2IN2A

Nmr structure of the apo human rhinovirus 3c protease (serotype 14)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
182
structure length
182
Chain Sequence
GPNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLKKQYFVEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Picornain 3C
publication title NMR solution structures of the apo and peptide-inhibited human rhinovirus 3C protease (Serotype 14): structural and dynamic comparison.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Hydrolase
total genus 45
structure length 182
sequence length 182
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2in2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2in2A02
1OSSA 1H1BA 3PLBA 4NCYA 1SR5C 2ZQ1A 2FM2A 1KIGH 5GPIB 3UFAA 4CHAC 4YM9A 1MTWA 5K7RA 1O3KA 3PB1E 1O32A 4JZIA 4ABGA 1A1RA 5FCRA 1MU8B 4A5TS 2EI8A 4QT8C 4ZKNU 1TGNA 3PWCA 1K1NA 1CQQA 1NRNH 1BBRE 3PLPA 3TGJE 1IAUA 2VWMA 3NPSA 5GXPA 3SOSA 4INLA 2J95A 1S84A 1O2VA 5DP7A 1BB0B 3RLYH 1ZTJA 2ZFPH 3K2UA 1GJDB 2XCNA 4GUXA 4WWYA 2BTCE 3UQVA 4Y0ZE 2PSXA 1CT4E 3QLPH 2Y5HA 5C1YA 3OX7U 1C1OA 1PPFE 2ZP0H 1GJCB 3QGJA 4B76A 2Y5FA 2H5CA 1GI5A 1XUHA 3TPIZ 3M5OA 3NKKA 3RP2A 4J1YA 4Y0YE 4MPUA 1D4PB 2ZHEH 3S7KB 1SVPA 2BOHB 1XXFA 4ISNA 2AMQA 1DUAA 4X1NU 5F8ZA 3CP7A 1ELBA 1AGJA 1HRTH 2ALPA 3MOCA 4CREA 4BAHB 1PQ5A 2CF9H 1O37A 1O3NA 2ZC9H 3E1XB 3LH3A 4WMDA 4OS2A 1AE8H 1QR3E 4X1QU 2BY7X 3LJJA 2ZFTA 2BVSH 1O3HA 2GZ7A 3ZZ6A 4FUBA 1KYNA 3TK9A 1HAVB 3S69A 4YT7H 1HAGE 3P8GA 1NC6A 1C1PA 1ANCA 2FYQA 2ULLA 2BOKA 1O3IA 1RTKA 3P8OA 3ENSB 3RU4E 5A0AE 2Z7FE 3G01A 3LIWA 5GJ4B 1FPHH 1A2CH 1T32A 3RXHA 2BLOA 1V2TT 3GY5A 3A7TA 2HLCA 2HWLB 3KL6A 2F9PA 5FBEA 1ELAA 4IW4E 1YCPM 2QN5T 1N8OB 2C8WB 9ESTA 1RTFB 2G8TA 4NSVA 3T62A 2VWNA 4K1TA 6LPRA 1ZZZA 1CGJE 2XBYA 1AU8A 1MD7A 4NA7A 3DD2H 1ZMNA 5FHTA 1IQFA 1NU9A 5TJXA 4MPXA 2DUCA 1QY6A 3ATIA 3RU4D 5JB8S 2WUBA 1KSNA 4I33A 1TB6H 2A31A 2ZCHP 3TGIE 1GWAA 4X2VA 3VGCB 1H8IH 3E0NB 3ODFA 3NXPA 1L1JA 1D3PB 1TMUH 2IN2A 4D7GA 3GOVB 2FOMB 1EPTC 1C5OH 2FS9A 1YM0A 3V12A 1ABJH 9LPRA 3Q3YA 1B0EA 1C1MA 2FIRH 1SGYE 1HXEH 1HAYB 3E91A 1TPPA 4NSYA 5C5OA 4H6TA 3T28A 1TAWA 2RDLA 1NROH 1PYTC 2A0QB 1O3DA 1Z7KA 3SUDA 3RMLH 3UQOA 5JBBS 1XVOA 1VZQH 2A4QA 4ZKOU 2O8WA 2Z9LA 2UWOA 1AHTH 2Z3EA 1C5SA 3HATH 4MDSA 4FVDA 2BD9A 1KY9A 3MU1A 2VINA 3FZDA 4WMFA 1ZHPA 2SGFE 2Y81A 4ASHA 2OXSA 1BTWA 4X2YA 2BVRH 1O5DH 3M7QA 3ZZ4A 2A7CA 3LT3A 2G00A 2IJOB 4O9VA 5HM9A 1YLCA 3SGAE 1MTSA 2UUJB 4HFPB 2KAIB 2TGAA 1TMBH 4Q7YA 1YLDA 4O03A 1EPTA 1O2PA 1LKAA 1J8AA 4HGCA 3RC6A 3A8CA 1L4DA 2F83A 5CHAC 1YBWA 4DT7B 2FMJA 2HVXA 7GCHG 3E6PH 3LJOA 3RM2H 1QRZA 2P94A 2ZGXH 1VCQA 3BG4C 3LH1A 2B0FA 5CMXH 7KMEH 1Y3WA 4B1TA 1HAHH 2CGAA 2SFAA 1C2JA 1AVWA 4YOJA 1P03A 3SNBA 1C5NH 5EW1H 3P6ZB 4U30A 1RIWC 1QJ1B 2C8ZB 3MO3A 5T3HA 3GCHC 1MAXA 5FAHA 1KLJH 1O2NA 2FTMA 4FXGH 2Q1JA 1TONA 3ZZ9A 2GX4A 3I78A 1HPGA 1TNIA 1K1MA 1BJVA 2WYGA 3M7UA 1AB9B 5EG4A 4A1TA 4GLYA 3A89A 2SNVA 3GY6A 1A5GH 4AORA 4NWKA 4WXIA 1O2ZA 1S0RA 5DP9A 1G3EA 3A8AA 1MTNC 2Y7XA 1C5VA 3BTHE 1DY9A 6CHAB 1YPLH 1GHVH 1DFPA 1HXFH 1UVPA 4B2AA 2JH0D 2ZFRH 5DO4H 3MMGA 5CE1A 1JOUB 2FZZA 2H9TH 2O9QA 1TNJA 1ARBA 3A85A 1GMDF 2F9VA 3BN9A 3VB6A 3MNXA 1ZPZA 2VVUA 1W2KH 3BTGE 3M3SA 3UY9A 2OQ5A 1LQEA 1QJ6B 3PO1B 3GISB 1P05A 1ZRKA 1Z1JA 2GMTC 1KLIH 1ELFA 4TWYA 1T7CA 2VGCB 1YF4A 3GY3A 1YGCH 4YLQH 2EI6A 3MNSA 1P2NA 2PSYA 2VB0A 1EZQA 1JBUH 2TIOA 1EJAA 2GV7A 1MH0A 1HYLA 1ZRBA 2ZIQH 1SLWB 2ZGBH 2ANKH 1NRPH 1W12U 4U2WA 3QK1A 2GCTC 1F0SA 1TNHA 2FOEA 5BPEA 1F0RA 1GHAF 2YOLA 2BDGA 1YPHE 1SQAA 1DM4B 3TH4H 1IQJA 3FZZA 3IWMA 3A7WA 4H4FA 3U1IB 1JMOH 1AIXH 3SJ9A 2BY5X 3SGQE 1GL0E 1LCYA 1UTJA 4MVNA 3BEUA 1GL1A 5LPRA 1HFDA 1HIAB 1C1VH 1AE5A 2EA3A 5A0BA 2Z3DA 1WQSA 4RSPA 1W7GH 3HPTB 3M3VA 4MNWA 1GBBA 1FAXA 1S0QA 2AEIH 1O3CA 1A7SA 2BQ6B 4MTBA 1GJBB 4K5ZA 1O38A 5LPFA 1P06A 4TY7A 3V3MA 5L6NH 1S5SA 2J38A 2OBOA 2AH4X 3LGTA 3AW0A 5C3NA 1A5IA 3KNXA 4NZQA 3MTYA 3P70B 1AO5A 1TNLA 4BANB 3OY6U 1NFYA 4AOQA 4E7NA 2ZI2H 2SNWA 4M7GA 1C1RA 3SJOA 4K8BA 1P02A 2HNTC 2I6SA 2QF0A 4ZAEA 3F9FA 5AFZH 2Z9IA 5FBIA 1XUKA 5FPTA 3SJKA 4F4OC 5FX5A 5ABWA 1SHHB 2FI3E 1IQLA 2HNTE 4B71A 1C9TA 4MNVA 3RUOA 2Q6FA 7LPRA 1GMHF 1ZSKA 3GICB 1XVMA 1KDQA 1JXPA 1LHGH 1V2JT 3UNRA 2BLWA 1C5ZB 4JYTA 1CO7E 2GT7A 4MLFB 3RXUA 3TJUA 5E2PA 1HLTH 1SHYA 2GDEH 4I8JA 1GBHA 1J16A 1W3CA 1GBJA 3SI3H 4VGCC 2VWLA 3SJIA 1NZQH 1AVGH 1DSTA 1O31A 3D65E 2OBQA 3BIVH 2GT8A 2PKAB 1P09A 2V0BA 5LH8A 1Y3XA 3GY2A 1BTPA 1TGBA 1V2OT 3Q3KA 3TK5A 5A8YA 8ESTE 5L2ZH 1N8OC 2UUFB 1TBQH 5GCHG 2VIVA 1TIOA 4DIHH 4MPWA 1C5TA 5E0JA 1YPJH 3ZZ8A 1D3DB 3MU4A 2CV3A 1Z1IA 1UCYK 4AGKA 1IQNA 1O3MA 3KHVA 2A4RA 1Y3UA 2PHBA 4TYDA 1V2LT 1E37B 2BDBA 5A8ZA 3Q3XA 1TX7A 1SGCA 1OYTH 2GD4B 2IOTA 2AIPA 4X1PU 1SL3A 3VGCC 1HGTH 3MO9A 1C5XB 3MNBA 5EOKA 3DFJA 1D6WA 1DWDH 1QCPA 1ZHMA 3B23B 1WBGB 4Z0KA 3EA8A 4ZXXH 2CF8H 4F49A 1FAKH 1OP0A 1UK4A 1ZR0A 1LQDB 1C2MA 3AW1A 1Z8RA 1CGHA 4X6OA 1VGCB 1GHZA 1CE5A 1GI3A 2J34A 3K6YA 3RXQA 2AGIX 3CENA 1HAIH 1LPKB 1EP6A 5IDKA 2ZU4A 3P95A 4B2BA 5LPEA 2HRVA 3HGNA 3SNCA 1MKWH 1UO6A 1YC0A 1FZZA 3LPRA 3RXVA 2NU4E 4BTIB 1A3BH 2OC0A 4THNH 3SHCH 4KGAA 4MNXA 3Q00A 2JH6D 4ABBA 2O8TA 2V35A 3D23A 1VITG 1O2LA 4FUIA 1MKWK 1MTUA 4Y11E 3R3GB 1A0LA 1GJ9B 1EATA 1MQ5A 5JDUB 1G3DA 1FJSA 4X1RU 1GI9B 3HGPA 4LXBH 1GBEA 1V2ST 2GZ8A 1LPGB 3VXEH 1FY5A 1LHFH 2AIQA 1G30B 1T31A 4HI3A 4BAQB 3SU4A 1ELEE 1ELVA 1PPZA 3TJOA 1AWHB 1LHDH 1UVOA 2XC0A 2QIQA 3LGYA 3MH7A 2PUQH 1JRTA 1UTKA 1Y3YA 3SNDA 3S0NA 1P3CA 1K22H 3S9CA 4MQAA 4UONA 1AI8H 2ZFQH 1QIXB 1TQ0B 4ZHAA 2ZKSA 2G5NA 3GDSA 3ZZCA 4UD9H 2FI4E 2B7DH 3SO3A 3RXCA 5B6OA 1TOCB 3ZVCA 1C5UA 1C2HA 2QXIA 1BRAA 1HAXB 1UHBB 1A0JA 2FS8A 4NA8A 4NZLA 3A7XA 4AFUA 1YYY1 1OP8A 2NWNA 2XC5A 2H2ZA 2UUYA 4YOIA 2VH6A 3A7YA 1AB9C 3ZZ3A 3TGKE 1EUFA 2G55A 2BD7A 5TCAA 1M9UA 1TNGA 3NCLA 1YPGH 2PGBB 4NGAH 1C1NA 3F1SB 1YCPH 2QAAA 2IPHA 2A1DB 5GCHF 1WYKA 4LOYH 2V6NA 5F03A 1ZJKA 3VEQB 3DT0H 3V0XA 5JPMH 1Z6EA 1J17T 6CHAC 4WH6A 1EB1H 2ZGJA 1O3JA 4HTCH 1OX1A 3ZZBA 4A1XA 3E16B 1T8NA 3PTBA 1YCPK 2WINI 5DJ7A 2O8LA 3KGPA 1H8DH 1DOJA 2R0KA 2ZZUH 3TVJB 2P3UB 3SU5A 3UNQA 1YKTA 2BZ6H 1OPHB 2ZHQH 4D9QA 1WCZA 1Y5AT 2BQ7B 4ISLA 1FY4A 1ZHRA 3GDUA 3D49H 2GDDA 1T8OA 3K6ZA 3T29A 1HCGA 1HAPH 4ZHMU 3A8BA 4H6SB 2VGCC 1EJMA 1W0ZU 1P9UA 2BY8X 3URCA 2J9NA 3EA7A 1X7AC 2A7HA 1EXFA 4WF8A 3ZVGA 4O3TA 1V2PT 1LMWB 4IN1A 1QA7A 1DICA 1O3BA 4JCNA 1DXWA 1NPMA 1F92A 3RXMA 4CRAA 1E35B 1S6FA 3H7OA 4IGDA 4ZH8A 1ANEA 1HAZB 3LGIA 4RKOB 1BTYA 2FX4A 2ZU1A 3VFEA 5DP5A 1BQYA 3BF6H 4ABJA 3S9BA 2AGGX 1P2IA 3MU0A 4IN2A 2FOFA 2BD2A 2OD3B 2Y7ZA 4DJZB 1TNKA 1GMDG 4YO9A 1ACBE 1ELCA 2ZDKA 2PR3A 1J15A 4WJG2 3SV8A 1BMAA 1GI4A 1VITF 4AYVB 4JZFH 4FU9A 1SLUB 3LOXA 1BTXA 2FOAA 1NT1A 1N6YA 1FY1A 3VXFH 1MCTA 1Y5BT 1P3EA 1ABIH 4DURA 2HNTF 5L2YH 1WQVH 4NFFA 1E36B 4Y71A 1EAWA 2BLQA 3TJVA 5SGAE 1GJ6A 1TGTA 1SOTA 2XBVA 2P8OB 3RXPA 3SV6A 1C5MD 1NRSH 1NFUA 1NRRH 4SGAE 2ZFSA 1TGSZ 1BHXB 3UPEA 4Q7XA 3UOUA 2Z3CA 5DG6A 2HPQH 3EDXB 2NU1E 1AZZA 4XDEA 5EODA 5EW2H 1TALA 5EPNA 1UVUH 3PYHA 4JMYA 1MZDA 3GCNA 4BXSA 2TGDA 1GHAG 4NIVA 1LHCH 3UWIA 4A7IB 1BRBE 1WTHD 1ZMLA 2JH5D 1TBRH 1C5WB 2QC2A 2ZTXA 1U6QA 1SLVB 2P59A 3E90B 5E0GA 1GCDA 4H42U 4ZMAH 1GBIA 2A4OA 3SU3A 2RG3A 2Z9GA 1JIMA 5JBCS 1ELDE 3MH5A 2GZ9A 1ORFA 1OYQA 5ETXA 1OWEA 6ESTA 2YNBA 1BUIA 1O36A 3BTTE 2QF3A 1C5LH 4CRCA 3WY8A 1WV7H 3HK6B 4X8TH 1SFQB 4ABDA 5T6DA 1HJAB 2VIPA 3TLOA 3V13A 1FY8E 1PYTD 5HMAA 3M3TA 2ZGCA 3FAOA 4MG3A 1PPBH 1O2UA 1UVSH 4Y6DA 1ZPBA 5TCCA 1IHSH 1UJ1A 3RXLA 8KME2 1HNEE 5L30H 1ARCA 1GI2A 2FXRA 3MU5A 4Y10E 1V2RT 4B74A 3FP6E 1LKBA 1P57B 1CT0E 1GI8B 1SGFA 2AYWA 1XUIA 3H7TA 1V2WT 1TGCA 2ZDLA 2QYIA 1O3EA 1O5CB 4CHAB 1MTVA 4CR9A 4FVBA 3BTFE 2ODPA 4DIIH 1QL9A 2A7JA 4BAOB 1THPB 3NK8A 4B73A 1QBOA 1O2JA 4FUDA 3P17H 2NU0E 3NUMA 3QO6A 1GVZA 2P3TB 2QY0B 4UEHH 2BQWB 1P10A 1GMHG 3M61U 1KXBA 1WTGH 4K69A 7ESTE 1AWFH 2SGAA 2ZU3A 1S83A 3ODDA 4I7YH 2W7UA 1O5AB 3QX5H 1CA0C 2ESTE 1O2TA 1GPZA 2V3HH 3F68H 4FUEA 4FUJA 2OC8A 3RXOA 1C5QA 1GBTA 4YESB 2FX6A 2WV5A 1THSH 3SUGA 2RA0A 1ZSLA 1W11U 1AMHA 1BMNH 1L0ZA 2ZDNA 3BTDE 2XRCA 1B7XB 5JYIA 1VGCC 2C8XB 5J4QA 3T26A 4JZEH 2QXGA 1O2HA 1SFIA 5EQRA 4ABHA 2BB4A 3LC3A 3S7HB 4X6PA 1NU7B 3EAJA 3GY8A 1SI5H 1OWDA 4SGBE 1KLTA 1SOZA 2ZG0H 2ZTYA 2H6MA 3DFLA 3W95A 1C5PA 1V2VT 1UTPA 4K3JA 1FONA 2VU8E 3ATKA 5HYOA 1SQTA 3PMBB 2ZA5A 3Q76A 1GBCA 3QGNB 1NS3A 2JETB 4D8NA 3A81A 1MCVA 1GJAB 3MFJA 1DDJA 1XKAC 1GG6B 1UK3A 1MZAA 1SGFG 2ZHWH 2NU2E 1ETTH 1MMJN 3VPKA 6GCHG 2OP9A 5JBTA 4LK4A 3TH2H 1F5LA 4NIXA 1NFXA 2ZEBA 4ABIA 4UE7H 5JBAS 1F0TA 1MUEB 1D3TB 1O5EH 5DPAA 1HAOH 3ATMA 2H1UA 2PWXA 1GVKB 3UNSA 1YPHC 2PFEA 2Y80A 1AD8H 1GBFA 1VJ9U 1TBZH 4XFQA 5HGGA 1K2I1 3GY7A 3RDZA 3T2NA 1AKSA 3UR9A 1C1UH 4ZKRU 5AF9H 1A61H 4CH2B 1C5RA 2A45B 1ESAA 1FY3A 2BDCA 2VVCA 3ATWA 2XYAA 3SBKA 1K28D 4RKJB 5FPYA 1AVXA 1ZGVA 1EASA 1KXFA 3BTKE 2J94A 3ZYEA 2FPZA 3RM0H 1YP9A 1P0SH 2FP7B 1BITA 2G4UA 1O3LA 1G2LA 2NU3E 4XBDA 4TPYA 3TNTA 3DUXH 1FI8A 1CA8B 4R0IA 1Z8JB 3A80A 5EGMA 4IC5A 1G37A 1KTTB 1G32B 3MH6A 4UFGH 1DWBH 3U8TH 5PTPA 2GTBA 3RXEA 1O5BB 4ABAA 1FNIA 1BZXE 2D1JA 1QNJA 1EPTB 1F2SE 1N6XA 5A0CA 2XWBI 5EQSA 8GCHF 1MQ6A 4X8UH 2C90B 1W14U 1GI1A 2J4IA 3KQEA 1QTFA 4AFZA 3TU7H 1F7ZA 3FFGA 3CS0A 2AGEX 3A8DA 1P11E 1UMAH 3JZ1B 1TMTH 4JK6A 5J4SA 5C1UA 3MU8A 3RXJA 2C4FH 3ZVDA 1SGRE 1GI6A 3EA9A 3CS7A 1FMGA 3MH4A 4KKDA 1IHTH 3PROA 3M35A 3KQBA 1AUJA 4BAKB 1CSOE 3P92A 2CJIA 5EXMA 4ABFA 1Y8TA 3PMHB 1G2MA 1OKXA 4ABEA 4IC6A 2XXLA 3K9XB 1HV7A 1ZTKA 3MYWA 1AFEH 3SN8A 2THFB 4BNRA 1C2GA 2STBE 1EQ9A 2I6QA 1UCYH 1Z71A 3RXRA 1QJ7B 2FDAA 4XBCA 5T6FA 3KIDU 2ZDAH 4DOQA 1IQIA 2BMGB 2SGDE 1GBKA 3FVFB 1W8BH 1ELGA 1EP5A 2GP9B 3E3TA 2GCHF 3BIUH 3BSQA 1GI0A 1B0FA 3A84A 1K1IA 2EEKA 2A5IA 3UUZA 1DSUA 3ESTA 3EE0B 2ZDMA 2UWPA 6GCHF 3NZIA 4Q7ZA 2H9EH 1PPHE 2C93B 1GMCG 2Z94A 2QXHA 4FUGA 4MPVA 1HAVA 2WPHS 5EPYA 1MKXK 1RIWB 2FESH 3TK6A 3UR6A 4DCDA 4JYUH 3N7OA 3STJA 1FLEE 3GCHB 4TWWA 1ELTA 3SZNA 5ESTE 3F6UH 3RXDA 1SGTA 4AX9H 1SGQE 1HUTH 1DE7H 4K1EA 1EKBB 1O2SA 2AMDA 3IITA 3O8BA 1TPAE 1SB1H 2P8OC 4PROA 1JWTA 4ZHLU 1F5KU 2Y82A 1QRXA 2PLXA 1CBWB 1NTPA 2XBWA 5HXFA 3QUMP 1P9SA 4RN6A 1NY22 2VVVA 1WOFA 1PQ8A 1A46H 2FLRH 2PKSB 5GDSH 4KTSA 4NWLA 2WPLS 2XW9A 2VJ1A 1ZOMA 2RA3A 1C4U2 1PPGE 3SQHE 1VCPA 4WH8A 2ZPSA 1GBMA 3LDXH 2BXUH 5C1XA 1EJNA 4BAMB 1TQ7B 1BA8B 2C8YB 1O3AA 1O2GH 1TLDA 4D9RA 1GHXH 1O2OA 5FXLA 2BX3A 1SGIB 4X6MA 3SW2B 3BTQE 5F6MA 2A2QH 3NWUA 1TWXB 1TFXA 2VIQA 1AN1E 4Q80A 5A2MH 1EAUA 2ZNKH 4ISOA 4Z6AH 3L6PA 1QGFA 1SC8U 1SMFE 1QQUA 1K1LA 4OS5A 1MD8A 2AMPA 1ESTA 1NESE 2OLGA 3RMNH 1HJAC 2A5AA 3F9HA 4IMZA 2HGTH 3BTEE 1SG8B 1E38B 4AG2A 2BDYA 2QXJA 2ZGHA 3LGVA 5ESBA 4X1SU 3K65B 4FUHA 1NRQH 1Z8IB 1NFWA 2F9BH 1W7XH 2ZFFH 4XE4A 1SGNE 4JYVH 2VIDA 3RXSA 3D62A 1GHBF 3PM3A 1VCWA 2GV6A 1J14A 2XTTB 1QB6A 4WXVA 1WSSH 2R3UA 1W13U 2V3OH 1FUJA 3SUFA 1F5RA 4Y76A 1GDQA 1FPCH 3PV4A 5E8EH 1DX5M 2BY6X 1FN6A 3PTNA 1XM1A 2XNIA 5DP6A 1BDAA 2UUKB 1DUEA 2C3SA 1VR1H 2D2DA 1SBWA 4I8KA 4TPIZ 1MBQA 4KP0A 2EC9H 2W26A 5E0HA 2BVXH 3P8NA 3GY4A 4XSKU 2F91A 1KDQB 1O0DH 1K21H 1OP2A 2KAIA 2ASUB 3M7TA 1C1TA 1DITH 2AS9A 1EOJA 1GBDA 4FU7A 2BDAA 2G5VA 4FUFA 3U8RH 1FQ3A 4Y8XA 3AAUA 4CRDA 3T25A 4K2YA 1QBVH 1LDTT 1S6HA 3ZVEA 2D26C 2A32A 1ZLRA 2BZAA 4MNYA 3LONA 1A5HA 1TE0A 1DANH 3Q77A 4OS6A 1RJXB 2Z6BD 2FTLE 3OSYA 4INHA 3P8FA 1O2YA 1FN8A 1UTQA 3QZQA 2ZDVH 1GCTB 2HPPH 1O3GA 1B5GH 1ID5H 2FOBA 1P2KA 3HK3B 1PQAA 1BRCE 1GDUA 3RXFA 1LVOA 3PO1C 4BTUB 1GMCF 4I31A 2QA9E 1Q31A 4OS1A 2DE8A 1CU1A 1W10U 5DK1A 3RXTA 2SGPE 5C67A 2JETC 1INCA 3SV2H 3LGUA 1GG6C 3BEFB 2OTVA 2TGPZ 4NFEA 2GKVE 4DY7B 2ODYB 2Z9JA 3KN2A 3SU1A 3QWCH 2Z9KA 1XX9A 4AZ2B 2PGQB 4JZ1A 1UK2A 3ZV8A 4A1VA 1LVYA 2STAE 1O5GH 4CBNA 2FODA 4AGJA 3JZ2B 1NO9H 2CHAB 4ZXYH 2WPJS 1BBRH 4VGCB 2R3YA 1LVBA 1BTZA 2XWAA 2QCYA 4OGXA 3PMJA 4I8GA 3SNAA 1LO6A 3AASA 1C2LA 2ZWLH 3M5LA 3O8RA 1O2IA 1O3PB 2OC1A 3UIRA 1P2MA 1S85A 1SGEE 2G51A 2WYJA 1GBLA 1V6DA 1C4Y2 1CHOG 4BTTB 8LPRA 2BX4A 1BBRK 3O8DA 1A3EH 1L1GA 3QTOH 2BD4A 2BLVA 4WVPE 3RXAA 1GI7B 4CH8B 2BD8A 4DGJA 1KXAA 4IS5A 1DLKB 1PPEE 3VB3A 1O30A 3LC5A 4AFSA 1HDTH 1G3BA 2Y6TA 3MWIU 2CN0H 3OYPA 1IOEA 2F3CE 2W5EA 5EXLA 1EB2A 1GJ7B 3B9FH 2PTCE 4KTUA 2A2XH 1EZSC 2H9HA 4IMQA 1AUTC 1CVWH 1DPOA 1DWCH 1P12E 4FU8A 2UWLA 5DP3A 3ATLA 1K9OE 2AERH 1YPEH 3BV9B 1IQGA 1C4V2 4BOHA 2FEQH 2TRMA 2ZECA 2R0LA 1QRWA 1O3OA 1XKBC 3TJNA 3OTJE 2B5TB 1GVLA 4KELA 4UFEH 4AB9A 1TRMA 3L33A 1J9CH 3FP8E 3L3TA 4OS7A 1W0YH 4CRGA 5DP4A 5K0HA 1BIOA 1H9HE 1KTSB 2WV4A 1QQ4A 5AFYH 4K60A 2AFQB 3QN7A 3B8JA 2J92A 1HIAA 3QZRA 1GGDB 4U32A 1D6RA 1AFQB 2G4TA 1ZGIA 3OY5U 2ZF0H 1AY6H 1C1QA 1DXPA 3M37A 1O5FH 1TOMH 2Y5GA 3ZZ5A 2BD3A 1TYNA 1O2QA 4I8LA 2R2WU 3M5NA 3U9AH 1T4VH 4DG4A 3PMAB 4GHTA 1H4WA 2ANYA 3ZVBA 2O8UA 3U69H 1TX6A 3URDA 1Y59T 4UDWH 4K8YA 1Z8GA 2ZU2A 4CBOA 2ANMH 3ELAH 1A0HB 3GDVA 1O33A 1S81A 2ZHDA 1HB0B 2BM2A 8GCHG 2ILNA 4XBBA 1LPZB 2SGQE 4Y7AA 2QGRA 4Y8YA 1DWEH 2R9PA 1XMNB 1D9IA 4AB8A 3UREA 1GHWH 1ETSH 1OWHA 5EXNA 1XXDA 2Q6DA 1IQKA 2WPMS 1UTMA 1D3QB 4Q2KA 2BDIA 2ZHFH 2W3KA 1O34A 3PWBA 1BHXF 1O2KA 4Y7BA 2WPIS 3A82A 4O3UA 1CT2E 1QBNA 3SGBE 1IQMA 2F9OA 5F8TA 1ZJDA 3A88A 1BMLA 1N1LA 3TH3H 1OWJA 2ZQ2A 3RMMH 1V2QT 1JRSA 3F9GA 2WUCA 3LGWA 4X2WA 1GBAA 3M36A 1GJ4H 1OS8A 1TRNA 1PQ7A 3E8LA 1WU1A 1OWIA 3QDZB 2A5KA 1Z6JH 3T27A 1QFKH 3DHKH 2W3IA 1BJUA 4J2YB 1NM6A 3OU0A 1OOKB 1ZYOA 1CBWC 1XUGA 2PKAA 1SQOA 1UTLM 2FOHA 1IQHA 4DVAU 2VIOA 3A7ZA 2PKSC 2OCVB 3KF2A 4B75A 1TA2A 1CHOF 3UWJH 3BTWE 2B8OH 3KCGH 3VB4A 2W7SA 1NN6A 2LPRA 4GSOA 4LZ1H 2GCHG 2JKHA 3TIUA 4NIYA 1QURH 1FXYA 1WUNH 1EZUC 4D7FA 3LU9B 1KXEA 5AVDA 1P8VC 3SI4H 3SNEA 1V2UT 4HZHA 1XUFA 4CR5A 1Q2WA 2PUXB 2M5TA 2TBSA 1GJ5H 1G3CA 5C20A 2ZTZA 1ZSJA 4YZUA 5C5NA 1V2KT 2J2UA 3SV7A 3BEIB 3A87A 4KTCA 4UFFH 2FOGA 3A7VA 3TNSA 1O2MA 1PPCE 1K1PA 1AQ7A 1THRH 3GCTG 2YNAA 1OWKA 2ZPRA 3ZZ7A 1T4UH 2RCEA 4I32A 3T5FH 5GWZA 3SU2A 2BHGA 4D76A 1O2XA 3RXIA 1ZMJA 2K1QA 3FP7E 1QB9A 3M5MA 4ZROA 1SGPE 1CGIE 1EAIA 3HKIB 4AFQA 2ODQA 4CRFA 1C1SA 1LTOA 5GIBA 4GAWA 2A4GA 4OGYA 1DLEA 1BCUH 4GCHG 2P93A 1RD3B 2FI5E 3PLKA 1JIRA 3MI4A 4ESTE 1TPOA 1C2DA 3KQCA 4CRBA 1TRYA 4ISHH 1DY8A 4DW2U 4E06H 1UCYE 3A86A 2WPKS 2CMYA 3EGKH 1Y3VA 1P2QA 3SV9A 1DT2A 4I8HA 5FPSA 5A8XA 1L4ZA 1KXCA 2R2MB 3U8OH 4AN7A 1BOQA 1BTUA 3EQ0H 1T8LA 1LVMA 1V2MT 4U01A 5H4IB 1Q3XA 1C2IA 4X2XA 1P04A 3E0PB 3MHWU 1CHGA 1RRKA 3KQDA 3O8CA 1UVTH 3ZZAA 5DKMA 7GCHF 4X8SH 4A92A 1QL8A 1YPKH 1GHBG 1GJ8B 1UTOA 1RXPA 5I46H 3DA9B 2P16A 1C5YB 2PV9B 3RLWH 5EQQA 5A09A 2B9LA 1ESBA 1GCTC 4NA9H 5DGJA 1G9IE 2ZCLP 5BRRE 1HBTH 1EAXA 1PJPA 3U98H 1K1JA 1UTNA 3W94A 1C2EA 1ZPCA 2BDHA 2G52A 3ZZDA 1GDNA 2VWOA 1SPJA 4YLUA 1UHBA 2PTNA 3A83A 2TGTA 3V7TA 2BXTH 1KXDA 4JK5A 5EU8A 4AG1A 3MNCA 1EOLA 4GHQA 2GGVB 5LGOA 3VB7A 1HJ9A 4YTAA 1C9PA 2BYAX 3AAVA 4LZ4B 3BG8A 5IYTA 1DS2E 1ZTLA 1PFXC 4ZKSU 2QV1A 3ITIA 3IG6B 3HKJB 5T6GA 4YOGA 2XBXA 1TX8A 2FO9A 2Q6GA 4GPGA 1RS0A 1C1WH 2VNTA 3GYLB 2OC7A 2XCFA 4NG9H 3SU6A 2FLBH 1QL7A 5I25A 1MBMA 5CHAB 4FUCA 1SLXB 2CHAC 4ZUHA 1FDPA 1GHYH 1S82A 3LKWA 4B2CA 1SSXA 3H5CB 3ZVFA 2OQUA 3KEEA 1MKXH 1QA0A 1H9IE 3AVZA 1XUJA 3BG4B 4JZDH 3UOPA 3VB5A 1BT7A 1C2FA 2BD5A 4O97A 2H5DA 2ZU5A 2ANWA 2ZPQA 4TY6A 5HM2A 1MU6B 2O8MA 4NIWA 3RXGA 1ANBA 2DE9A 1T8MA 5G4BA 3RMOH 3RXBA 3SU0A 1P2OA 1FIWA 1K1OA 5E2OA 1HJ8A 1LHEH 1E0FD 2FYRA 1VJAU 1F0UA 2G81E 4OS4A 4Y8ZA 1O3FA 4BXWA 4Y79A 2D8WA 1VITH 3SHAH 1O2RA 1A4WH 5AHGH 3ZYDA 3U1JB 3ZV9A 3ZVAA 2F9UA 3GCTF 1V3XA 2F9NA 3UTUH 1G36A 1EZXC 3TITA 3RXKA 5FCKA 1BTHH 1OXGA 1BRUP 1MAYA 2VH0A 2HOBA 4ISIH 1CA0B 1SGDE 1P01A 1MTNB 3C1KA 4WMEA 1QHRB 3STIA 3RU4T 2PW8H 4UFDH 1AKSB 1TABE 1RFNA 2GVFA 5JB9S 3SUEA 2FOCA 4GCHF 1O35A 1QB1A 1L1NA 3SJ8A 1O39A 3C27B 3EYDA 2ZO3H 3RC4A 1FV9A 3F9EA 1AZ8A 2P3FH 2XC4A 3FANA 1FIZA 1BMMH 1L2EA 1Y5UT 2BY9X 4GVUA 1GGDC 1AFQC 2ALVA 3RC5A 3GCOA 3GYMA 1E34B 4R8TB 5F8XA 4X8VH 2FWWA 1TPSA 1IQEA 2GMTB 2ZCKP 5FX6A 1O2WA 3BTME 3R0FA 2VIWA 4AYYB 4K1SA 3I77A 1P2JA 1YPMH 4E05H 3S9AA 1C2KA 5DP8A 1ANDA 5C2ZA 4E7RG 4X0WU 2HALA 1WAYB 2TPIZ 1EX3A 1TA6A 2P95A 3I29A 4IBLH 2SGEE 3SORA 3QTVH 1ETRH 1DVAH 2EI7A 4A6LA 3MO6A 2OUAA 4INKA 4YT6H 1H9LB 4WY3A 1RGQA 2CXVA 3SQEE 4XOJA 1V2NT 2LNCA 2OINA 2GCTB 1RTLA 4X6NA
chains in the Genus database with same CATH superfamily
1OSSA 1H1BA 3PLBA 4NCYA 1SR5C 2ZQ1A 2FM2A 2QE7D 1KIGH 5GPIB 3UFAA 4CHAC 4YM9A 1MTWA 5K7RA 1O3KA 3PB1E 1O32A 4JZIA 4ABGA 1A1RA 5FCRA 1MU8B 4A5TS 2EI8A 4QT8C 4ZKNU 1TGNA 3PWCA 1K1NA 1CQQA 1NRNH 1S6LA 1BBRE 2L74A 3PLPA 3TGJE 1IAUA 2VWMA 3NPSA 5GXPA 3SOSA 4INLA 2JDID 2J95A 1S84A 1O2VA 5DP7A 1BB0B 3RLYH 1ZTJA 2ZFPH 3K2UA 1GJDB 2XCNA 4GUXA 4WWYA 2BTCE 3UQVA 4Y0ZE 2PSXA 1CT4E 3QLPH 2Y5HA 2J5UA 5C1YA 3OX7U 1C1OA 1PPFE 2ZP0H 1GJCB 3QGJA 4B76A 2Y5FA 4F55A 2H5CA 1GI5A 1XUHA 3TPIZ 3M5OA 3NKKA 3RP2A 4J1YA 4Y0YE 4MPUA 1D4PB 2ZHEH 3S7KB 1SVPA 2BOHB 1XXFA 4ISNA 2AMQA 1DUAA 4X1NU 5F8ZA 3CP7A 4TSFD 1ELBA 3OTPA 1AGJA 1HRTH 2ALPA 3MOCA 4CREA 4BAHB 1PQ5A 2CF9H 1O37A 1O3NA 2ZC9H 3E1XB 3LH3A 4WMDA 4OS2A 1AE8H 1QR3E 4X1QU 4RI0A 2BY7X 3LJJA 2ZFTA 2BVSH 1O3HA 2GZ7A 3ZZ6A 4FUBA 1KYNA 3TK9A 1HAVB 3S69A 4YT7H 1HAGE 3GS9A 3P8GA 1NC6A 1C1PA 1ANCA 2FYQA 2ULLA 2BOKA 1O3IA 1RTKA 3P8OA 3ENSB 3RU4E 5A0AE 2Z7FE 3G01A 3LIWA 5GJ4B 1FPHH 1A2CH 1T32A 3RXHA 2BLOA 1V2TT 3GY5A 3A7TA 2HLCA 2HWLB 3KL6A 2F9PA 5FBEA 1ELAA 3OAAD 4IW4E 1YCPM 2QN5T 1N8OB 2JIZD 2C8WB 9ESTA 1RTFB 2G8TA 4NSVA 3T62A 2VWNA 4K1TA 6LPRA 1ZZZA 1CGJE 2XBYA 1AU8A 1MD7A 4NA7A 3WWBA 1ZMNA 3DD2H 5FHTA 1IQFA 1NU9A 4B6EA 5TJXA 4MPXA 2DUCA 1QY6A 3ATIA 3RU4D 5JB8S 2WUBA 3WWFA 1KSNA 4I33A 1TB6H 2A31A 2ZCHP 3TGIE 1GWAA 4X2VA 3VGCB 1H8IH 3E0NB 3ODFA 3NXPA 1L1JA 1D3PB 1TMUH 2IN2A 4D7GA 3GOVB 2FOMB 1EPTC 1C5OH 2FS9A 1YM0A 3V12A 4FETA 1ABJH 9LPRA 3Q3YA 1B0EA 1C1MA 3OE7D 2FIRH 1SGYE 1HXEH 4I86A 1HAYB 3E91A 1TPPA 4NSYA 5C5OA 4H6TA 3T28A 1TAWA 2RDLA 1NROH 1PYTC 2A0QB 1O3DA 1Z7KA 2W6ID 3SUDA 3RMLH 3UQOA 5JBBS 1XVOA 1VZQH 2A4QA 4ZKOU 2O8WA 2Z9LA 2UWOA 1AHTH 2Z3EA 1C5SA 3HATH 4MDSA 4FVDA 2BD9A 1KY9A 3MU1A 2VINA 3FZDA 4WMFA 1ZHPA 2SGFE 2Y81A 4ASHA 2OXSA 1BTWA 3PRBA 4X2YA 2BVRH 1O5DH 3M7QA 3ZZ4A 2A7CA 3LT3A 2G00A 2IJOB 4O9VA 5HM9A 1YLCA 3SGAE 1MTSA 3DSGA 2UUJB 4HFPB 2V7QD 2KAIB 2TGAA 1TMBH 4Q7YA 1YLDA 4O03A 1EPTA 1O2PA 1LKAA 1J8AA 4HGCA 3RC6A 5KGOA 3A8CA 1L4DA 2F83A 5CHAC 1YBWA 2EY4C 4DT7B 2FMJA 2HVXA 7GCHG 3F3BA 3E6PH 3LJOA 3RM2H 1QRZA 2P94A 2ZGXH 1VCQA 3BG4C 3LH1A 2B0FA 5CMXH 7KMEH 1Y3WA 4B1TA 1HAHH 2CGAA 2SFAA 1C2JA 1AVWA 4YOJA 1P03A 3SNBA 1C5NH 5EW1H 3P6ZB 4U30A 1RIWC 1QJ1B 2C8ZB 3MO3A 5T3HA 3GCHC 1MAXA 5FAHA 1KLJH 1O2NA 2FTMA 4FXGH 2Q1JA 1TONA 3ZZ9A 2GX4A 3I78A 1HPGA 1TNIA 1K1MA 5DN6D 1BJVA 2WYGA 3M7UA 1AB9B 5EG4A 4A1TA 4GLYA 3A89A 5C17A 2SNVA 5KECA 3GY6A 1A5GH 4AORA 2PP6A 4NWKA 4WXIA 1O2ZA 1S0RA 5DP9A 1G3EA 3A8AA 1MTNC 2Y7XA 1C5VA 3BTHE 1DY9A 6CHAB 1YPLH 1GHVH 1DFPA 1HXFH 1UVPA 4B2AA 2JH0D 2ZFRH 5DO4H 3MMGA 5CE1A 1JOUB 2FZZA 2H9TH 2O9QA 3W1EA 2WZQA 2HVYB 1TNJA 1ARBA 3A85A 1GMDF 5GNDA 2F9VA 3BN9A 3VB6A 3MNXA 1ZPZA 2VVUA 1W2KH 3BTGE 3M3SA 3UY9A 1LQEA 2OQ5A 1QJ6B 2EQNA 3PO1B 3GISB 3U28C 1EFRD 1P05A 1ZRKA 1Z1JA 2GMTC 1KLIH 1ELFA 4TWYA 1T7CA 2VGCB 1YF4A 3GY3A 1YGCH 4YLQH 2EI6A 3MNSA 1P2NA 2PSYA 2VB0A 1EZQA 1JBUH 2WHXA 2TIOA 1EJAA 2GV7A 1MH0A 1HYLA 1ZRBA 2ZIQH 1SLWB 2ZGBH 2ANKH 1NRPH 1W12U 4U2WA 3QK1A 2GCTC 1F0SA 1TNHA 2FOEA 5BPEA 1F0RA 1GHAF 2YOLA 1E1QD 2BDGA 1YPHE 1SQAA 1DM4B 3TH4H 1IQJA 3FZZA 3IWMA 3A7WA 4H4FA 3U1IB 1JMOH 1AIXH 4B6FA 3SJ9A 2BY5X 3SGQE 1GL0E 1LCYA 1UTJA 4MVNA 3BEUA 1GL1A 5LPRA 1HFDA 1HIAB 1C1VH 1AE5A 2EA3A 5C0UA 5A0BA 2Z3DA 1WQSA 4RSPA 3UAIC 1W7GH 3HPTB 3M3VA 4MNWA 1GBBA 1FAXA 1S0QA 2AEIH 1O3CA 1A7SA 2BQ6B 4MTBA 4P00A 1GJBB 4K5ZA 1O38A 5LPFA 1P06A 4TY7A 3V3MA 5EJLA 5L6NH 1S5SA 2J38A 2OBOA 2AH4X 3LGTA 3AW0A 5C3NA 1A5IA 3KNXA 4RT0A 1BMFD 4NZQA 3MTYA 3P70B 1AO5A 1TNLA 4BANB 3OY6U 1NFYA 4AOQA 4E7NA 2ZI2H 2SNWA 4M7GA 1C1RA 3SJOA 4K8BA 5HIYA 1P02A 2HNTC 2I6SA 2QF0A 4ZAEA 3F9FA 5AFZH 2Z9IA 5FBIA 1XUKA 5FPTA 3SJKA 4F4OC 5FX5A 5ABWA 1SHHB 2FI3E 5KEDA 1COWD 1IQLA 3OEHD 2HNTE 4B71A 1C9TA 4MNVA 3RUOA 2Q6FA 7LPRA 1UW7A 1GMHF 1ZSKA 3GICB 1XVMA 1KDQA 1JXPA 1LHGH 1V2JT 3UNRA 2BLWA 1C5ZB 4JYTA 1CO7E 2GT7A 4MLFB 3RXUA 3TJUA 5E2PA 1HLTH 1SHYA 2GDEH 4I8JA 1GBHA 1J16A 1W3CA 1GBJA 3SI3H 4VGCC 2VWLA 3SJIA 1NZQH 1AVGH 1DSTA 1O31A 3D65E 2OBQA 3BIVH 2GT8A 2PKAB 1P09A 2V0BA 5LH8A 1Y3XA 3GY2A 1BTPA 1TGBA 1V2OT 3Q3KA 3TK5A 5A8YA 8ESTE 5L2ZH 1N8OC 2UUFB 1TBQH 5GCHG 2VIVA 2WV9A 1TIOA 4DIHH 4MPWA 1C5TA 5E0JA 1YPJH 3ZZ8A 1D3DB 3MU4A 2CV3A 1Z1IA 1UCYK 4AGKA 1IQNA 1O3MA 3KHVA 2A4RA 1Y3UA 2PHBA 4TYDA 1V2LT 1E37B 2BDBA 5A8ZA 3Q3XA 1TX7A 2J97A 1SGCA 1OYTH 2GD4B 2IOTA 2AIPA 4X1PU 1SL3A 3VGCC 1HGTH 3MO9A 1C5XB 3MNBA 5EOKA 3DFJA 1D6WA 5EJZA 1DWDH 1QCPA 1ZHMA 3B23B 1WBGB 4Z0KA 3EA8A 4ZXXH 2CF8H 4F49A 4ACAA 1FAKH 1OP0A 1UK4A 1ZR0A 1LQDB 1C2MA 2HLDD 3AW1A 1Z8RA 1CGHA 4X6OA 1VGCB 1GHZA 1CE5A 1GI3A 2J34A 3K6YA 3RXQA 2AGIX 3CENA 1HAIH 2L6OA 1LPKB 1EP6A 5IDKA 2ZU4A 3P95A 4B2BA 1KMHB 5LPEA 2HRVA 3HGNA 3SNCA 1MKWH 1UO6A 1YC0A 1FZZA 3LPRA 3RXVA 2NU4E 4BTIB 1A3BH 2OC0A 4THNH 3SHCH 4KGAA 4MNXA 3Q00A 2JH6D 4ABBA 2O8TA 2V35A 3D23A 3WW7A 1VITG 1O2LA 4FUIA 1MKWK 1MTUA 4Y11E 4OM9A 3R3GB 1A0LA 1GJ9B 1EATA 1MQ5A 5JDUB 1G3DA 1FJSA 4X1RU 1GI9B 3HGPA 4LXBH 1GBEA 1V2ST 2GZ8A 1LPGB 3VXEH 1FY5A 1LHFH 2AIQA 2OK5A 1G30B 1T31A 4HI3A 4HG6A 4BAQB 1E79D 3SU4A 1ELEE 1ELVA 1PPZA 3TJOA 1AWHB 1LHDH 1UVOA 2XC0A 2QIQA 3LGYA 3MH7A 2PUQH 1JRTA 1UTKA 1Y3YA 3SNDA 3S0NA 1P3CA 1K22H 3S9CA 4MQAA 4UONA 1AI8H 2ZFQH 1QIXB 1TQ0B 4ZHAA 2ZKSA 2G5NA 3F2FA 3GDSA 3ZZCA 4UD9H 2FI4E 2B7DH 3SO3A 3RXCA 5B6OA 2RDEA 1TOCB 3ZVCA 1C5UA 1C2HA 2QXIA 1BRAA 1HAXB 1UHBB 1A0JA 2FS8A 4NA8A 4NZLA 3A7XA 4AFUA 1YYY1 1OP8A 2NWNA 2XC5A 2H2ZA 2UUYA 4YOIA 2VH6A 3A7YA 1AB9C 3ZZ3A 3TGKE 1EUFA 2G55A 2BD7A 3UB0A 5TCAA 1M9UA 1TNGA 3NCLA 1YPGH 2PGBB 4NGAH 1C1NA 3F1SB 3F0OA 1YCPH 2QAAA 2IPHA 2A1DB 2J98B 5GCHF 1WYKA 4LOYH 2V6NA 5F03A 1ZJKA 3VEQB 3DT0H 3V0XA 5JPMH 3N7DA 1Z6EA 1J17T 6CHAC 4WH6A 1EB1H 2ZGJA 1O3JA 4HTCH 1OX1A 3ZZBA 4A1XA 3E16B 1T8NA 3PTBA 1YCPK 2WINI 5DJ7A 2O8LA 3KGPA 1H8DH 1DOJA 2R0KA 2ZZUH 3TVJB 2P3UB 3SU5A 3UNQA 1YKTA 2BZ6H 1OPHB 2ZHQH 4D9QA 3N99A 1WCZA 1Y5AT 2BQ7B 4ISLA 1FY4A 1ZHRA 3GDUA 3D49H 2GDDA 1T8OA 3K6ZA 3T29A 1HCGA 1HAPH 4ZHMU 3A8BA 4H6SB 2VGCC 1EJMA 1W0ZU 1P9UA 2BY8X 3URCA 2J9NA 3EA7A 1X7AC 2A7HA 1EXFA 4WF8A 3ZVGA 4O3TA 1V2PT 1LMWB 4IN1A 1QA7A 1DICA 1O3BA 4JCNA 1DXWA 1NPMA 1F92A 3RXMA 4CRAA 1E35B 1S6FA 3H7OA 4IGDA 4ZH8A 1ANEA 1HAZB 3LGIA 4RKOB 2QF5A 1BTYA 2FX4A 2ZU1A 3VFEA 5DP5A 1BQYA 3BF6H 4ABJA 3S9BA 2AGGX 1P2IA 3MU0A 4IN2A 2FOFA 2BD2A 2OD3B 2Y7ZA 4DJZB 1TNKA 1GMDG 4YO9A 1ACBE 1ELCA 2ZDKA 4TT3D 2PR3A 1J15A 4WJG2 3SV8A 1BMAA 1GI4A 1VITF 4AYVB 4JZFH 4FU9A 1SLUB 4M9FA 3LOXA 1BTXA 2FOAA 1NT1A 1N6YA 1FY1A 3VXFH 1MCTA 1Y5BT 1P3EA 1ABIH 3KQ5A 4DURA 2HNTF 5L2YH 1WQVH 4NFFA 1E36B 4Y71A 1EAWA 2BLQA 3TJVA 5SGAE 1GJ6A 1TGTA 1SOTA 2XBVA 2P8OB 3RXPA 3SV6A 1C5MD 1NRSH 1NFUA 1NRRH 4SGAE 2ZFSA 1TGSZ 1BHXB 3UPEA 4Q7XA 3UOUA 2Z3CA 5DG6A 2HPQH 3F0PA 3EDXB 2NU1E 1AZZA 4XDEA 5EODA 5EW2H 3DCLA 1TALA 5EPNA 1UVUH 3PYHA 4JMYA 1MZDA 3GCNA 4BXSA 2TGDA 1GHAG 4NIVA 1LHCH 3UWIA 4A7IB 1BRBE 1WTHD 1ZMLA 2JH5D 1TBRH 1C5WB 2QC2A 2ZTXA 1U6QA 1SLVB 2P59A 3E90B 5E0GA 1GCDA 4H42U 4ZMAH 1GBIA 2A4OA 3SU3A 2RG3A 2Z9GA 1JIMA 5JBCS 1ELDE 3MH5A 2GZ9A 1ORFA 1OYQA 5ETXA 1OWEA 3PV2A 6ESTA 2YNBA 1BUIA 1O36A 3BTTE 2QF3A 1C5LH 4CRCA 3WY8A 1WV7H 3HK6B 4ASUD 4X8TH 1SFQB 4ABDA 5T6DA 1HJAB 2VIPA 3TLOA 3V13A 1FY8E 1PYTD 5HMAA 3M3TA 2ZGCA 3FAOA 4MG3A 1PPBH 1O2UA 1UVSH 4Y6DA 1ZPBA 5TCCA 1IHSH 1UJ1A 3RXLA 8KME2 1HNEE 5L30H 1ARCA 1GI2A 2FXRA 3MU5A 4Y10E 1V2RT 4B74A 3FP6E 1LKBA 1P57B 1CT0E 1GI8B 1SGFA 2AYWA 1XUIA 3H7TA 1V2WT 1TGCA 2ZDLA 2QYIA 1SQRA 1O3EA 4XRNA 1O5CB 2KM0A 4CHAB 1MTVA 4CR9A 4FVBA 3BTFE 2ODPA 4DIIH 1QL9A 2A7JA 4BAOB 1MABB 1THPB 3NK8A 4B73A 1QBOA 1O2JA 4FUDA 3P17H 2NU0E 3NUMA 3QO6A 1GVZA 4XD7D 2P3TB 2QY0B 4UEHH 2BQWB 1P10A 1GMHG 3M61U 1KXBA 1WTGH 4K69A 7ESTE 1AWFH 2SGAA 2ZU3A 1S83A 3ODDA 1NBME 4I7YH 2W7UA 3DSOA 1O5AB 3QX5H 1CA0C 2ESTE 1O2TA 1GPZA 2V3HH 3F68H 4FUEA 4FUJA 2OC8A 3RXOA 1C5QA 1GBTA 4YESB 2FX6A 2WV5A 1THSH 3SUGA 2RA0A 1ZSLA 1W11U 1AMHA 1BMNH 1L0ZA 2ZDNA 3BTDE 2XRCA 1B7XB 5JYIA 1VGCC 2C8XB 5J4QA 3T26A 3VG8A 4JZEH 2QXGA 1O2HA 1SFIA 5EQRA 4ABHA 5C0TA 2BB4A 3LC3A 3S7HB 4X6PA 1NU7B 3EAJA 3GY8A 1SI5H 1OWDA 4SGBE 1KLTA 1SOZA 2ZG0H 2ZTYA 3H09A 2H6MA 3DFLA 3W95A 1C5PA 1V2VT 1UTPA 4K3JA 1FONA 2VU8E 3ATKA 5HYOA 1SQTA 2YMSC 3PMBB 2ZA5A 3Q76A 1NBMD 1GBCA 3QGNB 1NS3A 1W0KD 2JETB 4D8NA 3A81A 1MCVA 1GJAB 3MFJA 1DDJA 1XKAC 1GG6B 1UK3A 1MZAA 1SGFG 2ZHWH 2NU2E 1ETTH 1MMJN 3VPKA 6GCHG 2OP9A 5JBTA 5T1VA 4LK4A 3TH2H 1F5LA 4ZCNA 4NIXA 1NFXA 2ZEBA 4ABIA 4UE7H 5JBAS 1F0TA 1MUEB 1D3TB 1O5EH 5DPAA 1HAOH 3ATMA 2H1UA 2PWXA 1GVKB 3UNSA 1YPHC 2PFEA 2Y80A 1AD8H 1SKYE 3MQKC 1GBFA 1VJ9U 1TBZH 4XFQA 5HGGA 1K2I1 3F2HA 3GY7A 3RDZA 3T2NA 1AKSA 3UR9A 1C1UH 4ZKRU 5AF9H 1A61H 4CH2B 1C5RA 2A45B 1ESAA 1FY3A 2BDCA 2VVCA 3ATWA 2XYAA 3SBKA 1K28D 4RKJB 5FPYA 1AVXA 1ZGVA 2YMSD 1EASA 1KXFA 3BTKE 2J94A 3ZYEA 2FPZA 1WDIA 3RM0H 1YP9A 1P0SH 2FP7B 2K8IA 1BITA 2G4UA 1O3LA 1G2LA 2NU3E 4XBDA 4TPYA 3TNTA 3DUXH 1FI8A 1CA8B 4R0IA 1Z8JB 3A80A 5EGMA 4IC5A 1G37A 1KTTB 1G32B 3MH6A 4UFGH 4YXWD 1DWBH 3U8TH 5PTPA 2GTBA 3RXEA 1O5BB 4ABAA 1FNIA 1BZXE 2D1JA 1QNJA 1EPTB 1F2SE 1N6XA 2K0QA 1E1RD 5A0CA 2XWBI 5EQSA 1WXRA 8GCHF 1MQ6A 4X8UH 2C90B 1W14U 1GI1A 2J4IA 3KQEA 1QTFA 4AFZA 1W0JD 3TU7H 1F7ZA 3FFGA 3CS0A 2AGEX 3A8DA 1P11E 1UMAH 3JZ1B 1TMTH 4JK6A 5J4SA 5DSFA 5C1UA 4F48B 3MU8A 3RXJA 2C4FH 3ZVDA 1SGRE 1GI6A 3EA9A 3CS7A 1FMGA 3MH4A 4KKDA 1IHTH 3PROA 3M35A 3KQBA 1AUJA 4BAKB 1CSOE 5CHBA 3P92A 2CJIA 5EXMA 4ABFA 1Y8TA 3PMHB 1G2MA 1OKXA 4ABEA 4IC6A 2XXLA 3K9XB 1HV7A 1ZTKA 3MYWA 1AFEH 3CNRA 3SN8A 2THFB 4BNRA 1C2GA 2STBE 1EQ9A 2I6QA 1UCYH 1Z71A 3RXRA 1QJ7B 2FDAA 4XBCA 5T6FA 3KIDU 2ZDAH 4DOQA 1IQIA 2BMGB 2SGDE 1GBKA 3FVFB 1W8BH 2WPDD 1ELGA 2F4LA 1EP5A 2GP9B 4FOUC 3E3TA 2GCHF 2GJGA 3BIUH 3BSQA 1GI0A 2XOKD 1B0FA 3A84A 1K1IA 2EEKA 2A5IA 2AHME 3UUZA 1DSUA 3ESTA 3EE0B 2ZDMA 2UWPA 6GCHF 3AK5A 3NZIA 4Q7ZA 2H9EH 1PPHE 2C93B 1GMCG 2Z94A 2QXHA 4FUGA 4MPVA 1HAVA 2WPHS 5EPYA 1MKXK 1RIWB 2FESH 3TK6A 3UR6A 4DCDA 4JYUH 3N7OA 2V3MA 1FLEE 3GCHB 3STJA 4TWWA 1ELTA 3SZNA 5ESTE 3F6UH 3RXDA 1SGTA 4AX9H 1SGQE 1HUTH 1DE7H 4K1EA 1EKBB 1O2SA 2AMDA 3IITA 3O8BA 1TPAE 1SB1H 2P8OC 4PROA 1JWTA 4ZHLU 1F5KU 2Y82A 1QRXA 2PLXA 1CBWB 1NTPA 2XBWA 5HXFA 3QUMP 1P9SA 2KZ4A 4RN6A 1NY22 2VVVA 1WOFA 1PQ8A 1A46H 2FLRH 2PKSB 5GDSH 1YWUA 4KTSA 4NWLA 2WPLS 2XW9A 2VJ1A 1ZOMA 2RA3A 1C4U2 1PPGE 3SQHE 1VCPA 4WH8A 2ZPSA 1GBMA 2VBCA 3LDXH 2BXUH 5C1XA 1EJNA 4BAMB 1TQ7B 1BA8B 2C8YB 1O3AA 1O2GH 1TLDA 4D9RA 1GHXH 1O2OA 5FXLA 2BX3A 1SGIB 4X6MA 3SW2B 3BTQE 5F6MA 2A2QH 3NWUA 1TWXB 1TFXA 2VIQA 1AN1E 4Q80A 5A2MH 1EAUA 2ZNKH 4ISOA 4Z6AH 3L6PA 1QGFA 1SC8U 1SMFE 1QQUA 1K1LA 4OS5A 1MD8A 2AMPA 2M2AA 1ESTA 1NESE 2OLGA 3RMNH 1HJAC 2A5AA 3F9HA 4IMZA 2HGTH 2KCYA 3BTEE 1H8ED 1SG8B 1E38B 4AG2A 2BDYA 2QXJA 2ZGHA 3LGVA 5ESBA 4X1SU 3K65B 4FUHA 1NRQH 1Z8IB 1NFWA 2KCOA 2F9BH 1W7XH 2ZFFH 4XE4A 1SGNE 4JYVH 2VIDA 3RXSA 3D62A 1GHBF 3PM3A 1VCWA 2GV6A 1J14A 2XTTB 1QB6A 4WXVA 1WSSH 2R3UA 1W13U 2V3OH 1FUJA 3SUFA 1F5RA 4Y76A 1GDQA 1FPCH 3PV4A 1FX0B 5E8EH 1DX5M 2BY6X 1FN6A 3PTNA 1XM1A 2XNIA 5DP6A 1BDAA 2UUKB 1DUEA 2C3SA 1VR1H 2D2DA 1SBWA 4I8KA 4TPIZ 1MBQA 4KP0A 2EC9H 2W26A 5E0HA 2BVXH 3P8NA 3GY4A 4XSKU 2F91A 1KDQB 1O0DH 1K21H 1OP2A 2KAIA 2ASUB 3M7TA 1C1TA 1DITH 2AS9A 1EOJA 1GBDA 4FU7A 2BDAA 2G5VA 4FUFA 3U8RH 1FQ3A 4Y8XA 3AAUA 4CRDA 3T25A 4K2YA 1QBVH 1LDTT 3N7EA 1S6HA 3ZVEA 2D26C 2A32A 1ZLRA 2BZAA 4MNYA 1H8HD 3LONA 1A5HA 1TE0A 1DANH 3Q77A 4OS6A 1RJXB 2Z6BD 2FTLE 3OSYA 4INHA 3P8FA 3FKSD 1O2YA 1FN8A 1UTQA 3QZQA 2ZDVH 1GCTB 2HPPH 1O3GA 1B5GH 1ID5H 2FOBA 1P2KA 3HK3B 1PQAA 1BRCE 1GDUA 3RXFA 1LVOA 3PO1C 4BTUB 1GMCF 4I31A 3KYFA 2QA9E 1Q31A 4OS1A 2DE8A 1CU1A 1W10U 5DK1A 3RXTA 2SGPE 5C67A 2JETC 1INCA 5FL7D 4Q4LA 3SV2H 3LGUA 1GG6C 3BEFB 5EIYA 2OTVA 2TGPZ 4NFEA 2GKVE 4DY7B 2JJ1D 2ODYB 2Z9JA 3KN2A 3SU1A 3QWCH 2Z9KA 1XX9A 4AZ2B 2PGQB 4JZ1A 1UK2A 3ZV8A 4Q63A 4A1VA 1LVYA 2STAE 1O5GH 4CBNA 2FODA 3KYGA 4AGJA 3JZ2B 1NO9H 2CHAB 4ZXYH 2WPJS 1BBRH 4VGCB 2R3YA 1LVBA 1BTZA 2XWAA 3FO8D 2QCYA 4OGXA 3PMJA 4I8GA 3SNAA 1LO6A 3AASA 1C2LA 2ZWLH 4DT4A 3M5LA 3O8RA 1O2IA 1O3PB 2OC1A 3UIRA 1P2MA 1S85A 1SGEE 2G51A 2WYJA 1GBLA 1V6DA 1C4Y2 1CHOG 4BTTB 8LPRA 2BX4A 1BBRK 3O8DA 1A3EH 1L1GA 3QTOH 2BD4A 2BLVA 4WVPE 3RXAA 1GI7B 4CH8B 2KX4A 2BD8A 4DGJA 1KXAA 4IS5A 1DLKB 1PPEE 3VB3A 1O30A 3LC5A 4AFSA 1HDTH 1G3BA 2Y6TA 3MWIU 2CN0H 3OYPA 1IOEA 2F3CE 2W5EA 5EXLA 1EB2A 1GJ7B 3B9FH 2PTCE 4KTUA 2A2XH 1EZSC 2H9HA 4IMQA 1AUTC 1CVWH 1DPOA 1DWCH 2RFKC 1P12E 4FU8A 2UWLA 5DP3A 3ATLA 1K9OE 2AERH 1YPEH 3BV9B 1IQGA 1C4V2 4BOHA 2FEQH 2TRMA 2ZECA 2R0LA 1QRWA 1O3OA 1XKBC 3TJNA 3OTJE 2B5TB 1GVLA 4KELA 4UFEH 4AB9A 1TRMA 3L33A 1J9CH 3FP8E 3L3TA 4OS7A 1W0YH 4CRGA 5DP4A 5K0HA 1BIOA 1H9HE 1KTSB 2WV4A 1QQ4A 5AFYH 4K60A 2AFQB 1OHHD 3QN7A 3B8JA 2J92A 1HIAA 3QZRA 1GGDB 4U32A 1D6RA 1AFQB 2G4TA 1ZGIA 3OY5U 2ZF0H 1AY6H 1C1QA 1DXPA 3M37A 1O5FH 1TOMH 2Y5GA 3ZZ5A 2BD3A 1TYNA 1O2QA 4I8LA 2R2WU 3M5NA 3U9AH 1T4VH 4DG4A 3PMAB 4GHTA 1H4WA 2ANYA 3ZVBA 4ACBA 2O8UA 3U69H 1TX6A 3URDA 1Y59T 4UDWH 4K8YA 1Z8GA 2ZU2A 4CBOA 2ANMH 3ELAH 1A0HB 3GDVA 1O33A 1S81A 2ZHDA 1HB0B 2BM2A 8GCHG 2ILNA 4XBBA 1LPZB 2SGQE 4Y7AA 2QGRA 4Y8YA 1DWEH 2R9PA 1XMNB 1VKYA 5EJ1A 1D9IA 4AB8A 3UREA 1GHWH 5B6LA 1ETSH 1OWHA 5EXNA 1XXDA 2Q6DA 1IQKA 2WPMS 1UTMA 1D3QB 4Q2KA 2BDIA 2ZHFH 2W3KA 1O34A 3PWBA 1BHXF 1O2KA 4Y7BA 2WPIS 3A82A 3DSPA 4O3UA 1CT2E 1QBNA 3SGBE 1IQMA 2F9OA 5F8TA 1ZJDA 3A88A 1BMLA 1N1LA 3TH3H 1OWJA 2ZQ2A 3RMMH 1V2QT 1JRSA 3F9GA 2WUCA 2KFWA 3LGWA 4X2WA 1GBAA 3M36A 1GJ4H 1OS8A 1TRNA 1PQ7A 3E8LA 1WU1A 1OWIA 3QDZB 2A5KA 3PRDA 1Z6JH 3T27A 1QFKH 3DHKH 2W3IA 1BJUA 4J2YB 1NM6A 3OU0A 2XNDD 1OOKB 1ZYOA 1CBWC 1XUGA 2PKAA 1SQOA 1UTLM 2FOHA 1IQHA 4DVAU 2VIOA 3A7ZA 2PKSC 2OCVB 3KF2A 4B75A 1TA2A 1CHOF 3UWJH 3BTWE 2B8OH 3F2GA 3KCGH 3VB4A 2W7SA 1NN6A 2LPRA 4GSOA 4LZ1H 2GCHG 2JKHA 3TIUA 4NIYA 1QURH 1FXYA 2KR7A 1WUNH 1EZUC 4D7FA 3LU9B 1KXEA 5AVDA 1P8VC 3SI4H 3SNEA 1V2UT 4HZHA 1XUFA 4CR5A 1Q2WA 2PUXB 2M5TA 2TBSA 1GJ5H 1G3CA 2LP6A 5C20A 2ZTZA 1ZSJA 4YZUA 5C5NA 1V2KT 2J2UA 3SV7A 3BEIB 3ZIAD 3A87A 4KTCA 4UFFH 2FOGA 3A7VA 3TNSA 1O2MA 1PPCE 1K1PA 1AQ7A 1THRH 3GCTG 2YNAA 1OWKA 2ZPRA 3ZZ7A 1T4UH 2RCEA 2LELA 4I32A 3T5FH 5GWZA 3SU2A 2BHGA 4D76A 1O2XA 4P02A 3RXIA 1ZMJA 2K1QA 3FP7E 1QB9A 3M5MA 4ZROA 1SGPE 1CGIE 1EAIA 3HKIB 4AFQA 2ODQA 4CRFA 1C1SA 1QZ8A 1LTOA 5GIBA 4GAWA 3FN8A 2A4GA 4OGYA 1DLEA 1BCUH 4GCHG 2P93A 1RD3B 2FI5E 3PLKA 1JIRA 3MI4A 4ESTE 1TPOA 1C2DA 3KQCA 4CRBA 1TRYA 4ISHH 1DY8A 4DW2U 5CDFE 4E06H 1UCYE 3A86A 2WPKS 2CMYA 3EGKH 1Y3VA 1P2QA 3SV9A 1DT2A 4I8HA 5FPSA 5A8XA 1L4ZA 1KXCA 5IK2D 2R2MB 2CK3D 3U8OH 4AN7A 1BOQA 1BTUA 3EQ0H 1T8LA 1LVMA 1V2MT 4U01A 2IJD1 5H4IB 1Q3XA 1C2IA 4X2XA 3OFND 1P04A 3E0PB 3MHWU 1CHGA 1RRKA 3KQDA 3O8CA 1UVTH 3ZZAA 5DKMA 7GCHF 4X8SH 4A92A 1QL8A 1YPKH 1GHBG 1GJ8B 1UTOA 1RXPA 5I46H 3DA9B 2P16A 1C5YB 2PV9B 3RLWH 5EQQA 4AC9A 5A09A 2B9LA 1ESBA 1GCTC 4NA9H 5DGJA 1G9IE 2ZCLP 5BRRE 1HBTH 1EAXA 1PJPA 3U98H 1K1JA 1UTNA 3W94A 1C2EA 1ZPCA 2BDHA 2G52A 3ZZDA 5F53A 1GDNA 4Z1MD 2VWOA 1SPJA 4YLUA 1UHBA 2PTNA 3A83A 2TGTA 3V7TA 2BXTH 1KXDA 4JK5A 5EU8A 4AG1A 3MNCA 1EOLA 4GHQA 2GGVB 5LGOA 3VB7A 1HJ9A 4YTAA 1C9PA 2BYAX 3AAVA 4LZ4B 3BG8A 5IYTA 1DS2E 1ZTLA 1PFXC 4ZKSU 1YY3A 2QV1A 3ITIA 3IG6B 3HKJB 5T6GA 4YOGA 2XBXA 1TX8A 2KCAA 2FO9A 2Q6GA 4GPGA 1RS0A 1C1WH 2VNTA 5HIZA 3GYLB 2OC7A 2XCFA 2J98A 4NG9H 3SU6A 2FLBH 1QL7A 5I25A 1MBMA 5CHAB 3OEED 1SLXB 2CHAC 4FUCA 4ZUHA 1FDPA 1GHYH 1S82A 3LKWA 4B2CA 1SSXA 3H5CB 3ZVFA 2OQUA 3KEEA 1MKXH 1QA0A 1H9IE 3AVZA 1YLNA 1XUJA 3BG4B 5HKKD 4JZDH 3UOPA 2KCPA 3VB5A 1C2FA 1BT7A 4RT1A 2BD5A 2IPQX 4O97A 2H5DA 2ZU5A 2ANWA 3SZEA 2ZPQA 4TY6A 5HM2A 1MU6B 2O8MA 3SYJA 4NIWA 3RXGA 1ANBA 2DE9A 1T8MA 5G4BA 3RMOH 3RXBA 3SU0A 1P2OA 1FIWA 5C94A 1K1OA 5E2OA 1HJ8A 1LHEH 1E0FD 2FYRA 1VJAU 3NRLA 1F0UA 2G81E 4OS4A 2F43B 4Y8ZA 1O3FA 4BXWA 4Y79A 2D8WA 1VITH 3SHAH 1O2RA 1A4WH 5AHGH 3ZYDA 3U1JB 3ZV9A 3ZVAA 2F9UA 3GCTF 1V3XA 2F9NA 3UTUH 1G36A 1EZXC 3TITA 3EE7A 3RXKA 5FCKA 1BTHH 1OXGA 1BRUP 1MAYA 2VH0A 2HOBA 4ISIH 1CA0B 1SGDE 1P01A 1MTNB 3C1KA 4WMEA 2WSSD 1QHRB 3STIA 2QF4A 3RU4T 2PW8H 4UFDH 1AKSB 1TABE 1RFNA 2GVFA 5JB9S 3SUEA 2FOCA 4GCHF 1O35A 2JJ2D 1QB1A 1L1NA 3SJ8A 1O39A 3C27B 3EYDA 2ZO3H 3RC4A 1FV9A 3F9EA 1AZ8A 2P3FH 2XC4A 3FANA 1FIZA 1BMMH 1L2EA 1Y5UT 2BY9X 4GVUA 1GGDC 1AFQC 2ALVA 3RC5A 3GCOA 3GYMA 1E34B 2YMSB 4R8TB 5F8XA 4X8VH 2FWWA 1TPSA 1IQEA 2GMTB 2ZCKP 5FX6A 1O2WA 3BTME 3R0FA 2VIWA 4AYYB 4K1SA 3I77A 1P2JA 1YPMH 4E05H 3S9AA 1C2KA 5DP8A 1ANDA 5C2ZA 4E7RG 3PV5A 1K0HA 4X0WU 2HALA 1WAYB 2TPIZ 1EX3A 1TA6A 2P95A 2W6JD 3FOAA 3I29A 4IBLH 2SGEE 3SORA 3QTVH 1ETRH 1DVAH 2EI7A 4A6LA 3MO6A 2OUAA 4INKA 4YT6H 1H9LB 4WY3A 1RGQA 2CXVA 3SQEE 4XOJA 1V2NT 2LNCA 2OINA 2GCTB 1RTLA 4X6NA
chains in the Genus database with same CATH topology
1OSSA 1H1BA 3PLBA 4NCYA 1SR5C 2ZQ1A 2FM2A 1KIGH 5GPIB 3UFAA 4CHAC 4YM9A 1MTWA 5K7RA 1O3KA 3PB1E 1O32A 4JZIA 4ABGA 1A1RA 5FCRA 1MU8B 4A5TS 2EI8A 4QT8C 4ZKNU 1TGNA 3PWCA 1K1NA 1CQQA 1NRNH 1BBRE 3PLPA 3TGJE 1IAUA 2VWMA 3NPSA 5GXPA 3SOSA 4INLA 2J95A 1S84A 1O2VA 5DP7A 1BB0B 3RLYH 1ZTJA 2ZFPH 3K2UA 1GJDB 2XCNA 4GUXA 4WWYA 2BTCE 3UQVA 4Y0ZE 2PSXA 1CT4E 3QLPH 2Y5HA 5C1YA 3OX7U 1C1OA 1PPFE 2ZP0H 1GJCB 3QGJA 4B76A 2Y5FA 2H5CA 1GI5A 1XUHA 3TPIZ 3M5OA 3NKKA 3RP2A 4J1YA 4Y0YE 4MPUA 1D4PB 2ZHEH 3S7KB 1SVPA 2BOHB 1XXFA 4ISNA 2AMQA 1DUAA 4X1NU 5F8ZA 3CP7A 1ELBA 1AGJA 1HRTH 2ALPA 3MOCA 4CREA 4BAHB 1PQ5A 2CF9H 1O37A 1O3NA 2ZC9H 3E1XB 3LH3A 4WMDA 4OS2A 1AE8H 1QR3E 4X1QU 2BY7X 3LJJA 2ZFTA 2BVSH 1O3HA 2GZ7A 3ZZ6A 4FUBA 1KYNA 3TK9A 1HAVB 3S69A 4YT7H 1HAGE 3P8GA 1NC6A 1C1PA 1ANCA 2FYQA 2ULLA 2BOKA 1O3IA 1RTKA 3P8OA 3ENSB 3RU4E 5A0AE 2Z7FE 3G01A 3LIWA 5GJ4B 1FPHH 1A2CH 1T32A 3RXHA 2BLOA 1V2TT 3GY5A 3A7TA 2HLCA 2HWLB 3KL6A 2F9PA 5FBEA 1ELAA 4IW4E 1YCPM 2QN5T 1N8OB 2C8WB 9ESTA 1RTFB 2G8TA 4NSVA 3T62A 2VWNA 4K1TA 6LPRA 1ZZZA 1CGJE 2XBYA 1AU8A 1MD7A 4NA7A 3DD2H 1ZMNA 5FHTA 1IQFA 1NU9A 5TJXA 4MPXA 2DUCA 1QY6A 3ATIA 3RU4D 5JB8S 2WUBA 1KSNA 4I33A 1TB6H 2A31A 2ZCHP 3TGIE 1GWAA 4X2VA 3VGCB 1H8IH 3E0NB 3ODFA 3NXPA 1L1JA 1D3PB 1TMUH 2IN2A 4D7GA 3GOVB 2FOMB 1EPTC 1C5OH 2FS9A 1YM0A 3V12A 1ABJH 9LPRA 3Q3YA 1B0EA 1C1MA 2FIRH 1SGYE 1HXEH 1HAYB 3E91A 1TPPA 4NSYA 5C5OA 4H6TA 3T28A 1TAWA 2RDLA 1NROH 1PYTC 2A0QB 1O3DA 1Z7KA 3SUDA 3RMLH 3UQOA 5JBBS 1XVOA 1VZQH 2A4QA 4ZKOU 2O8WA 2Z9LA 2UWOA 1AHTH 2Z3EA 1C5SA 3HATH 4MDSA 4FVDA 2BD9A 1KY9A 3MU1A 2VINA 3FZDA 4WMFA 1ZHPA 2SGFE 2Y81A 4ASHA 2OXSA 1BTWA 4X2YA 2BVRH 1O5DH 3M7QA 3ZZ4A 2A7CA 3LT3A 2G00A 2IJOB 4O9VA 5HM9A 1YLCA 3SGAE 1MTSA 2UUJB 4HFPB 2KAIB 2TGAA 1TMBH 4Q7YA 1YLDA 4O03A 1EPTA 1O2PA 1LKAA 1J8AA 4HGCA 3RC6A 3A8CA 1L4DA 2F83A 5CHAC 1YBWA 4DT7B 2FMJA 2HVXA 7GCHG 3E6PH 3LJOA 3RM2H 1QRZA 2P94A 2ZGXH 1VCQA 3BG4C 3LH1A 2B0FA 5CMXH 7KMEH 1Y3WA 4B1TA 1HAHH 2CGAA 2SFAA 1C2JA 1AVWA 4YOJA 1P03A 3SNBA 1C5NH 5EW1H 3P6ZB 4U30A 1RIWC 1QJ1B 2C8ZB 3MO3A 5T3HA 3GCHC 1MAXA 5FAHA 1KLJH 1O2NA 2FTMA 4FXGH 2Q1JA 1TONA 3ZZ9A 2GX4A 3I78A 1HPGA 1TNIA 1K1MA 1BJVA 2WYGA 3M7UA 1AB9B 5EG4A 4A1TA 4GLYA 3A89A 2SNVA 3GY6A 1A5GH 4AORA 4NWKA 4WXIA 1O2ZA 1S0RA 5DP9A 1G3EA 3A8AA 1MTNC 2Y7XA 1C5VA 3BTHE 1DY9A 6CHAB 1YPLH 1GHVH 1DFPA 1HXFH 1UVPA 4B2AA 2JH0D 2ZFRH 5DO4H 3MMGA 5CE1A 1JOUB 2FZZA 2H9TH 2O9QA 1TNJA 1ARBA 3A85A 1GMDF 2F9VA 3BN9A 3VB6A 3MNXA 1ZPZA 2VVUA 1W2KH 3BTGE 3M3SA 3UY9A 2OQ5A 1LQEA 1QJ6B 3PO1B 3GISB 1P05A 1ZRKA 1Z1JA 2GMTC 1KLIH 1ELFA 4TWYA 1T7CA 2VGCB 1YF4A 3GY3A 1YGCH 4YLQH 2EI6A 3MNSA 1P2NA 2PSYA 2VB0A 1EZQA 1JBUH 2TIOA 1EJAA 2GV7A 1MH0A 1HYLA 1ZRBA 2ZIQH 1SLWB 2ZGBH 2ANKH 1NRPH 1W12U 4U2WA 3QK1A 2GCTC 1F0SA 1TNHA 2FOEA 5BPEA 1F0RA 1GHAF 2YOLA 2BDGA 1YPHE 1SQAA 1DM4B 3TH4H 1IQJA 3FZZA 3IWMA 3A7WA 4H4FA 3U1IB 1JMOH 1AIXH 3SJ9A 2BY5X 3SGQE 1GL0E 1LCYA 1UTJA 4MVNA 3BEUA 1GL1A 5LPRA 1HFDA 1HIAB 1C1VH 1AE5A 2EA3A 5A0BA 2Z3DA 1WQSA 4RSPA 1W7GH 3HPTB 3M3VA 4MNWA 1GBBA 1FAXA 1S0QA 2AEIH 1O3CA 1A7SA 2BQ6B 4MTBA 1GJBB 4K5ZA 1O38A 5LPFA 1P06A 4TY7A 3V3MA 5L6NH 1S5SA 2J38A 2OBOA 2AH4X 3LGTA 3AW0A 5C3NA 1A5IA 3KNXA 4NZQA 3MTYA 3P70B 1AO5A 1TNLA 4BANB 3OY6U 1NFYA 4AOQA 4E7NA 2ZI2H 2SNWA 4M7GA 1C1RA 3SJOA 4K8BA 1P02A 2HNTC 2I6SA 2QF0A 4ZAEA 3F9FA 5AFZH 2Z9IA 5FBIA 1XUKA 5FPTA 3SJKA 4F4OC 5FX5A 5ABWA 1SHHB 2FI3E 1IQLA 2HNTE 4B71A 1C9TA 4MNVA 3RUOA 2Q6FA 7LPRA 1GMHF 1ZSKA 3GICB 1XVMA 1KDQA 1JXPA 1LHGH 1V2JT 3UNRA 2BLWA 1C5ZB 4JYTA 1CO7E 2GT7A 4MLFB 3RXUA 3TJUA 5E2PA 1HLTH 1SHYA 2GDEH 4I8JA 1GBHA 1J16A 1W3CA 1GBJA 3SI3H 4VGCC 2VWLA 3SJIA 1NZQH 1AVGH 1DSTA 1O31A 3D65E 2OBQA 3BIVH 2GT8A 2PKAB 1P09A 2V0BA 5LH8A 1Y3XA 3GY2A 1BTPA 1TGBA 1V2OT 3Q3KA 3TK5A 5A8YA 8ESTE 5L2ZH 1N8OC 2UUFB 1TBQH 5GCHG 2VIVA 1TIOA 4DIHH 4MPWA 1C5TA 5E0JA 1YPJH 3ZZ8A 1D3DB 3MU4A 2CV3A 1Z1IA 1UCYK 4AGKA 1IQNA 1O3MA 3KHVA 2A4RA 1Y3UA 2PHBA 4TYDA 1V2LT 1E37B 2BDBA 5A8ZA 3Q3XA 1TX7A 1SGCA 1OYTH 2GD4B 2IOTA 2AIPA 4X1PU 1SL3A 3VGCC 1HGTH 3MO9A 1C5XB 3MNBA 5EOKA 3DFJA 1D6WA 1DWDH 1QCPA 1ZHMA 3B23B 1WBGB 4Z0KA 3EA8A 4ZXXH 2CF8H 4F49A 1FAKH 1OP0A 1UK4A 1ZR0A 1LQDB 1C2MA 3AW1A 1Z8RA 1CGHA 4X6OA 1VGCB 1GHZA 1CE5A 1GI3A 2J34A 3K6YA 3RXQA 2AGIX 3CENA 1HAIH 1LPKB 1EP6A 5IDKA 2ZU4A 3P95A 4B2BA 5LPEA 2HRVA 3HGNA 3SNCA 1MKWH 1UO6A 1YC0A 1FZZA 3LPRA 3RXVA 2NU4E 4BTIB 1A3BH 2OC0A 4THNH 3SHCH 4KGAA 4MNXA 3Q00A 2JH6D 4ABBA 2O8TA 2V35A 3D23A 1VITG 1O2LA 4FUIA 1MKWK 1MTUA 4Y11E 3R3GB 1A0LA 1GJ9B 1EATA 1MQ5A 5JDUB 1G3DA 1FJSA 4X1RU 1GI9B 3HGPA 4LXBH 1GBEA 1V2ST 2GZ8A 1LPGB 3VXEH 1FY5A 1LHFH 2AIQA 1G30B 1T31A 4HI3A 4BAQB 3SU4A 1ELEE 1ELVA 1PPZA 3TJOA 1AWHB 1LHDH 1UVOA 2XC0A 2QIQA 3LGYA 3MH7A 2PUQH 1JRTA 1UTKA 1Y3YA 3SNDA 3S0NA 1P3CA 1K22H 3S9CA 4MQAA 4UONA 1AI8H 2ZFQH 1QIXB 1TQ0B 4ZHAA 2ZKSA 2G5NA 3GDSA 3ZZCA 4UD9H 2FI4E 2B7DH 3SO3A 3RXCA 5B6OA 1TOCB 3ZVCA 1C5UA 1C2HA 2QXIA 1BRAA 1HAXB 1UHBB 1A0JA 2FS8A 4NA8A 4NZLA 3A7XA 4AFUA 1YYY1 1OP8A 2NWNA 2XC5A 2H2ZA 2UUYA 4YOIA 2VH6A 3A7YA 1AB9C 3ZZ3A 3TGKE 1EUFA 2G55A 2BD7A 5TCAA 1M9UA 1TNGA 3NCLA 1YPGH 2PGBB 4NGAH 1C1NA 3F1SB 1YCPH 2QAAA 2IPHA 2A1DB 5GCHF 1WYKA 4LOYH 2V6NA 5F03A 1ZJKA 3VEQB 3DT0H 3V0XA 5JPMH 1Z6EA 1J17T 6CHAC 4WH6A 1EB1H 2ZGJA 1O3JA 4HTCH 1OX1A 3ZZBA 4A1XA 3E16B 1T8NA 3PTBA 1YCPK 2WINI 5DJ7A 2O8LA 3KGPA 1H8DH 1DOJA 2R0KA 2ZZUH 3TVJB 2P3UB 3SU5A 3UNQA 1YKTA 2BZ6H 1OPHB 2ZHQH 4D9QA 1WCZA 1Y5AT 2BQ7B 4ISLA 1FY4A 1ZHRA 3GDUA 3D49H 2GDDA 1T8OA 3K6ZA 3T29A 1HCGA 1HAPH 4ZHMU 3A8BA 4H6SB 2VGCC 1EJMA 1W0ZU 1P9UA 2BY8X 3URCA 2J9NA 3EA7A 1X7AC 2A7HA 1EXFA 4WF8A 3ZVGA 4O3TA 1V2PT 1LMWB 4IN1A 1QA7A 1DICA 1O3BA 4JCNA 1DXWA 1NPMA 1F92A 3RXMA 4CRAA 1E35B 1S6FA 3H7OA 4IGDA 4ZH8A 1ANEA 1HAZB 3LGIA 4RKOB 1BTYA 2FX4A 2ZU1A 3VFEA 5DP5A 1BQYA 3BF6H 4ABJA 3S9BA 2AGGX 1P2IA 3MU0A 4IN2A 2FOFA 2BD2A 2OD3B 2Y7ZA 4DJZB 1TNKA 1GMDG 4YO9A 1ACBE 1ELCA 2ZDKA 2PR3A 1J15A 4WJG2 3SV8A 1BMAA 1GI4A 1VITF 4AYVB 4JZFH 4FU9A 1SLUB 3LOXA 1BTXA 2FOAA 1NT1A 1N6YA 1FY1A 3VXFH 1MCTA 1Y5BT 1P3EA 1ABIH 4DURA 2HNTF 5L2YH 1WQVH 4NFFA 1E36B 4Y71A 1EAWA 2BLQA 3TJVA 5SGAE 1GJ6A 1TGTA 1SOTA 2XBVA 2P8OB 3RXPA 3SV6A 1C5MD 1NRSH 1NFUA 1NRRH 4SGAE 2ZFSA 1TGSZ 1BHXB 3UPEA 4Q7XA 3UOUA 2Z3CA 5DG6A 2HPQH 3EDXB 2NU1E 1AZZA 4XDEA 5EODA 5EW2H 1TALA 5EPNA 1UVUH 3PYHA 4JMYA 1MZDA 3GCNA 4BXSA 2TGDA 1GHAG 4NIVA 1LHCH 3UWIA 4A7IB 1BRBE 1WTHD 1ZMLA 2JH5D 1TBRH 1C5WB 2QC2A 2ZTXA 1U6QA 1SLVB 2P59A 3E90B 5E0GA 1GCDA 4H42U 4ZMAH 1GBIA 2A4OA 3SU3A 2RG3A 2Z9GA 1JIMA 5JBCS 1ELDE 3MH5A 2GZ9A 1ORFA 1OYQA 5ETXA 1OWEA 6ESTA 2YNBA 1BUIA 1O36A 3BTTE 2QF3A 1C5LH 4CRCA 3WY8A 1WV7H 3HK6B 4X8TH 1SFQB 4ABDA 5T6DA 1HJAB 2VIPA 3TLOA 3V13A 1FY8E 1PYTD 5HMAA 3M3TA 2ZGCA 3FAOA 4MG3A 1PPBH 1O2UA 1UVSH 4Y6DA 1ZPBA 5TCCA 1IHSH 1UJ1A 3RXLA 8KME2 1HNEE 5L30H 1ARCA 1GI2A 2FXRA 3MU5A 4Y10E 1V2RT 4B74A 3FP6E 1LKBA 1P57B 1CT0E 1GI8B 1SGFA 2AYWA 1XUIA 3H7TA 1V2WT 1TGCA 2ZDLA 2QYIA 1O3EA 1O5CB 4CHAB 1MTVA 4CR9A 4FVBA 3BTFE 2ODPA 4DIIH 1QL9A 2A7JA 4BAOB 1THPB 3NK8A 4B73A 1QBOA 1O2JA 4FUDA 3P17H 2NU0E 3NUMA 3QO6A 1GVZA 2P3TB 2QY0B 4UEHH 2BQWB 1P10A 1GMHG 3M61U 1KXBA 1WTGH 4K69A 7ESTE 1AWFH 2SGAA 2ZU3A 1S83A 3ODDA 4I7YH 2W7UA 1O5AB 3QX5H 1CA0C 2ESTE 1O2TA 1GPZA 2V3HH 3F68H 4FUEA 4FUJA 2OC8A 3RXOA 1C5QA 1GBTA 4YESB 2FX6A 2WV5A 1THSH 3SUGA 2RA0A 1ZSLA 1W11U 1AMHA 1BMNH 1L0ZA 2ZDNA 3BTDE 2XRCA 1B7XB 5JYIA 1VGCC 2C8XB 5J4QA 3T26A 4JZEH 2QXGA 1O2HA 1SFIA 5EQRA 4ABHA 2BB4A 3LC3A 3S7HB 4X6PA 1NU7B 3EAJA 3GY8A 1SI5H 1OWDA 4SGBE 1KLTA 1SOZA 2ZG0H 2ZTYA 2H6MA 3DFLA 3W95A 1C5PA 1V2VT 1UTPA 4K3JA 1FONA 2VU8E 3ATKA 5HYOA 1SQTA 3PMBB 2ZA5A 3Q76A 1GBCA 3QGNB 1NS3A 2JETB 4D8NA 3A81A 1MCVA 1GJAB 3MFJA 1DDJA 1XKAC 1GG6B 1UK3A 1MZAA 1SGFG 2ZHWH 2NU2E 1ETTH 1MMJN 3VPKA 6GCHG 2OP9A 5JBTA 4LK4A 3TH2H 1F5LA 4NIXA 1NFXA 2ZEBA 4ABIA 4UE7H 5JBAS 1F0TA 1MUEB 1D3TB 1O5EH 5DPAA 1HAOH 3ATMA 2H1UA 2PWXA