  1JLV A;  3JCM L;  1XWB A;  2H66 A;  5CRH A;  2C0F A;  2LV3 A;  1S3C A;  2IL3 A;  1ZOF A;  4MK3 A;  5IPH A;  2V32 A;  4EF0 A;  3DIE A;  2RM6 A;  1THO A;  4ZL8 A;  1PKZ A;  1ERT A;  4L5L A;  3FY7 A;  2HZF A;  3CRT A;  2H1B A;  2P0G A;  3GTU B;  1U87 A;  2OE3 A;  1T3B A;  1XWC A;  2KP1 A;  1YY7 A;  3NZN A;  5B8B A;  2WS2 A;  2GS3 A;  2HRK A;  2JSZ A;  3LGC A;  3I43 A;  4DVC A;  2JZS A;  2XBQ A;  3TKP A;  1EWX A;  1Z7R A;  3OR5 A;  2X8G A;  4L8E A;  3EE2 A;  4XS4 A;  4MZC A;  1T7P B;  2YWI A;  1TK5 B;  1LJR A;  5JCW A;  1U88 A;  11GS A;  1T4Z A;  1EV4 A;  1BQ7 A;  2B5Y A;  4F9Z A;  3EC3 A;  4LMV A;  1XOA A;  1WOU A;  3VUR A;  4DSS A;  1PX6 A;  4MAB A;  1PKW A;  1K0O A;  1U3I A;  1KBN A;  4K0G A;  4KW6 A;  4D73 B;  1YEP A;  2PER A;  4FH8 A;  1FOV A;  2F9S A;  2CQ9 A;  3TJJ A;  4J2F A;  2H0G A;  3GV1 A;  3WD6 A;  1O7U A;  1R5P A;  4O7H A;  5E4W A;  2YJ7 A;  4KSO A;  3DVX A;  4E8E A;  2NPB A;  2V6K A;  4GTU A;  2I4A A;  1VF3 A;  2L6C A;  5GZZ B;  5FT3 A;  3BCI A;  2MBT A;  3GL3 A;  2DIZ A;  2LQO A;  2LJK A;  1TRU A;  2ZNM A;  4Q5N A;  2DJK A;  4FIW A;  2X8C A;  5IMV A;  4TRX A;  1VF4 A;  1B8X A;  3S9F A;  1QXH A;  1V58 A;  2VAF A;  4XRA A;  5IOW A;  5ABR A;  2VLV A;  3GYK A;  1A8L A;  5A4V A;  1NHY A;  3GH9 A;  5D73 A;  2WJU A;  2PMT A;  2IMK A;  16GS A;  3GKM A;  1VF1 A;  1GWC A;  2VCT A;  1S3D A;  1VGL A;  2PPT A;  1BYE A;  3GUS A;  6GSY A;  2VCQ A;  1TK0 B;  1QFN A;  5CNW A;  2AB6 A;  1WRY A;  4G2E A;  1BAY A;  3LG6 A;  2HSM B;  3GKX A;  5ID2 A;  2KLX A;  4KDU A;  5AGY A;  4WF4 A;  1GSU A;  4ZB9 A;  4ID0 A;  1CQH A;  1LBK A;  14GS A;  4KF9 A;  1Q4J A;  2LEG A;  3K8N A;  3WGX A;  2C3T A;  1K0D A;  5IMZ A;  2OKA A;  5LCZ A;  2FCH A;  2L5O A;  3HZ8 A;  2JU5 A;  4NWY A;  3HHV A;  1BX9 A;  2RII A;  4L5O A;  4K7N A;  4QL7 A;  4ZIJ A;  4K2D A;  4JRR A;  3C7M A;  3HVS A;  2H6Z A;  1AQW A;  5GAP D;  1ST9 A;  4MDC A;  1K0M A;  2MMN A;  1GUM A;  3GHA A;  1PSQ A;  2HYX A;  2XC2 A;  1Z6M A;  2FNO A;  4KGI A;  3VPT A;  3AY8 A;  1WP0 A;  1K0N A;  4GSS A;  5IMC A;  4OO5 A;  2FWF A;  1I9D A;  4ECC A;  4TR3 A;  2YCD A;  3KP8 A;  4IJI A;  1EZK A;  1EP8 A;  3DRN A;  3LFL A;  3EU4 A;  3IXR A;  5CP1 A;  1XVW A;  3W6G A;  5DQY A;  4K0N A;  3DEX A;  2OBI A;  2WFC A;  4USS A;  4O32 A;  4ILF A;  1TW9 A;  1GNW A;  4G0I A;  2I81 A;  4KE3 A;  1MDI A;  2CVB A;  4GCI A;  4PNG A;  2HRF A;  1HD2 A;  5DAL B;  1K3L A;  4TW5 A;  4F03 A;  1GTA A;  4NHW A;  5ECM B;  3APO A;  3UL3 A;  1A2L A;  3ZIT A;  4PQ1 A;  1O8X A;  1RQM A;  3Q74 A;  3FKF A;  3TCO A;  1PN9 A;  2FWE A;  4V2N A;  5G1L A;  5ECP B;  3Q19 A;  4MJC A;  3GNJ A;  4LMW A;  1AW9 A;  1YF1 A;  1SEN A;  4ZBA A;  7GSS A;  2D2Z A;  3TB2 A;  2DIY A;  1OAZ A;  4GSN A;  2KUC A;  2R4V A;  4CDO A;  1ZZY A;  3GKN A;  1GP1 A;  4G9H A;  4HDE A;  3EVI A;  2B5E A;  4OCF A;  3RHC A;  4GLT A;  1PMT A;  4D73 A;  4MJE A;  2WCI A;  3M1G A;  1XWA A;  4MA9 A;  5D96 A;  4FYB A;  5IMF A;  3QAG A;  2GDR A;  4IVF A;  2WZ9 A;  3GFK A;  5IIZ A;  2HZE B;  4ULX A;  2B7K A;  4PUA A;  5LD0 A;  1HNC A;  2IIY A;  4TXV A;  2CZ3 A;  5CRD A;  20GS A;  1JZD A;  1GSF A;  2F3M A;  4MJA A;  5F05 A;  3RBT A;  1M9B A;  1GTI A;  1JZR A;  5JCG A;  5IOX A;  4OFT A;  2H1G A;  4BVX B;  2AV4 A;  4IHU A;  4TR1 B;  2EIR A;  3ZTL A;  2VL9 A;  4KCE A;  4Q5R A;  1FB6 A;  1S3A A;  2FWH A;  4I8B A;  2LRT A;  2VUP A;  1OKD A;  1ZGN A;  2WRT A;  3C8E A;  4IN0 A;  3N9J A;  2DJJ A;  2P31 A;  4EC0 A;  3J7Y b;  1GUH A;  3H93 A;  2HXK A;  2PVQ A;  3QFA C;  4XIH A;  2HSM A;  3D4M A;  2LNT A;  2DJ2 A;  1DE1 A;  2OE1 A;  2B6M A;  1SKR B;  3IAS 2;  2VCZ A;  3TOU A;  2DML A;  4POB A;  2NVL A;  1QGV A;  2ZUP A;  5H5S A;  4TKY A;  2GSS A;  5JCU A;  1G0T A;  1FVK A;  2XBI A;  2OAD A;  3VK9 A;  2NBS A;  3R2Q A;  3UOM A;  1Q98 A;  3ZMK A;  3G9B A;  2IWT A;  4ECI A;  1WWJ A;  5ELG A;  3FZ9 A;  3U5R E;  3HJM A;  2H6X A;  1R4W A;  5AIV A;  3O76 A;  4MH2 A;  4N11 A;  1TJD A;  5GAN D;  4WR5 A;  1TK8 B;  2BMX A;  1F6M C;  3M3M A;  3QFB C;  1XOB A;  4HJ2 A;  2VCW A;  2XHF A;  3M9J A;  3UAP A;  1SK1 A;  1THX A;  5ECN B;  2GQM A;  2IN3 A;  3IHQ A;  4K1F A;  1BG5 A;  2QGV A;  2GSR A;  1XFL A;  1WMJ A;  1M2A A;  3FR3 A;  1WJK A;  2CVK A;  4L0U A;  3H8Q A;  1GSE A;  4EVM A;  2M72 A;  3CBU A;  4WKW A;  1PA3 A;  1FG4 A;  4E8H A;  1GRX A;  2B7J A;  2L4Q A;  4KSM A;  6GSU A;  1GUL A;  1WE0 A;  1U6T A;  1AXD A;  3KEB A;  4MPG A;  3MDK A;  2VD0 A;  4XCS A;  3H79 A;  4LL4 B;  3ISO A;  4OFN A;  5C00 A;  2B1K A;  1KNG A;  1LU4 A;  2FD3 A;  4KCA A;  5CRG A;  1FO5 A;  1ERV A;  1TRV A;  3UVH A;  3GKK A;  3QPM A;  3F6D A;  2AHE A;  4N0V A;  3L9U A;  2WGR A;  4N30 A;  3HD5 A;  3G7Y A;  3F4T A;  1O6J A;  5DCH A;  3LJR A;  3R3E A;  1TRS A;  2HZE A;  4BWS A;  4ECJ A;  1QQ2 A;  5D9V A;  5J41 A;  4I2U A;  1IYH A;  3D21 A;  4PUF C;  3PIN A;  5IO0 A;  1V98 A;  2C4J A;  2I1U A;  1MTC A;  4FYC A;  2LJR A;  2LQQ A;  4IP6 A;  4YAP A;  1GH2 A;  3IK7 A;  3BBY A;  1K3O A;  4KA0 A;  2AJQ B;  3TKS C;  3ZLP A;  3BOA A;  1TP9 A;  3HJP A;  3IK9 A;  5KN2 A;  4BVX A;  3LWA A;  4TR1 A;  2NTO A;  1G7E A;  3FEU A;  1XXU A;  4LA1 A;  3QCP A;  3KP9 A;  4Q5Q A;  4AF2 A;  4MP4 A;  4NHZ A;  3CYN A;  3FW2 A;  2L4C A;  1USB A;  2CX4 A;  1JFU A;  5D9X A;  4GST A;  2CVD A;  1UVZ A;  2KHP A;  3HJO A;  4YH2 A;  1FB0 A;  2LNS A;  1SJZ A;  5COH A;  1GTB A;  3FZ4 A;  4MH3 A;  4ZB6 A;  2VOC A;  6GSW A;  4RUV A;  2VD1 A;  2VLT A;  2R5G A;  1SYR A;  1UA5 A;  22GS A;  2JAC A;  4TVE A;  3O3T A;  4TR0 A;  3LQ7 A;  8GSS A;  1X9W B;  3KXO A;  3TUE A;  2FWG A;  5CAX A;  1EOH A;  1SK2 A;  2C0E A;  3A2V A;  2QC7 A;  1PGT A;  2VCX A;  2GT5 A;  4ZIL A;  2C1Y A;  2FA4 A;  3TJB A;  4EE0 A;  1Y25 A;  4BVY B;  4YQM A;  1W89 A;  4LL1 B;  3F6F A;  3EWL A;  2AUV A;  2H73 A;  1PL1 A;  1HNB A;  4ISD A;  1XBS A;  1UC7 A;  3KZQ A;  1TXX A;  2GQL A;  6GST A;  1TTZ A;  2EIQ A;  3FRC A;  4OWY A;  1M0U A;  2DBC A;  3UVT A;  2WDU A;  1TI3 A;  1TDI A;  4P3Y B;  4G0K A;  2FHE A;  2YAN A;  3N5O A;  1PD2 1;  1FW1 A;  5DVB A;  2L59 A;  3UAR A;  2YPM A;  2N5A A;  1TU7 A;  3L4N A;  3CSJ A;  4KND A;  1ML6 A;  3MSZ A;  2X64 A;  3I9V 2;  3WT1 A;  3WYW A;  2VL2 A;  4ZBD A;  1SKW B;  5AIS A;  4GF0 A;  1T8E B;  5D9T A;  4EXJ A;  3RHB A;  2CAQ A;  5B8A A;  3E0U A;  2MMZ A;  2GSQ A;  4PGT A;  2HSH A;  2HFD A;  4X1U A;  1GUK A;  4RQX A;  2GVP A;  5HR1 A;  3KGK A;  4MZW A;  1X0R A;  2GST A;  4HU9 A;  1FAA A;  3EIN A;  3C73 A;  4HEA 2;  3LOR A;  2VLU A;  3H1N A;  1E2Y A;  4KAE A;  1A8Y A;  2O89 A;  3GN3 A;  1F3A A;  2A4V A;  1PX7 A;  1YKA A;  4PQI A;  5DDL A;  4NXI A;  3TKS A;  2YJH A;  2K9F A;  2YWN A;  4NV5 A;  4K7O A;  2G2Q A;  3KM6 A;  2VM2 A;  3I6A A;  1A24 A;  4HS1 A;  2ON5 A;  3P8W A;  2KOK A;  5CYY A;  2FA8 A;  4KDX A;  3KCM A;  1O8W A;  3TDG A;  3TGZ A;  1SKS B;  2B5X A;  2H19 A;  2OE0 A;  2J23 A;  3EMX A;  3HVV A;  1O85 A;  1IYI A;  1QUW A;  1R7H A;  5J9C A;  12GS A;  1KTE A;  2R2J A;  2HLS A;  5CRE A;  3NOF A;  2CZ2 A;  3E3E A;  1JZO A;  1OE8 A;  4BA7 A;  4AGS A;  2H71 A;  3VWW A;  4ML6 A;  5F07 A;  1V2A A;  4JZQ A;  4O92 A;  2DJ1 A;  1SD9 A;  2N5B A;  2DJ0 A;  2HSN B;  3F3R A;  1YJ6 A;  1YZX A;  3RPP A;  4N10 A;  5EY6 A;  2HE3 A;  1E6B A;  2HNL A;  3I69 A;  4I2T A;  1XIY A;  5KEJ A;  1T00 A;  2H01 A;  3TKQ A;  5J5N A;  4POL A;  3IV4 A;  3HVX A;  2IME A;  2BTO T;  2DC5 A;  1YQ1 A;  2JZT A;  1O81 A;  1ZMA A;  3KTL A;  2HQT A;  3P7X A;  2K6V A;  1B9Y C;  4GRF A;  2PU9 C;  1X5C A;  4BWQ A;  1OC3 A;  2CT6 A;  1R5A A;  2RLI A;  2FUG 2;  2H8L A;  5AN1 A;  2PUK C;  5A5K A;  3ERG A;  4GXZ A;  4XHM A;  1CQG A;  1BJX A;  4MLY A;  4NMU A;  3EUR A;  4BVY A;  4MJB A;  5B6M A;  4CHS A;  4WEY A;  3TJK A;  3ZRD A;  1R26 A;  4I6X A;  2HSY A;  3P90 A;  4EL1 A;  3WT2 A;  1YKC A;  2WB9 A;  2R3X A;  1JLW A;  4FQU A;  1GTU A;  1AAZ A;  4TOP A;  4OO4 A;  4KDY A;  1VF2 A;  2FGX A;  2R6K A;  1ON4 A;  2H6Y A;  2YWM A;  19GS A;  1XCC A;  1EEM A;  1XWK A;  9GSS A;  2O85 A;  4J56 E;  2E2M A;  3ZYW A;  4H86 A;  2PBJ A;  4G19 A;  4AJ7 A;  1N8J A;  2GTU A;  2CA8 A;  3L9S A;  1NW2 A;  1Z7P A;  4HOJ A;  1BED A;  6GSV A;  5CRW A;  5EVO A;  3D22 A;  5L71 A;  4KH7 A;  4RI7 A;  1XW9 A;  1SD8 A;  4TN8 A;  1EV9 A;  3KJY A;  3LYK A;  4HZ2 A;  2MYG A;  3E9J B;  2FY6 A;  2P5Q A;  3HXS A;  3GX0 A;  2V2G A;  4FO5 A;  3ED3 A;  2E7P A;  5DCG A;  2PGT A;  3MWH A;  1TRW A;  5G1K A;  2A2R A;  3SWL A;  1B9X C;  4V1A g;  3TJF A;  5ECR B;  3TRX A;  3NIV A;  5ECL B;  2F8A A;  4PTS A;  4NV2 A;  4RI6 A;  4K8M A;  1ACV A;  4MF5 A;  4GWR A;  2CAI A;  4MF7 A;  1WPI A;  2H1D A;  5E59 A;  2CX3 A;  4GQF A;  1JZW A;  5BMU A;  1M2D A;  5HFG A;  4Z7X A;  4ZB8 A;  3DYR A;  4AJ8 A;  3GUR A;  2HRN A;  2OBK A;  2O7K A;  3VWV A;  1PL2 A;  3CMI A;  1QK8 A;  2LST A;  5EPF A;  1ZCP A;  1DSB A;  4IBP A;  5FWG A;  2GZP A;  4HQS A;  4XS6 A;  4DSQ A;  5EL8 A;  1DBY A;  3LYP A;  2GZZ A;  4JED A;  5H5R A;  5J4U A;  3QR6 A;  2TRX A;  1M99 A;  3SBC A;  2O8V B;  3A2W A;  3RDW A;  3KMN A;  4V1A p;  5ECI B;  3QAW A;  5DJM A;  3CRU A;  1GL8 A;  2PVO C;  2GQK A;  4HU7 A;  3M0F A;  2HI7 A;  1G6W A;  3TKR A;  3F3Q A;  3CSH A;  1A2M A;  2EIO A;  5ECK B;  5HR3 A;  4PQH A;  4N0Z A;  2VO4 A;  5DAK B;  1OKT A;  5G5E A;  4WBR D;  2C3Q A;  4WBJ A;  2VL2 C;  5HQP A;  3D6I A;  2MMA A;  3DGQ A;  3MAK A;  1NHO A;  3FHK A;  2LRC A;  1C72 A;  3IA1 A;  1X5D A;  2K8S A;  3LXZ A;  2H30 A;  1M7T A;  4YQU A;  2G0F A;  5IO2 A;  5J3R A;  3APS A;  4ZXG A;  1XPV A;  3IC8 A;  1YDK A;  2ZCT A;  5JWR B;  1SL2 B;  1RW1 A;  4BL7 B;  3ZFB A;  2YZH A;  1I5G A;  3QOU A;  1A2J A;  3UBK A;  1V57 A;  2YOI A;  1SL0 B;  17GS A;  2JZR A;  3F8U A;  4IQ1 A;  3HCZ A;  2AYT A;  3ZFL A;  4EO3 A;  3VLN A;  1K0A A;  4G10 A;  1U3A A;  3RAZ A;  4AJ6 A;  5IPG A;  3GH6 A;  1N2A A;  3LXT A;  3TRP A;  5D8I A;  3V1W A;  3FZA A;  4QQ7 A;  3VI5 A;  2YZU A;  4HQZ A;  3APQ A;  2XPE A;  2QSI A;  4WR4 A;  1H4O A;  2M80 A;  3TKS E;  3IBH A;  4EKZ A;  1OE7 A;  3EYT A;  4V2M A;  5F06 A;  1ERU A;  4WXT A;  4CW9 A;  2LKU A;  4EDZ A;  1OC9 B;  1EP7 A;  3ZL5 A;  1SJI A;  2K8V A;  1GSD A;  3MNG A;  3A5W A;  1Y6E A;  1JHB A;  1AIU A;  2HT9 A;  3RPN A;  2H76 A;  2H0I A;  3HY2 A;  5HR2 A;  5DBQ A;  5ECS A;  3QAV A;  3D0Z A;  3G7J A;  5H5Q A;  5INY A;  4ECB A;  1G6Y A;  2VL3 A;  3IDV A;  2FLS A;  4PXO A;  3PR8 A;  1X9M B;  3DML A;  3D5J A;  2H1A A;  3EU3 A;  2ON7 A;  3KD0 A;  4FYU A;  4X0X A;  4JR6 A;  1GLP A;  1B4Q A;  1AQV A;  3FR9 A;  1OYJ A;  4YQV A;  2C8U A;  1A0R P;  3F0I A;  2H72 A;  5KN3 A;  3F63 A;  4MMM A;  1V9W A;  1A23 A;  2J9H A;  3FK8 A;  1W4V A;  4OD7 A;  1AQX A;  1EGO A;  3ERF A;  2A2S A;  4RQR A;  3P2A A;  1SK0 A;  1H75 A;  1ABA A;  4MCU A;  1PRX A;  4I97 A;  2C3N A;  4XS1 A;  2BJX A;  4NPB A;  3BCK A;  1G7O A;  5J9B A;  5G30 A;  5AIX A;  4IW9 A;  4I5Q A;  5HFK A;  1SU9 A;  3EMP A;  10GS A;  3DWV A;  2TRC P;  4OCE A;  4JU5 A;  4TR4 A;  5HR0 A;  4K6X A;  4BPY A;  4XTS A;  4IGJ A;  3G7I A;  2B1L A;  2OAC A;  4PNF A;  4POM A;  5ECQ B;  4EDY A;  4PUR A;  5DAK A; 
#chains in the Genus database with same CATH topology
 1K0C A;  5ECH B;  4DSR A;  2IFQ B;  2UZ8 A;  3IC4 A;  2X99 A;  3H4K A;  4AKH A;  3ZIV A;  3UIW A;  2LS5 A;  2LJA A;  2YNX A;  2OA7 A;  1YEW C;  3ZRE A;  4KUN A;  13GS A;  1V40 A;  2F51 A;  2YP6 A;  4K9Z A;  2MZC A;  3KTB A;  2P5R A;  1MD4 A;  3PH9 A;  6GSS A;  2C0D A;  2OJL A;  1DUG A;  1YEX A;  3C71 A;  2A2P A;  3FMW A;  2NDO A;  1M2B A;  1T4Y A;  4BL7 A;  4HZ4 A;  2IJY A;  1KEB A;  5F0G A;  1AUC A;  3IPZ A;  1F2E A;  2B3S A;  1B48 A;  4ZL7 A;  1ZYP A;  3UBL A;  3KIJ A;  2DLX A;  1K3Y A;  4OFM A;  1M9A A;  2UV8 G;  2LUS A;  1GNE A;  2DJ3 A;  3GRX A;  3J7Y k;  1DE2 A;  4EIQ A;  2TIR A;  3VI7 A;  4MF6 A;  4IQA A;  2YN1 A;  5B6N A;  4KB3 A;  5F8B A;  1GSS A;  5G5F A;  3C1R A;  1ILO A;  3MIX A;  3PPU A;  5D93 A;  3ERW A;  2RUF A;  4TXO B;  3WGE A;  5KN0 A;  1Z9H A;  3VWU A;  1FHE A;  1ZYE A;  5IMA A;  3GTU A;  2N5F A;  3ZVJ A;  2GZY A;  3LEF A;  3ZZX A;  2AAW A;  2VCV A;  5DJL A;  4K5S A;  3ZML A;  2C0G A;  1ERW A;  2QKE A;  1Z5Y E;  1OVN A;  2EC4 A;  2YWO A;  3GL5 A;  4ACS A;  5JWO B;  1WIK A;  2HRA A;  2L57 A;  3VFI A;  2DMM A;  4K7I A;  2EFE A;  1XZO A;  1EOG A;  5IMD A;  2DSA A;  2L6D A;  3QMX A;  3DVW A;  2R0G A;  2ES7 A;  1OC9 A;  4L0W A;  2CV4 A;  4J57 E;  2VIM A;  2H70 A;  3FYG A;  1MDK A;  4ZL9 A;  2IMF A;  3WGD A;  3GIX A;  3W8J A;  1FVJ A;  2WUL A;  1SL1 B;  2K18 A;  1X9S B;  1T1V A;  3TRQ A;  2M46 A;  5GST A;  4MZB A;  1TKD B;  4KX4 A;  2YV7 A;  1GLQ A;  3L0H A;  2PWJ A;  1J0F A;  2PN8 A;  5D9W A;  3IAM 2;  4DEJ A;  2JAD A;  4IKH A;  3VWX A;  4F0C A;  1ZYQ B;  1A0F A;  2DKI A;  2MBS A;  2IPA A;  3CTG A;  2MMO A;  2Z9S A;  4FXY P;  1PN0 A;  4POK A;  3CTF A;  1EEJ A;  2GLR A;  5GSS A;  3ZVJ D;  3FR6 A;  5IM9 A;  3Q6O A;  3PGT A;  3US3 A;  3O6T A;  2XPD A;  4YAV A;  3HA9 A;  1PFO A;  1HQO A;  2I3Y A;  3BD2 A;  3ME8 A;  5ECO B;  1HYU A;  3ME7 A;  2X8H A;  3CSI A;  4IJ3 A;  3C1S A;  2HRK B;  2VKZ G;  1X5E A;  2I9H A;  3M8N A;  2H74 A;  4GQC A;  2F8F A;  4XS4 B;  4JBB A;  4ZBB A;  3TOT A;  2YV9 A;  4X43 A;  3DD3 A;  3L9V A;  2KP2 A;  4LLR A;  2IFQ A;  4XRD A;  4DSS B;  4NAX A;  1PQN A;  3HKR A;  2GT6 A;  3GA4 A;  5ENU A;  5C04 A;  1SYX A;  1O73 A;  3HYP A;  3M9K A;  2C80 A;  4O5R A;  3A3T A;  1K0B A;  2E2G A;  4WF5 A;  2REM A;  1SVL A;  1XW6 A;  3W8S A;  1TI1 A;  3GX8 A;  1F3B A;  3FZ5 A;  3HDC A;  5DQS A;  3DKS A;  3HZ4 A;  3KH9 A;  3D4T A;  4JR4 A;  1RK4 A;  3QDN A;  5LNK e;  2V1M A;  4V2L A;  3CXG A;  2L5L A;  4G0L A;  2ALB A;  1BG1 A;  5KOW A;  3MYD A;  4F82 A;  3TJG A;  1QMV A;  2GGT A;  3IE3 A;  3KMO A;  18GS A;  1HNA A;  2E0Q A;  5A4U A;  1YF0 A;  1MDJ A;  2RUE A;  3L78 A;  3GSS A;  3DXB A;  4IEL A;  4F0B A;  2H75 A;  1VRS D;  4HJM A;  2V6O A;  5A4W A;  4HI7 A;  2JL4 A;  2LTK A;  5HFI A;  4IP1 A;  3UEM A;  4TXO A;  5CO3 A;  5DAL A;  4EUY A;  1F37 A;  1NSW A;  1URM A;  5FHI A;  1UN2 A;  5G31 A;  2IMI A;  3HMJ G;  3U6V A;  3GST A;  2JSY A;  4JE1 A;  3GMF A;  3LSZ A;  5ID2 B;  3ZIJ A;  3VPQ A;  2H0H A;  2LRN A;  3CHX C;  5JWQ B;  4Q5F A;  3Q18 A;  1TU8 A;  3UJ1 A;  5KN1 A;  3UMA A;  1F9M A;  1GSY A;  3IR4 A;  2V41 A;  4MPF A;  2R37 A;  4OMV A;  4E68 A;  2WW3 A;  1SJ6 A;  6GSX A;  2IMD A;  1GSQ A;  1NM3 A;  5IQY A;  1J9B A;  1Z3E A;  1TOF A;  3QD9 A;  5G2Z A;  4HUA A;  1XWG A;  3BJ5 A;  3KH7 A;  5B7C A;  4PX1 A;  1Z6N A;  3F4S A;  1J08 A;  1XVQ A;  4ML1 A;  4IS0 A;  4F2I A;  2O87 A;  3IRA A;  1XW5 A;  3A2X A;  3IOS A;  2RM5 A;  3F4R A;  4QL9 A;  3F9U A;  1MEK A;  4WET A;  5ELA A;  4YKF A;  1EGR A;  1ZL9 A;  2VM1 A;  1OC8 A;  1SVM A;  1MD3 A;  1AC1 A;  1B4P A;  1JLV A;  3JCM L;  1XWB A;  2H66 A;  4G01 A;  5CRH A;  2C0F A;  2LV3 A;  1S3C A;  2IL3 A;  1ZOF A;  4MK3 A;  5IPH A;  2V32 A;  4EF0 A;  3DIE A;  2RM6 A;  1THO A;  4ZL8 A;  2H1L A;  1PKZ A;  1ERT A;  4L5L A;  3FY7 A;  2HZF A;  3CRT A;  2H1B A;  2P0G A;  3GTU B;  1U87 A;  2OE3 A;  1T3B A;  1XWC A;  2KP1 A;  1YY7 A;  3NZN A;  5B8B A;  2WS2 A;  2GS3 A;  2HRK A;  2JSZ A;  3LGC A;  3I43 A;  4DVC A;  2JZS A;  2XBQ A;  3TKP A;  1I1I P;  1EWX A;  1Z7R A;  3OR5 A;  2X8G A;  4L8E A;  3EE2 A;  4XS4 A;  4MZC A;  1T7P B;  2YWI A;  1TK5 B;  1LJR A;  5JCW A;  1U88 A;  11GS A;  1T4Z A;  1ZYN A;  1EV4 A;  1BQ7 A;  4W66 A;  2B5Y A;  4F9Z A;  3EC3 A;  4LMV A;  1XOA A;  1WOU A;  3VUR A;  4DSS A;  1PX6 A;  4MAB A;  1PKW A;  1K0O A;  1U3I A;  1KBN A;  4K0G A;  4KW6 A;  4D73 B;  1YEP A;  2PER A;  4FH8 A;  1FOV A;  2F9S A;  2CQ9 A;  3TJJ A;  4J2F A;  2H0G A;  3GV1 A;  3WD6 A;  1O7U A;  1R5P A;  4O7H A;  5E4W A;  2YJ7 A;  4KSO A;  3DVX A;  4E8E A;  2NPB A;  5J4V A;  2V6K A;  4GTU A;  2I4A A;  1VF3 A;  2L6C A;  4Z2U A;  2QA1 A;  5GZZ B;  5FT3 A;  3BCI A;  2MBT A;  3GL3 A;  2DIZ A;  2LQO A;  2LJK A;  1TRU A;  2ZNM A;  4Q5N A;  2DJK A;  4FIW A;  2X8C A;  4PHZ C;  5IMV A;  4TRX A;  1VF4 A;  1B8X A;  3S9F A;  1QXH A;  1V58 A;  2VAF A;  4XRA A;  5IOW A;  5ABR A;  4AKX B;  2VLV A;  3GYK A;  1A8L A;  5A4V A;  1NHY A;  3GH9 A;  5D73 A;  2WJU A;  2PMT A;  2IMK A;  16GS A;  3GKM A;  1VF1 A;  1GWC A;  2VCT A;  1S3D A;  1VGL A;  2PPT A;  1BYE A;  3GUS A;  5BRT A;  6GSY A;  2VCQ A;  1TK0 B;  1QFN A;  5CNW A;  2AB6 A;  1WRY A;  4G2E A;  1BAY A;  3LG6 A;  2HSM B;  3GKX A;  5ID2 A;  2KLX A;  4KDU A;  5AGY A;  4WF4 A;  1GSU A;  4ZB9 A;  4ID0 A;  1CQH A;  1LBK A;  14GS A;  4KF9 A;  1Q4J A;  2LEG A;  3K8N A;  3WGX A;  2C3T A;  1K0D A;  5IMZ A;  2OKA A;  5LCZ A;  2FCH A;  2L5O A;  3HZ8 A;  2JU5 A;  4NWY A;  3HHV A;  1BX9 A;  2RII A;  4L5O A;  4K7N A;  4QL7 A;  4ZIJ A;  4K2D A;  4JRR A;  3C7M A;  3HVS A;  2H6Z A;  1AQW A;  2R0C A;  5GAP D;  1ST9 A;  2QA2 A;  4MDC A;  1K0M A;  2MMN A;  1GUM A;  3GHA A;  1PSQ A;  2HYX A;  2XC2 A;  1Z6M A;  2FNO A;  4KGI A;  3VPT A;  3AY8 A;  1WP0 A;  1K0N A;  4GSS A;  5IMC A;  5J4Y A;  4OO5 A;  2FWF A;  1I9D A;  4ECC A;  4TR3 A;  2YCD A;  3KP8 A;  4IJI A;  1EZK A;  1EP8 A;  3DRN A;  3LFL A;  3EU4 A;  3IXR A;  5CP1 A;  1XVW A;  3W6G A;  5DQY A;  4K0N A;  3DEX A;  2OBI A;  2WFC A;  4USS A;  4O32 A;  4ILF A;  1TW9 A;  1GNW A;  4G0I A;  4AKG A;  2I81 A;  4KE3 A;  1MDI A;  2CVB A;  4GCI A;  2WVX B;  4PNG A;  1FOH A;  2HRF A;  1HD2 A;  5DAL B;  1K3L A;  4TW5 A;  4F03 A;  1GTA A;  4NHW A;  5ECM B;  3APO A;  3UL3 A;  1A2L A;  3ZIT A;  4PQ1 A;  1O8X A;  1RQM A;  3Q74 A;  3FKF A;  3TCO A;  1PN9 A;  2FWE A;  4V2N A;  5G1L A;  5ECP B;  3Q19 A;  4MJC A;  3GNJ A;  4LMW A;  1AW9 A;  1YF1 A;  1SEN A;  4ZBA A;  7GSS A;  2D2Z A;  3TB2 A;  2DIY A;  1OAZ A;  4GSN A;  2KUC A;  2R4V A;  4CDO A;  1ZZY A;  3GKN A;  1GP1 A;  4PI2 C;  4G9H A;  4HDE A;  3EVI A;  2B5E A;  4OCF A;  3RHC A;  5A5H B;  4GLT A;  5A1N B;  1PMT A;  4MNN A;  4D73 A;  4MJE A;  2WCI A;  3M1G A;  1XWA A;  4MA9 A;  5D96 A;  4FYB A;  5IMF A;  3QAG A;  2GDR A;  4IVF A;  2WZ9 A;  3GFK A;  5IIZ A;  2HZE B;  4ULX A;  2B7K A;  4PUA A;  5LD0 A;  1HNC A;  2IIY A;  4TXV A;  2CZ3 A;  5CRD A;  20GS A;  1JZD A;  1GSF A;  2F3M A;  4MJA A;  5F05 A;  3RBT A;  1M9B A;  1GTI A;  1JZR A;  5JCG A;  5IOX A;  4OFT A;  2H1G A;  4BVX B;  2AV4 A;  4IHU A;  4TR1 B;  2EIR A;  3ZTL A;  3CWG A;  2VL9 A;  4KCE A;  4Q5R A;  1FB6 A;  1S3A A;  2FWH A;  2LRT A;  4I8B A;  2VUP A;  1OKD A;  1ZGN A;  2WRT A;  3C8E A;  4IN0 A;  3N9J A;  2DJJ A;  2P31 A;  4EC0 A;  3J7Y b;  1GUH A;  2WW2 A;  3H93 A;  2HXK A;  2PVQ A;  3QFA C;  4XIH A;  2HSM A;  3D4M A;  4Z2T A;  2LNT A;  2DJ2 A;  1DE1 A;  2OE1 A;  5J47 A;  2B6M A;  1SKR B;  4ICY A;  3IAS 2;  2VCZ A;  3TOU A;  2DML A;  1M3I A;  4POB A;  2NVL A;  1QGV A;  2ZUP A;  5H5S A;  4TKY A;  2GSS A;  5JCU A;  1G0T A;  1FVK A;  2XBI A;  2OAD A;  4A5P A;  3VK9 A;  2NBS A;  3R2Q A;  3UOM A;  1Q98 A;  3ZMK A;  3G9B A;  2IWT A;  4ECI A;  1WWJ A;  5ELG A;  3FZ9 A;  3U5R E;  3HJM A;  2H6X A;  1R4W A;  5AIV A;  1XG8 A;  3O76 A;  4MH2 A;  4N11 A;  1TJD A;  5GAN D;  4WR5 A;  1TK8 B;  2BMX A;  1F6M C;  3M3M A;  3QFB C;  1XOB A;  4HJ2 A;  2VCW A;  2XHF A;  3M9J A;  3UAP A;  1SK1 A;  1THX A;  5ECN B;  2GQM A;  2IN3 A;  3IHQ A;  4K1F A;  1BG5 A;  2QGV A;  2GSR A;  1XFL A;  1WMJ A;  1M2A A;  3FR3 A;  1WJK A;  2CVK A;  2WVX A;  4L0U A;  3H8Q A;  1GSE A;  4EVM A;  2M72 A;  3CBU A;  4WKW A;  1PA3 A;  1FG4 A;  4E8H A;  1GRX A;  2B7J A;  2L4Q A;  4KSM A;  6GSU A;  1GUL A;  1WE0 A;  1U6T A;  1AXD A;  3KEB A;  4MPG A;  3MDK A;  2VD0 A;  4XCS A;  3H79 A;  4LL4 B;  3ISO A;  4OFN A;  5C00 A;  2B1K A;  1KNG A;  1LU4 A;  2FD3 A;  4KCA A;  5CRG A;  1FO5 A;  2WVZ A;  1ERV A;  1TRV A;  5A5H A;  3UVH A;  5A1N A;  3GKK A;  3QPM A;  3F6D A;  2AHE A;  4N0V A;  3L9U A;  2WGR A;  4N30 A;  3HD5 A;  3G7Y A;  3F4T A;  1O6J A;  5DCH A;  3LJR A;  3R3E A;  1TRS A;  2HZE A;  4BWS A;  4ECJ A;  1QQ2 A;  1YVL A;  5D9V A;  5J41 A;  4I2U A;  1IYH A;  3D21 A;  4PUF C;  3PIN A;  5IO0 A;  1V98 A;  2C4J A;  2I1U A;  2O5V A;  1MTC A;  4FYC A;  2LJR A;  2LQQ A;  4IP6 A;  4YAP A;  1GH2 A;  3IK7 A;  3BBY A;  1K3O A;  4KA0 A;  2AJQ B;  3TKS C;  2WW1 A;  3ZLP A;  3BOA A;  1TP9 A;  3HJP A;  3IK9 A;  5KN2 A;  4BVX A;  3LWA A;  4TR1 A;  2NTO A;  1G7E A;  3FEU A;  1XXU A;  4LA1 A;  3QCP A;  3KP9 A;  4Q5Q A;  4AF2 A;  4MP4 A;  4NHZ A;  3CYN A;  3FW2 A;  2L4C A;  1USB A;  2CX4 A;  1JFU A;  5D9X A;  4GST A;  2CVD A;  1UVZ A;  2KHP A;  3HJO A;  4YH2 A;  4GDF A;  1FB0 A;  2LNS A;  1SJZ A;  5COH A;  1GTB A;  3FZ4 A;  4MH3 A;  4ZB6 A;  2VOC A;  4BIK A;  6GSW A;  3HVN A;  4RUV A;  2VD1 A;  2VLT A;  2R5G A;  1SYR A;  1UA5 A;  22GS A;  2JAC A;  4AI6 A;  4TVE A;  3O3T A;  4TR0 A;  2O3E A;  3LQ7 A;  8GSS A;  1X9W B;  3KXO A;  3TUE A;  2FWG A;  5CAX A;  1EOH A;  1SK2 A;  2C0E A;  3A2V A;  2QC7 A;  1PGT A;  2VCX A;  2GT5 A;  4ZIL A;  2C1Y A;  2FA4 A;  3TJB A;  4EE0 A;  1Y25 A;  4BVY B;  4YQM A;  1W89 A;  1M3J A;  4LL1 B;  3F6F A;  3CQF A;  3EWL A;  2AUV A;  2H73 A;  1PL1 A;  1HNB A;  4ISD A;  1XBS A;  1UC7 A;  3KZQ A;  1TXX A;  2GQL A;  6GST A;  1TTZ A;  2EIQ A;  3FRC A;  4OWY A;  1M0U A;  2DBC A;  3UVT A;  2WDU A;  1TI3 A;  1TDI A;  4P3Y B;  2OT3 A;  4G0K A;  2FHE A;  2YAN A;  3N5O A;  2O36 A;  1PD2 1;  1FW1 A;  5DVB A;  2L59 A;  3UAR A;  3RGB C;  2YPM A;  2N5A A;  1TU7 A;  3L4N A;  3CSJ A;  4KND A;  2EFD A;  1ML6 A;  3MSZ A;  2X64 A;  3I9V 2;  3WT1 A;  3WYW A;  4CY6 A;  2VL2 A;  4ZBD A;  1SKW B;  5AIS A;  4GF0 A;  1T8E B;  1S4B P;  5D9T A;  4EXJ A;  3RHB A;  2CAQ A;  5B8A A;  3E0U A;  2MMZ A;  4AKI A;  2GSQ A;  4PGT A;  2HSH A;  2HFD A;  4X1U A;  1GUK A;  4RQX A;  2GVP A;  5HR1 A;  3KGK A;  4MZW A;  1X0R A;  2GST A;  4HU9 A;  1FAA A;  3EIN A;  3C73 A;  4HEA 2;  3LOR A;  2VLU A;  3H1N A;  1E2Y A;  4KAE A;  1A8Y A;  2O89 A;  2EFH A;  3GN3 A;  1F3A A;  2A4V A;  1PX7 A;  1YKA A;  4PQI A;  5DDL A;  4NXI A;  5BMU B;  3TKS A;  2DKH A;  2YJH A;  2K9F A;  2YWN A;  4NV5 A;  4K7O A;  2G2Q A;  5A34 B;  3KM6 A;  2VM2 A;  3I6A A;  1A24 A;  4HS1 A;  2ON5 A;  3TU3 B;  3P8W A;  2KOK A;  5CYY A;  2FA8 A;  4KDX A;  3KCM A;  1O8W A;  3TDG A;  3TGZ A;  1SKS B;  2B5X A;  2H19 A;  2OE0 A;  2J23 A;  3EMX A;  3HVV A;  3LW9 A;  1O85 A;  1IYI A;  1QUW A;  1R7H A;  5J9C A;  12GS A;  1KTE A;  2R2J A;  2HLS A;  5CRE A;  3NOF A;  2CZ2 A;  3E3E A;  1JZO A;  1OE8 A;  4BA7 A;  4AGS A;  2H71 A;  3VWW A;  4ML6 A;  5F07 A;  1V2A A;  4HSC X;  4JZQ A;  4O92 A;  2DJ1 A;  1SD9 A;  2N5B A;  2DJ0 A;  2HSN B;  3F3R A;  3RFR C;  1YJ6 A;  1YZX A;  3RPP A;  4N10 A;  5EY6 A;  2HE3 A;  4EIP A;  1E6B A;  2HNL A;  3I69 A;  4I2T A;  1XIY A;  5KEJ A;  1T00 A;  2H01 A;  3TKQ A;  5J5N A;  4POL A;  3IV4 A;  3HVX A;  2IME A;  2BTO T;  2DC5 A;  1YQ1 A;  2JZT A;  1O81 A;  1ZMA A;  3KTL A;  2HQT A;  3P7X A;  2K6V A;  1B9Y C;  4GRF A;  2PU9 C;  1X5C A;  4BWQ A;  1OC3 A;  2CT6 A;  1R5A A;  2RLI A;  2FUG 2;  2H8L A;  5AN1 A;  2PUK C;  5A5K A;  3ERG A;  4GXZ A;  4XHM A;  1CQG A;  1BJX A;  4MLY A;  4NMU A;  3EUR A;  4BVY A;  4MJB A;  5B6M A;  4CHS A;  4WEY A;  3TJK A;  3ZRD A;  1R26 A;  4I6X A;  2HSY A;  3P90 A;  4EL1 A;  3WT2 A;  1YKC A;  2WB9 A;  2R3X A;  1JLW A;  4FQU A;  2X49 A;  1GTU A;  1AAZ A;  4TOP A;  4OO4 A;  4KDY A;  1VF2 A;  2YWM A;  2R6K A;  1ON4 A;  2H6Y A;  2FGX A;  19GS A;  1XCC A;  1Y1U A;  1EEM A;  1XWK A;  9GSS A;  2O85 A;  4J56 E;  2E2M A;  3ZYW A;  4H86 A;  2PBJ A;  4G19 A;  4AJ7 A;  1N8J A;  2GTU A;  2CA8 A;  3L9S A;  1NW2 A;  3IHG A;  1Z7P A;  4HOJ A;  1BED A;  6GSV A;  5CRW A;  5EVO A;  3D22 A;  5L71 A;  4KH7 A;  4RI7 A;  1XW9 A;  1SD8 A;  4TN8 A;  1EV9 A;  3KJY A;  3LYK A;  4HZ2 A;  2MYG A;  3E9J B;  2FY6 A;  2P5Q A;  3HXS A;  3GX0 A;  2V2G A;  4FO5 A;  3ED3 A;  2E7P A;  5DCG A;  2PGT A;  3MWH A;  1TRW A;  5G1K A;  2A2R A;  4X4J A;  3SWL A;  1B9X C;  4PI0 C;  4V1A g;  3TJF A;  5ECR B;  3TRX A;  3NIV A;  5ECL B;  2F8A A;  4PTS A;  4NV2 A;  4RI6 A;  4K8M A;  1ACV A;  4MF5 A;  4GWR A;  2CAI A;  4MF7 A;  1WPI A;  2H1D A;  5E59 A;  2CX3 A;  4GQF A;  1JZW A;  2WVY A;  5BMU A;  5J40 A;  5A34 A;  1N25 A;  1M2D A;  5HFG A;  4Z7X A;  4ZB8 A;  3DYR A;  3EPT A;  4AJ8 A;  3GUR A;  2HRN A;  2OBK A;  2O7K A;  3VWV A;  1PL2 A;  3CMI A;  4ZB7 A;  1QK8 A;  2LST A;  5EPF A;  2A4H A;  1ZCP A;  1DSB A;  4IBP A;  5FWG A;  2GZP A;  4HQS A;  4XS6 A;  4DSQ A;  5EL8 A;  4K2X A;  1DBY A;  3LYP A;  2GZZ A;  4CY8 A;  1S3R A;  2R0P A;  4JED A;  5H5R A;  5J4U A;  3QR6 A;  2TRX A;  1M99 A;  1BF5 A;  3SBC A;  2O8V B;  3A2W A;  3RDW A;  3KMN A;  4V1A p;  5ECI B;  3QAW A;  2HSN A;  5DJM A;  1SVO A;  3CRU A;  1GL8 A;  2PVO C;  2GQK A;  4HU7 A;  3M0F A;  2HI7 A;  1G6W A;  3TKR A;  3F3Q A;  3CSH A;  1A2M A;  2EIO A;  5ECK B;  5HR3 A;  4PQH A;  4N0Z A;  2VO4 A;  5DAK B;  5KOX A;  1OKT A;  5G5E A;  4WBR D;  2C3Q A;  4WBJ A;  2VL2 C;  5HQP A;  3D6I A;  2MMA A;  3DGQ A;  4O5Q A;  2WZS A;  3MAK A;  1NHO A;  3FHK A;  2LRC A;  1C72 A;  3IA1 A;  1X5D A;  2K8S A;  3LXZ A;  2H30 A;  1M7T A;  4YQU A;  2G0F A;  5IO2 A;  2EFC A;  5J3R A;  3APS A;  4ZXG A;  1XPV A;  3IC8 A;  1YDK A;  2ZCT A;  5JWR B;  1SL2 B;  1RW1 A;  4BL7 B;  3ZFB A;  4O5U A;  2YZH A;  1I5G A;  3QOU A;  1A2J A;  3A5I A;  3UBK A;  1V57 A;  2YOI A;  1SL0 B;  17GS A;  2JZR A;  3F8U A;  4IQ1 A;  3HCZ A;  2AYT A;  3ZFL A;  4EO3 A;  3VLN A;  1K0A A;  4G10 A;  1U3A A;  3RAZ A;  4AJ6 A;  5IPG A;  3GH6 A;  1N2A A;  3LXT A;  3TRP A;  5D8I A;  3V1W A;  3FZA A;  4QQ7 A;  3VI5 A;  2YZU A;  4HQZ A;  3APQ A;  2XPE A;  2QSI A;  4WR4 A;  4N3Z A;  1H4O A;  2M80 A;  3TKS E;  3IBH A;  4EKZ A;  1OE7 A;  4K5R A;  3EYT A;  4V2M A;  5F06 A;  1ERU A;  4WXT A;  4QMK A;  4CW9 A;  2LKU A;  4EDZ A;  1OC9 B;  1EP7 A;  3ZL5 A;  1SJI A;  2K8V A;  1GSD A;  3MNG A;  3A5W A;  1Y6E A;  1JHB A;  1AIU A;  2HT9 A;  3RPN A;  2H76 A;  2H0I A;  3HY2 A;  5HR2 A;  5DBQ A;  5ECS A;  3QAV A;  3D0Z A;  3G7J A;  5H5Q A;  5INY A;  4ECB A;  1G6Y A;  2VL3 A;  3IDV A;  2FLS A;  4PXO A;  3PR8 A;  2WW0 A;  1X9M B;  3DML A;  3D5J A;  2H1A A;  3EU3 A;  2ON7 A;  3KD0 A;  4FYU A;  4X0X A;  2X4A A;  1GLP A;  4JR6 A;  1B4Q A;  1AQV A;  3FR9 A;  1OYJ A;  4YQV A;  2C8U A;  1A0R P;  3F0I A;  2H72 A;  5KN3 A;  3F63 A;  4MMM A;  1V9W A;  1A23 A;  4Z2R A;  2J9H A;  3FK8 A;  1W4V A;  4OD7 A;  1AQX A;  1EGO A;  3ERF A;  2A2S A;  4RQR A;  3P2A A;  1SK0 A;  1H75 A;  1ABA A;  4MCU A;  1PRX A;  4I97 A;  2C3N A;  4XS1 A;  2BJX A;  4NPB A;  4YKG A;  3BCK A;  1G7O A;  5J9B A;  5G30 A;  5AIX A;  4IW9 A;  4I5Q A;  5HFK A;  1SU9 A;  3EMP A;  10GS A;  3DWV A;  2TRC P;  4OCE A;  4JU5 A;  4TR4 A;  5HR0 A;  4K6X A;  4BPY A;  1TXU A;  4XTS A;  4IGJ A;  3G7I A;  2B1L A;  2OAC A;  4PNF A;  4POM A;  5ECQ B;  4EDY A;  4PUR A;  5DAK A; 
#chains in the Genus database with same CATH homology
 1K0C A;  5ECH B;  4DSR A;  2IFQ B;  2UZ8 A;  3IC4 A;  2X99 A;  3H4K A;  4AKH A;  3ZIV A;  3UIW A;  2LS5 A;  2LJA A;  2YNX A;  2OA7 A;  3ZRE A;  4KUN A;  13GS A;  1V40 A;  2F51 A;  2YP6 A;  4K9Z A;  2MZC A;  3KTB A;  2P5R A;  1MD4 A;  3PH9 A;  6GSS A;  2C0D A;  2OJL A;  1DUG A;  1YEX A;  3C71 A;  2A2P A;  3FMW A;  2NDO A;  1M2B A;  1T4Y A;  4BL7 A;  4HZ4 A;  2IJY A;  1KEB A;  5F0G A;  1AUC A;  3IPZ A;  1F2E A;  2B3S A;  1B48 A;  4ZL7 A;  1ZYP A;  3UBL A;  3KIJ A;  2DLX A;  1K3Y A;  4OFM A;  1M9A A;  2UV8 G;  2LUS A;  1GNE A;  2DJ3 A;  3GRX A;  3J7Y k;  1DE2 A;  4EIQ A;  2TIR A;  3VI7 A;  4MF6 A;  4IQA A;  2YN1 A;  5B6N A;  4KB3 A;  5F8B A;  1GSS A;  5G5F A;  3C1R A;  1ILO A;  3MIX A;  3PPU A;  5D93 A;  3ERW A;  2RUF A;  4TXO B;  3WGE A;  5KN0 A;  1Z9H A;  3VWU A;  1FHE A;  1ZYE A;  5IMA A;  3GTU A;  2N5F A;  3ZVJ A;  2GZY A;  3LEF A;  3ZZX A;  2AAW A;  2VCV A;  5DJL A;  4K5S A;  3ZML A;  2C0G A;  1ERW A;  2QKE A;  1Z5Y E;  1OVN A;  2EC4 A;  2YWO A;  3GL5 A;  4ACS A;  5JWO B;  1WIK A;  2HRA A;  2L57 A;  3VFI A;  2DMM A;  4K7I A;  2EFE A;  1XZO A;  1EOG A;  5IMD A;  2DSA A;  2L6D A;  3QMX A;  3DVW A;  2R0G A;  2ES7 A;  1OC9 A;  4L0W A;  2CV4 A;  4J57 E;  2VIM A;  2H70 A;  3FYG A;  1MDK A;  4ZL9 A;  2IMF A;  3WGD A;  3GIX A;  3W8J A;  1FVJ A;  2WUL A;  1SL1 B;  2K18 A;  1X9S B;  1T1V A;  3TRQ A;  2M46 A;  5GST A;  4MZB A;  1TKD B;  4KX4 A;  2YV7 A;  1GLQ A;  3L0H A;  2PWJ A;  1J0F A;  2PN8 A;  5D9W A;  3IAM 2;  4DEJ A;  2JAD A;  4IKH A;  3VWX A;  4F0C A;  1ZYQ B;  1A0F A;  2DKI A;  2MBS A;  2IPA A;  3CTG A;  2MMO A;  2Z9S A;  1PN0 A;  4POK A;  3CTF A;  1EEJ A;  2GLR A;  5GSS A;  3ZVJ D;  3FR6 A;  5IM9 A;  3Q6O A;  3PGT A;  3US3 A;  3O6T A;  2XPD A;  4YAV A;  3HA9 A;  1HQO A;  2I3Y A;  3BD2 A;  3ME8 A;  5ECO B;  1HYU A;  3ME7 A;  2X8H A;  3CSI A;  4IJ3 A;  3C1S A;  2HRK B;  2VKZ G;  1X5E A;  2I9H A;  3M8N A;  2H74 A;  4GQC A;  2F8F A;  4XS4 B;  4JBB A;  4ZBB A;  3TOT A;  2YV9 A;  4X43 A;  3DD3 A;  3L9V A;  2KP2 A;  4LLR A;  2IFQ A;  4XRD A;  4DSS B;  4NAX A;  1PQN A;  3HKR A;  2GT6 A;  3GA4 A;  5ENU A;  5C04 A;  1SYX A;  1O73 A;  3HYP A;  3M9K A;  2C80 A;  4O5R A;  3A3T A;  1K0B A;  2E2G A;  4WF5 A;  2REM A;  1SVL A;  1XW6 A;  3W8S A;  1TI1 A;  3GX8 A;  1F3B A;  3FZ5 A;  3HDC A;  5DQS A;  3DKS A;  3HZ4 A;  3KH9 A;  3D4T A;  4JR4 A;  1RK4 A;  3QDN A;  5LNK e;  2V1M A;  4V2L A;  3CXG A;  2L5L A;  4G0L A;  2ALB A;  1BG1 A;  5KOW A;  3MYD A;  4F82 A;  3TJG A;  1QMV A;  2GGT A;  3IE3 A;  3KMO A;  18GS A;  1HNA A;  2E0Q A;  5A4U A;  1YF0 A;  1MDJ A;  2RUE A;  3L78 A;  3GSS A;  3DXB A;  4IEL A;  4F0B A;  2H75 A;  1VRS D;  4HJM A;  2V6O A;  5A4W A;  4HI7 A;  2JL4 A;  2LTK A;  5HFI A;  4IP1 A;  3UEM A;  4TXO A;  5CO3 A;  5DAL A;  4EUY A;  1F37 A;  1NSW A;  1URM A;  5FHI A;  1UN2 A;  5G31 A;  2IMI A;  3HMJ G;  3U6V A;  3GST A;  2JSY A;  4JE1 A;  3GMF A;  3LSZ A;  5ID2 B;  3ZIJ A;  3VPQ A;  2H0H A;  2LRN A;  5JWQ B;  4Q5F A;  3Q18 A;  1TU8 A;  3UJ1 A;  5KN1 A;  3UMA A;  1F9M A;  1GSY A;  3IR4 A;  2V41 A;  4MPF A;  2R37 A;  4OMV A;  4E68 A;  1SJ6 A;  6GSX A;  2IMD A;  1GSQ A;  1NM3 A;  5IQY A;  1J9B A;  1Z3E A;  1TOF A;  3QD9 A;  5G2Z A;  4HUA A;  1XWG A;  3BJ5 A;  3KH7 A;  5B7C A;  4PX1 A;  1Z6N A;  3F4S A;  1J08 A;  1XVQ A;  4ML1 A;  4IS0 A;  4F2I A;  2O87 A;  3IRA A;  1XW5 A;  3A2X A;  3IOS A;  2RM5 A;  3F4R A;  4QL9 A;  3F9U A;  1MEK A;  4WET A;  5ELA A;  4YKF A;  1EGR A;  1ZL9 A;  2VM1 A;  1OC8 A;  1SVM A;  1MD3 A;  1AC1 A;  1B4P A;  1JLV A;  3JCM L;  1XWB A;  2H66 A;  4G01 A;  5CRH A;  2C0F A;  2LV3 A;  1S3C A;  2IL3 A;  1ZOF A;  4MK3 A;  5IPH A;  2V32 A;  4EF0 A;  3DIE A;  2RM6 A;  1THO A;  4ZL8 A;  2H1L A;  1PKZ A;  1ERT A;  4L5L A;  3FY7 A;  2HZF A;  3CRT A;  2H1B A;  2P0G A;  3GTU B;  1U87 A;  2OE3 A;  1T3B A;  1XWC A;  2KP1 A;  1YY7 A;  3NZN A;  5B8B A;  2WS2 A;  2GS3 A;  2HRK A;  2JSZ A;  3LGC A;  3I43 A;  4DVC A;  2JZS A;  2XBQ A;  3TKP A;  1EWX A;  1Z7R A;  3OR5 A;  2X8G A;  4L8E A;  3EE2 A;  4XS4 A;  4MZC A;  1T7P B;  2YWI A;  1TK5 B;  1LJR A;  5JCW A;  1U88 A;  11GS A;  1T4Z A;  1ZYN A;  1EV4 A;  1BQ7 A;  4W66 A;  2B5Y A;  4F9Z A;  3EC3 A;  4LMV A;  1XOA A;  1WOU A;  3VUR A;  4DSS A;  1PX6 A;  4MAB A;  1PKW A;  1K0O A;  1U3I A;  1KBN A;  4K0G A;  4KW6 A;  4D73 B;  1YEP A;  2PER A;  4FH8 A;  1FOV A;  2F9S A;  2CQ9 A;  3TJJ A;  4J2F A;  2H0G A;  3GV1 A;  3WD6 A;  1O7U A;  1R5P A;  4O7H A;  5E4W A;  2YJ7 A;  4KSO A;  3DVX A;  4E8E A;  2NPB A;  5J4V A;  2V6K A;  4GTU A;  2I4A A;  1VF3 A;  2L6C A;  4Z2U A;  2QA1 A;  5GZZ B;  5FT3 A;  3BCI A;  2MBT A;  3GL3 A;  2DIZ A;  2LQO A;  2LJK A;  1TRU A;  2ZNM A;  4Q5N A;  2DJK A;  4FIW A;  2X8C A;  5IMV A;  4TRX A;  1VF4 A;  1B8X A;  3S9F A;  1QXH A;  1V58 A;  2VAF A;  4XRA A;  5IOW A;  5ABR A;  4AKX B;  2VLV A;  3GYK A;  1A8L A;  5A4V A;  1NHY A;  3GH9 A;  5D73 A;  2WJU A;  2PMT A;  2IMK A;  16GS A;  3GKM A;  1VF1 A;  1GWC A;  2VCT A;  1S3D A;  1VGL A;  2PPT A;  1BYE A;  3GUS A;  5BRT A;  6GSY A;  2VCQ A;  1TK0 B;  1QFN A;  5CNW A;  2AB6 A;  1WRY A;  4G2E A;  1BAY A;  3LG6 A;  2HSM B;  3GKX A;  5ID2 A;  2KLX A;  4KDU A;  5AGY A;  4WF4 A;  1GSU A;  4ZB9 A;  4ID0 A;  1CQH A;  1LBK A;  14GS A;  4KF9 A;  1Q4J A;  2LEG A;  3K8N A;  3WGX A;  2C3T A;  1K0D A;  5IMZ A;  2OKA A;  5LCZ A;  2FCH A;  2L5O A;  3HZ8 A;  2JU5 A;  4NWY A;  3HHV A;  1BX9 A;  2RII A;  4L5O A;  4K7N A;  4QL7 A;  4ZIJ A;  4K2D A;  4JRR A;  3C7M A;  3HVS A;  2H6Z A;  1AQW A;  2R0C A;  5GAP D;  1ST9 A;  2QA2 A;  4MDC A;  1K0M A;  2MMN A;  1GUM A;  3GHA A;  1PSQ A;  2HYX A;  2XC2 A;  1Z6M A;  2FNO A;  4KGI A;  3VPT A;  3AY8 A;  1WP0 A;  1K0N A;  4GSS A;  5IMC A;  5J4Y A;  4OO5 A;  2FWF A;  1I9D A;  4ECC A;  4TR3 A;  2YCD A;  3KP8 A;  4IJI A;  1EZK A;  1EP8 A;  3DRN A;  3LFL A;  3EU4 A;  3IXR A;  5CP1 A;  1XVW A;  3W6G A;  5DQY A;  4K0N A;  3DEX A;  2OBI A;  2WFC A;  4USS A;  4O32 A;  4ILF A;  1TW9 A;  1GNW A;  4G0I A;  4AKG A;  2I81 A;  4KE3 A;  1MDI A;  2CVB A;  4GCI A;  4PNG A;  1FOH A;  2HRF A;  1HD2 A;  5DAL B;  1K3L A;  4TW5 A;  4F03 A;  1GTA A;  4NHW A;  5ECM B;  3APO A;  3UL3 A;  1A2L A;  3ZIT A;  4PQ1 A;  1O8X A;  1RQM A;  3Q74 A;  3FKF A;  3TCO A;  1PN9 A;  2FWE A;  4V2N A;  5G1L A;  5ECP B;  3Q19 A;  4MJC A;  3GNJ A;  4LMW A;  1AW9 A;  1YF1 A;  1SEN A;  4ZBA A;  7GSS A;  2D2Z A;  3TB2 A;  2DIY A;  1OAZ A;  4GSN A;  2KUC A;  2R4V A;  4CDO A;  1ZZY A;  3GKN A;  1GP1 A;  4G9H A;  4HDE A;  3EVI A;  2B5E A;  4OCF A;  3RHC A;  5A5H B;  4GLT A;  5A1N B;  1PMT A;  4MNN A;  4D73 A;  4MJE A;  2WCI A;  3M1G A;  1XWA A;  4MA9 A;  5D96 A;  4FYB A;  5IMF A;  3QAG A;  2GDR A;  4IVF A;  2WZ9 A;  3GFK A;  5IIZ A;  2HZE B;  4ULX A;  2B7K A;  4PUA A;  5LD0 A;  1HNC A;  2IIY A;  4TXV A;  2CZ3 A;  5CRD A;  20GS A;  1JZD A;  1GSF A;  2F3M A;  4MJA A;  5F05 A;  3RBT A;  1M9B A;  1GTI A;  1JZR A;  5JCG A;  5IOX A;  4OFT A;  2H1G A;  4BVX B;  2AV4 A;  4IHU A;  4TR1 B;  2EIR A;  3ZTL A;  3CWG A;  2VL9 A;  4KCE A;  4Q5R A;  1FB6 A;  1S3A A;  2FWH A;  2LRT A;  4I8B A;  2VUP A;  1OKD A;  1ZGN A;  2WRT A;  3C8E A;  4IN0 A;  3N9J A;  2DJJ A;  2P31 A;  4EC0 A;  3J7Y b;  1GUH A;  3H93 A;  2HXK A;  2PVQ A;  3QFA C;  4XIH A;  2HSM A;  3D4M A;  4Z2T A;  2LNT A;  2DJ2 A;  1DE1 A;  2OE1 A;  5J47 A;  2B6M A;  1SKR B;  4ICY A;  3IAS 2;  2VCZ A;  3TOU A;  2DML A;  4POB A;  2NVL A;  1QGV A;  2ZUP A;  5H5S A;  4TKY A;  2GSS A;  5JCU A;  1G0T A;  1FVK A;  2XBI A;  2OAD A;  4A5P A;  3VK9 A;  2NBS A;  3R2Q A;  3UOM A;  1Q98 A;  3ZMK A;  3G9B A;  2IWT A;  4ECI A;  1WWJ A;  5ELG A;  3FZ9 A;  3U5R E;  3HJM A;  2H6X A;  1R4W A;  5AIV A;  3O76 A;  4MH2 A;  4N11 A;  1TJD A;  5GAN D;  4WR5 A;  1TK8 B;  2BMX A;  1F6M C;  3M3M A;  3QFB C;  1XOB A;  4HJ2 A;  2VCW A;  2XHF A;  3M9J A;  3UAP A;  1SK1 A;  1THX A;  5ECN B;  2GQM A;  2IN3 A;  3IHQ A;  4K1F A;  1BG5 A;  2QGV A;  2GSR A;  1XFL A;  1WMJ A;  1M2A A;  3FR3 A;  1WJK A;  2CVK A;  4L0U A;  3H8Q A;  1GSE A;  4EVM A;  2M72 A;  3CBU A;  4WKW A;  1PA3 A;  1FG4 A;  4E8H A;  1GRX A;  2B7J A;  2L4Q A;  4KSM A;  6GSU A;  1GUL A;  1WE0 A;  1U6T A;  1AXD A;  3KEB A;  4MPG A;  3MDK A;  2VD0 A;  4XCS A;  3H79 A;  4LL4 B;  3ISO A;  4OFN A;  5C00 A;  2B1K A;  1KNG A;  1LU4 A;  2FD3 A;  4KCA A;  5CRG A;  1FO5 A;  1ERV A;  1TRV A;  5A5H A;  3UVH A;  5A1N A;  3GKK A;  3QPM A;  3F6D A;  2AHE A;  4N0V A;  3L9U A;  2WGR A;  4N30 A;  3HD5 A;  3G7Y A;  3F4T A;  1O6J A;  5DCH A;  3LJR A;  3R3E A;  1TRS A;  2HZE A;  4BWS A;  4ECJ A;  1QQ2 A;  1YVL A;  5D9V A;  5J41 A;  4I2U A;  1IYH A;  3D21 A;  4PUF C;  3PIN A;  5IO0 A;  1V98 A;  2C4J A;  2I1U A;  2O5V A;  1MTC A;  4FYC A;  2LJR A;  2LQQ A;  4IP6 A;  4YAP A;  1GH2 A;  3IK7 A;  3BBY A;  1K3O A;  4KA0 A;  2AJQ B;  3TKS C;  3ZLP A;  3BOA A;  1TP9 A;  3HJP A;  3IK9 A;  5KN2 A;  4BVX A;  3LWA A;  4TR1 A;  2NTO A;  1G7E A;  3FEU A;  1XXU A;  4LA1 A;  3QCP A;  3KP9 A;  4Q5Q A;  4AF2 A;  4MP4 A;  4NHZ A;  3CYN A;  3FW2 A;  2L4C A;  1USB A;  2CX4 A;  1JFU A;  5D9X A;  4GST A;  2CVD A;  1UVZ A;  2KHP A;  3HJO A;  4YH2 A;  4GDF A;  1FB0 A;  2LNS A;  1SJZ A;  5COH A;  1GTB A;  3FZ4 A;  4MH3 A;  4ZB6 A;  2VOC A;  6GSW A;  4RUV A;  2VD1 A;  2VLT A;  2R5G A;  1SYR A;  1UA5 A;  22GS A;  2JAC A;  4AI6 A;  4TVE A;  3O3T A;  4TR0 A;  3LQ7 A;  8GSS A;  1X9W B;  3KXO A;  3TUE A;  2FWG A;  5CAX A;  1EOH A;  1SK2 A;  2C0E A;  3A2V A;  2QC7 A;  1PGT A;  2VCX A;  2GT5 A;  4ZIL A;  2C1Y A;  2FA4 A;  3TJB A;  4EE0 A;  1Y25 A;  4BVY B;  4YQM A;  1W89 A;  4LL1 B;  3F6F A;  3EWL A;  2AUV A;  2H73 A;  1PL1 A;  1HNB A;  4ISD A;  1XBS A;  1UC7 A;  3KZQ A;  1TXX A;  2GQL A;  6GST A;  1TTZ A;  2EIQ A;  3FRC A;  4OWY A;  1M0U A;  2DBC A;  3UVT A;  2WDU A;  1TI3 A;  1TDI A;  4P3Y B;  2OT3 A;  4G0K A;  2FHE A;  2YAN A;  3N5O A;  1PD2 1;  1FW1 A;  5DVB A;  2L59 A;  3UAR A;  2YPM A;  2N5A A;  1TU7 A;  3L4N A;  3CSJ A;  4KND A;  2EFD A;  1ML6 A;  3MSZ A;  2X64 A;  3I9V 2;  3WT1 A;  3WYW A;  4CY6 A;  2VL2 A;  4ZBD A;  1SKW B;  5AIS A;  4GF0 A;  1T8E B;  5D9T A;  4EXJ A;  3RHB A;  2CAQ A;  5B8A A;  3E0U A;  2MMZ A;  4AKI A;  2GSQ A;  4PGT A;  2HSH A;  2HFD A;  4X1U A;  1GUK A;  4RQX A;  2GVP A;  5HR1 A;  3KGK A;  4MZW A;  1X0R A;  2GST A;  4HU9 A;  1FAA A;  3EIN A;  3C73 A;  4HEA 2;  3LOR A;  2VLU A;  3H1N A;  1E2Y A;  4KAE A;  1A8Y A;  2O89 A;  2EFH A;  3GN3 A;  1F3A A;  2A4V A;  1PX7 A;  1YKA A;  4PQI A;  5DDL A;  4NXI A;  5BMU B;  3TKS A;  2DKH A;  2YJH A;  2K9F A;  2YWN A;  4NV5 A;  4K7O A;  2G2Q A;  5A34 B;  3KM6 A;  2VM2 A;  3I6A A;  1A24 A;  4HS1 A;  2ON5 A;  3TU3 B;  3P8W A;  2KOK A;  5CYY A;  2FA8 A;  4KDX A;  3KCM A;  1O8W A;  3TDG A;  3TGZ A;  1SKS B;  2B5X A;  2H19 A;  2OE0 A;  2J23 A;  3EMX A;  3HVV A;  3LW9 A;  1O85 A;  1IYI A;  1QUW A;  1R7H A;  5J9C A;  12GS A;  1KTE A;  2R2J A;  2HLS A;  5CRE A;  3NOF A;  2CZ2 A;  3E3E A;  1JZO A;  1OE8 A;  4BA7 A;  4AGS A;  2H71 A;  3VWW A;  4ML6 A;  5F07 A;  1V2A A;  4JZQ A;  4O92 A;  2DJ1 A;  1SD9 A;  2N5B A;  2DJ0 A;  2HSN B;  3F3R A;  1YJ6 A;  1YZX A;  3RPP A;  4N10 A;  5EY6 A;  2HE3 A;  4EIP A;  1E6B A;  2HNL A;  3I69 A;  4I2T A;  1XIY A;  5KEJ A;  1T00 A;  2H01 A;  3TKQ A;  5J5N A;  4POL A;  3IV4 A;  3HVX A;  2IME A;  2BTO T;  2DC5 A;  1YQ1 A;  2JZT A;  1O81 A;  1ZMA A;  3KTL A;  2HQT A;  3P7X A;  2K6V A;  1B9Y C;  4GRF A;  2PU9 C;  1X5C A;  4BWQ A;  1OC3 A;  2CT6 A;  1R5A A;  2RLI A;  2FUG 2;  2H8L A;  5AN1 A;  2PUK C;  5A5K A;  3ERG A;  4GXZ A;  4XHM A;  1CQG A;  1BJX A;  4MLY A;  4NMU A;  3EUR A;  4BVY A;  4MJB A;  5B6M A;  4CHS A;  4WEY A;  3TJK A;  3ZRD A;  1R26 A;  4I6X A;  2HSY A;  3P90 A;  4EL1 A;  3WT2 A;  1YKC A;  2WB9 A;  2R3X A;  1JLW A;  4FQU A;  2X49 A;  1GTU A;  1AAZ A;  4TOP A;  4OO4 A;  4KDY A;  1VF2 A;  2YWM A;  2R6K A;  1ON4 A;  2H6Y A;  2FGX A;  19GS A;  1XCC A;  1Y1U A;  1EEM A;  1XWK A;  9GSS A;  2O85 A;  4J56 E;  2E2M A;  3ZYW A;  4H86 A;  2PBJ A;  4G19 A;  4AJ7 A;  1N8J A;  2GTU A;  2CA8 A;  3L9S A;  1NW2 A;  3IHG A;  1Z7P A;  4HOJ A;  1BED A;  6GSV A;  5CRW A;  5EVO A;  3D22 A;  5L71 A;  4KH7 A;  4RI7 A;  1XW9 A;  1SD8 A;  4TN8 A;  1EV9 A;  3KJY A;  3LYK A;  4HZ2 A;  2MYG A;  3E9J B;  2FY6 A;  2P5Q A;  3HXS A;  3GX0 A;  2V2G A;  4FO5 A;  3ED3 A;  2E7P A;  5DCG A;  2PGT A;  3MWH A;  1TRW A;  5G1K A;  2A2R A;  4X4J A;  3SWL A;  1B9X C;  4V1A g;  3TJF A;  5ECR B;  3TRX A;  3NIV A;  5ECL B;  2F8A A;  4PTS A;  4NV2 A;  4RI6 A;  4K8M A;  1ACV A;  4MF5 A;  4GWR A;  2CAI A;  4MF7 A;  1WPI A;  2H1D A;  5E59 A;  2CX3 A;  4GQF A;  1JZW A;  5BMU A;  5J40 A;  5A34 A;  1N25 A;  1M2D A;  5HFG A;  4Z7X A;  4ZB8 A;  3DYR A;  3EPT A;  4AJ8 A;  3GUR A;  2HRN A;  2OBK A;  2O7K A;  3VWV A;  1PL2 A;  3CMI A;  4ZB7 A;  1QK8 A;  2LST A;  5EPF A;  2A4H A;  1ZCP A;  1DSB A;  4IBP A;  5FWG A;  2GZP A;  4HQS A;  4XS6 A;  4DSQ A;  5EL8 A;  4K2X A;  1DBY A;  3LYP A;  2GZZ A;  4CY8 A;  2R0P A;  4JED A;  5H5R A;  5J4U A;  3QR6 A;  2TRX A;  1M99 A;  1BF5 A;  3SBC A;  2O8V B;  3A2W A;  3RDW A;  3KMN A;  4V1A p;  5ECI B;  3QAW A;  2HSN A;  5DJM A;  1SVO A;  3CRU A;  1GL8 A;  2PVO C;  2GQK A;  4HU7 A;  3M0F A;  2HI7 A;  1G6W A;  3TKR A;  3F3Q A;  3CSH A;  1A2M A;  2EIO A;  5ECK B;  5HR3 A;  4PQH A;  4N0Z A;  2VO4 A;  5DAK B;  5KOX A;  1OKT A;  5G5E A;  4WBR D;  2C3Q A;  4WBJ A;  2VL2 C;  5HQP A;  3D6I A;  2MMA A;  3DGQ A;  4O5Q A;  3MAK A;  1NHO A;  3FHK A;  2LRC A;  1C72 A;  3IA1 A;  1X5D A;  2K8S A;  3LXZ A;  2H30 A;  1M7T A;  4YQU A;  2G0F A;  5IO2 A;  2EFC A;  5J3R A;  3APS A;  4ZXG A;  1XPV A;  3IC8 A;  1YDK A;  2ZCT A;  5JWR B;  1SL2 B;  1RW1 A;  4BL7 B;  3ZFB A;  4O5U A;  2YZH A;  1I5G A;  3QOU A;  1A2J A;  3A5I A;  3UBK A;  1V57 A;  2YOI A;  1SL0 B;  17GS A;  2JZR A;  3F8U A;  4IQ1 A;  3HCZ A;  2AYT A;  3ZFL A;  4EO3 A;  3VLN A;  1K0A A;  4G10 A;  1U3A A;  3RAZ A;  4AJ6 A;  5IPG A;  3GH6 A;  1N2A A;  3LXT A;  3TRP A;  5D8I A;  3V1W A;  3FZA A;  4QQ7 A;  3VI5 A;  2YZU A;  4HQZ A;  3APQ A;  2XPE A;  2QSI A;  4WR4 A;  4N3Z A;  1H4O A;  2M80 A;  3TKS E;  3IBH A;  4EKZ A;  1OE7 A;  4K5R A;  3EYT A;  4V2M A;  5F06 A;  1ERU A;  4WXT A;  4QMK A;  4CW9 A;  2LKU A;  4EDZ A;  1OC9 B;  1EP7 A;  3ZL5 A;  1SJI A;  2K8V A;  1GSD A;  3MNG A;  3A5W A;  1Y6E A;  1JHB A;  1AIU A;  2HT9 A;  3RPN A;  2H76 A;  2H0I A;  3HY2 A;  5HR2 A;  5DBQ A;  5ECS A;  3QAV A;  3D0Z A;  3G7J A;  5H5Q A;  5INY A;  4ECB A;  1G6Y A;  2VL3 A;  3IDV A;  2FLS A;  4PXO A;  3PR8 A;  1X9M B;  3DML A;  3D5J A;  2H1A A;  3EU3 A;  2ON7 A;  3KD0 A;  4FYU A;  4X0X A;  2X4A A;  1GLP A;  4JR6 A;  1B4Q A;  1AQV A;  3FR9 A;  1OYJ A;  4YQV A;  2C8U A;  1A0R P;  3F0I A;  2H72 A;  5KN3 A;  3F63 A;  4MMM A;  1V9W A;  1A23 A;  4Z2R A;  2J9H A;  3FK8 A;  1W4V A;  4OD7 A;  1AQX A;  1EGO A;  3ERF A;  2A2S A;  4RQR A;  3P2A A;  1SK0 A;  1H75 A;  1ABA A;  4MCU A;  1PRX A;  4I97 A;  2C3N A;  4XS1 A;  2BJX A;  4NPB A;  4YKG A;  3BCK A;  1G7O A;  5J9B A;  5G30 A;  5AIX A;  4IW9 A;  4I5Q A;  5HFK A;  1SU9 A;  3EMP A;  10GS A;  3DWV A;  2TRC P;  4OCE A;  4JU5 A;  4TR4 A;  5HR0 A;  4K6X A;  4BPY A;  1TXU A;  4XTS A;  4IGJ A;  3G7I A;  2B1L A;  2OAC A;  4PNF A;  4POM A;  5ECQ B;  4EDY A;  4PUR A;  5DAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...