2IN3A

Crystal structure of a putative protein disulfide isomerase from nitrosomonas europaea
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
204
Chain Sequence
b'EKPVLWYIADPMCSWCWGFAPVIENIRQEYSAFLTVKIMPGGTNTPLLPEKRAQILHHWHSVHITTGQPFTFENALPEGFIYDTEPACRGVVSVSLIEPEKVFPFFAAIQRAFYVGQEDVAQLAILKKLAVDLGIPESRFTPVFQSDEAKQRTLAGFQRVAQWGISGFPALVVESGTDRYLITTGYRPIEALRQLLDTWLQQHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of a putative protein disulfide isomerase from Nitrosomonas europaea
rcsb
source organism Nitrosomonas europaea
molecule tags Isomerase
total genus 63
structure length 204
sequence length 208
ec nomenclature
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.60 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 putative protein disulfide isomerase domain 2in3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2in3A01
2OBKA 3DGQA 1J0FA 3RHBA 3CSIA 4YAPA 2WFCA 2BTOT 1SKRB 4JEDA 1XWKA 4AGSA 1XWGA 1TI3A 3EURA 3DD3A 3HZ8A 3RHCA 2H01A 3K8NA 4MF7A 2CZ2A 4N0ZA 1FW1A 1J9BA 5IO2A 1FB6A 5J41A 3KP9A 3LORA 1MDJA 2YANA 3NIVA 4ZIJA 4Q5QA 3TKRA 1M9BA 2FWEA 14GSA 4MCUA 2RLIA 2JZRA 4JR6A 3ZLPA 5IOXA 5CRWA 1BX9A 3VWVA 4KDUA 5D9TA 1PN9A 2NBSA 2CAIA 1HYUA 4RQXA 2C3QA 4PNFA 3W6GA 2ES7A 3GUSA 2JZSA 4EE0A 5D93A 2HT9A 4N0VA 5DCHA 4CDOA 2C3TA 2F8AA 5ECOB 4ML6A 4OCFA 3QPMA 1U3IA 2G0FA 3DEXA 4F03A 4FH8A 4ZBDA 1B4PA 2DJ2A 2E2MA 5JCGA 1R5PA 2CA8A 3IC4A 4GSTA 3CSHA 4F0CA 3O3TA 1GLQA 4O7HA 2AUVA 2MMNA 3EC3A 2V32A 5ID2B 3D6IA 4YQVA 1Z6MA 2DJ1A 4GSSA 3TCOA 3F4TA 3O6TA 4WR4A 1SL0B 2DMMA 5KN2A 2FD3A 1PSQA 4DSRA 4OO5A 3FR9A 1O8WA 1OC9A 2HSYA 1AW9A 3GKMA 2JSYA 4JZQA 2KHPA 1F6MC 1M2DA 2DIZA 2H6ZA 2WRTA 2ZUPA 4ZXGA 2H8LA 3Q18A 1B9YC 3IAS2 2I3YA 1WE0A 4F0BA 2L6DA 3F6FA 4JBBA 4H86A 2GVPA 5J9BA 4POKA 3GRXA 4OFTA 4Z7XA 2N5AA 2QC7A 3VI5A 2B3SA 6GSTA 2RUEA 3C7MA 4BVYA 1BQ7A 5LNKe 3IAM2 1R26A 3GX0A 1VF4A 2C8UA 4EL1A 3VK9A 5C04A 2LQQA 4NXIA 4XS1A 1JZRA 4L0WA 3ZYWA 3GKKA 5DCGA 2PUKC 4NV5A 3CBUA 5B6NA 3GH9A 4PURA 2VL2A 1ZYQB 1XBSA 2YCDA 2B7KA 1V9WA 1PRXA 2LQOA 2C3NA 3FKFA 8GSSA 11GSA 2IMKA 1PGTA 3KMNA 3PGTA 3WT2A 1O8XA 2JL4A 5CRGA 1QUWA 4G10A 2V41A 3LG6A 3BCKA 1WJKA 4DSSA 2AHEA 3DVXA 1GNEA 3WGDA 2VM2A 1W4VA 2CVBA 1OC9B 3PH9A 3Q19A 2FWHA 3VPTA 2LRNA 1F37A 3W8JA 2JSZA 4HI7A 3C8EA 4PUAA 5EPFA 5LD0A 4XS4A 2WGRA 3IOSA 2YV7A 2MMZA 4ZBAA 3BJ5A 3LSZA 5G5FA 1SYRA 5EY6A 1XPVA 1WMJA 1T8EB 1Q98A 2VOCA 1EWXA 3TGZA 4L5OA 5IMVA 2B1LA 4MF5A 1IYHA 3TKPA 1YKCA 2RM5A 4GQCA 1WPIA 4YH2A 5DQSA 1K0AA 2HZFA 3TOTA 5F8BA 4TR0A 2F9SA 1BAYA 1U87A 2XPDA 4ECCA 4K0GA 3E9JB 4MP4A 5LCZA 1Z6NA 2VD0A 2YWIA 1YKAA 4GQFA 4IP6A 4MJAA 1FAAA 4ILFA 2VCZA 5EVOA 4XS6A 2H0HA 3LEFA 1NSWA 1ZCPA 2VIMA 1T4ZA 5IQYA 1A24A 1GLPA 5KN0A 2L6CA 4KB3A 2H1BA 4TXOB 1M2AA 1NHOA 1EGRA 2H6XA 1EOGA 2FA8A 4FYCA 3ZREA 3UVHA 4WXTA 3H8QA 6GSWA 2IMEA 4ML1A 2DMLA 2P5QA 1YEPA 1TKDB 5E59A 3WYWA 2EIOA 4NAXA 2QGVA 4NPBA 3ZTLA 2GSRA 4XS4B 1AAZA 2XPEA 1OAZA 5F07A 4KCEA 3DYRA 1SJIA 4GTUA 4MZBA 3C71A 2AJQB 16GSA 1AC1A 2MMOA 3D4TA 3TKSA 5JCUA 3ZMLA 5INYA 2GZZA 1TI1A 4G19A 4FIWA 1XW5A 1OKTA 1PL1A 2P31A 2GQLA 2DC5A 6GSYA 2VCXA 13GSA 3RPNA 1X5CA 4KW6A 2H66A 4EDYA 4DSQA 3HYPA 3GSSA 4KDXA 4HZ4A 3L0HA 2LEGA 4KX4A 4HDEA 6GSSA 4K7OA 4TOPA 3LFLA 3F0IA 3QAGA 1V58A 1LJRA 5IPGA 3M0FA 2NVLA 1E2YA 2YPMA 3HVSA 6GSUA 1PKZA 4AJ8A 3GURA 4DEJA 4TRXA 3TJKA 2HRFA 3F6DA 2C1YA 4JU5A 1BEDA 3U6VA 2C4JA 2C0DA 2M80A 5ECSA 1V57A 4MZCA 1J08A 5G31A 1ON4A 2ON5A 1TRVA 4ID0A 3HY2A 3IK9A 2FA4A 5A4WA 3S9FA 2B1KA 2LRTA 2CQ9A 3VPQA 1YQ1A 2Z9SA 1Y6EA 4V2MA 3IA1A 2DBCA 4OFMA 5DVBA 3TRPA 3CMIA 3GX8A 5JCWA 1ABAA 4GWRA 1F2EA 2V6KA 5DQYA 2ON7A 1UN2A 1Z5YE 2WULA 3KCMA 4MA9A 5IMFA 2PMTA 2O8VB 3CYNA 1U6TA 3ISOA 5CRHA 2F3MA 1WRYA 2WJUA 1VF2A 1ST9A 2H75A 4KSMA 4MPFA 3ZRDA 2RUFA 1OVNA 3A2WA 3BD2A 1QQ2A 3M9JA 3KM6A 1HNBA 1B4QA 1XW6A 1MTCA 3BCIA 1ZZYA 3RAZA 2JU5A 4LA1A 1VRSD 3L9UA 3FZAA 1TK0B 3R2QA 2R5GA 3GN3A 2XBQA 3L78A 2N5BA 3M8NA 3DRNA 4BWSA 2K18A 3D0ZA 4IS0A 1QFNA 4OWYA 4TR4A 2VD1A 3IPZA 4L5LA 2OADA 1V40A 2ZCTA 4LLRA 3CXGA 4POLA 3G9BA 5EL8A 4Q5FA 4N30A 1EP7A 3HJOA 2AYTA 1LU4A 4ZB9A 2BJXA 1KEBA 2M72A 4HEA2 2L4QA 1GUHA 2IFQA 1GSSA 3TDGA 5KN1A 3HCZA 1V98A 2PVQA 4IQ1A 1FVKA 3VLNA 1WIKA 3VFIA 2O85A 5ID2A 1B48A 2D2ZA 1I9DA 5CO3A 2GLRA 4POBA 3I69A 4TR3A 3FR6A 3LXZA 5DJMA 3IR4A 1R5AA 2FLSA 2PERA 4NHWA 3P8WA 4HOJA 1ERUA 3EU4A 3AY8A 3PINA 4XTSA 3LYPA 3HVXA 2PVOC 5FT3A 4HU9A 2HXKA 5J3RA 3F4RA 1A2JA 2AAWA 3WD6A 1ERWA 1TU7A 3M1GA 4K1FA 4ECIA 3MSZA 2I4AA 5D9WA 4MH3A 3CSJA 2P0GA 2HI7A 5GAND 3HHVA 5IO0A 1Z7RA 1O7UA 2IN3A 2B5YA 4K9ZA 1OE8A 3J7Yb 2H76A 3A3TA 2I9HA 1YF0A 5AISA 3DXBA 2KUCA 2H73A 4GLTA 2KP2A 1K3YA 4PX1A 1OE7A 3PR8A 2IFQB 1VF3A 3GFKA 4LMWA 3J7Yk 3GIXA 4F82A 2XHFA 3GV1A 3UJ1A 2K8SA 2LNTA 4YQMA 1SKWB 1Z3EA 4LL4B 2VL2C 1SKSB 2ALBA 3KH9A 3IE3A 10GSA 1O85A 2AB6A 4K7IA 4OMVA 3ZFLA 1AIUA 1Y25A 2H1DA 4I8BA 3BOAA 3UMAA 4L8EA 3M3MA 5D73A 12GSA 1IYIA 4ZBBA 4PQHA 3I43A 4LMVA 2E7PA 2JACA 1S3AA 3UBKA 5G1KA 1TJDA 1GWCA 2VLVA 3P2AA 1MEKA 1F9MA 4PUFC 4ZILA 2HSHA 3VWWA 2HRNA 1K0OA 5AN1A 3E3EA 4NV2A 2IWTA 1WOUA 1XZOA 3ME8A 4RI6A 3ME7A 4TKYA 4X43A 2CV4A 2E2GA 1S3CA 2OE3A 3FK8A 3Q74A 1VGLA 5A4UA 4MMMA 1G7OA 1F3AA 1G6WA 1TRWA 3EMXA 5ECPB 2YOIA 3G7YA 1DUGA 4O5RA 1ZL9A 2C0GA 4TXOA 1K0NA 2KOKA 3KTLA 3ZIVA 1QXHA 4KUNA 3Q6OA 4LL1B 4HU7A 3UEMA 2FY6A 2DIYA 2R6KA 3TKQA 1TK8B 3IDVA 1A0RP 3GA4A 4XIHA 1FOVA 5COHA 5H5QA 2DSAA 3GTUB 2YJHA 1H75A 1SK1A 2YWOA 4AJ7A 3TJJA 1NM3A 5D9VA 1DE1A 1LBKA 3RDWA 1GSDA 4WBJA 4HS1A 4EDZA 3IRAA 1X9MB 1JLWA 3BBYA 4XRDA 4TN8A 4G9HA 1X5DA 1GSFA 4J56E 1T4YA 2K8VA 3FZ5A 3IBHA 4WF4A 4ZB8A 3TJFA 1T3BA 1MD3A 19GSA 5ABRA 4CHSA 3TKSC 1FVJA 1XW9A 4YQUA 3A5WA 1GUKA 4G2EA 2VCWA 3O76A 2DJKA 1GSUA 1XWCA 1AQWA 4ISDA 4ULXA 2FHEA 3NZNA 1ZGNA 4V2LA 5AIVA 2X8GA 3QCPA 2OJLA 4HQSA 1JZWA 3E0UA 3TKSE 4X0XA 2GSSA 1TRUA 2VUPA 3GKXA 4I5QA 2YWMA 2VAFA 2HE3A 1UC7A 2LUSA 5IM9A 4J57E 5CYYA 2IJYA 2BMXA 2LJAA 3V1WA 4MF6A 1THOA 3HA9A 2L59A 1TW9A 1RW1A 4KAEA 2PWJA 2VCVA 5JWQB 1B8XA 2LJRA 4FYBA 5HFKA 4IN0A 3LWAA 1RK4A 1SL1B 3WGEA 4KH7A 2PBJA 22GSA 1EOHA 2GT5A 2VM1A 3JCML 1NW2A 2X8CA 3GH6A 2DLXA 4IHUA 2LKUA 4EC0A 1YF1A 2EIQA 1U3AA 4PNGA 1GH2A 5KN3A 1ZMAA 2XC2A 1TU8A 1MDKA 2IMIA 4IJIA 2I81A 4MLYA 4F9ZA 2DJ3A 2A4VA 4EUYA 3HVVA 4KNDA 1TOFA 2OKAA 2MBTA 2C0FA 4IKHA 1PX7A 2R2JA 4ZL9A 4IP1A 1M7TA 1YY7A 4TW5A 1BJXA 3GKNA 3IHQA 4L0UA 2IMDA 1XXUA 2WS2A 3EWLA 1BYEA 1G0TA 3ZVJA 4D73A 3MWHA 3UL3A 3EU3A 4RUVA 5GZZB 3L9VA 2GGTA 3I6AA 3GSTA 1A23A 1X9WB 3GNJA 1T00A 4JRRA 2MZCA 5J9CA 1ACVA 5IMDA 2R3XA 1OKDA 1SL2B 4RI7A 3FR3A 4BL7A 1JFUA 1AQVA 2OBIA 2P5RA 4EO3A 2RIIA 1GTAA 4V1Ag 3KP8A 2H74A 5CP1A 2YNXA 1SYXA 2H71A 3ERGA 5D9XA 3H79A 5AGYA 1Z7PA 4GCIA 2H72A 7GSSA 4MJBA 1EZKA 1ZOFA 2CZ3A 2VL9A 1K0BA 4WF5A 1ERTA 2O7KA 2OE0A 4ZL7A 3ERWA 4KA0A 3SWLA 3N9JA 5CAXA 1EGOA 4WEYA 2GTUA 2C80A 3KMOA 4HJMA 3TJGA 3LQ7A 1X9SB 1SJ6A 1FO5A 5J5NA 5E4WA 1WWJA 4EF0A 1S3DA 2YV9A 1SENA 2L5OA 2A2RA 4RQRA 2B6MA 5F05A 2IPAA 1QK8A 2LV3A 1T7PB 3M9KA 3ZL5A 1V2AA 4D73B 3F9UA 5H5SA 4ACSA 4QQ7A 4HUAA 3APSA 1K0DA 5G30A 5ELGA 5IMCA 5HFGA 2EIRA 2LNSA 1K0MA 5IPHA 1G6YA 2TRCP 3QAVA 20GSA 1FG4A 3FZ4A 4BPYA 1M2BA 4OCEA 4MJEA 2I1UA 3UARA 3HXSA 4IELA 5G5EA 4K2DA 6GSXA 4TR1B 2VLTA 3MAKA 2GZPA 5A4VA 3ZIJA 4QL9A 1UVZA 5GAPD 2H19A 4N11A 4YAVA 5DAKA 2MBSA 4O32A 3FHKA 3IK7A 5FWGA 1JLVA 1XOAA 1GUMA 1E6BA 3QD9A 3LXTA 4NMUA 2A2SA 4IQAA 2VCQA 5ECNB 1R7HA 3A2VA 5J4UA 3QR6A 1RQMA 2J23A 2PN8A 1GSQA 1QGVA 1M0UA 3LGCA 5D8IA 5ELAA 4PGTA 3TJBA 1T1VA 1EV9A 1F3BA 3MNGA 4K7NA 3HJMA 5DDLA 17GSA 5ECRB 3QFAC 3VI7A 2LS5A 1CQHA 4KE3A 2NPBA 4MZWA 4IVFA 3OR5A 4OO4A 2FWFA 4HZ2A 4TXVA 3QFBC 2X99A 1SK0A 2V1MA 1GP1A 2REMA 5ECHB 3ZZXA 3H93A 3QAWA 3DMLA 2JZTA 5G1LA 2MMAA 3APOA 4K8MA 4V2NA 1XFLA 2CX4A 5HR1A 1GNWA 2HZEA 1GL8A 2WDUA 4GSNA 3QOUA 1K3OA 5ECMB 3C73A 4MH2A 2GSTA 3TRQA 3F3RA 5IIZA 3F8UA 4XCSA 2NDOA 2YZUA 1ERVA 5A5KA 2X64A 4WETA 4OFNA 2LSTA 5ECLB 5IMZA 3F3QA 3D22A 5DAKB 4J2FA 3FYGA 2TRXA 3WT1A 3UOMA 4FO5A 3D21A 1CQGA 1C72A 4BWQA 2L4CA 5C00A 3DWVA 5HR0A 5B8BA 2PPTA 2M46A 5B6MA 1FHEA 2GT6A 1USBA 1GTBA 3VWUA 2QSIA 1SJZA 1XOBA 3FZ9A 2LTKA 3L4NA 3DVWA 4MPGA 2R4VA 1BG5A 2KLXA 3GTUA 3US3A 2V2GA 1AQXA 5FHIA 1DSBA 2CT6A 1M9AA 1ML6A 1KBNA 4GXZA 1TRSA 4FYUA 1PQNA 3KXOA 1GTUA 3APQA 3CTGA 1HNAA 2LJKA 1PL2A 2HZEB 1PA3A 2FCHA 2V6OA 1MDIA 1M99A 1UA5A 4Q5NA 2VO4A 2OE1A 3UBLA 5DJLA 2VL3A 3KD0A 2CAQA 4I97A 5B8AA 3WGXA 1GSYA 1JZDA 4ZB6A 1XVQA 5CNWA 4IJ3A 5GSTA 4BA7A 4KSOA 2FNOA 5L71A 3HD5A 1TDIA 3C1SA 1DE2A 4K0NA 2AV4A 3W8SA 4DVCA 2XBIA 5B7CA 3KTBA 5ECKB 3P90A 1HD2A 3FEUA 3ZVJD 3N5OA 4WBRD 3G7JA 1XWAA 3CRUA 1KTEA 3GMFA 1PMTA 4PQ1A 2X8HA 3KGKA 2EC4A 1YEXA 1PD21 5D96A 4NHZA 4QL7A 3EVIA 1OYJA 3HKRA 4O92A 3QDNA 1GSEA 2MYGA 1H4OA 2HNLA 2IL3A 1K0CA 1THXA 3KZQA 2H0IA 3QMXA 1JHBA 2R37A 1VF1A 3F4SA 2JADA 5DALA 1HQOA 2GSQA 3EINA 3IXRA 4POMA 4XHMA 4ECJA 4ECBA 1A2MA 2GZYA 2WCIA 1EV4A 1TP9A 3F63A 4EKZA 3HJPA 1Q4JA 1PX6A 3H1NA 1XVWA 2B7JA 1AXDA 1ILOA 4GF0A 1U88A 4TVEA 2N5FA 1DBYA 2H30A 2OACA 4BVXA 5CREA 3GYKA 2VCTA 3ZMKA 2PGTA 1AUCA 1K3LA 4AJ6A 3TRXA 1NHYA 3I9V2 3ZFBA 2TIRA 3ED3A 2H1GA 3RPPA 2H6YA 3IV4A 2H1AA 2F51A 1JZOA 3NOFA 5ECIB 2F8FA 4I2UA 3TOUA 1O6JA 1TTZA 3L9SA 3UAPA 1OC8A 3GL3A 2H0GA 2FGXA 2YN1A 4EXJA 2HLSA 1N8JA 3HZ4A 3SBCA 4Q5RA 4DSSB 2GS3A 5ECQB 4MDCA 2YWNA 2GQKA 1I5GA 4JE1A 5DBQA 5DALB 1XWBA 1A8LA 1SD9A 3EE2A 4OD7A 1B9XC 2WB9A 5IMAA 3HDCA 2C0EA 4P3YB 4MK3A 4AF2A 1GTIA 2YZHA 1G7EA 1GULA 1TXXA 1QMVA 3ZITA 4JR4A 4ZL8A 2K9FA 2CVDA 4PXOA 1HNCA 4GRFA 18GSA 2L5LA 4X1UA 1TK5B 1PKWA 4WR5A 1W89A 1GRXA 4KCAA 4I6XA 4PQIA 3TUEA 1EP8A 1KNGA 2ZNMA 1FB0A 2NTOA 4KDYA 3ERFA 3LJRA 1XCCA 1EEMA 3EYTA 1SK2A 3UIWA 4IGJA 2HYXA 4WKWA 2E0QA 4F2IA 1URMA 3KH7A 4NWYA 3LYKA 5HFIA 2DJJA 2PU9C 4TR1A 5F06A 5JWOB 4K6XA 5H5RA 2H70A 4E8HA 4E8EA 2O87A 5KEJA 1OC3A 2L57A 5CRDA 3CTFA 3VURA 4N10A 4CW9A 1R4WA 1X5EA 6GSVA 1X0RA 3FRCA 4MABA 2HFDA 4XRAA 3DIEA 2FWGA 3D5JA 2LRCA 1EEJA 1YZXA 2J9HA 3GL5A 3U5RE 1YDKA 2CX3A 2OA7A 3EMPA 5GSSA 4HJ2A 3CRTA 1A2LA 2GDRA 3P7XA 2CVKA 3KIJA 1SD8A 5HQPA 3UVTA 5ENUA 2DJ0A 4V1Ap 4EVMA 2RM6A 5HR3A 3KEBA 1N2AA 9GSSA 3FY7A 3MDKA 2QKEA 1ZYEA 3TB2A 3VWXA 1MD4A 4IBPA 5HR2A 2IMFA 5AIXA 3H4KA 3FW2A 3GHAA 2FUG2 1O73A 4MJCA 2GQMA 2IIYA 2YP6A 3D4MA 1A0FA 5G2ZA 5JWRB 1Z9HA 1SU9A 4IW9A 2WZ9A 2B5XA 3DKSA 1XIYA 2O89A 3RBTA 3G7IA 4KGIA 3A2XA 1O81A 1WP0A 3C1RA 1YJ6A 5F0GA 2K6VA 2G2QA 5IOWA 2VLUA 1A8YA 2B5EA 2YJ7A 4HQZA 2KP1A 3KJYA 4I2TA
chains in the Genus database with same CATH superfamily
2F2CA 2OBKA 4Z2UA 3DGQA 1J0FA 3RHBA 3CSIA 3NDQA 4YAPA 2WFCA 2BTOT 1TD6A 1SKRB 4JEDA 1XWKA 4AGSA 1XWGA 1FVVB 1TI3A 3EURA 3DD3A 3HZ8A 3RHCA 2H01A 4HL4A 3K8NA 4MF7A 2CZ2A 4N0ZA 1FW1A 1J9BA 2R0CA 5IO2A 1FB6A 5J41A 3KP9A 3LORA 2QFZA 4YOZA 1MDJA 2YANA 1H25B 3NIVA 1PKDB 3DTOA 4ZIJA 4Q5QA 3TKRA 1M9BA 2FWEA 14GSA 4MCUA 2RLIA 2JZRA 2DD4B 4JR6A 3ZLPA 5IOXA 5CRWA 1BX9A 3VWVA 4KDUA 5D9TA 4F7LB 1PN9A 2NBSA 2CAIA 1HYUA 4RQXA 2C3QA 2BS3A 4PNFA 3W6GA 2ES7A 3GUSA 2JZSA 4EE0A 5D93A 1OKWB 2D0QB 2HT9A 4N0VA 2C4GB 5DCHA 4CDOA 2C3TA 2F8AA 5ECOB 2W2HA 4ML6A 4OCFA 3QPMA 1U3IA 2G0FA 3DEXA 4F03A 4FH8A 4ZBDA 1B4PA 2DJ2A 2E2MA 5JCGA 1R5PA 2CA8A 3IC4A 4GSTA 3CSHA 2QDJA 4F0CA 3O3TA 1GLQA 4EOIB 4O7HA 2AUVA 2MMNA 1FINB 3EC3A 3R3EA 2V32A 4JX5A 5ID2B 3D6IA 4YQVA 1Z6MA 2DJ1A 2AHJB 1BU2A 4GSSA 3TCOA 3F4TA 3O6TA 4WR4A 1SL0B 2DMMA 5KN2A 2FD3A 2C5XB 3RGFB 1PSQA 4DSRA 4OO5A 2PJQA 3FR9A 1O8WA 1OC9A 2HSYA 1AW9A 5DQVA 3GKMA 2JSYA 2QF7A 4JZQA 2KHPA 1F6MC 1M2DA 3MIAB 2DIZA 2H6ZA 2WRTA 2ZUPA 4ZXGA 2H8LA 3Q18A 1B9YC 3IAS2 4BCMB 2I3YA 1WE0A 4F0BA 2L6DA 3F6FA 4JBBA 4H86A 4CFMB 2GVPA 5J9BA 4POKA 3GRXA 4OFTA 4Z7XA 2N5AA 2QC7A 3VI5A 2B3SA 6GSTA 2RUEA 3BHTB 3C7MA 4BVYA 2IW6B 1BQ7A 4MNNA 5LNKe 3IAM2 1R26A 3GX0A 1VF4A 2C8UA 2ZPEB 4EL1A 4NC6A 3VK9A 5C04A 2LQQA 4NXIA 4XS1A 1JZRA 5L2WB 4L0WA 3ZYWA 3GKKA 5DCGA 4BCPB 3LW9A 2PUKC 4NV5A 3CBUA 5B6NA 3GH9A 4PURA 2VL2A 1ZYQB 1XBSA 2YCDA 2B7KA 1V9WA 1PRXA 2LQOA 2C3NA 3FKFA 8GSSA 11GSA 2IMKA 1PGTA 3KMNA 3PGTA 3WT2A 1OL2B 1O8XA 2JL4A 5CRGA 1QUWA 4G10A 2V41A 3LG6A 3BCKA 1WJKA 4DSSA 4OB2B 2AHEA 4O5UA 3DVXA 1GNEA 3WGDA 2VM2A 1W4VA 2CVBA 1OC9B 1FOHA 3PH9A 4K2XA 3Q19A 2FWHA 2WMBB 3VPTA 4A5PA 2LRNA 1F37A 3W8JA 2JSZA 4HI7A 3C8EA 4PUAA 5EPFA 5LD0A 4XS4A 3QHWB 2WGRA 1AD6A 3IOSA 2YV7A 2MMZA 4ZBAA 1AISB 3BJ5A 3LSZA 5G5FA 1SYRA 5EY6A 1XPVA 1WMJA 1T8EB 1Q98A 2WJ9A 1GH6B 2VOCA 1EWXA 3TGZA 3BG9A 4L5OA 4BVYB 3A8GB 5IMVA 2B1LA 4MF5A 4EOPB 1IYHA 4M6VA 3TKPA 1YKCA 2RM5A 3TW7A 4GQCA 1WPIA 4YH2A 5DQSA 1K0AA 2HZFA 3TOTA 5F8BA 4TR0A 2F9SA 4EC9B 1BAYA 1U87A 2XPDA 4ECCA 4K0GA 1PN0A 3E9JB 4MP4A 5LCZA 1Z6NA 2VD0A 2YWIA 1YKAA 4GQFA 4IP6A 4MJAA 1FAAA 4ILFA 2VCZA 5EVOA 4XS6A 4HLQA 4BBSM 2H0HA 3LEFA 3A8OB 3HO8A 1NSWA 1ZCPA 2VIMA 4OB1B 1T4ZA 5IQYA 1A24A 1GLPA 5KN0A 2L6CA 4KB3A 2H1BA 4TXOB 1M2AA 1NHOA 1EGRA 2H6XA 1EOGA 3BG5A 2FA8A 4FYCA 3ZREA 3MYDA 3UVHA 4WXTA 4EORB 2UZDB 2BS2A 2C5VB 1IREB 3H8QA 1GUXA 5HQ0B 6GSWA 2ZZDB 2IMEA 4ML1A 3QXEB 2DMLA 2P5QA 1PFOA 1YEPA 1TKDB 2QQ8A 5E59A 3WYWA 3BLQB 2EIOA 4NAXA 2QGVA 4NPBA 3ZTLA 2GSRA 1QLBA 4XS4B 1AAZA 2XPEA 1OAZA 5F07A 4F7JB 3LQ5B 4ELLA 4BCOB 4KCEA 3DYRA 1SJIA 4GTUA 3G33B 4MZBA 3C71A 2AJQB 1UNLD 4CFXB 3EPTA 1JOWA 16GSA 1AC1A 2MMOA 3D4TA 3TKSA 4YC3B 5JCUA 3ZMLA 5INYA 2GZZA 1TI1A 4G19A 4FIWA 1XW5A 1OKTA 1O9KA 4EIQA 1PL1A 2P31A 2GQLA 2DC5A 6GSYA 2VCXA 13GSA 3RPNA 1X5CA 4KW6A 3DL1A 2H66A 4EDYA 4DSQA 3QHRB 3HYPA 3GSSA 4KDXA 4HZ4A 3DJBA 3L0HA 2LEGA 4KX4A 4HDEA 6GSSA 4K7OA 4TOPA 4YKGA 3LFLA 3F0IA 3QAGA 1V58A 2ZCFB 1LJRA 5IPGA 3M0FA 2NVLA 1E2YA 2YPMA 3HVSA 6GSUA 1PKZA 4AJ8A 3GURA 4DEJA 4TRXA 3TJKA 2HRFA 2IW9B 3F6DA 1UNGD 2C1YA 4JU5A 3VYHB 1GUXB 5BNJB 1BEDA 3U6VA 2C4JA 2C0DA 2M80A 5ECSA 3DOGB 1V57A 4MZCA 1QMZB 1J08A 5G31A 1ON4A 1AHJB 2ZPFB 2ON5A 1TRVA 4ID0A 3HY2A 3IK9A 2FA4A 5A4WA 3S9FA 2B1KA 2LRTA 2CQ9A 2UZEB 3VPQA 1YQ1A 2Z9SA 1Y6EA 4V2MA 2PK9B 3IA1A 4O5QA 4MFEA 2DBCA 4OFMA 5DVBA 4CRLB 2BS4A 3PO3S 3TRPA 3CMIA 3GX8A 5HVYB 1ABAA 5JCWA 4GWRA 1F2EA 4HNTA 1ZYNA 3KHIA 2V6KA 5DQYA 2ON7A 1UN2A 1Z5YE 2DKIA 2WULA 3KCMA 4MA9A 5IMFA 2PMTA 2O8VB 3CYNA 1U6TA 3ISOA 5CRHA 2F3MA 1WRYA 2WJUA 1VF2A 1ST9A 2H75A 4KSMA 4MPFA 3ZRDA 1XO2A 5HBJB 2RUFA 1OVNA 3A2WA 3BD2A 1QQ2A 3M9JA 3KM6A 1HNBA 1B4QA 1MTCA 1XW6A 1OIYB 3BCIA 2KMGA 2WXVB 1ZZYA 3RAZA 1H27B 2JU5A 2R0PA 4BCKB 4LA1A 1VRSD 3L9UA 3FZAA 1UNHD 3R2QA 1TK0B 2R5GA 2PHGA 3GN3A 2XBQA 3L78A 1ENWA 2N5BA 3M8NA 5BRTA 3DRNA 2HRKA 1F5QB 4BWSA 4NSTB 2K18A 3D0ZA 4IS0A 1QFNA 1VOLA 4OWYA 4YOOA 4TR4A 2VD1A 3IPZA 4LOCA 4L5LA 2OADA 1XG8A 1V40A 4HSCX 3WVEB 2ZCTA 4LLRA 3CXGA 4POLA 3G9BA 5EL8A 2ZPGB 4Q5FA 4N30A 1EP7A 3HJOA 2X49A 4TTHA 2AYTA 1LU4A 4ZB9A 2QDYB 2X4AA 2BJXA 1KEBA 2M72A 4HEA2 2G77A 2L4QA 1GUHA 2IFQA 1GSSA 3TDGA 5KN1A 3HCZA 1V98A 2PVQA 1H1SB 4IQ1A 1FVKA 3VLNA 1WIKA 2DXBB 3VFIA 2O85A 5ID2A 1B48A 4CY8A 2D2ZA 1I9DA 3BLHB 5CO3A 2GLRA 4POBA 3I69A 4TR3A 3FR6A 4G0KA 3LXZA 5DJMA 3IR4A 3QYGB 1R5AA 2FLSA 2PERA 4NHWA 3P8WA 4HOJA 1ERUA 3EU4A 2WIHB 3AY8A 2C5OB 3PINA 4XTSA 3LYPA 3HVXA 3A8MB 3HZJA 2PVOC 5FT3A 4HU9A 2HXKA 5J3RA 3F4RA 1A2JA 2AAWA 2ZPBB 3WD6A 1ERWA 1TU7A 3M1GA 4K1FA 3MI9B 4ECIA 3EIDB 3MSZA 2I4AA 5D9WA 1GY3B 4MH3A 3CSJA 2P0GA 2HI7A 5GAND 3HHVA 5IO0A 4BCND 1Z7RA 1O7UA 3X25B 2IN3A 2B5YA 4BY7X 4K9ZA 1OE8A 3J7Yb 3PPUA 2H76A 3F5XB 2DPPB 3A3TA 2I9HA 1YF0A 5AISA 3DXBA 2KUCA 4EC8B 2H73A 4GLTA 2KP2A 1JKWA 1K3YA 4PX1A 1OE7A 3PR8A 2IFQB 1VF3A 3GFKA 4LMWA 3J7Yk 4IMYB 3GIXA 4F82A 2XHFA 2WFYB 3GV1A 3UJ1A 5KOWA 2K8SA 2LNTA 4YQMA 1SKWB 2CZ7B 1Z3EA 1OKVB 4G0IA 4LL4B 2VL2C 1E7PA 1SKSB 2UZLB 2ALBA 3MY5B 2C5NB 4RODA 3KH9A 3IE3A 10GSA 1O85A 4BCGB 2AB6A 4K7IA 4OMVA 2W96A 4F6UB 3ZFLA 1AIUA 1Y25A 2H1DA 4I8BA 3BOAA 3UMAA 4L8EA 3M3MA 5D73A 12GSA 1IYIA 4ZBBA 4PQHA 3I43A 4LMVA 2E7PA 1OIUB 2JACA 1S3AA 3UBKA 5G1KA 1TJDA 1GWCA 2VLVA 3P2AA 1MEKA 1F9MA 5LMKB 4F70B 4MFDA 4PUFC 3MIXA 4ZILA 1JSTB 4CFWB 2HSHA 3VWWA 2HRNA 1K0OA 5AN1A 3E3EA 4NV2A 2W9ZA 2IWTA 1WOUA 1P5EB 4ROCA 1XZOA 3ME8A 4RI6A 3ME7A 4TKYA 4OB0B 3TW6A 4X43A 4CFUD 2CV4A 2E2GA 1S3CA 2OE3A 3FK8A 3Q74A 1VGLA 5A4UA 4MMMA 1G7OA 1F3AA 1G6WA 1TRWA 3EMXA 5ECPB 5FGKB 2YOIA 3G7YA 1DUGA 4O5RA 1ZL9A 5LQFB 2C0GA 4CY6A 4TXOA 2I53A 1K0NA 2CYZB 2KOKA 3KTLA 2WPAB 3ZIVA 1QXHA 4KUNA 3Q6OA 4AKGA 4LL1B 4HU7A 1N4MA 3UEMA 2FY6A 2CJMB 4G6LB 2DIYA 2R6KA 3TKQA 1TK8B 3IDVA 1A0RP 3GA4A 4XIHA 1FOVA 5COHA 4II5B 2DSAA 5H5QA 3GTUB 1W98B 3WVDB 2YJHA 1H75A 1SK1A 2YWOA 4AJ7A 3TJJA 1NM3A 5D9VA 4BCFB 1DE1A 1LBKA 3RDWA 4Y72B 4HNUA 1GSDA 4WBJA 4HS1A 4EDZA 3IRAA 1X9MB 1JLWA 3BBYA 4XRDA 4TN8A 3EJ1B 4G9HA 1X5DA 1GSFA 4J56E 1T4YA 2K8VA 3FZ5A 3IBHA 4WF4A 4ZB8A 3TJFA 1T3BA 1S3RA 1MD3A 19GSA 5ABRA 4CHSA 2WEVB 3TKSC 4BCHB 1FVJA 2CCIB 1XW9A 4YQUA 3A5WA 1GUKA 4G2EA 4CFVB 2VCWA 3O76A 2DJKA 1GSUA 1XWCA 1AQWA 4ISDA 4ULXA 3TNIB 2FHEA 3NZNA 1ZGNA 4V2LA 5AIVA 1H1RB 2X8GA 3QCPA 2QA2A 3VKHA 2OJLA 4HQSA 5CEIB 1JZWA 3E0UA 3TKSE 4X0XA 2GSSA 1TRUA 2QGSA 2VUPA 3GKXA 4I5QA 2YWMA 2VAFA 4AKHA 3HB9A 2HE3A 1UC7A 2LUSA 3A8LB 5IM9A 4J57E 2CZ1B 4BXXX 5CYYA 2IJYA 2BMXA 2LJAA 3V1WA 4MF6A 1THOA 3HA9A 2L59A 1TW9A 3IHGA 1RW1A 4KAEA 2PWJA 2VCVA 5JWQB 1B8XA 2LJRA 4FYBA 5HFKA 4IN0A 3LWAA 4ZGJB 1H1QB 1RK4A 1SL1B 3WGEA 4KH7A 2PBJA 22GSA 4KF9A 1EOHA 2GT5A 2VM1A 3JCML 1NW2A 2X8CA 3GH6A 2DLXA 4IHUA 2LKUA 4EC0A 1YF1A 2EIQA 1U3AA 2R0GA 4PNGA 1GH2A 3DDQB 1V29B 5KN3A 1ZMAA 2XC2A 4EOLB 1TU8A 1MDKA 2IMIA 4IJIA 2I81A 4MLYA 4F9ZA 2DJ3A 1UGQB 4KRDB 2A4VA 5EJCA 4EUYA 3HVVA 4KNDA 1TOFA 2OKAA 2V22B 4EIPA 2MBTA 2C0FA 4IKHA 1PX7A 2R2JA 4ZL9A 2DMEA 4IP1A 1M7TA 1YY7A 4TW5A 1BJXA 2C6TB 3GKNA 3IHQA 4L0UA 2IMDA 1XXUA 2WS2A 3EWLA 3IC8A 1BYEA 1G0TA 3ZVJA 3VKGA 4D73A 3MWHA 3UL3A 3EU3A 4RUVA 5GZZB 3L9VA 2ZPIB 2GGTA 3I6AA 3GSTA 1A23A 1X9WB 3GNJA 4PTSA 1T00A 1H28B 4JRRA 2MZCA 5J9CA 1ACVA 1M3JA 5IMDA 2R3XA 1OKDA 4BCMD 1SL2B 4BIKA 4RI7A 3FR3A 4BL7A 1JFUA 1AQVA 2OBIA 2P5RA 4EO3A 2RIIA 1GTAA 4V1Ag 3KP8A 2H74A 1OGUB 5CP1A 2YNXA 2I40B 1SYXA 2H71A 3ERGA 5D9XA 3H79A 5AGYA 1Z7PA 4GCIA 2H72A 7GSSA 4MJBA 1EZKA 1ZOFA 2CZ3A 3EOCB 2VL9A 1K0BA 4WF5A 1ERTA 2O7KA 2OE0A 2A4HA 4ZL7A 3ERWA 4KA0A 4UN0A 3SWLA 3N9JA 5CAXA 4CFNB 1EGOA 4WEYA 2GTUA 2C80A 3KMOA 4HJMA 3TJGA 3LQ7A 1X9SB 1SJ6A 4I3ZB 1FO5A 3O0GD 4Z6YA 5ICPB 5J5NA 5E4WA 1WWJA 1FKMA 2IW8B 4EF0A 1S3DA 2YV9A 3B57A 1SENA 2L5OA 2A2RA 4RQRA 2B6MA 5F05A 1D3UB 2IPAA 1QK8A 2LV3A 1T7PB 3M9KA 3ZL5A 2W9FA 1V2AA 4D73B 3F9UA 5H5SA 4ACSA 4QQ7A 4HUAA 3APSA 1K0DA 5G30A 5ELGA 5IMCA 4ZGEB 5HFGA 2EIRA 2LNSA 4BY1X 1K0MA 5IPHA 1G6YA 2TRCP 3QAVA 3QWLA 20GSA 2A2PA 1FG4A 4BL7B 3FZ4A 4BPYA 1M2BA 4OCEA 4MJEA 2I1UA 3UARA 3HXSA 4IELA 5G5EA 4FM4B 4K2DA 6GSXA 4TR1B 2VLTA 3MAKA 2GZPA 5A4VA 3ZIJA 4QL9A 1UVZA 5GAPD 2H19A 4N11A 4YAVA 5DAKA 2MBSA 2EUFA 4O32A 3FHKA 4AI6A 3IK7A 5FWGA 1JLVA 1XOAA 1GUMA 1E6BA 3QD9A 1ZYPA 3LXTA 4NMUA 2A2SA 4IQAA 2G9XB 2VCQA 5ECNB 1R7HA 3A2VA 5J4UA 3QR6A 1RQMA 2J23A 2PN8A 1GSQA 1QGVA 1M0UA 3LGCA 5D8IA 5ELAA 4PGTA 3TJBA 1T1VA 1EV9A 1F3BA 2R7GA 3MNGA 3DDPB 4K7NA 3HJMA 3QYHB 5DDLA 17GSA 4HNVA 5ECRB 3QFAC 3VI7A 2LS5A 1CQHA 2IVXA 4KE3A 2NPBA 3X24B 4MZWA 4IVFA 3OR5A 4OO4A 2FWFA 4HZ2A 4TXVA 3QFBC 2CZ6B 2X99A 2V1MA 1SK0A 1GP1A 2REMA 3TN8B 5ECHB 3ZZXA 3H93A 3QAWA 3DMLA 2JZTA 5G1LA 2MMAA 3APOA 4K8MA 4V2NA 1XFLA 2CX4A 5HR1A 1GNWA 2HZEA 1GL8A 2WDUA 4GSNA 3QOUA 1URCB 1K3OA 5ECMB 3C73A 4MH2A 2GSTA 4EOSB 3TRQA 3F3RA 5IIZA 3F8UA 4XCSA 2NDOA 2YZUA 1ERVA 5A5KA 2X64A 4WETA 1ZP2A 2LSTA 4OFNA 5ECLB 3VYGB 2PMIB 4BCIB 5IMZA 3BHUB 3F3QA 3D22A 5DAKB 4J2FA 3FYGA 2TRXA 3WT1A 5HBEB 3UOMA 1VYWB 4FO5A 5IDNB 3D21A 3K7AM 1CQGA 2DXCB 1C72A 3QYBA 4Z2TA 4BWQA 2L4CA 5C00A 3DWVA 5HR0A 4YOSA 5B8BA 2PPTA 2M46A 5B6MA 1FHEA 2GT6A 1USBA 1GTBA 3VWUA 2QSIA 1SJZA 1XOBA 3FZ9A 3HBLA 2LTKA 3L4NA 3DVWA 4MPGA 1JSUB 4F6WB 2R4VA 1BG5A 2KLXA 3GTUA 3US3A 4MIMA 4BCQB 1OI9B 2V2GA 1AQXA 5FHIA 1DSBA 2CT6A 1M9AA 1ML6A 2UZBB 1KBNA 3A5IA 4ELJA 4EOMB 4GXZA 4G0LA 1TRSA 1PQNA 4FYUA 3KXOA 1GTUA 3APQA 3CTGA 1HNAA 2LJKA 1PL2A 2HZEB 1PA3A 2FCHA 4BCJB 2V6OA 1MDIA 1E9HB 1M99A 1UA5A 2BPMB 4Q5NA 2VO4A 2OE1A 3UBLA 5DJLA 2VL3A 3KD0A 3QZ9B 2CAQA 4I97A 5B8AA 3WGXA 1GSYA 1JZDA 4ZB6A 1XVQA 5CNWA 4IJ3A 5GSTA 4BA7A 2X1NB 4KSOA 2FNOA 5L71A 3HD5A 1TDIA 3C1SA 1DE2A 1TFBA 4K0NA 2AV4A 3W8SA 4DVCA 2XBIA 5B7CA 3KTBA 5ECKB 3P90A 1HD2A 3FEUA 2DKHA 3ZVJD 3N5OA 4WBRD 3G7JA 3GTMS 1XWAA 3CRUA 1KTEA 4K5RA 3GMFA 5BMUA 1PMTA 4PQ1A 2X8HA 3KGKA 2EC4A 1YEXA 1PD21 5D96A 2CCHB 4NHZA 1H26B 4QL7A 3EVIA 1OYJA 4OR5B 3HKRA 4O92A 3QDNA 4ZGDB 2PK2A 1GSEA 2MYGA 3FMWA 1H4OA 2HNLA 2JGZB 2IL3A 1K0CA 4ROEA 1THXA 3KZQA 2H0IA 4QSHA 3QMXA 1JHBA 3QZ5B 2WIPB 2R37A 1VF1A 3F4SA 2JADA 5DALA 1HQOA 2GSQA 3EINA 3IXRA 4POMA 4XHMA 4ECJA 4ECBA 3POMA 4JX6A 1A2MA 2GZYA 2WCIA 1EV4A 5DQWA 1TP9A 3F63A 4EKZA 3HJPA 1Q4JA 1PX6A 3H1NA 1XVWA 2B7JA 1AXDA 3CQFA 3HHTB 2W99A 1ILOA 4GF0A 1U88A 4TVEA 2N5FA 5HNBB 1DBYA 2H30A 2OACA 4BVXA 5CREA 3X26B 3GYKA 2VCTA 3ZMKA 2PGTA 1AUCA 1K3LA 4AJ6A 3TRXA 1NHYA 5IHYA 3I9V2 3ZFBA 2TIRA 2UZ8A 3ED3A 2H1GA 3RPPA 2H6YA 3IV4A 2H1AA 4KRCB 2F51A 1JZOA 3NOFA 5ECIB 3QYEA 2F8FA 4I2UA 3TOUA 4EONB 1O6JA 1TTZA 3L9SA 3UAPA 1OC8A 3GL3A 2H0GA 2FGXA 2YN1A 4EXJA 2HSMA 2HLSA 1N8JA 3HZ4A 3SBCA 4Q5RA 4DSSB 2GS3A 5ECQB 4MDCA 3H4CA 2YWNA 2KR6A 3X20B 4USSA 2GQKA 3TNWB 3TNHB 1I5GA 4EOKB 2LW4A 4JE1A 5DBQA 5DALB 5CYIB 1XWBA 1A8LA 1SD9A 3EE2A 4OD7A 1B9XC 2WB9A 5IMAA 1VINA 3HDCA 2C0EA 5I5ZB 4P3YB 5KOXA 4MK3A 1KXUA 4AF2A 4EOOB 1GTIA 4BCNB 4EOJB 2YZHA 1G7EA 1GULA 1TXXA 1UGRB 1QMVA 3ZITA 4JR4A 4ZL8A 2K9FA 2CVDA 4PXOA 1HNCA 4GRFA 18GSA 2L5LA 4BVXB 1OL1B 5IDPB 4X1UA 1TK5B 1PKWA 4WR5A 2UUEB 1W89A 1GRXA 4KCAA 4X4JA 1H4LD 4BCQD 4I6XA 2CZ0B 4PQIA 3TUEA 1EP8A 1KNGA 2ZNMA 1FB0A 2NTOA 4KDYA 4EOQB 2WHBB 3ERFA 3LJRA 2DD5B 1XCCA 1EEMA 3EYTA 3MY1B 1SK2A 3UIWA 4IGJA 2HYXA 4JX4A 4WKWA 2E0QA 4F2IA 3HVNA 1URMA 2B9RA 4K5SA 3KH7A 4NWYA 3LYKA 5HFIA 2DJJA 2PU9C 4TR1A 5F06A 5JWOB 4K6XA 5H5RA 4OGRB 2H70A 4E8HA 4E8EA 2O87A 5KEJA 4YKFA 1OC3A 2L57A 5CRDA 3CTFA 5HBHB 3VURA 4N10A 4CW9A 1R4WA 1X5EA 6GSVA 1X0RA 3FRCA 5EFQB 4MABA 4F7SB 2HRAA 2HFDA 4XRAA 3DIEA 2FWGA 3D5JA 2LRCA 3X28B 1EEJA 1YZXA 5IF1B 2J9HA 3GL5A 3U5RE 1YDKA 2CX3A 3BG3A 4BBRM 2OA7A 3EMPA 5GSSA 4HJ2A 3CRTA 1A2LA 4AKIA 2GDRA 3P7XA 4ICYA 2CVKA 1H1PB 4CFUB 3KIJA 2BKZB 1M3IA 1SD8A 3BHVB 5HQPA 4OB3B 3UVTA 5ENUA 2WMAB 1O9KB 1C9BA 2DJ0A 2ZPHB 3BLRB 4V1Ap 4EVMA 2RM6A 5HR3A 3KEBA 1N2AA 9GSSA 3FY7A 4FX3B 3MDKA 2QKEA 4Z2RA 1ZYEA 3TB2A 3VWXA 1MD4A 4IBPA 5HR2A 4FQUA 2IMFA 5AIXA 4F6SB 3H4KA 3FW2A 3GHAA 2FUG2 1O73A 4MJCA 5ACBA 2GQMA 2IIYA 2YP6A 3D4MA 1A0FA 5G2ZA 4CXAB 5JWRB 1Z9HA 1G3NC 1SU9A 1UGPB 4IW9A 1H24B 2WZ9A 2B5XA 3DKSA 1XIYA 2O89A 3RBTA 3G7IA 4KGIA 4F7NB 3A2XA 3M03A 1O81A 1WP0A 3C1RA 1YJ6A 2QA1A 5F0GA 2K6VA 2G2QA 5IOWA 2VLUA 1UGSB 1A8YA 2B5EA 3A8HB 2YJ7A 4HQZA 2KP1A 3KJYA 4I2TA
chains in the Genus database with same CATH topology
2OBKA 4Z2UA 3DGQA 1J0FA 3RHBA 3CSIA 4YAPA 2WFCA 2BTOT 1SKRB 4JEDA 1XWKA 4AGSA 1XWGA 1TI3A 3EURA 3DD3A 3HZ8A 3RHCA 2H01A 3K8NA 4MF7A 2CZ2A 4N0ZA 1FW1A 1J9BA 2R0CA 5IO2A 1FB6A 5J41A 3KP9A 3LORA 1MDJA 2YANA 3NIVA 4ZIJA 4Q5QA 3TKRA 1M9BA 2FWEA 14GSA 4MCUA 2RLIA 2JZRA 4JR6A 3ZLPA 5IOXA 5CRWA 1BX9A 3VWVA 4KDUA 5D9TA 1PN9A 2NBSA 2CAIA 1HYUA 4RQXA 2C3QA 4PNFA 3W6GA 2ES7A 3GUSA 2JZSA 4EE0A 5D93A 2HT9A 4N0VA 5DCHA 4CDOA 2C3TA 2F8AA 5ECOB 4ML6A 4OCFA 3QPMA 1U3IA 2G0FA 3DEXA 4F03A 4FH8A 4ZBDA 1B4PA 2DJ2A 2E2MA 5JCGA 1R5PA 2CA8A 3IC4A 4GSTA 3CSHA 4F0CA 3O3TA 1GLQA 4O7HA 2AUVA 2MMNA 3EC3A 3R3EA 2V32A 5ID2B 3D6IA 4YQVA 1Z6MA 2DJ1A 4GSSA 3TCOA 3F4TA 3O6TA 4WR4A 1SL0B 2DMMA 5KN2A 2FD3A 1PSQA 4DSRA 4OO5A 3FR9A 1O8WA 1OC9A 2HSYA 1AW9A 3GKMA 2JSYA 4JZQA 2KHPA 1F6MC 1M2DA 2DIZA 2H6ZA 2WRTA 2ZUPA 4ZXGA 2H8LA 3Q18A 1B9YC 3IAS2 2I3YA 1WE0A 4F0BA 2L6DA 3F6FA 4JBBA 4H86A 2GVPA 5J9BA 4POKA 3GRXA 4OFTA 4Z7XA 2N5AA 2QC7A 3VI5A 2B3SA 6GSTA 2RUEA 3C7MA 4BVYA 1BQ7A 4MNNA 5LNKe 3IAM2 1R26A 3GX0A 1VF4A 2C8UA 4EL1A 3VK9A 5C04A 2LQQA 4NXIA 4XS1A 1JZRA 4L0WA 3ZYWA 3GKKA 5DCGA 3LW9A 2PUKC 4NV5A 3CBUA 5B6NA 3GH9A 4PURA 2VL2A 1ZYQB 1XBSA 2YCDA 2B7KA 1V9WA 1PRXA 2LQOA 2C3NA 3FKFA 8GSSA 11GSA 2IMKA 1PGTA 3KMNA 3PGTA 3WT2A 1O8XA 2JL4A 5CRGA 1QUWA 4G10A 2V41A 3LG6A 3BCKA 1WJKA 4DSSA 2AHEA 4O5UA 3DVXA 1GNEA 3WGDA 2VM2A 1W4VA 2CVBA 1OC9B 1FOHA 4K2XA 3PH9A 3Q19A 2FWHA 3VPTA 4A5PA 2LRNA 1F37A 3W8JA 2JSZA 4HI7A 3C8EA 4PUAA 5EPFA 5LD0A 4XS4A 2WGRA 3IOSA 2YV7A 2MMZA 4ZBAA 3BJ5A 3LSZA 5G5FA 1SYRA 5EY6A 1XPVA 1WMJA 1T8EB 1Q98A 2VOCA 1EWXA 3TGZA 4L5OA 4BVYB 5IMVA 2B1LA 4MF5A 1IYHA 3TKPA 1YKCA 2RM5A 4GQCA 1WPIA 4YH2A 5DQSA 1K0AA 2HZFA 3TOTA 5F8BA 4TR0A 2F9SA 1BAYA 1U87A 2XPDA 4ECCA 4K0GA 1PN0A 3E9JB 4MP4A 5LCZA 1Z6NA 2VD0A 2YWIA 1YKAA 4GQFA 4IP6A 4MJAA 1FAAA 4ILFA 2VCZA 5EVOA 4XS6A 2H0HA 3LEFA 1NSWA 1ZCPA 2VIMA 1T4ZA 5IQYA 1A24A 1GLPA 5KN0A 2L6CA 4KB3A 2H1BA 4TXOB 1M2AA 1NHOA 1EGRA 2H6XA 1EOGA 2FA8A 4FYCA 3ZREA 3MYDA 3UVHA 4WXTA 3H8QA 6GSWA 2IMEA 4ML1A 2DMLA 2P5QA 1YEPA 1TKDB 5E59A 3WYWA 2EIOA 4NAXA 2QGVA 4NPBA 3ZTLA 2GSRA 4XS4B 1AAZA 2XPEA 1OAZA 5F07A 4KCEA 3DYRA 1SJIA 4GTUA 4MZBA 3C71A 2AJQB 3EPTA 16GSA 1AC1A 2MMOA 3D4TA 3TKSA 5JCUA 3ZMLA 5INYA 2GZZA 1TI1A 4G19A 4FIWA 1XW5A 1OKTA 4EIQA 1PL1A 2P31A 2GQLA 2DC5A 6GSYA 2VCXA 13GSA 3RPNA 1X5CA 4KW6A 2H66A 4EDYA 4DSQA 3HYPA 3GSSA 4KDXA 4HZ4A 3L0HA 2LEGA 4KX4A 4HDEA 6GSSA 4K7OA 4TOPA 4YKGA 3LFLA 3F0IA 3QAGA 1V58A 1LJRA 5IPGA 3M0FA 2NVLA 1E2YA 2YPMA 3HVSA 6GSUA 1PKZA 4AJ8A 3GURA 4DEJA 4TRXA 3TJKA 2HRFA 3F6DA 2C1YA 4JU5A 1BEDA 3U6VA 2C4JA 2C0DA 2M80A 5ECSA 1V57A 4MZCA 1J08A 5G31A 1ON4A 2ON5A 1TRVA 4ID0A 3HY2A 3IK9A 2FA4A 5A4WA 3S9FA 2B1KA 2LRTA 2CQ9A 3VPQA 1YQ1A 2Z9SA 1Y6EA 4V2MA 3IA1A 4O5QA 2DBCA 4OFMA 5DVBA 3TRPA 3CMIA 3GX8A 5JCWA 1ABAA 4GWRA 1F2EA 1ZYNA 2V6KA 5DQYA 2ON7A 1UN2A 1Z5YE 2DKIA 2WULA 3KCMA 4MA9A 5IMFA 2PMTA 2O8VB 3CYNA 1U6TA 3ISOA 5CRHA 2F3MA 1WRYA 2WJUA 1VF2A 1ST9A 2H75A 4KSMA 4MPFA 3ZRDA 2RUFA 1OVNA 3A2WA 3BD2A 1QQ2A 3M9JA 3KM6A 1HNBA 1B4QA 1XW6A 1MTCA 3BCIA 1ZZYA 3RAZA 2JU5A 2R0PA 4LA1A 1VRSD 3L9UA 3FZAA 1TK0B 3R2QA 2R5GA 3GN3A 2XBQA 3L78A 2N5BA 3M8NA 5BRTA 3DRNA 2HRKA 4BWSA 2K18A 3D0ZA 4IS0A 1QFNA 4OWYA 4TR4A 2VD1A 3IPZA 4L5LA 2OADA 1V40A 2ZCTA 4LLRA 3CXGA 4POLA 3G9BA 5EL8A 4Q5FA 4N30A 1EP7A 3HJOA 2X49A 2AYTA 1LU4A 4ZB9A 2BJXA 1KEBA 2M72A 2X4AA 4HEA2 2L4QA 1GUHA 2IFQA 1GSSA 3TDGA 5KN1A 3HCZA 1V98A 2PVQA 4IQ1A 1FVKA 3VLNA 1WIKA 3VFIA 2O85A 5ID2A 1B48A 4CY8A 2D2ZA 1I9DA 5CO3A 2GLRA 4POBA 3I69A 4TR3A 3FR6A 4G0KA 3LXZA 5DJMA 3IR4A 1R5AA 2FLSA 2PERA 4NHWA 3P8WA 4HOJA 1ERUA 3EU4A 3AY8A 3PINA 4XTSA 3LYPA 3HVXA 2PVOC 5FT3A 4HU9A 2HXKA 5J3RA 3F4RA 1A2JA 2AAWA 3WD6A 1ERWA 1TU7A 3M1GA 4K1FA 4ECIA 3MSZA 2I4AA 5D9WA 4MH3A 3CSJA 2P0GA 2HI7A 5GAND 3HHVA 5IO0A 1Z7RA 1O7UA 2IN3A 2B5YA 4K9ZA 1OE8A 3J7Yb 3PPUA 2H76A 3A3TA 2I9HA 1YF0A 5AISA 3DXBA 2KUCA 2H73A 4GLTA 2KP2A 1K3YA 4PX1A 1OE7A 3PR8A 2IFQB 1VF3A 3GFKA 4LMWA 3J7Yk 3GIXA 4F82A 2XHFA 3GV1A 3UJ1A 5KOWA 2K8SA 2LNTA 4YQMA 1SKWB 1Z3EA 4G0IA 4LL4B 2VL2C 1SKSB 2ALBA 3KH9A 3IE3A 10GSA 1O85A 2AB6A 4K7IA 4OMVA 3ZFLA 1AIUA 1Y25A 2H1DA 4I8BA 3BOAA 3UMAA 4L8EA 3M3MA 5D73A 12GSA 1IYIA 4ZBBA 4PQHA 3I43A 4LMVA 2E7PA 2JACA 1S3AA 3UBKA 5G1KA 1TJDA 1GWCA 2VLVA 3P2AA 1MEKA 1F9MA 4PUFC 3MIXA 4ZILA 2HSHA 3VWWA 2HRNA 1K0OA 5AN1A 3E3EA 4NV2A 2IWTA 1WOUA 1XZOA 3ME8A 4RI6A 3ME7A 4TKYA 4X43A 2CV4A 2E2GA 1S3CA 2OE3A 3FK8A 3Q74A 1VGLA 5A4UA 4MMMA 1G7OA 1F3AA 1G6WA 1TRWA 3EMXA 5ECPB 2YOIA 3G7YA 1DUGA 4O5RA 1ZL9A 2C0GA 4CY6A 4TXOA 1K0NA 2KOKA 3KTLA 3ZIVA 1QXHA 4KUNA 3Q6OA 4LL1B 4HU7A 3UEMA 2FY6A 2DIYA 2R6KA 3TKQA 1TK8B 3IDVA 1A0RP 3GA4A 4XIHA 1FOVA 5COHA 5H5QA 2DSAA 3GTUB 2YJHA 1H75A 1SK1A 2YWOA 4AJ7A 3TJJA 1NM3A 5D9VA 1DE1A 1LBKA 3RDWA 1GSDA 4WBJA 4HS1A 4EDZA 3IRAA 1X9MB 1JLWA 3BBYA 4XRDA 4TN8A 4G9HA 1X5DA 1GSFA 4J56E 1T4YA 2K8VA 3FZ5A 3IBHA 4WF4A 4ZB8A 3TJFA 1T3BA 1MD3A 19GSA 5ABRA 4CHSA 3TKSC 1FVJA 1XW9A 4YQUA 3A5WA 1GUKA 4G2EA 2VCWA 3O76A 2DJKA 1GSUA 1XWCA 1AQWA 4ISDA 4ULXA 2FHEA 3NZNA 1ZGNA 4V2LA 5AIVA 2X8GA 3QCPA 2QA2A 2OJLA 4HQSA 1JZWA 3E0UA 3TKSE 4X0XA 2GSSA 1TRUA 2VUPA 3GKXA 4I5QA 2YWMA 2VAFA 2HE3A 1UC7A 2LUSA 5IM9A 4J57E 5CYYA 2IJYA 2BMXA 2LJAA 3V1WA 4MF6A 1THOA 3HA9A 2L59A 1TW9A 3IHGA 1RW1A 4KAEA 2PWJA 2VCVA 5JWQB 1B8XA 2LJRA 4FYBA 5HFKA 4IN0A 3LWAA 1RK4A 1SL1B 3WGEA 4KH7A 2PBJA 22GSA 4KF9A 1EOHA 2GT5A 2VM1A 3JCML 1NW2A 2X8CA 3GH6A 2DLXA 4IHUA 2LKUA 4EC0A 1YF1A 2EIQA 1U3AA 2R0GA 4PNGA 1GH2A 5KN3A 1ZMAA 2XC2A 1TU8A 1MDKA 2IMIA 4IJIA 2I81A 4MLYA 4F9ZA 2DJ3A 2A4VA 4EUYA 3HVVA 4KNDA 1TOFA 2OKAA 4EIPA 2MBTA 2C0FA 4IKHA 1PX7A 2R2JA 4ZL9A 4IP1A 1M7TA 1YY7A 4TW5A 1BJXA 3GKNA 3IHQA 4L0UA 2IMDA 1XXUA 2WS2A 3EWLA 3IC8A 1BYEA 1G0TA 3ZVJA 4D73A 3MWHA 3UL3A 3EU3A 4RUVA 5GZZB 3L9VA 2GGTA 3I6AA 3GSTA 1A23A 1X9WB 3GNJA 4PTSA 1T00A 4JRRA 2MZCA 5J9CA 1ACVA 5IMDA 2R3XA 1OKDA 1SL2B 4RI7A 3FR3A 4BL7A 1JFUA 1AQVA 2OBIA 2P5RA 4EO3A 2RIIA 1GTAA 4V1Ag 3KP8A 2H74A 5CP1A 2YNXA 1SYXA 2H71A 3ERGA 5D9XA 3H79A 5AGYA 1Z7PA 4GCIA 2H72A 7GSSA 4MJBA 1EZKA 1ZOFA 2CZ3A 2VL9A 1K0BA 4WF5A 1ERTA 2O7KA 2OE0A 2A4HA 4ZL7A 3ERWA 4KA0A 3SWLA 3N9JA 5CAXA 1EGOA 4WEYA 2GTUA 2C80A 3KMOA 4HJMA 3TJGA 3LQ7A 1X9SB 1SJ6A 1FO5A 5J5NA 5E4WA 1WWJA 4EF0A 1S3DA 2YV9A 1SENA 2L5OA 2A2RA 4RQRA 2B6MA 5F05A 2IPAA 1QK8A 2LV3A 1T7PB 3M9KA 3ZL5A 1V2AA 4D73B 3F9UA 5H5SA 4ACSA 4QQ7A 4HUAA 3APSA 1K0DA 5G30A 5ELGA 5IMCA 5HFGA 2EIRA 2LNSA 1K0MA 5IPHA 1G6YA 2TRCP 3QAVA 20GSA 2A2PA 1FG4A 4BL7B 3FZ4A 4BPYA 1M2BA 4OCEA 4MJEA 2I1UA 3UARA 3HXSA 4IELA 5G5EA 4K2DA 6GSXA 4TR1B 2VLTA 3MAKA 2GZPA 5A4VA 3ZIJA 4QL9A 1UVZA 5GAPD 2H19A 4N11A 4YAVA 5DAKA 2MBSA 4O32A 3FHKA 3IK7A 5FWGA 1JLVA 1XOAA 1GUMA 1E6BA 3QD9A 1ZYPA 3LXTA 4NMUA 2A2SA 4IQAA 2VCQA 5ECNB 1R7HA 3A2VA 5J4UA 3QR6A 1RQMA 2J23A 2PN8A 1GSQA 1QGVA 1M0UA 3LGCA 5D8IA 5ELAA 4PGTA 3TJBA 1T1VA 1EV9A 1F3BA 3MNGA 4K7NA 3HJMA 5DDLA 17GSA 5ECRB 3QFAC 3VI7A 2LS5A 1CQHA 4KE3A 2NPBA 4MZWA 4IVFA 3OR5A 4OO4A 2FWFA 4HZ2A 4TXVA 3QFBC 2X99A 1SK0A 2V1MA 1GP1A 2REMA 5ECHB 3ZZXA 3H93A 3QAWA 3DMLA 2JZTA 5G1LA 2MMAA 3APOA 4K8MA 4V2NA 1XFLA 2CX4A 5HR1A 1GNWA 2HZEA 1GL8A 2WDUA 4GSNA 3QOUA 1K3OA 5ECMB 3C73A 4MH2A 2GSTA 3TRQA 3F3RA 5IIZA 3F8UA 4XCSA 2NDOA 2YZUA 1ERVA 5A5KA 2X64A 4WETA 4OFNA 2LSTA 5ECLB 5IMZA 3F3QA 3D22A 5DAKB 4J2FA 3FYGA 2TRXA 3WT1A 3UOMA 4FO5A 3D21A 1CQGA 1C72A 4Z2TA 4BWQA 2L4CA 5C00A 3DWVA 5HR0A 5B8BA 2PPTA 2M46A 5B6MA 1FHEA 2GT6A 1USBA 1GTBA 3VWUA 2QSIA 1SJZA 1XOBA 3FZ9A 2LTKA 3L4NA 3DVWA 4MPGA 2R4VA 1BG5A 2KLXA 3GTUA 3US3A 2V2GA 1AQXA 5FHIA 1DSBA 2CT6A 1M9AA 1ML6A 1KBNA 3A5IA 4GXZA 4G0LA 1TRSA 4FYUA 1PQNA 3KXOA 1GTUA 3APQA 3CTGA 1HNAA 2LJKA 1PL2A 2HZEB 1PA3A 2FCHA 2V6OA 1MDIA 1M99A 1UA5A 4Q5NA 2VO4A 2OE1A 3UBLA 5DJLA 2VL3A 3KD0A 2CAQA 4I97A 5B8AA 3WGXA 1GSYA 1JZDA 4ZB6A 1XVQA 5CNWA 4IJ3A 5GSTA 4BA7A 4KSOA 2FNOA 5L71A 3HD5A 1TDIA 3C1SA 1DE2A 4K0NA 2AV4A 3W8SA 4DVCA 2XBIA 5B7CA 3KTBA 5ECKB 3P90A 1HD2A 3FEUA 2DKHA 3ZVJD 3N5OA 4WBRD 3G7JA 1XWAA 3CRUA 1KTEA 4K5RA 3GMFA 5BMUA 1PMTA 4PQ1A 2X8HA 3KGKA 2EC4A 1YEXA 1PD21 5D96A 4NHZA 4QL7A 3EVIA 1OYJA 3HKRA 4O92A 3QDNA 1GSEA 2MYGA 3FMWA 1H4OA 2HNLA 2IL3A 1K0CA 1THXA 3KZQA 2H0IA 3QMXA 1JHBA 2R37A 1VF1A 3F4SA 2JADA 5DALA 1HQOA 2GSQA 3EINA 3IXRA 4POMA 4XHMA 4ECJA 4ECBA 1A2MA 2GZYA 2WCIA 1EV4A 1TP9A 3F63A 4EKZA 3HJPA 1Q4JA 1PX6A 3H1NA 1XVWA 2B7JA 1AXDA 1ILOA 4GF0A 1U88A 4TVEA 2N5FA 1DBYA 2H30A 2OACA 4BVXA 5CREA 3GYKA 2VCTA 3ZMKA 2PGTA 1AUCA 1K3LA 4AJ6A 3TRXA 1NHYA 3I9V2 3ZFBA 2TIRA 2UZ8A 3ED3A 2H1GA 3RPPA 2H6YA 3IV4A 2H1AA 2F51A 1JZOA 3NOFA 5ECIB 2F8FA 4I2UA 3TOUA 1O6JA 1TTZA 3L9SA 3UAPA 1OC8A 3GL3A 2H0GA 2FGXA 2YN1A 4EXJA 2HSMA 2HLSA 1N8JA 3HZ4A 3SBCA 4Q5RA 4DSSB 2GS3A 5ECQB 4MDCA 2YWNA 4USSA 2GQKA 1I5GA 4JE1A 5DBQA 5DALB 1XWBA 1A8LA 1SD9A 3EE2A 4OD7A 1B9XC 2WB9A 5IMAA 3HDCA 2C0EA 4P3YB 5KOXA 4MK3A 4AF2A 1GTIA 2YZHA 1G7EA 1GULA 1TXXA 1QMVA 3ZITA 4JR4A 4ZL8A 2K9FA 2CVDA 4PXOA 1HNCA 4GRFA 18GSA 2L5LA 4BVXB 4X1UA 1TK5B 1PKWA 4WR5A 1W89A 1GRXA 4KCAA 4X4JA 4I6XA 4PQIA 3TUEA 1EP8A 1KNGA 2ZNMA 1FB0A 2NTOA 4KDYA 3ERFA 3LJRA 1XCCA 1EEMA 3EYTA 1SK2A 3UIWA 4IGJA 2HYXA 4WKWA 2E0QA 4F2IA 1URMA 4K5SA 3KH7A 4NWYA 3LYKA 5HFIA 2DJJA 2PU9C 4TR1A 5F06A 5JWOB 4K6XA 5H5RA 2H70A 4E8HA 4E8EA 2O87A 5KEJA 4YKFA 1OC3A 2L57A 5CRDA 3CTFA 3VURA 4N10A 4CW9A 1R4WA 1X5EA 6GSVA 1X0RA 3FRCA 4MABA 2HRAA 2HFDA 4XRAA 3DIEA 2FWGA 3D5JA 2LRCA 1EEJA 1YZXA 2J9HA 3GL5A 3U5RE 1YDKA 2CX3A 2OA7A 3EMPA 5GSSA 4HJ2A 3CRTA 1A2LA 2GDRA 3P7XA 4ICYA 2CVKA 3KIJA 1SD8A 5HQPA 3UVTA 5ENUA 2DJ0A 4V1Ap 4EVMA 2RM6A 5HR3A 3KEBA 1N2AA 9GSSA 3FY7A 3MDKA 2QKEA 4Z2RA 1ZYEA 3TB2A 3VWXA 1MD4A 4IBPA 5HR2A 4FQUA 2IMFA 5AIXA 3H4KA 3FW2A 3GHAA 2FUG2 1O73A 4MJCA 2GQMA 2IIYA 2YP6A 3D4MA 1A0FA 5G2ZA 5JWRB 1Z9HA 1SU9A 4IW9A 2WZ9A 2B5XA 3DKSA 1XIYA 2O89A 3RBTA 3G7IA 4KGIA 3A2XA 1O81A 1WP0A 3C1RA 1YJ6A 2QA1A 5F0GA 2K6VA 2G2QA 5IOWA 2VLUA 1A8YA 2B5EA 2YJ7A 4HQZA 2KP1A 3KJYA 4I2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OBK A;  3DGQ A;  1J0F A;  3RHB A;  3CSI A;  4YAP A;  2WFC A;  2BTO T;  1SKR B;  4JED A;  1XWK A;  4AGS A;  1XWG A;  1TI3 A;  3EUR A;  3DD3 A;  3HZ8 A;  3RHC A;  2H01 A;  3K8N A;  4MF7 A;  2CZ2 A;  4N0Z A;  1FW1 A;  1J9B A;  5IO2 A;  1FB6 A;  5J41 A;  3KP9 A;  3LOR A;  1MDJ A;  2YAN A;  3NIV A;  4ZIJ A;  4Q5Q A;  3TKR A;  1M9B A;  2FWE A;  14GS A;  4MCU A;  2RLI A;  2JZR A;  4JR6 A;  3ZLP A;  5IOX A;  5CRW A;  1BX9 A;  3VWV A;  4KDU A;  5D9T A;  1PN9 A;  2NBS A;  2CAI A;  1HYU A;  4RQX A;  2C3Q A;  4PNF A;  3W6G A;  2ES7 A;  3GUS A;  2JZS A;  4EE0 A;  5D93 A;  2HT9 A;  4N0V A;  5DCH A;  4CDO A;  2C3T A;  2F8A A;  5ECO B;  4ML6 A;  4OCF A;  3QPM A;  1U3I A;  2G0F A;  3DEX A;  4F03 A;  4FH8 A;  4ZBD A;  1B4P A;  2DJ2 A;  2E2M A;  5JCG A;  1R5P A;  2CA8 A;  3IC4 A;  4GST A;  3CSH A;  4F0C A;  3O3T A;  1GLQ A;  4O7H A;  2AUV A;  2MMN A;  3EC3 A;  2V32 A;  5ID2 B;  3D6I A;  4YQV A;  1Z6M A;  2DJ1 A;  4GSS A;  3TCO A;  3F4T A;  3O6T A;  4WR4 A;  1SL0 B;  2DMM A;  5KN2 A;  2FD3 A;  1PSQ A;  4DSR A;  4OO5 A;  3FR9 A;  1O8W A;  1OC9 A;  2HSY A;  1AW9 A;  3GKM A;  2JSY A;  4JZQ A;  2KHP A;  1F6M C;  1M2D A;  2DIZ A;  2H6Z A;  2WRT A;  2ZUP A;  4ZXG A;  2H8L A;  3Q18 A;  1B9Y C;  3IAS 2;  2I3Y A;  1WE0 A;  4F0B A;  2L6D A;  3F6F A;  4JBB A;  4H86 A;  2GVP A;  5J9B A;  4POK A;  3GRX A;  4OFT A;  4Z7X A;  2N5A A;  2QC7 A;  3VI5 A;  2B3S A;  6GST A;  2RUE A;  3C7M A;  4BVY A;  1BQ7 A;  5LNK e;  3IAM 2;  1R26 A;  3GX0 A;  1VF4 A;  2C8U A;  4EL1 A;  3VK9 A;  5C04 A;  2LQQ A;  4NXI A;  4XS1 A;  1JZR A;  4L0W A;  3ZYW A;  3GKK A;  5DCG A;  2PUK C;  4NV5 A;  3CBU A;  5B6N A;  3GH9 A;  4PUR A;  2VL2 A;  1ZYQ B;  1XBS A;  2YCD A;  2B7K A;  1V9W A;  1PRX A;  2LQO A;  2C3N A;  3FKF A;  8GSS A;  11GS A;  2IMK A;  1PGT A;  3KMN A;  3PGT A;  3WT2 A;  1O8X A;  2JL4 A;  5CRG A;  1QUW A;  4G10 A;  2V41 A;  3LG6 A;  3BCK A;  1WJK A;  4DSS A;  2AHE A;  3DVX A;  1GNE A;  3WGD A;  2VM2 A;  1W4V A;  2CVB A;  1OC9 B;  3PH9 A;  3Q19 A;  2FWH A;  3VPT A;  2LRN A;  1F37 A;  3W8J A;  2JSZ A;  4HI7 A;  3C8E A;  4PUA A;  5EPF A;  5LD0 A;  4XS4 A;  2WGR A;  3IOS A;  2YV7 A;  2MMZ A;  4ZBA A;  3BJ5 A;  3LSZ A;  5G5F A;  1SYR A;  5EY6 A;  1XPV A;  1WMJ A;  1T8E B;  1Q98 A;  2VOC A;  1EWX A;  3TGZ A;  4L5O A;  5IMV A;  2B1L A;  4MF5 A;  1IYH A;  3TKP A;  1YKC A;  2RM5 A;  4GQC A;  1WPI A;  4YH2 A;  5DQS A;  1K0A A;  2HZF A;  3TOT A;  5F8B A;  4TR0 A;  2F9S A;  1BAY A;  1U87 A;  2XPD A;  4ECC A;  4K0G A;  3E9J B;  4MP4 A;  5LCZ A;  1Z6N A;  2VD0 A;  2YWI A;  1YKA A;  4GQF A;  4IP6 A;  4MJA A;  1FAA A;  4ILF A;  2VCZ A;  5EVO A;  4XS6 A;  2H0H A;  3LEF A;  1NSW A;  1ZCP A;  2VIM A;  1T4Z A;  5IQY A;  1A24 A;  1GLP A;  5KN0 A;  2L6C A;  4KB3 A;  2H1B A;  4TXO B;  1M2A A;  1NHO A;  1EGR A;  2H6X A;  1EOG A;  2FA8 A;  4FYC A;  3ZRE A;  3UVH A;  4WXT A;  3H8Q A;  6GSW A;  2IME A;  4ML1 A;  2DML A;  2P5Q A;  1YEP A;  1TKD B;  5E59 A;  3WYW A;  2EIO A;  4NAX A;  2QGV A;  4NPB A;  3ZTL A;  2GSR A;  4XS4 B;  1AAZ A;  2XPE A;  1OAZ A;  5F07 A;  4KCE A;  3DYR A;  1SJI A;  4GTU A;  4MZB A;  3C71 A;  2AJQ B;  16GS A;  1AC1 A;  2MMO A;  3D4T A;  3TKS A;  5JCU A;  3ZML A;  5INY A;  2GZZ A;  1TI1 A;  4G19 A;  4FIW A;  1XW5 A;  1OKT A;  1PL1 A;  2P31 A;  2GQL A;  2DC5 A;  6GSY A;  2VCX A;  13GS A;  3RPN A;  1X5C A;  4KW6 A;  2H66 A;  4EDY A;  4DSQ A;  3HYP A;  3GSS A;  4KDX A;  4HZ4 A;  3L0H A;  2LEG A;  4KX4 A;  4HDE A;  6GSS A;  4K7O A;  4TOP A;  3LFL A;  3F0I A;  3QAG A;  1V58 A;  1LJR A;  5IPG A;  3M0F A;  2NVL A;  1E2Y A;  2YPM A;  3HVS A;  6GSU A;  1PKZ A;  4AJ8 A;  3GUR A;  4DEJ A;  4TRX A;  3TJK A;  2HRF A;  3F6D A;  2C1Y A;  4JU5 A;  1BED A;  3U6V A;  2C4J A;  2C0D A;  2M80 A;  5ECS A;  1V57 A;  4MZC A;  1J08 A;  5G31 A;  1ON4 A;  2ON5 A;  1TRV A;  4ID0 A;  3HY2 A;  3IK9 A;  2FA4 A;  5A4W A;  3S9F A;  2B1K A;  2LRT A;  2CQ9 A;  3VPQ A;  1YQ1 A;  2Z9S A;  1Y6E A;  4V2M A;  3IA1 A;  2DBC A;  4OFM A;  5DVB A;  3TRP A;  3CMI A;  3GX8 A;  5JCW A;  1ABA A;  4GWR A;  1F2E A;  2V6K A;  5DQY A;  2ON7 A;  1UN2 A;  1Z5Y E;  2WUL A;  3KCM A;  4MA9 A;  5IMF A;  2PMT A;  2O8V B;  3CYN A;  1U6T A;  3ISO A;  5CRH A;  2F3M A;  1WRY A;  2WJU A;  1VF2 A;  1ST9 A;  2H75 A;  4KSM A;  4MPF A;  3ZRD A;  2RUF A;  1OVN A;  3A2W A;  3BD2 A;  1QQ2 A;  3M9J A;  3KM6 A;  1HNB A;  1B4Q A;  1XW6 A;  1MTC A;  3BCI A;  1ZZY A;  3RAZ A;  2JU5 A;  4LA1 A;  1VRS D;  3L9U A;  3FZA A;  1TK0 B;  3R2Q A;  2R5G A;  3GN3 A;  2XBQ A;  3L78 A;  2N5B A;  3M8N A;  3DRN A;  4BWS A;  2K18 A;  3D0Z A;  4IS0 A;  1QFN A;  4OWY A;  4TR4 A;  2VD1 A;  3IPZ A;  4L5L A;  2OAD A;  1V40 A;  2ZCT A;  4LLR A;  3CXG A;  4POL A;  3G9B A;  5EL8 A;  4Q5F A;  4N30 A;  1EP7 A;  3HJO A;  2AYT A;  1LU4 A;  4ZB9 A;  2BJX A;  1KEB A;  2M72 A;  4HEA 2;  2L4Q A;  1GUH A;  2IFQ A;  1GSS A;  3TDG A;  5KN1 A;  3HCZ A;  1V98 A;  2PVQ A;  4IQ1 A;  1FVK A;  3VLN A;  1WIK A;  3VFI A;  2O85 A;  5ID2 A;  1B48 A;  2D2Z A;  1I9D A;  5CO3 A;  2GLR A;  4POB A;  3I69 A;  4TR3 A;  3FR6 A;  3LXZ A;  5DJM A;  3IR4 A;  1R5A A;  2FLS A;  2PER A;  4NHW A;  3P8W A;  4HOJ A;  1ERU A;  3EU4 A;  3AY8 A;  3PIN A;  4XTS A;  3LYP A;  3HVX A;  2PVO C;  5FT3 A;  4HU9 A;  2HXK A;  5J3R A;  3F4R A;  1A2J A;  2AAW A;  3WD6 A;  1ERW A;  1TU7 A;  3M1G A;  4K1F A;  4ECI A;  3MSZ A;  2I4A A;  5D9W A;  4MH3 A;  3CSJ A;  2P0G A;  2HI7 A;  5GAN D;  3HHV A;  5IO0 A;  1Z7R A;  1O7U A;  2IN3 A;  2B5Y A;  4K9Z A;  1OE8 A;  3J7Y b;  2H76 A;  3A3T A;  2I9H A;  1YF0 A;  5AIS A;  3DXB A;  2KUC A;  2H73 A;  4GLT A;  2KP2 A;  1K3Y A;  4PX1 A;  1OE7 A;  3PR8 A;  2IFQ B;  1VF3 A;  3GFK A;  4LMW A;  3J7Y k;  3GIX A;  4F82 A;  2XHF A;  3GV1 A;  3UJ1 A;  2K8S A;  2LNT A;  4YQM A;  1SKW B;  1Z3E A;  4LL4 B;  2VL2 C;  1SKS B;  2ALB A;  3KH9 A;  3IE3 A;  10GS A;  1O85 A;  2AB6 A;  4K7I A;  4OMV A;  3ZFL A;  1AIU A;  1Y25 A;  2H1D A;  4I8B A;  3BOA A;  3UMA A;  4L8E A;  3M3M A;  5D73 A;  12GS A;  1IYI A;  4ZBB A;  4PQH A;  3I43 A;  4LMV A;  2E7P A;  2JAC A;  1S3A A;  3UBK A;  5G1K A;  1TJD A;  1GWC A;  2VLV A;  3P2A A;  1MEK A;  1F9M A;  4PUF C;  4ZIL A;  2HSH A;  3VWW A;  2HRN A;  1K0O A;  5AN1 A;  3E3E A;  4NV2 A;  2IWT A;  1WOU A;  1XZO A;  3ME8 A;  4RI6 A;  3ME7 A;  4TKY A;  4X43 A;  2CV4 A;  2E2G A;  1S3C A;  2OE3 A;  3FK8 A;  3Q74 A;  1VGL A;  5A4U A;  4MMM A;  1G7O A;  1F3A A;  1G6W A;  1TRW A;  3EMX A;  5ECP B;  2YOI A;  3G7Y A;  1DUG A;  4O5R A;  1ZL9 A;  2C0G A;  4TXO A;  1K0N A;  2KOK A;  3KTL A;  3ZIV A;  1QXH A;  4KUN A;  3Q6O A;  4LL1 B;  4HU7 A;  3UEM A;  2FY6 A;  2DIY A;  2R6K A;  3TKQ A;  1TK8 B;  3IDV A;  1A0R P;  3GA4 A;  4XIH A;  1FOV A;  5COH A;  5H5Q A;  2DSA A;  3GTU B;  2YJH A;  1H75 A;  1SK1 A;  2YWO A;  4AJ7 A;  3TJJ A;  1NM3 A;  5D9V A;  1DE1 A;  1LBK A;  3RDW A;  1GSD A;  4WBJ A;  4HS1 A;  4EDZ A;  3IRA A;  1X9M B;  1JLW A;  3BBY A;  4XRD A;  4TN8 A;  4G9H A;  1X5D A;  1GSF A;  4J56 E;  1T4Y A;  2K8V A;  3FZ5 A;  3IBH A;  4WF4 A;  4ZB8 A;  3TJF A;  1T3B A;  1MD3 A;  19GS A;  5ABR A;  4CHS A;  3TKS C;  1FVJ A;  1XW9 A;  4YQU A;  3A5W A;  1GUK A;  4G2E A;  2VCW A;  3O76 A;  2DJK A;  1GSU A;  1XWC A;  1AQW A;  4ISD A;  4ULX A;  2FHE A;  3NZN A;  1ZGN A;  4V2L A;  5AIV A;  2X8G A;  3QCP A;  2OJL A;  4HQS A;  1JZW A;  3E0U A;  3TKS E;  4X0X A;  2GSS A;  1TRU A;  2VUP A;  3GKX A;  4I5Q A;  2YWM A;  2VAF A;  2HE3 A;  1UC7 A;  2LUS A;  5IM9 A;  4J57 E;  5CYY A;  2IJY A;  2BMX A;  2LJA A;  3V1W A;  4MF6 A;  1THO A;  3HA9 A;  2L59 A;  1TW9 A;  1RW1 A;  4KAE A;  2PWJ A;  2VCV A;  5JWQ B;  1B8X A;  2LJR A;  4FYB A;  5HFK A;  4IN0 A;  3LWA A;  1RK4 A;  1SL1 B;  3WGE A;  4KH7 A;  2PBJ A;  22GS A;  1EOH A;  2GT5 A;  2VM1 A;  3JCM L;  1NW2 A;  2X8C A;  3GH6 A;  2DLX A;  4IHU A;  2LKU A;  4EC0 A;  1YF1 A;  2EIQ A;  1U3A A;  4PNG A;  1GH2 A;  5KN3 A;  1ZMA A;  2XC2 A;  1TU8 A;  1MDK A;  2IMI A;  4IJI A;  2I81 A;  4MLY A;  4F9Z A;  2DJ3 A;  2A4V A;  4EUY A;  3HVV A;  4KND A;  1TOF A;  2OKA A;  2MBT A;  2C0F A;  4IKH A;  1PX7 A;  2R2J A;  4ZL9 A;  4IP1 A;  1M7T A;  1YY7 A;  4TW5 A;  1BJX A;  3GKN A;  3IHQ A;  4L0U A;  2IMD A;  1XXU A;  2WS2 A;  3EWL A;  1BYE A;  1G0T A;  3ZVJ A;  4D73 A;  3MWH A;  3UL3 A;  3EU3 A;  4RUV A;  5GZZ B;  3L9V A;  2GGT A;  3I6A A;  3GST A;  1A23 A;  1X9W B;  3GNJ A;  1T00 A;  4JRR A;  2MZC A;  5J9C A;  1ACV A;  5IMD A;  2R3X A;  1OKD A;  1SL2 B;  4RI7 A;  3FR3 A;  4BL7 A;  1JFU A;  1AQV A;  2OBI A;  2P5R A;  4EO3 A;  2RII A;  1GTA A;  4V1A g;  3KP8 A;  2H74 A;  5CP1 A;  2YNX A;  1SYX A;  2H71 A;  3ERG A;  5D9X A;  3H79 A;  5AGY A;  1Z7P A;  4GCI A;  2H72 A;  7GSS A;  4MJB A;  1EZK A;  1ZOF A;  2CZ3 A;  2VL9 A;  1K0B A;  4WF5 A;  1ERT A;  2O7K A;  2OE0 A;  4ZL7 A;  3ERW A;  4KA0 A;  3SWL A;  3N9J A;  5CAX A;  1EGO A;  4WEY A;  2GTU A;  2C80 A;  3KMO A;  4HJM A;  3TJG A;  3LQ7 A;  1X9S B;  1SJ6 A;  1FO5 A;  5J5N A;  5E4W A;  1WWJ A;  4EF0 A;  1S3D A;  2YV9 A;  1SEN A;  2L5O A;  2A2R A;  4RQR A;  2B6M A;  5F05 A;  2IPA A;  1QK8 A;  2LV3 A;  1T7P B;  3M9K A;  3ZL5 A;  1V2A A;  4D73 B;  3F9U A;  5H5S A;  4ACS A;  4QQ7 A;  4HUA A;  3APS A;  1K0D A;  5G30 A;  5ELG A;  5IMC A;  5HFG A;  2EIR A;  2LNS A;  1K0M A;  5IPH A;  1G6Y A;  2TRC P;  3QAV A;  20GS A;  1FG4 A;  3FZ4 A;  4BPY A;  1M2B A;  4OCE A;  4MJE A;  2I1U A;  3UAR A;  3HXS A;  4IEL A;  5G5E A;  4K2D A;  6GSX A;  4TR1 B;  2VLT A;  3MAK A;  2GZP A;  5A4V A;  3ZIJ A;  4QL9 A;  1UVZ A;  5GAP D;  2H19 A;  4N11 A;  4YAV A;  5DAK A;  2MBS A;  4O32 A;  3FHK A;  3IK7 A;  5FWG A;  1JLV A;  1XOA A;  1GUM A;  1E6B A;  3QD9 A;  3LXT A;  4NMU A;  2A2S A;  4IQA A;  2VCQ A;  5ECN B;  1R7H A;  3A2V A;  5J4U A;  3QR6 A;  1RQM A;  2J23 A;  2PN8 A;  1GSQ A;  1QGV A;  1M0U A;  3LGC A;  5D8I A;  5ELA A;  4PGT A;  3TJB A;  1T1V A;  1EV9 A;  1F3B A;  3MNG A;  4K7N A;  3HJM A;  5DDL A;  17GS A;  5ECR B;  3QFA C;  3VI7 A;  2LS5 A;  1CQH A;  4KE3 A;  2NPB A;  4MZW A;  4IVF A;  3OR5 A;  4OO4 A;  2FWF A;  4HZ2 A;  4TXV A;  3QFB C;  2X99 A;  1SK0 A;  2V1M A;  1GP1 A;  2REM A;  5ECH B;  3ZZX A;  3H93 A;  3QAW A;  3DML A;  2JZT A;  5G1L A;  2MMA A;  3APO A;  4K8M A;  4V2N A;  1XFL A;  2CX4 A;  5HR1 A;  1GNW A;  2HZE A;  1GL8 A;  2WDU A;  4GSN A;  3QOU A;  1K3O A;  5ECM B;  3C73 A;  4MH2 A;  2GST A;  3TRQ A;  3F3R A;  5IIZ A;  3F8U A;  4XCS A;  2NDO A;  2YZU A;  1ERV A;  5A5K A;  2X64 A;  4WET A;  4OFN A;  2LST A;  5ECL B;  5IMZ A;  3F3Q A;  3D22 A;  5DAK B;  4J2F A;  3FYG A;  2TRX A;  3WT1 A;  3UOM A;  4FO5 A;  3D21 A;  1CQG A;  1C72 A;  4BWQ A;  2L4C A;  5C00 A;  3DWV A;  5HR0 A;  5B8B A;  2PPT A;  2M46 A;  5B6M A;  1FHE A;  2GT6 A;  1USB A;  1GTB A;  3VWU A;  2QSI A;  1SJZ A;  1XOB A;  3FZ9 A;  2LTK A;  3L4N A;  3DVW A;  4MPG A;  2R4V A;  1BG5 A;  2KLX A;  3GTU A;  3US3 A;  2V2G A;  1AQX A;  5FHI A;  1DSB A;  2CT6 A;  1M9A A;  1ML6 A;  1KBN A;  4GXZ A;  1TRS A;  4FYU A;  1PQN A;  3KXO A;  1GTU A;  3APQ A;  3CTG A;  1HNA A;  2LJK A;  1PL2 A;  2HZE B;  1PA3 A;  2FCH A;  2V6O A;  1MDI A;  1M99 A;  1UA5 A;  4Q5N A;  2VO4 A;  2OE1 A;  3UBL A;  5DJL A;  2VL3 A;  3KD0 A;  2CAQ A;  4I97 A;  5B8A A;  3WGX A;  1GSY A;  1JZD A;  4ZB6 A;  1XVQ A;  5CNW A;  4IJ3 A;  5GST A;  4BA7 A;  4KSO A;  2FNO A;  5L71 A;  3HD5 A;  1TDI A;  3C1S A;  1DE2 A;  4K0N A;  2AV4 A;  3W8S A;  4DVC A;  2XBI A;  5B7C A;  3KTB A;  5ECK B;  3P90 A;  1HD2 A;  3FEU A;  3ZVJ D;  3N5O A;  4WBR D;  3G7J A;  1XWA A;  3CRU A;  1KTE A;  3GMF A;  1PMT A;  4PQ1 A;  2X8H A;  3KGK A;  2EC4 A;  1YEX A;  1PD2 1;  5D96 A;  4NHZ A;  4QL7 A;  3EVI A;  1OYJ A;  3HKR A;  4O92 A;  3QDN A;  1GSE A;  2MYG A;  1H4O A;  2HNL A;  2IL3 A;  1K0C A;  1THX A;  3KZQ A;  2H0I A;  3QMX A;  1JHB A;  2R37 A;  1VF1 A;  3F4S A;  2JAD A;  5DAL A;  1HQO A;  2GSQ A;  3EIN A;  3IXR A;  4POM A;  4XHM A;  4ECJ A;  4ECB A;  1A2M A;  2GZY A;  2WCI A;  1EV4 A;  1TP9 A;  3F63 A;  4EKZ A;  3HJP A;  1Q4J A;  1PX6 A;  3H1N A;  1XVW A;  2B7J A;  1AXD A;  1ILO A;  4GF0 A;  1U88 A;  4TVE A;  2N5F A;  1DBY A;  2H30 A;  2OAC A;  4BVX A;  5CRE A;  3GYK A;  2VCT A;  3ZMK A;  2PGT A;  1AUC A;  1K3L A;  4AJ6 A;  3TRX A;  1NHY A;  3I9V 2;  3ZFB A;  2TIR A;  3ED3 A;  2H1G A;  3RPP A;  2H6Y A;  3IV4 A;  2H1A A;  2F51 A;  1JZO A;  3NOF A;  5ECI B;  2F8F A;  4I2U A;  3TOU A;  1O6J A;  1TTZ A;  3L9S A;  3UAP A;  1OC8 A;  3GL3 A;  2H0G A;  2FGX A;  2YN1 A;  4EXJ A;  2HLS A;  1N8J A;  3HZ4 A;  3SBC A;  4Q5R A;  4DSS B;  2GS3 A;  5ECQ B;  4MDC A;  2YWN A;  2GQK A;  1I5G A;  4JE1 A;  5DBQ A;  5DAL B;  1XWB A;  1A8L A;  1SD9 A;  3EE2 A;  4OD7 A;  1B9X C;  2WB9 A;  5IMA A;  3HDC A;  2C0E A;  4P3Y B;  4MK3 A;  4AF2 A;  1GTI A;  2YZH A;  1G7E A;  1GUL A;  1TXX A;  1QMV A;  3ZIT A;  4JR4 A;  4ZL8 A;  2K9F A;  2CVD A;  4PXO A;  1HNC A;  4GRF A;  18GS A;  2L5L A;  4X1U A;  1TK5 B;  1PKW A;  4WR5 A;  1W89 A;  1GRX A;  4KCA A;  4I6X A;  4PQI A;  3TUE A;  1EP8 A;  1KNG A;  2ZNM A;  1FB0 A;  2NTO A;  4KDY A;  3ERF A;  3LJR A;  1XCC A;  1EEM A;  3EYT A;  1SK2 A;  3UIW A;  4IGJ A;  2HYX A;  4WKW A;  2E0Q A;  4F2I A;  1URM A;  3KH7 A;  4NWY A;  3LYK A;  5HFI A;  2DJJ A;  2PU9 C;  4TR1 A;  5F06 A;  5JWO B;  4K6X A;  5H5R A;  2H70 A;  4E8H A;  4E8E A;  2O87 A;  5KEJ A;  1OC3 A;  2L57 A;  5CRD A;  3CTF A;  3VUR A;  4N10 A;  4CW9 A;  1R4W A;  1X5E A;  6GSV A;  1X0R A;  3FRC A;  4MAB A;  2HFD A;  4XRA A;  3DIE A;  2FWG A;  3D5J A;  2LRC A;  1EEJ A;  1YZX A;  2J9H A;  3GL5 A;  3U5R E;  1YDK A;  2CX3 A;  2OA7 A;  3EMP A;  5GSS A;  4HJ2 A;  3CRT A;  1A2L A;  2GDR A;  3P7X A;  2CVK A;  3KIJ A;  1SD8 A;  5HQP A;  3UVT A;  5ENU A;  2DJ0 A;  4V1A p;  4EVM A;  2RM6 A;  5HR3 A;  3KEB A;  1N2A A;  9GSS A;  3FY7 A;  3MDK A;  2QKE A;  1ZYE A;  3TB2 A;  3VWX A;  1MD4 A;  4IBP A;  5HR2 A;  2IMF A;  5AIX A;  3H4K A;  3FW2 A;  3GHA A;  2FUG 2;  1O73 A;  4MJC A;  2GQM A;  2IIY A;  2YP6 A;  3D4M A;  1A0F A;  5G2Z A;  5JWR B;  1Z9H A;  1SU9 A;  4IW9 A;  2WZ9 A;  2B5X A;  3DKS A;  1XIY A;  2O89 A;  3RBT A;  3G7I A;  4KGI A;  3A2X A;  1O81 A;  1WP0 A;  3C1R A;  1YJ6 A;  5F0G A;  2K6V A;  2G2Q A;  5IOW A;  2VLU A;  1A8Y A;  2B5E A;  2YJ7 A;  4HQZ A;  2KP1 A;  3KJY A;  4I2T A; 
#chains in the Genus database with same CATH topology
 2F2C A;  2OBK A;  4Z2U A;  3DGQ A;  1J0F A;  3RHB A;  3CSI A;  3NDQ A;  4YAP A;  2WFC A;  2BTO T;  1TD6 A;  1SKR B;  4JED A;  1XWK A;  4AGS A;  1XWG A;  1FVV B;  1TI3 A;  3EUR A;  3DD3 A;  3HZ8 A;  3RHC A;  2H01 A;  4HL4 A;  3K8N A;  4MF7 A;  2CZ2 A;  4N0Z A;  1FW1 A;  1J9B A;  2R0C A;  5IO2 A;  1FB6 A;  5J41 A;  3KP9 A;  3LOR A;  2QFZ A;  4YOZ A;  1MDJ A;  2YAN A;  1H25 B;  3NIV A;  1PKD B;  3DTO A;  4ZIJ A;  4Q5Q A;  3TKR A;  1M9B A;  2FWE A;  14GS A;  4MCU A;  2RLI A;  2JZR A;  2DD4 B;  4JR6 A;  3ZLP A;  5IOX A;  5CRW A;  1BX9 A;  3VWV A;  4KDU A;  5D9T A;  4F7L B;  1PN9 A;  2NBS A;  2CAI A;  1HYU A;  4RQX A;  2C3Q A;  2BS3 A;  4PNF A;  3W6G A;  2ES7 A;  3GUS A;  2JZS A;  4EE0 A;  5D93 A;  1OKW B;  2D0Q B;  2HT9 A;  4N0V A;  2C4G B;  5DCH A;  4CDO A;  2C3T A;  2F8A A;  5ECO B;  2W2H A;  4ML6 A;  4OCF A;  3QPM A;  1U3I A;  2G0F A;  3DEX A;  4F03 A;  4FH8 A;  4ZBD A;  1B4P A;  2DJ2 A;  2E2M A;  5JCG A;  1R5P A;  2CA8 A;  3IC4 A;  4GST A;  3CSH A;  2QDJ A;  4F0C A;  3O3T A;  1GLQ A;  4EOI B;  4O7H A;  2AUV A;  2MMN A;  1FIN B;  3EC3 A;  3R3E A;  2V32 A;  4JX5 A;  5ID2 B;  3D6I A;  4YQV A;  1Z6M A;  2DJ1 A;  2AHJ B;  1BU2 A;  4GSS A;  3TCO A;  3F4T A;  3O6T A;  4WR4 A;  1SL0 B;  2DMM A;  5KN2 A;  2FD3 A;  2C5X B;  3RGF B;  1PSQ A;  4DSR A;  4OO5 A;  2PJQ A;  3FR9 A;  1O8W A;  1OC9 A;  2HSY A;  1AW9 A;  5DQV A;  3GKM A;  2JSY A;  2QF7 A;  4JZQ A;  2KHP A;  1F6M C;  1M2D A;  3MIA B;  2DIZ A;  2H6Z A;  2WRT A;  2ZUP A;  4ZXG A;  2H8L A;  3Q18 A;  1B9Y C;  3IAS 2;  4BCM B;  2I3Y A;  1WE0 A;  4F0B A;  2L6D A;  3F6F A;  4JBB A;  4H86 A;  4CFM B;  2GVP A;  5J9B A;  4POK A;  3GRX A;  4OFT A;  4Z7X A;  2N5A A;  2QC7 A;  3VI5 A;  2B3S A;  6GST A;  2RUE A;  3BHT B;  3C7M A;  4BVY A;  2IW6 B;  1BQ7 A;  4MNN A;  5LNK e;  3IAM 2;  1R26 A;  3GX0 A;  1VF4 A;  2C8U A;  2ZPE B;  4EL1 A;  4NC6 A;  3VK9 A;  5C04 A;  2LQQ A;  4NXI A;  4XS1 A;  1JZR A;  5L2W B;  4L0W A;  3ZYW A;  3GKK A;  5DCG A;  4BCP B;  3LW9 A;  2PUK C;  4NV5 A;  3CBU A;  5B6N A;  3GH9 A;  4PUR A;  2VL2 A;  1ZYQ B;  1XBS A;  2YCD A;  2B7K A;  1V9W A;  1PRX A;  2LQO A;  2C3N A;  3FKF A;  8GSS A;  11GS A;  2IMK A;  1PGT A;  3KMN A;  3PGT A;  3WT2 A;  1OL2 B;  1O8X A;  2JL4 A;  5CRG A;  1QUW A;  4G10 A;  2V41 A;  3LG6 A;  3BCK A;  1WJK A;  4DSS A;  4OB2 B;  2AHE A;  4O5U A;  3DVX A;  1GNE A;  3WGD A;  2VM2 A;  1W4V A;  2CVB A;  1OC9 B;  1FOH A;  3PH9 A;  4K2X A;  3Q19 A;  2FWH A;  2WMB B;  3VPT A;  4A5P A;  2LRN A;  1F37 A;  3W8J A;  2JSZ A;  4HI7 A;  3C8E A;  4PUA A;  5EPF A;  5LD0 A;  4XS4 A;  3QHW B;  2WGR A;  1AD6 A;  3IOS A;  2YV7 A;  2MMZ A;  4ZBA A;  1AIS B;  3BJ5 A;  3LSZ A;  5G5F A;  1SYR A;  5EY6 A;  1XPV A;  1WMJ A;  1T8E B;  1Q98 A;  2WJ9 A;  1GH6 B;  2VOC A;  1EWX A;  3TGZ A;  3BG9 A;  4L5O A;  4BVY B;  3A8G B;  5IMV A;  2B1L A;  4MF5 A;  4EOP B;  1IYH A;  4M6V A;  3TKP A;  1YKC A;  2RM5 A;  3TW7 A;  4GQC A;  1WPI A;  4YH2 A;  5DQS A;  1K0A A;  2HZF A;  3TOT A;  5F8B A;  4TR0 A;  2F9S A;  4EC9 B;  1BAY A;  1U87 A;  2XPD A;  4ECC A;  4K0G A;  1PN0 A;  3E9J B;  4MP4 A;  5LCZ A;  1Z6N A;  2VD0 A;  2YWI A;  1YKA A;  4GQF A;  4IP6 A;  4MJA A;  1FAA A;  4ILF A;  2VCZ A;  5EVO A;  4XS6 A;  4HLQ A;  4BBS M;  2H0H A;  3LEF A;  3A8O B;  3HO8 A;  1NSW A;  1ZCP A;  2VIM A;  4OB1 B;  1T4Z A;  5IQY A;  1A24 A;  1GLP A;  5KN0 A;  2L6C A;  4KB3 A;  2H1B A;  4TXO B;  1M2A A;  1NHO A;  1EGR A;  2H6X A;  1EOG A;  3BG5 A;  2FA8 A;  4FYC A;  3ZRE A;  3MYD A;  3UVH A;  4WXT A;  4EOR B;  2UZD B;  2BS2 A;  2C5V B;  1IRE B;  3H8Q A;  1GUX A;  5HQ0 B;  6GSW A;  2ZZD B;  2IME A;  4ML1 A;  3QXE B;  2DML A;  2P5Q A;  1PFO A;  1YEP A;  1TKD B;  2QQ8 A;  5E59 A;  3WYW A;  3BLQ B;  2EIO A;  4NAX A;  2QGV A;  4NPB A;  3ZTL A;  2GSR A;  1QLB A;  4XS4 B;  1AAZ A;  2XPE A;  1OAZ A;  5F07 A;  4F7J B;  3LQ5 B;  4ELL A;  4BCO B;  4KCE A;  3DYR A;  1SJI A;  4GTU A;  3G33 B;  4MZB A;  3C71 A;  2AJQ B;  1UNL D;  4CFX B;  3EPT A;  1JOW A;  16GS A;  1AC1 A;  2MMO A;  3D4T A;  3TKS A;  4YC3 B;  5JCU A;  3ZML A;  5INY A;  2GZZ A;  1TI1 A;  4G19 A;  4FIW A;  1XW5 A;  1OKT A;  1O9K A;  4EIQ A;  1PL1 A;  2P31 A;  2GQL A;  2DC5 A;  6GSY A;  2VCX A;  13GS A;  3RPN A;  1X5C A;  4KW6 A;  3DL1 A;  2H66 A;  4EDY A;  4DSQ A;  3QHR B;  3HYP A;  3GSS A;  4KDX A;  4HZ4 A;  3DJB A;  3L0H A;  2LEG A;  4KX4 A;  4HDE A;  6GSS A;  4K7O A;  4TOP A;  4YKG A;  3LFL A;  3F0I A;  3QAG A;  1V58 A;  2ZCF B;  1LJR A;  5IPG A;  3M0F A;  2NVL A;  1E2Y A;  2YPM A;  3HVS A;  6GSU A;  1PKZ A;  4AJ8 A;  3GUR A;  4DEJ A;  4TRX A;  3TJK A;  2HRF A;  2IW9 B;  3F6D A;  1UNG D;  2C1Y A;  4JU5 A;  3VYH B;  1GUX B;  5BNJ B;  1BED A;  3U6V A;  2C4J A;  2C0D A;  2M80 A;  5ECS A;  3DOG B;  1V57 A;  4MZC A;  1QMZ B;  1J08 A;  5G31 A;  1ON4 A;  1AHJ B;  2ZPF B;  2ON5 A;  1TRV A;  4ID0 A;  3HY2 A;  3IK9 A;  2FA4 A;  5A4W A;  3S9F A;  2B1K A;  2LRT A;  2CQ9 A;  2UZE B;  3VPQ A;  1YQ1 A;  2Z9S A;  1Y6E A;  4V2M A;  2PK9 B;  3IA1 A;  4O5Q A;  4MFE A;  2DBC A;  4OFM A;  5DVB A;  4CRL B;  2BS4 A;  3PO3 S;  3TRP A;  3CMI A;  3GX8 A;  5HVY B;  1ABA A;  5JCW A;  4GWR A;  1F2E A;  4HNT A;  1ZYN A;  3KHI A;  2V6K A;  5DQY A;  2ON7 A;  1UN2 A;  1Z5Y E;  2DKI A;  2WUL A;  3KCM A;  4MA9 A;  5IMF A;  2PMT A;  2O8V B;  3CYN A;  1U6T A;  3ISO A;  5CRH A;  2F3M A;  1WRY A;  2WJU A;  1VF2 A;  1ST9 A;  2H75 A;  4KSM A;  4MPF A;  3ZRD A;  1XO2 A;  5HBJ B;  2RUF A;  1OVN A;  3A2W A;  3BD2 A;  1QQ2 A;  3M9J A;  3KM6 A;  1HNB A;  1B4Q A;  1MTC A;  1XW6 A;  1OIY B;  3BCI A;  2KMG A;  2WXV B;  1ZZY A;  3RAZ A;  1H27 B;  2JU5 A;  2R0P A;  4BCK B;  4LA1 A;  1VRS D;  3L9U A;  3FZA A;  1UNH D;  3R2Q A;  1TK0 B;  2R5G A;  2PHG A;  3GN3 A;  2XBQ A;  3L78 A;  1ENW A;  2N5B A;  3M8N A;  5BRT A;  3DRN A;  2HRK A;  1F5Q B;  4BWS A;  4NST B;  2K18 A;  3D0Z A;  4IS0 A;  1QFN A;  1VOL A;  4OWY A;  4YOO A;  4TR4 A;  2VD1 A;  3IPZ A;  4LOC A;  4L5L A;  2OAD A;  1XG8 A;  1V40 A;  4HSC X;  3WVE B;  2ZCT A;  4LLR A;  3CXG A;  4POL A;  3G9B A;  5EL8 A;  2ZPG B;  4Q5F A;  4N30 A;  1EP7 A;  3HJO A;  2X49 A;  4TTH A;  2AYT A;  1LU4 A;  4ZB9 A;  2QDY B;  2X4A A;  2BJX A;  1KEB A;  2M72 A;  4HEA 2;  2G77 A;  2L4Q A;  1GUH A;  2IFQ A;  1GSS A;  3TDG A;  5KN1 A;  3HCZ A;  1V98 A;  2PVQ A;  1H1S B;  4IQ1 A;  1FVK A;  3VLN A;  1WIK A;  2DXB B;  3VFI A;  2O85 A;  5ID2 A;  1B48 A;  4CY8 A;  2D2Z A;  1I9D A;  3BLH B;  5CO3 A;  2GLR A;  4POB A;  3I69 A;  4TR3 A;  3FR6 A;  4G0K A;  3LXZ A;  5DJM A;  3IR4 A;  3QYG B;  1R5A A;  2FLS A;  2PER A;  4NHW A;  3P8W A;  4HOJ A;  1ERU A;  3EU4 A;  2WIH B;  3AY8 A;  2C5O B;  3PIN A;  4XTS A;  3LYP A;  3HVX A;  3A8M B;  3HZJ A;  2PVO C;  5FT3 A;  4HU9 A;  2HXK A;  5J3R A;  3F4R A;  1A2J A;  2AAW A;  2ZPB B;  3WD6 A;  1ERW A;  1TU7 A;  3M1G A;  4K1F A;  3MI9 B;  4ECI A;  3EID B;  3MSZ A;  2I4A A;  5D9W A;  1GY3 B;  4MH3 A;  3CSJ A;  2P0G A;  2HI7 A;  5GAN D;  3HHV A;  5IO0 A;  4BCN D;  1Z7R A;  1O7U A;  3X25 B;  2IN3 A;  2B5Y A;  4BY7 X;  4K9Z A;  1OE8 A;  3J7Y b;  3PPU A;  2H76 A;  3F5X B;  2DPP B;  3A3T A;  2I9H A;  1YF0 A;  5AIS A;  3DXB A;  2KUC A;  4EC8 B;  2H73 A;  4GLT A;  2KP2 A;  1JKW A;  1K3Y A;  4PX1 A;  1OE7 A;  3PR8 A;  2IFQ B;  1VF3 A;  3GFK A;  4LMW A;  3J7Y k;  4IMY B;  3GIX A;  4F82 A;  2XHF A;  2WFY B;  3GV1 A;  3UJ1 A;  5KOW A;  2K8S A;  2LNT A;  4YQM A;  1SKW B;  2CZ7 B;  1Z3E A;  1OKV B;  4G0I A;  4LL4 B;  2VL2 C;  1E7P A;  1SKS B;  2UZL B;  2ALB A;  3MY5 B;  2C5N B;  4ROD A;  3KH9 A;  3IE3 A;  10GS A;  1O85 A;  4BCG B;  2AB6 A;  4K7I A;  4OMV A;  2W96 A;  4F6U B;  3ZFL A;  1AIU A;  1Y25 A;  2H1D A;  4I8B A;  3BOA A;  3UMA A;  4L8E A;  3M3M A;  5D73 A;  12GS A;  1IYI A;  4ZBB A;  4PQH A;  3I43 A;  4LMV A;  2E7P A;  1OIU B;  2JAC A;  1S3A A;  3UBK A;  5G1K A;  1TJD A;  1GWC A;  2VLV A;  3P2A A;  1MEK A;  1F9M A;  5LMK B;  4F70 B;  4MFD A;  4PUF C;  3MIX A;  4ZIL A;  1JST B;  4CFW B;  2HSH A;  3VWW A;  2HRN A;  1K0O A;  5AN1 A;  3E3E A;  4NV2 A;  2W9Z A;  2IWT A;  1WOU A;  1P5E B;  4ROC A;  1XZO A;  3ME8 A;  4RI6 A;  3ME7 A;  4TKY A;  4OB0 B;  3TW6 A;  4X43 A;  4CFU D;  2CV4 A;  2E2G A;  1S3C A;  2OE3 A;  3FK8 A;  3Q74 A;  1VGL A;  5A4U A;  4MMM A;  1G7O A;  1F3A A;  1G6W A;  1TRW A;  3EMX A;  5ECP B;  5FGK B;  2YOI A;  3G7Y A;  1DUG A;  4O5R A;  1ZL9 A;  5LQF B;  2C0G A;  4CY6 A;  4TXO A;  2I53 A;  1K0N A;  2CYZ B;  2KOK A;  3KTL A;  2WPA B;  3ZIV A;  1QXH A;  4KUN A;  3Q6O A;  4AKG A;  4LL1 B;  4HU7 A;  1N4M A;  3UEM A;  2FY6 A;  2CJM B;  4G6L B;  2DIY A;  2R6K A;  3TKQ A;  1TK8 B;  3IDV A;  1A0R P;  3GA4 A;  4XIH A;  1FOV A;  5COH A;  4II5 B;  2DSA A;  5H5Q A;  3GTU B;  1W98 B;  3WVD B;  2YJH A;  1H75 A;  1SK1 A;  2YWO A;  4AJ7 A;  3TJJ A;  1NM3 A;  5D9V A;  4BCF B;  1DE1 A;  1LBK A;  3RDW A;  4Y72 B;  4HNU A;  1GSD A;  4WBJ A;  4HS1 A;  4EDZ A;  3IRA A;  1X9M B;  1JLW A;  3BBY A;  4XRD A;  4TN8 A;  3EJ1 B;  4G9H A;  1X5D A;  1GSF A;  4J56 E;  1T4Y A;  2K8V A;  3FZ5 A;  3IBH A;  4WF4 A;  4ZB8 A;  3TJF A;  1T3B A;  1S3R A;  1MD3 A;  19GS A;  5ABR A;  4CHS A;  2WEV B;  3TKS C;  4BCH B;  1FVJ A;  2CCI B;  1XW9 A;  4YQU A;  3A5W A;  1GUK A;  4G2E A;  4CFV B;  2VCW A;  3O76 A;  2DJK A;  1GSU A;  1XWC A;  1AQW A;  4ISD A;  4ULX A;  3TNI B;  2FHE A;  3NZN A;  1ZGN A;  4V2L A;  5AIV A;  1H1R B;  2X8G A;  3QCP A;  2QA2 A;  3VKH A;  2OJL A;  4HQS A;  5CEI B;  1JZW A;  3E0U A;  3TKS E;  4X0X A;  2GSS A;  1TRU A;  2QGS A;  2VUP A;  3GKX A;  4I5Q A;  2YWM A;  2VAF A;  4AKH A;  3HB9 A;  2HE3 A;  1UC7 A;  2LUS A;  3A8L B;  5IM9 A;  4J57 E;  2CZ1 B;  4BXX X;  5CYY A;  2IJY A;  2BMX A;  2LJA A;  3V1W A;  4MF6 A;  1THO A;  3HA9 A;  2L59 A;  1TW9 A;  3IHG A;  1RW1 A;  4KAE A;  2PWJ A;  2VCV A;  5JWQ B;  1B8X A;  2LJR A;  4FYB A;  5HFK A;  4IN0 A;  3LWA A;  4ZGJ B;  1H1Q B;  1RK4 A;  1SL1 B;  3WGE A;  4KH7 A;  2PBJ A;  22GS A;  4KF9 A;  1EOH A;  2GT5 A;  2VM1 A;  3JCM L;  1NW2 A;  2X8C A;  3GH6 A;  2DLX A;  4IHU A;  2LKU A;  4EC0 A;  1YF1 A;  2EIQ A;  1U3A A;  2R0G A;  4PNG A;  1GH2 A;  3DDQ B;  1V29 B;  5KN3 A;  1ZMA A;  2XC2 A;  4EOL B;  1TU8 A;  1MDK A;  2IMI A;  4IJI A;  2I81 A;  4MLY A;  4F9Z A;  2DJ3 A;  1UGQ B;  4KRD B;  2A4V A;  5EJC A;  4EUY A;  3HVV A;  4KND A;  1TOF A;  2OKA A;  2V22 B;  4EIP A;  2MBT A;  2C0F A;  4IKH A;  1PX7 A;  2R2J A;  4ZL9 A;  2DME A;  4IP1 A;  1M7T A;  1YY7 A;  4TW5 A;  1BJX A;  2C6T B;  3GKN A;  3IHQ A;  4L0U A;  2IMD A;  1XXU A;  2WS2 A;  3EWL A;  3IC8 A;  1BYE A;  1G0T A;  3ZVJ A;  3VKG A;  4D73 A;  3MWH A;  3UL3 A;  3EU3 A;  4RUV A;  5GZZ B;  3L9V A;  2ZPI B;  2GGT A;  3I6A A;  3GST A;  1A23 A;  1X9W B;  3GNJ A;  4PTS A;  1T00 A;  1H28 B;  4JRR A;  2MZC A;  5J9C A;  1ACV A;  1M3J A;  5IMD A;  2R3X A;  1OKD A;  4BCM D;  1SL2 B;  4BIK A;  4RI7 A;  3FR3 A;  4BL7 A;  1JFU A;  1AQV A;  2OBI A;  2P5R A;  4EO3 A;  2RII A;  1GTA A;  4V1A g;  3KP8 A;  2H74 A;  1OGU B;  5CP1 A;  2YNX A;  2I40 B;  1SYX A;  2H71 A;  3ERG A;  5D9X A;  3H79 A;  5AGY A;  1Z7P A;  4GCI A;  2H72 A;  7GSS A;  4MJB A;  1EZK A;  1ZOF A;  2CZ3 A;  3EOC B;  2VL9 A;  1K0B A;  4WF5 A;  1ERT A;  2O7K A;  2OE0 A;  2A4H A;  4ZL7 A;  3ERW A;  4KA0 A;  4UN0 A;  3SWL A;  3N9J A;  5CAX A;  4CFN B;  1EGO A;  4WEY A;  2GTU A;  2C80 A;  3KMO A;  4HJM A;  3TJG A;  3LQ7 A;  1X9S B;  1SJ6 A;  4I3Z B;  1FO5 A;  3O0G D;  4Z6Y A;  5ICP B;  5J5N A;  5E4W A;  1WWJ A;  1FKM A;  2IW8 B;  4EF0 A;  1S3D A;  2YV9 A;  3B57 A;  1SEN A;  2L5O A;  2A2R A;  4RQR A;  2B6M A;  5F05 A;  1D3U B;  2IPA A;  1QK8 A;  2LV3 A;  1T7P B;  3M9K A;  3ZL5 A;  2W9F A;  1V2A A;  4D73 B;  3F9U A;  5H5S A;  4ACS A;  4QQ7 A;  4HUA A;  3APS A;  1K0D A;  5G30 A;  5ELG A;  5IMC A;  4ZGE B;  5HFG A;  2EIR A;  2LNS A;  4BY1 X;  1K0M A;  5IPH A;  1G6Y A;  2TRC P;  3QAV A;  3QWL A;  20GS A;  2A2P A;  1FG4 A;  4BL7 B;  3FZ4 A;  4BPY A;  1M2B A;  4OCE A;  4MJE A;  2I1U A;  3UAR A;  3HXS A;  4IEL A;  5G5E A;  4FM4 B;  4K2D A;  6GSX A;  4TR1 B;  2VLT A;  3MAK A;  2GZP A;  5A4V A;  3ZIJ A;  4QL9 A;  1UVZ A;  5GAP D;  2H19 A;  4N11 A;  4YAV A;  5DAK A;  2MBS A;  2EUF A;  4O32 A;  3FHK A;  4AI6 A;  3IK7 A;  5FWG A;  1JLV A;  1XOA A;  1GUM A;  1E6B A;  3QD9 A;  1ZYP A;  3LXT A;  4NMU A;  2A2S A;  4IQA A;  2G9X B;  2VCQ A;  5ECN B;  1R7H A;  3A2V A;  5J4U A;  3QR6 A;  1RQM A;  2J23 A;  2PN8 A;  1GSQ A;  1QGV A;  1M0U A;  3LGC A;  5D8I A;  5ELA A;  4PGT A;  3TJB A;  1T1V A;  1EV9 A;  1F3B A;  2R7G A;  3MNG A;  3DDP B;  4K7N A;  3HJM A;  3QYH B;  5DDL A;  17GS A;  4HNV A;  5ECR B;  3QFA C;  3VI7 A;  2LS5 A;  1CQH A;  2IVX A;  4KE3 A;  2NPB A;  3X24 B;  4MZW A;  4IVF A;  3OR5 A;  4OO4 A;  2FWF A;  4HZ2 A;  4TXV A;  3QFB C;  2CZ6 B;  2X99 A;  2V1M A;  1SK0 A;  1GP1 A;  2REM A;  3TN8 B;  5ECH B;  3ZZX A;  3H93 A;  3QAW A;  3DML A;  2JZT A;  5G1L A;  2MMA A;  3APO A;  4K8M A;  4V2N A;  1XFL A;  2CX4 A;  5HR1 A;  1GNW A;  2HZE A;  1GL8 A;  2WDU A;  4GSN A;  3QOU A;  1URC B;  1K3O A;  5ECM B;  3C73 A;  4MH2 A;  2GST A;  4EOS B;  3TRQ A;  3F3R A;  5IIZ A;  3F8U A;  4XCS A;  2NDO A;  2YZU A;  1ERV A;  5A5K A;  2X64 A;  4WET A;  1ZP2 A;  2LST A;  4OFN A;  5ECL B;  3VYG B;  2PMI B;  4BCI B;  5IMZ A;  3BHU B;  3F3Q A;  3D22 A;  5DAK B;  4J2F A;  3FYG A;  2TRX A;  3WT1 A;  5HBE B;  3UOM A;  1VYW B;  4FO5 A;  5IDN B;  3D21 A;  3K7A M;  1CQG A;  2DXC B;  1C72 A;  3QYB A;  4Z2T A;  4BWQ A;  2L4C A;  5C00 A;  3DWV A;  5HR0 A;  4YOS A;  5B8B A;  2PPT A;  2M46 A;  5B6M A;  1FHE A;  2GT6 A;  1USB A;  1GTB A;  3VWU A;  2QSI A;  1SJZ A;  1XOB A;  3FZ9 A;  3HBL A;  2LTK A;  3L4N A;  3DVW A;  4MPG A;  1JSU B;  4F6W B;  2R4V A;  1BG5 A;  2KLX A;  3GTU A;  3US3 A;  4MIM A;  4BCQ B;  1OI9 B;  2V2G A;  1AQX A;  5FHI A;  1DSB A;  2CT6 A;  1M9A A;  1ML6 A;  2UZB B;  1KBN A;  3A5I A;  4ELJ A;  4EOM B;  4GXZ A;  4G0L A;  1TRS A;  1PQN A;  4FYU A;  3KXO A;  1GTU A;  3APQ A;  3CTG A;  1HNA A;  2LJK A;  1PL2 A;  2HZE B;  1PA3 A;  2FCH A;  4BCJ B;  2V6O A;  1MDI A;  1E9H B;  1M99 A;  1UA5 A;  2BPM B;  4Q5N A;  2VO4 A;  2OE1 A;  3UBL A;  5DJL A;  2VL3 A;  3KD0 A;  3QZ9 B;  2CAQ A;  4I97 A;  5B8A A;  3WGX A;  1GSY A;  1JZD A;  4ZB6 A;  1XVQ A;  5CNW A;  4IJ3 A;  5GST A;  4BA7 A;  2X1N B;  4KSO A;  2FNO A;  5L71 A;  3HD5 A;  1TDI A;  3C1S A;  1DE2 A;  1TFB A;  4K0N A;  2AV4 A;  3W8S A;  4DVC A;  2XBI A;  5B7C A;  3KTB A;  5ECK B;  3P90 A;  1HD2 A;  3FEU A;  2DKH A;  3ZVJ D;  3N5O A;  4WBR D;  3G7J A;  3GTM S;  1XWA A;  3CRU A;  1KTE A;  4K5R A;  3GMF A;  5BMU A;  1PMT A;  4PQ1 A;  2X8H A;  3KGK A;  2EC4 A;  1YEX A;  1PD2 1;  5D96 A;  2CCH B;  4NHZ A;  1H26 B;  4QL7 A;  3EVI A;  1OYJ A;  4OR5 B;  3HKR A;  4O92 A;  3QDN A;  4ZGD B;  2PK2 A;  1GSE A;  2MYG A;  3FMW A;  1H4O A;  2HNL A;  2JGZ B;  2IL3 A;  1K0C A;  4ROE A;  1THX A;  3KZQ A;  2H0I A;  4QSH A;  3QMX A;  1JHB A;  3QZ5 B;  2WIP B;  2R37 A;  1VF1 A;  3F4S A;  2JAD A;  5DAL A;  1HQO A;  2GSQ A;  3EIN A;  3IXR A;  4POM A;  4XHM A;  4ECJ A;  4ECB A;  3POM A;  4JX6 A;  1A2M A;  2GZY A;  2WCI A;  1EV4 A;  5DQW A;  1TP9 A;  3F63 A;  4EKZ A;  3HJP A;  1Q4J A;  1PX6 A;  3H1N A;  1XVW A;  2B7J A;  1AXD A;  3CQF A;  3HHT B;  2W99 A;  1ILO A;  4GF0 A;  1U88 A;  4TVE A;  2N5F A;  5HNB B;  1DBY A;  2H30 A;  2OAC A;  4BVX A;  5CRE A;  3X26 B;  3GYK A;  2VCT A;  3ZMK A;  2PGT A;  1AUC A;  1K3L A;  4AJ6 A;  3TRX A;  1NHY A;  5IHY A;  3I9V 2;  3ZFB A;  2TIR A;  2UZ8 A;  3ED3 A;  2H1G A;  3RPP A;  2H6Y A;  3IV4 A;  2H1A A;  4KRC B;  2F51 A;  1JZO A;  3NOF A;  5ECI B;  3QYE A;  2F8F A;  4I2U A;  3TOU A;  4EON B;  1O6J A;  1TTZ A;  3L9S A;  3UAP A;  1OC8 A;  3GL3 A;  2H0G A;  2FGX A;  2YN1 A;  4EXJ A;  2HSM A;  2HLS A;  1N8J A;  3HZ4 A;  3SBC A;  4Q5R A;  4DSS B;  2GS3 A;  5ECQ B;  4MDC A;  3H4C A;  2YWN A;  2KR6 A;  3X20 B;  4USS A;  2GQK A;  3TNW B;  3TNH B;  1I5G A;  4EOK B;  2LW4 A;  4JE1 A;  5DBQ A;  5DAL B;  5CYI B;  1XWB A;  1A8L A;  1SD9 A;  3EE2 A;  4OD7 A;  1B9X C;  2WB9 A;  5IMA A;  1VIN A;  3HDC A;  2C0E A;  5I5Z B;  4P3Y B;  5KOX A;  4MK3 A;  1KXU A;  4AF2 A;  4EOO B;  1GTI A;  4BCN B;  4EOJ B;  2YZH A;  1G7E A;  1GUL A;  1TXX A;  1UGR B;  1QMV A;  3ZIT A;  4JR4 A;  4ZL8 A;  2K9F A;  2CVD A;  4PXO A;  1HNC A;  4GRF A;  18GS A;  2L5L A;  4BVX B;  1OL1 B;  5IDP B;  4X1U A;  1TK5 B;  1PKW A;  4WR5 A;  2UUE B;  1W89 A;  1GRX A;  4KCA A;  4X4J A;  1H4L D;  4BCQ D;  4I6X A;  2CZ0 B;  4PQI A;  3TUE A;  1EP8 A;  1KNG A;  2ZNM A;  1FB0 A;  2NTO A;  4KDY A;  4EOQ B;  2WHB B;  3ERF A;  3LJR A;  2DD5 B;  1XCC A;  1EEM A;  3EYT A;  3MY1 B;  1SK2 A;  3UIW A;  4IGJ A;  2HYX A;  4JX4 A;  4WKW A;  2E0Q A;  4F2I A;  3HVN A;  1URM A;  2B9R A;  4K5S A;  3KH7 A;  4NWY A;  3LYK A;  5HFI A;  2DJJ A;  2PU9 C;  4TR1 A;  5F06 A;  5JWO B;  4K6X A;  5H5R A;  4OGR B;  2H70 A;  4E8H A;  4E8E A;  2O87 A;  5KEJ A;  4YKF A;  1OC3 A;  2L57 A;  5CRD A;  3CTF A;  5HBH B;  3VUR A;  4N10 A;  4CW9 A;  1R4W A;  1X5E A;  6GSV A;  1X0R A;  3FRC A;  5EFQ B;  4MAB A;  4F7S B;  2HRA A;  2HFD A;  4XRA A;  3DIE A;  2FWG A;  3D5J A;  2LRC A;  3X28 B;  1EEJ A;  1YZX A;  5IF1 B;  2J9H A;  3GL5 A;  3U5R E;  1YDK A;  2CX3 A;  3BG3 A;  4BBR M;  2OA7 A;  3EMP A;  5GSS A;  4HJ2 A;  3CRT A;  1A2L A;  4AKI A;  2GDR A;  3P7X A;  4ICY A;  2CVK A;  1H1P B;  4CFU B;  3KIJ A;  2BKZ B;  1M3I A;  1SD8 A;  3BHV B;  5HQP A;  4OB3 B;  3UVT A;  5ENU A;  2WMA B;  1O9K B;  1C9B A;  2DJ0 A;  2ZPH B;  3BLR B;  4V1A p;  4EVM A;  2RM6 A;  5HR3 A;  3KEB A;  1N2A A;  9GSS A;  3FY7 A;  4FX3 B;  3MDK A;  2QKE A;  4Z2R A;  1ZYE A;  3TB2 A;  3VWX A;  1MD4 A;  4IBP A;  5HR2 A;  4FQU A;  2IMF A;  5AIX A;  4F6S B;  3H4K A;  3FW2 A;  3GHA A;  2FUG 2;  1O73 A;  4MJC A;  5ACB A;  2GQM A;  2IIY A;  2YP6 A;  3D4M A;  1A0F A;  5G2Z A;  4CXA B;  5JWR B;  1Z9H A;  1G3N C;  1SU9 A;  1UGP B;  4IW9 A;  1H24 B;  2WZ9 A;  2B5X A;  3DKS A;  1XIY A;  2O89 A;  3RBT A;  3G7I A;  4KGI A;  4F7N B;  3A2X A;  3M03 A;  1O81 A;  1WP0 A;  3C1R A;  1YJ6 A;  2QA1 A;  5F0G A;  2K6V A;  2G2Q A;  5IOW A;  2VLU A;  1UGS B;  1A8Y A;  2B5E A;  3A8H B;  2YJ7 A;  4HQZ A;  2KP1 A;  3KJY A;  4I2T A; 
#chains in the Genus database with same CATH homology
 2OBK A;  4Z2U A;  3DGQ A;  1J0F A;  3RHB A;  3CSI A;  4YAP A;  2WFC A;  2BTO T;  1SKR B;  4JED A;  1XWK A;  4AGS A;  1XWG A;  1TI3 A;  3EUR A;  3DD3 A;  3HZ8 A;  3RHC A;  2H01 A;  3K8N A;  4MF7 A;  2CZ2 A;  4N0Z A;  1FW1 A;  1J9B A;  2R0C A;  5IO2 A;  1FB6 A;  5J41 A;  3KP9 A;  3LOR A;  1MDJ A;  2YAN A;  3NIV A;  4ZIJ A;  4Q5Q A;  3TKR A;  1M9B A;  2FWE A;  14GS A;  4MCU A;  2RLI A;  2JZR A;  4JR6 A;  3ZLP A;  5IOX A;  5CRW A;  1BX9 A;  3VWV A;  4KDU A;  5D9T A;  1PN9 A;  2NBS A;  2CAI A;  1HYU A;  4RQX A;  2C3Q A;  4PNF A;  3W6G A;  2ES7 A;  3GUS A;  2JZS A;  4EE0 A;  5D93 A;  2HT9 A;  4N0V A;  5DCH A;  4CDO A;  2C3T A;  2F8A A;  5ECO B;  4ML6 A;  4OCF A;  3QPM A;  1U3I A;  2G0F A;  3DEX A;  4F03 A;  4FH8 A;  4ZBD A;  1B4P A;  2DJ2 A;  2E2M A;  5JCG A;  1R5P A;  2CA8 A;  3IC4 A;  4GST A;  3CSH A;  4F0C A;  3O3T A;  1GLQ A;  4O7H A;  2AUV A;  2MMN A;  3EC3 A;  3R3E A;  2V32 A;  5ID2 B;  3D6I A;  4YQV A;  1Z6M A;  2DJ1 A;  4GSS A;  3TCO A;  3F4T A;  3O6T A;  4WR4 A;  1SL0 B;  2DMM A;  5KN2 A;  2FD3 A;  1PSQ A;  4DSR A;  4OO5 A;  3FR9 A;  1O8W A;  1OC9 A;  2HSY A;  1AW9 A;  3GKM A;  2JSY A;  4JZQ A;  2KHP A;  1F6M C;  1M2D A;  2DIZ A;  2H6Z A;  2WRT A;  2ZUP A;  4ZXG A;  2H8L A;  3Q18 A;  1B9Y C;  3IAS 2;  2I3Y A;  1WE0 A;  4F0B A;  2L6D A;  3F6F A;  4JBB A;  4H86 A;  2GVP A;  5J9B A;  4POK A;  3GRX A;  4OFT A;  4Z7X A;  2N5A A;  2QC7 A;  3VI5 A;  2B3S A;  6GST A;  2RUE A;  3C7M A;  4BVY A;  1BQ7 A;  4MNN A;  5LNK e;  3IAM 2;  1R26 A;  3GX0 A;  1VF4 A;  2C8U A;  4EL1 A;  3VK9 A;  5C04 A;  2LQQ A;  4NXI A;  4XS1 A;  1JZR A;  4L0W A;  3ZYW A;  3GKK A;  5DCG A;  3LW9 A;  2PUK C;  4NV5 A;  3CBU A;  5B6N A;  3GH9 A;  4PUR A;  2VL2 A;  1ZYQ B;  1XBS A;  2YCD A;  2B7K A;  1V9W A;  1PRX A;  2LQO A;  2C3N A;  3FKF A;  8GSS A;  11GS A;  2IMK A;  1PGT A;  3KMN A;  3PGT A;  3WT2 A;  1O8X A;  2JL4 A;  5CRG A;  1QUW A;  4G10 A;  2V41 A;  3LG6 A;  3BCK A;  1WJK A;  4DSS A;  2AHE A;  4O5U A;  3DVX A;  1GNE A;  3WGD A;  2VM2 A;  1W4V A;  2CVB A;  1OC9 B;  1FOH A;  4K2X A;  3PH9 A;  3Q19 A;  2FWH A;  3VPT A;  4A5P A;  2LRN A;  1F37 A;  3W8J A;  2JSZ A;  4HI7 A;  3C8E A;  4PUA A;  5EPF A;  5LD0 A;  4XS4 A;  2WGR A;  3IOS A;  2YV7 A;  2MMZ A;  4ZBA A;  3BJ5 A;  3LSZ A;  5G5F A;  1SYR A;  5EY6 A;  1XPV A;  1WMJ A;  1T8E B;  1Q98 A;  2VOC A;  1EWX A;  3TGZ A;  4L5O A;  4BVY B;  5IMV A;  2B1L A;  4MF5 A;  1IYH A;  3TKP A;  1YKC A;  2RM5 A;  4GQC A;  1WPI A;  4YH2 A;  5DQS A;  1K0A A;  2HZF A;  3TOT A;  5F8B A;  4TR0 A;  2F9S A;  1BAY A;  1U87 A;  2XPD A;  4ECC A;  4K0G A;  1PN0 A;  3E9J B;  4MP4 A;  5LCZ A;  1Z6N A;  2VD0 A;  2YWI A;  1YKA A;  4GQF A;  4IP6 A;  4MJA A;  1FAA A;  4ILF A;  2VCZ A;  5EVO A;  4XS6 A;  2H0H A;  3LEF A;  1NSW A;  1ZCP A;  2VIM A;  1T4Z A;  5IQY A;  1A24 A;  1GLP A;  5KN0 A;  2L6C A;  4KB3 A;  2H1B A;  4TXO B;  1M2A A;  1NHO A;  1EGR A;  2H6X A;  1EOG A;  2FA8 A;  4FYC A;  3ZRE A;  3MYD A;  3UVH A;  4WXT A;  3H8Q A;  6GSW A;  2IME A;  4ML1 A;  2DML A;  2P5Q A;  1YEP A;  1TKD B;  5E59 A;  3WYW A;  2EIO A;  4NAX A;  2QGV A;  4NPB A;  3ZTL A;  2GSR A;  4XS4 B;  1AAZ A;  2XPE A;  1OAZ A;  5F07 A;  4KCE A;  3DYR A;  1SJI A;  4GTU A;  4MZB A;  3C71 A;  2AJQ B;  3EPT A;  16GS A;  1AC1 A;  2MMO A;  3D4T A;  3TKS A;  5JCU A;  3ZML A;  5INY A;  2GZZ A;  1TI1 A;  4G19 A;  4FIW A;  1XW5 A;  1OKT A;  4EIQ A;  1PL1 A;  2P31 A;  2GQL A;  2DC5 A;  6GSY A;  2VCX A;  13GS A;  3RPN A;  1X5C A;  4KW6 A;  2H66 A;  4EDY A;  4DSQ A;  3HYP A;  3GSS A;  4KDX A;  4HZ4 A;  3L0H A;  2LEG A;  4KX4 A;  4HDE A;  6GSS A;  4K7O A;  4TOP A;  4YKG A;  3LFL A;  3F0I A;  3QAG A;  1V58 A;  1LJR A;  5IPG A;  3M0F A;  2NVL A;  1E2Y A;  2YPM A;  3HVS A;  6GSU A;  1PKZ A;  4AJ8 A;  3GUR A;  4DEJ A;  4TRX A;  3TJK A;  2HRF A;  3F6D A;  2C1Y A;  4JU5 A;  1BED A;  3U6V A;  2C4J A;  2C0D A;  2M80 A;  5ECS A;  1V57 A;  4MZC A;  1J08 A;  5G31 A;  1ON4 A;  2ON5 A;  1TRV A;  4ID0 A;  3HY2 A;  3IK9 A;  2FA4 A;  5A4W A;  3S9F A;  2B1K A;  2LRT A;  2CQ9 A;  3VPQ A;  1YQ1 A;  2Z9S A;  1Y6E A;  4V2M A;  3IA1 A;  4O5Q A;  2DBC A;  4OFM A;  5DVB A;  3TRP A;  3CMI A;  3GX8 A;  5JCW A;  1ABA A;  4GWR A;  1F2E A;  1ZYN A;  2V6K A;  5DQY A;  2ON7 A;  1UN2 A;  1Z5Y E;  2DKI A;  2WUL A;  3KCM A;  4MA9 A;  5IMF A;  2PMT A;  2O8V B;  3CYN A;  1U6T A;  3ISO A;  5CRH A;  2F3M A;  1WRY A;  2WJU A;  1VF2 A;  1ST9 A;  2H75 A;  4KSM A;  4MPF A;  3ZRD A;  2RUF A;  1OVN A;  3A2W A;  3BD2 A;  1QQ2 A;  3M9J A;  3KM6 A;  1HNB A;  1B4Q A;  1XW6 A;  1MTC A;  3BCI A;  1ZZY A;  3RAZ A;  2JU5 A;  2R0P A;  4LA1 A;  1VRS D;  3L9U A;  3FZA A;  1TK0 B;  3R2Q A;  2R5G A;  3GN3 A;  2XBQ A;  3L78 A;  2N5B A;  3M8N A;  5BRT A;  3DRN A;  2HRK A;  4BWS A;  2K18 A;  3D0Z A;  4IS0 A;  1QFN A;  4OWY A;  4TR4 A;  2VD1 A;  3IPZ A;  4L5L A;  2OAD A;  1V40 A;  2ZCT A;  4LLR A;  3CXG A;  4POL A;  3G9B A;  5EL8 A;  4Q5F A;  4N30 A;  1EP7 A;  3HJO A;  2X49 A;  2AYT A;  1LU4 A;  4ZB9 A;  2BJX A;  1KEB A;  2M72 A;  2X4A A;  4HEA 2;  2L4Q A;  1GUH A;  2IFQ A;  1GSS A;  3TDG A;  5KN1 A;  3HCZ A;  1V98 A;  2PVQ A;  4IQ1 A;  1FVK A;  3VLN A;  1WIK A;  3VFI A;  2O85 A;  5ID2 A;  1B48 A;  4CY8 A;  2D2Z A;  1I9D A;  5CO3 A;  2GLR A;  4POB A;  3I69 A;  4TR3 A;  3FR6 A;  4G0K A;  3LXZ A;  5DJM A;  3IR4 A;  1R5A A;  2FLS A;  2PER A;  4NHW A;  3P8W A;  4HOJ A;  1ERU A;  3EU4 A;  3AY8 A;  3PIN A;  4XTS A;  3LYP A;  3HVX A;  2PVO C;  5FT3 A;  4HU9 A;  2HXK A;  5J3R A;  3F4R A;  1A2J A;  2AAW A;  3WD6 A;  1ERW A;  1TU7 A;  3M1G A;  4K1F A;  4ECI A;  3MSZ A;  2I4A A;  5D9W A;  4MH3 A;  3CSJ A;  2P0G A;  2HI7 A;  5GAN D;  3HHV A;  5IO0 A;  1Z7R A;  1O7U A;  2IN3 A;  2B5Y A;  4K9Z A;  1OE8 A;  3J7Y b;  3PPU A;  2H76 A;  3A3T A;  2I9H A;  1YF0 A;  5AIS A;  3DXB A;  2KUC A;  2H73 A;  4GLT A;  2KP2 A;  1K3Y A;  4PX1 A;  1OE7 A;  3PR8 A;  2IFQ B;  1VF3 A;  3GFK A;  4LMW A;  3J7Y k;  3GIX A;  4F82 A;  2XHF A;  3GV1 A;  3UJ1 A;  5KOW A;  2K8S A;  2LNT A;  4YQM A;  1SKW B;  1Z3E A;  4G0I A;  4LL4 B;  2VL2 C;  1SKS B;  2ALB A;  3KH9 A;  3IE3 A;  10GS A;  1O85 A;  2AB6 A;  4K7I A;  4OMV A;  3ZFL A;  1AIU A;  1Y25 A;  2H1D A;  4I8B A;  3BOA A;  3UMA A;  4L8E A;  3M3M A;  5D73 A;  12GS A;  1IYI A;  4ZBB A;  4PQH A;  3I43 A;  4LMV A;  2E7P A;  2JAC A;  1S3A A;  3UBK A;  5G1K A;  1TJD A;  1GWC A;  2VLV A;  3P2A A;  1MEK A;  1F9M A;  4PUF C;  3MIX A;  4ZIL A;  2HSH A;  3VWW A;  2HRN A;  1K0O A;  5AN1 A;  3E3E A;  4NV2 A;  2IWT A;  1WOU A;  1XZO A;  3ME8 A;  4RI6 A;  3ME7 A;  4TKY A;  4X43 A;  2CV4 A;  2E2G A;  1S3C A;  2OE3 A;  3FK8 A;  3Q74 A;  1VGL A;  5A4U A;  4MMM A;  1G7O A;  1F3A A;  1G6W A;  1TRW A;  3EMX A;  5ECP B;  2YOI A;  3G7Y A;  1DUG A;  4O5R A;  1ZL9 A;  2C0G A;  4CY6 A;  4TXO A;  1K0N A;  2KOK A;  3KTL A;  3ZIV A;  1QXH A;  4KUN A;  3Q6O A;  4LL1 B;  4HU7 A;  3UEM A;  2FY6 A;  2DIY A;  2R6K A;  3TKQ A;  1TK8 B;  3IDV A;  1A0R P;  3GA4 A;  4XIH A;  1FOV A;  5COH A;  5H5Q A;  2DSA A;  3GTU B;  2YJH A;  1H75 A;  1SK1 A;  2YWO A;  4AJ7 A;  3TJJ A;  1NM3 A;  5D9V A;  1DE1 A;  1LBK A;  3RDW A;  1GSD A;  4WBJ A;  4HS1 A;  4EDZ A;  3IRA A;  1X9M B;  1JLW A;  3BBY A;  4XRD A;  4TN8 A;  4G9H A;  1X5D A;  1GSF A;  4J56 E;  1T4Y A;  2K8V A;  3FZ5 A;  3IBH A;  4WF4 A;  4ZB8 A;  3TJF A;  1T3B A;  1MD3 A;  19GS A;  5ABR A;  4CHS A;  3TKS C;  1FVJ A;  1XW9 A;  4YQU A;  3A5W A;  1GUK A;  4G2E A;  2VCW A;  3O76 A;  2DJK A;  1GSU A;  1XWC A;  1AQW A;  4ISD A;  4ULX A;  2FHE A;  3NZN A;  1ZGN A;  4V2L A;  5AIV A;  2X8G A;  3QCP A;  2QA2 A;  2OJL A;  4HQS A;  1JZW A;  3E0U A;  3TKS E;  4X0X A;  2GSS A;  1TRU A;  2VUP A;  3GKX A;  4I5Q A;  2YWM A;  2VAF A;  2HE3 A;  1UC7 A;  2LUS A;  5IM9 A;  4J57 E;  5CYY A;  2IJY A;  2BMX A;  2LJA A;  3V1W A;  4MF6 A;  1THO A;  3HA9 A;  2L59 A;  1TW9 A;  3IHG A;  1RW1 A;  4KAE A;  2PWJ A;  2VCV A;  5JWQ B;  1B8X A;  2LJR A;  4FYB A;  5HFK A;  4IN0 A;  3LWA A;  1RK4 A;  1SL1 B;  3WGE A;  4KH7 A;  2PBJ A;  22GS A;  4KF9 A;  1EOH A;  2GT5 A;  2VM1 A;  3JCM L;  1NW2 A;  2X8C A;  3GH6 A;  2DLX A;  4IHU A;  2LKU A;  4EC0 A;  1YF1 A;  2EIQ A;  1U3A A;  2R0G A;  4PNG A;  1GH2 A;  5KN3 A;  1ZMA A;  2XC2 A;  1TU8 A;  1MDK A;  2IMI A;  4IJI A;  2I81 A;  4MLY A;  4F9Z A;  2DJ3 A;  2A4V A;  4EUY A;  3HVV A;  4KND A;  1TOF A;  2OKA A;  4EIP A;  2MBT A;  2C0F A;  4IKH A;  1PX7 A;  2R2J A;  4ZL9 A;  4IP1 A;  1M7T A;  1YY7 A;  4TW5 A;  1BJX A;  3GKN A;  3IHQ A;  4L0U A;  2IMD A;  1XXU A;  2WS2 A;  3EWL A;  3IC8 A;  1BYE A;  1G0T A;  3ZVJ A;  4D73 A;  3MWH A;  3UL3 A;  3EU3 A;  4RUV A;  5GZZ B;  3L9V A;  2GGT A;  3I6A A;  3GST A;  1A23 A;  1X9W B;  3GNJ A;  4PTS A;  1T00 A;  4JRR A;  2MZC A;  5J9C A;  1ACV A;  5IMD A;  2R3X A;  1OKD A;  1SL2 B;  4RI7 A;  3FR3 A;  4BL7 A;  1JFU A;  1AQV A;  2OBI A;  2P5R A;  4EO3 A;  2RII A;  1GTA A;  4V1A g;  3KP8 A;  2H74 A;  5CP1 A;  2YNX A;  1SYX A;  2H71 A;  3ERG A;  5D9X A;  3H79 A;  5AGY A;  1Z7P A;  4GCI A;  2H72 A;  7GSS A;  4MJB A;  1EZK A;  1ZOF A;  2CZ3 A;  2VL9 A;  1K0B A;  4WF5 A;  1ERT A;  2O7K A;  2OE0 A;  2A4H A;  4ZL7 A;  3ERW A;  4KA0 A;  3SWL A;  3N9J A;  5CAX A;  1EGO A;  4WEY A;  2GTU A;  2C80 A;  3KMO A;  4HJM A;  3TJG A;  3LQ7 A;  1X9S B;  1SJ6 A;  1FO5 A;  5J5N A;  5E4W A;  1WWJ A;  4EF0 A;  1S3D A;  2YV9 A;  1SEN A;  2L5O A;  2A2R A;  4RQR A;  2B6M A;  5F05 A;  2IPA A;  1QK8 A;  2LV3 A;  1T7P B;  3M9K A;  3ZL5 A;  1V2A A;  4D73 B;  3F9U A;  5H5S A;  4ACS A;  4QQ7 A;  4HUA A;  3APS A;  1K0D A;  5G30 A;  5ELG A;  5IMC A;  5HFG A;  2EIR A;  2LNS A;  1K0M A;  5IPH A;  1G6Y A;  2TRC P;  3QAV A;  20GS A;  2A2P A;  1FG4 A;  4BL7 B;  3FZ4 A;  4BPY A;  1M2B A;  4OCE A;  4MJE A;  2I1U A;  3UAR A;  3HXS A;  4IEL A;  5G5E A;  4K2D A;  6GSX A;  4TR1 B;  2VLT A;  3MAK A;  2GZP A;  5A4V A;  3ZIJ A;  4QL9 A;  1UVZ A;  5GAP D;  2H19 A;  4N11 A;  4YAV A;  5DAK A;  2MBS A;  4O32 A;  3FHK A;  3IK7 A;  5FWG A;  1JLV A;  1XOA A;  1GUM A;  1E6B A;  3QD9 A;  1ZYP A;  3LXT A;  4NMU A;  2A2S A;  4IQA A;  2VCQ A;  5ECN B;  1R7H A;  3A2V A;  5J4U A;  3QR6 A;  1RQM A;  2J23 A;  2PN8 A;  1GSQ A;  1QGV A;  1M0U A;  3LGC A;  5D8I A;  5ELA A;  4PGT A;  3TJB A;  1T1V A;  1EV9 A;  1F3B A;  3MNG A;  4K7N A;  3HJM A;  5DDL A;  17GS A;  5ECR B;  3QFA C;  3VI7 A;  2LS5 A;  1CQH A;  4KE3 A;  2NPB A;  4MZW A;  4IVF A;  3OR5 A;  4OO4 A;  2FWF A;  4HZ2 A;  4TXV A;  3QFB C;  2X99 A;  1SK0 A;  2V1M A;  1GP1 A;  2REM A;  5ECH B;  3ZZX A;  3H93 A;  3QAW A;  3DML A;  2JZT A;  5G1L A;  2MMA A;  3APO A;  4K8M A;  4V2N A;  1XFL A;  2CX4 A;  5HR1 A;  1GNW A;  2HZE A;  1GL8 A;  2WDU A;  4GSN A;  3QOU A;  1K3O A;  5ECM B;  3C73 A;  4MH2 A;  2GST A;  3TRQ A;  3F3R A;  5IIZ A;  3F8U A;  4XCS A;  2NDO A;  2YZU A;  1ERV A;  5A5K A;  2X64 A;  4WET A;  4OFN A;  2LST A;  5ECL B;  5IMZ A;  3F3Q A;  3D22 A;  5DAK B;  4J2F A;  3FYG A;  2TRX A;  3WT1 A;  3UOM A;  4FO5 A;  3D21 A;  1CQG A;  1C72 A;  4Z2T A;  4BWQ A;  2L4C A;  5C00 A;  3DWV A;  5HR0 A;  5B8B A;  2PPT A;  2M46 A;  5B6M A;  1FHE A;  2GT6 A;  1USB A;  1GTB A;  3VWU A;  2QSI A;  1SJZ A;  1XOB A;  3FZ9 A;  2LTK A;  3L4N A;  3DVW A;  4MPG A;  2R4V A;  1BG5 A;  2KLX A;  3GTU A;  3US3 A;  2V2G A;  1AQX A;  5FHI A;  1DSB A;  2CT6 A;  1M9A A;  1ML6 A;  1KBN A;  3A5I A;  4GXZ A;  4G0L A;  1TRS A;  4FYU A;  1PQN A;  3KXO A;  1GTU A;  3APQ A;  3CTG A;  1HNA A;  2LJK A;  1PL2 A;  2HZE B;  1PA3 A;  2FCH A;  2V6O A;  1MDI A;  1M99 A;  1UA5 A;  4Q5N A;  2VO4 A;  2OE1 A;  3UBL A;  5DJL A;  2VL3 A;  3KD0 A;  2CAQ A;  4I97 A;  5B8A A;  3WGX A;  1GSY A;  1JZD A;  4ZB6 A;  1XVQ A;  5CNW A;  4IJ3 A;  5GST A;  4BA7 A;  4KSO A;  2FNO A;  5L71 A;  3HD5 A;  1TDI A;  3C1S A;  1DE2 A;  4K0N A;  2AV4 A;  3W8S A;  4DVC A;  2XBI A;  5B7C A;  3KTB A;  5ECK B;  3P90 A;  1HD2 A;  3FEU A;  2DKH A;  3ZVJ D;  3N5O A;  4WBR D;  3G7J A;  1XWA A;  3CRU A;  1KTE A;  4K5R A;  3GMF A;  5BMU A;  1PMT A;  4PQ1 A;  2X8H A;  3KGK A;  2EC4 A;  1YEX A;  1PD2 1;  5D96 A;  4NHZ A;  4QL7 A;  3EVI A;  1OYJ A;  3HKR A;  4O92 A;  3QDN A;  1GSE A;  2MYG A;  3FMW A;  1H4O A;  2HNL A;  2IL3 A;  1K0C A;  1THX A;  3KZQ A;  2H0I A;  3QMX A;  1JHB A;  2R37 A;  1VF1 A;  3F4S A;  2JAD A;  5DAL A;  1HQO A;  2GSQ A;  3EIN A;  3IXR A;  4POM A;  4XHM A;  4ECJ A;  4ECB A;  1A2M A;  2GZY A;  2WCI A;  1EV4 A;  1TP9 A;  3F63 A;  4EKZ A;  3HJP A;  1Q4J A;  1PX6 A;  3H1N A;  1XVW A;  2B7J A;  1AXD A;  1ILO A;  4GF0 A;  1U88 A;  4TVE A;  2N5F A;  1DBY A;  2H30 A;  2OAC A;  4BVX A;  5CRE A;  3GYK A;  2VCT A;  3ZMK A;  2PGT A;  1AUC A;  1K3L A;  4AJ6 A;  3TRX A;  1NHY A;  3I9V 2;  3ZFB A;  2TIR A;  2UZ8 A;  3ED3 A;  2H1G A;  3RPP A;  2H6Y A;  3IV4 A;  2H1A A;  2F51 A;  1JZO A;  3NOF A;  5ECI B;  2F8F A;  4I2U A;  3TOU A;  1O6J A;  1TTZ A;  3L9S A;  3UAP A;  1OC8 A;  3GL3 A;  2H0G A;  2FGX A;  2YN1 A;  4EXJ A;  2HSM A;  2HLS A;  1N8J A;  3HZ4 A;  3SBC A;  4Q5R A;  4DSS B;  2GS3 A;  5ECQ B;  4MDC A;  2YWN A;  4USS A;  2GQK A;  1I5G A;  4JE1 A;  5DBQ A;  5DAL B;  1XWB A;  1A8L A;  1SD9 A;  3EE2 A;  4OD7 A;  1B9X C;  2WB9 A;  5IMA A;  3HDC A;  2C0E A;  4P3Y B;  5KOX A;  4MK3 A;  4AF2 A;  1GTI A;  2YZH A;  1G7E A;  1GUL A;  1TXX A;  1QMV A;  3ZIT A;  4JR4 A;  4ZL8 A;  2K9F A;  2CVD A;  4PXO A;  1HNC A;  4GRF A;  18GS A;  2L5L A;  4BVX B;  4X1U A;  1TK5 B;  1PKW A;  4WR5 A;  1W89 A;  1GRX A;  4KCA A;  4X4J A;  4I6X A;  4PQI A;  3TUE A;  1EP8 A;  1KNG A;  2ZNM A;  1FB0 A;  2NTO A;  4KDY A;  3ERF A;  3LJR A;  1XCC A;  1EEM A;  3EYT A;  1SK2 A;  3UIW A;  4IGJ A;  2HYX A;  4WKW A;  2E0Q A;  4F2I A;  1URM A;  4K5S A;  3KH7 A;  4NWY A;  3LYK A;  5HFI A;  2DJJ A;  2PU9 C;  4TR1 A;  5F06 A;  5JWO B;  4K6X A;  5H5R A;  2H70 A;  4E8H A;  4E8E A;  2O87 A;  5KEJ A;  4YKF A;  1OC3 A;  2L57 A;  5CRD A;  3CTF A;  3VUR A;  4N10 A;  4CW9 A;  1R4W A;  1X5E A;  6GSV A;  1X0R A;  3FRC A;  4MAB A;  2HRA A;  2HFD A;  4XRA A;  3DIE A;  2FWG A;  3D5J A;  2LRC A;  1EEJ A;  1YZX A;  2J9H A;  3GL5 A;  3U5R E;  1YDK A;  2CX3 A;  2OA7 A;  3EMP A;  5GSS A;  4HJ2 A;  3CRT A;  1A2L A;  2GDR A;  3P7X A;  4ICY A;  2CVK A;  3KIJ A;  1SD8 A;  5HQP A;  3UVT A;  5ENU A;  2DJ0 A;  4V1A p;  4EVM A;  2RM6 A;  5HR3 A;  3KEB A;  1N2A A;  9GSS A;  3FY7 A;  3MDK A;  2QKE A;  4Z2R A;  1ZYE A;  3TB2 A;  3VWX A;  1MD4 A;  4IBP A;  5HR2 A;  4FQU A;  2IMF A;  5AIX A;  3H4K A;  3FW2 A;  3GHA A;  2FUG 2;  1O73 A;  4MJC A;  2GQM A;  2IIY A;  2YP6 A;  3D4M A;  1A0F A;  5G2Z A;  5JWR B;  1Z9H A;  1SU9 A;  4IW9 A;  2WZ9 A;  2B5X A;  3DKS A;  1XIY A;  2O89 A;  3RBT A;  3G7I A;  4KGI A;  3A2X A;  1O81 A;  1WP0 A;  3C1R A;  1YJ6 A;  2QA1 A;  5F0G A;  2K6V A;  2G2Q A;  5IOW A;  2VLU A;  1A8Y A;  2B5E A;  2YJ7 A;  4HQZ A;  2KP1 A;  3KJY A;  4I2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...