2IN3A

Crystal structure of a putative protein disulfide isomerase from nitrosomonas europaea
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
204
Chain Sequence
EKPVLWYIADPMCSWCWGFAPVIENIRQEYSAFLTVKIMPGGTNTPLLPEKRAQILHHWHSVHITTGQPFTFENALPEGFIYDTEPACRGVVSVSLIEPEKVFPFFAAIQRAFYVGQEDVAQLAILKKLAVDLGIPESRFTPVFQSDEAKQRTLAGFQRVAQWGISGFPALVVESGTDRYLITTGYRPIEALRQLLDTWLQQHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of a putative protein disulfide isomerase from Nitrosomonas europaea
rcsb
source organism Nitrosomonas europaea
molecule tags Isomerase
total genus 63
structure length 204
sequence length 208
ec nomenclature
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.60 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 putative protein disulfide isomerase domain 2in3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2in3A01
1OAZA 1XW9A 1QQ2A 2L5LA 3TUEA 1I5GA 2GSTA 4IN0A 1FG4A 5A4VA 3VLNA 2H72A 5F07A 3UJ1A 1OKDA 1YEXA 3MAKA 3PR8A 4IHUA 3QD9A 4EF0A 3WD6A 5G1LA 5G5FA 2VL9A 3ZVJD 3PINA 1TI3A 4J56E 1X9MB 1TTZA 3GSTA 3GX0A 1UN2A 2R2JA 5LNKe 1Z6NA 2LNSA 2GZZA 5ECSA 2E0QA 3GL3A 3IAM2 4KH7A 2F51A 2MMOA 1ABAA 1JHBA 2XPEA 4J57E 3D0ZA 1OC8A 3GFKA 4L0WA 3QOUA 3KXOA 2LRCA 3EC3A 4ZL7A 2MMAA 3M8NA 1IYHA 3HHVA 2RLIA 1G7OA 4V1Ag 1THOA 1C72A 2WFCA 3CRTA 1GRXA 4G2EA 2IFQA 2H6XA 5DALB 3EWLA 3HJOA 3FZ4A 1R26A 4K7NA 2A2SA 4MJEA 1V57A 1O8XA 1B48A 3ZLPA 1USBA 1XBSA 5J3RA 4IELA 2R37A 4O92A 1WOUA 2PBJA 2RUEA 4WR4A 1AIUA 1O81A 3CSIA 2CT6A 3FKFA 3ZVJA 3R2QA 1E6BA 4F9ZA 4K9ZA 1PA3A 3ERFA 3KJYA 2PPTA 4PNGA 3MSZA 1T4YA 3H79A 4NWYA 3ZIVA 2VCZA 3TOTA 2FLSA 1YJ6A 2DMLA 1BYEA 1SL1B 4EE0A 4QQ7A 1GH2A 2IJYA 1WIKA 2JADA 4DVCA 2X8HA 1XIYA 1DE1A 3OR5A 4F82A 2H75A 2P5RA 1XVWA 1YQ1A 2V6OA 2EIRA 3E9JB 4K8MA 4FYCA 5CRDA 5AN1A 4KCEA 1XWBA 1Q98A 3WT2A 4POKA 5ELGA 1ZMAA 5DQYA 1BQ7A 5D9TA 1M9BA 4WETA 2VUPA 3CMIA 2JSYA 1TRSA 2DJ0A 4JRRA 2C0GA 2D2ZA 11GSA 2H0HA 3HA9A 4IGJA 5D9XA 4XS4B 3VWWA 4XS6A 2V1MA 2EIQA 2B7KA 1ERTA 1GNEA 2R6KA 5KN0A 3JCML 2EC4A 1TK5B 2NDOA 2LQOA 1QMVA 4HOJA 2IMIA 5CRGA 4NPBA 5D73A 3FEUA 2P0GA 3DXBA 1ON4A 5KN1A 4ID0A 5F0GA 3D5JA 3H1NA 1SKWB 2WCIA 2RIIA 1G0TA 2H0GA 4TRXA 3SBCA 1NHYA 4IS0A 3F4RA 4LL1B 4HZ2A 2X64A 1R5PA 1SD8A 3RPNA 1LBKA 4GQFA 4ML1A 3UEMA 4BPYA 1FB0A 3ZMKA 4TVEA 4EVMA 3RDWA 1ZYEA 1S3DA 3CBUA 1EP7A 3TRQA 2OACA 2I4AA 5EPFA 3W6GA 5EY6A 1XW5A 1URMA 1X9SB 1TW9A 3O6TA 5G31A 4F0CA 2YNXA 1WJKA 4HDEA 4OFTA 5E4WA 1AAZA 1PRXA 3HZ8A 2LUSA 4KA0A 4F03A 1UA5A 1YKAA 1HNAA 2YJHA 4DEJA 2F8FA 2YP6A 1ZCPA 3KM6A 3GUSA 4AJ8A 4EO3A 2VCQA 2PU9C 1J08A 2M80A 1PD21 2H73A 3DYRA 4V2MA 3BOAA 2AV4A 4MK3A 3ZREA 1H4OA 5IMVA 1X5DA 1A2JA 3EYTA 1W89A 2VD0A 4ZL8A 2OE0A 1SL0B 2GLRA 3TJKA 1TRVA 2EIOA 3LJRA 4D73A 4MCUA 2IMEA 3IXRA 4I8BA 1OE8A 16GSA 2LNTA 3HYPA 4EXJA 4GSSA 4PX1A 1SU9A 1BJXA 1ERVA 3FZ9A 3TGZA 1TRUA 5GZZB 3CRUA 1Z3EA 5KN3A 2OADA 1AW9A 3BD2A 1A0RP 3Q18A 22GSA 2H19A 1MD4A 3IC4A 6GSWA 1OVNA 4XHMA 1XVQA 4IW9A 1TK8B 1SKSB 4XIHA 2DLXA 4MJAA 5GAND 4IVFA 1SYRA 3KP9A 1YDKA 4KAEA 4JZQA 3H93A 5DAKB 1EGOA 4DSRA 5AGYA 1X5EA 2IIYA 3TB2A 2FD3A 5F8BA 2IMKA 5JWOB 2LRNA 4V2LA 2J9HA 3C71A 2WJUA 1V2AA 3G9BA 2BMXA 2I3YA 1M2DA 2HI7A 2IWTA 2DIZA 5ECRB 1U88A 3GV1A 2N5AA 1GP1A 4Q5NA 4AJ7A 3VI7A 2PN8A 5EL8A 4K7OA 5H5QA 1QK8A 5JWQB 4ECIA 4JR6A 3QDNA 2HRNA 1O73A 2H8LA 4HEA2 4ZB9A 4CDOA 4LMWA 1AXDA 1OC9A 2FCHA 4POBA 4ZBDA 5IMAA 5B8BA 5DVBA 3M9KA 1QFNA 5IOXA 5CAXA 4X1UA 3LYKA 5HR0A 5AIVA 3WT1A 3Q6OA 2QGVA 2DJJA 3QAWA 2LJKA 5B7CA 4YQUA 3G7IA 1K3YA 4XRDA 4TR4A 3VWXA 3GTUA 1SD9A 4K6XA 1VRSD 4ECJA 3FY7A 2R4VA 3HVVA 2AUVA 1QUWA 4ZILA 1V98A 1AQWA 3IE3A 1MD3A 4WKWA 1YY7A 4RI7A 3EURA 3KH7A 4KE3A 5IMFA 1B4PA 3HVSA 2X8GA 4MZWA 1XXUA 2LV3A 3A2WA 5DJLA 5G5EA 2HXKA 1PMTA 1V58A 5HR2A 4ZB6A 5D8IA 5ECKB 3TJGA 3ERGA 1HYUA 4ULXA 4LL4B 2REMA 4DSQA 3F0IA 4GF0A 1NHOA 5JWRB 5ECPB 2VCTA 3ZTLA 3HCZA 2H1GA 2GSQA 4TR1A 2GT6A 1JZWA 17GSA 4KDUA 2CA8A 1XOBA 3L0HA 4TR0A 3TRXA 5IQYA 5HFGA 1M9AA 2LJAA 3WGXA 3EMXA 5G30A 1CQHA 1K0NA 3GURA 1O7UA 6GSUA 6GSXA 3CSHA 5CYYA 2VM1A 1U87A 2Z9SA 3EINA 3S9FA 4PQIA 2HZEB 2LJRA 2CV4A 5HQPA 3QFAC 3O3TA 2P5QA 2O87A 4J2FA 3J7Yk 3P7XA 2NBSA 3DVWA 4F0BA 2VLUA 4I97A 2WDUA 2VO4A 3G7JA 2QC7A 2L57A 2X8CA 4MLYA 3A5WA 3CSJA 1VGLA 1Z9HA 2VL2A 3ZFBA 1DBYA 4N0VA 4FO5A 4HZ4A 1O85A 2BJXA 1VF3A 2P31A 5B6NA 2B3SA 14GSA 1MDJA 1XZOA 2NVLA 4HU9A 5G1KA 2OBKA 4HU7A 3DWVA 4N0ZA 3D4TA 3FHKA 3H8QA 2VAFA 2JU5A 1A2MA 4YQVA 3EU3A 3TJBA 3E0UA 4ZIJA 3ME8A 2B5EA 4HJ2A 2H6YA 3LFLA 3QMXA 1TKDB 5A5KA 4WF4A 1FAAA 1GSSA 2HNLA 3KTBA 4YQMA 4EKZA 5DALA 5J5NA 1F6MC 3GKNA 3QCPA 1ZOFA 2VCWA 1PQNA 4YAVA 3GH9A 6GSSA 3FYGA 4GLTA 3F4TA 2QSIA 2FNOA 4WR5A 4E8EA 1GTIA 1QXHA 3IAS2 3I9V2 1EZKA 1GSYA 3WGEA 2GQKA 3TDGA 3UOMA 1T00A 5FT3A 1WPIA 3F6FA 4AGSA 3ZYWA 3W8JA 4OWYA 2LQQA 4KX4A 5A4UA 1YKCA 3ZMLA 1NM3A 3WYWA 3LXTA 2DC5A 2L4QA 1IYIA 1F3AA 3LORA 2GZYA 1V9WA 2J23A 4O32A 3LYPA 2CZ2A 1GTAA 3VK9A 1OE7A 2YN1A 3GKXA 3EE2A 1WE0A 1PN9A 4I2UA 1PKWA 1T4ZA 1VF2A 4BA7A 3F6DA 5IMCA 1TU8A 3ME7A 1WP0A 2DJKA 4EL1A 2VLTA 1EOHA 4RQRA 2KUCA 3DGQA 3C73A 2XHFA 2B6MA 1VF1A 4V2NA 4XS4A 4ZBAA 4MP4A 3KEBA 3M0FA 2WULA 4BL7A 2HSYA 2FWFA 5AISA 3FR9A 4ILFA 1A0FA 2C4JA 19GSA 5H5RA 1GUHA 1MEKA 3F63A 1F2EA 4L5OA 5ELAA 3AY8A 2N5FA 4GSTA 2ZCTA 4KSMA 2DJ2A 2E2MA 1GWCA 2ON7A 9GSSA 1TOFA 1J9BA 2C80A 1SK0A 2H01A 4DSSB 4N11A 1G6WA 1EP8A 4ZBBA 1DSBA 2O85A 3LEFA 4XRAA 1K3OA 2JSZA 5KN2A 2H74A 5IO0A 5CRHA 1A8LA 4IP1A 4WXTA 3ERWA 3F9UA 2YWNA 2YWIA 3CYNA 1BAYA 4Z7XA 2OA7A 2DSAA 2OE1A 1GLQA 2C3TA 2ON5A 3SWLA 5C00A 1AQVA 1M99A 4K2DA 4KDYA 4TXOB 1R5AA 4MF7A 1ST9A 2IPAA 4PGTA 2MBTA 5JCWA 2WGRA 4QL7A 2GQLA 2HLSA 5ECLB 4TOPA 5HR1A 4EUYA 5IO2A 2YPMA 7GSSA 3UARA 4NHZA 3M3MA 3A3TA 3N5OA 2AHEA 2XC2A 3MNGA 1TI1A 1YF0A 3F8UA 3IPZA 4K1FA 1SYXA 1H75A 4WF5A 3PH9A 2YCDA 2B5YA 1JZOA 2KLXA 2LKUA 5DQSA 5A4WA 2JACA 2VCXA 2AAWA 1GSDA 2IMDA 5HFIA 2TRCP 3IOSA 2DIYA 4I2TA 2NTOA 2GSRA 2CVDA 2DJ1A 4KW6A 4OFNA 4GCIA 3EU4A 3ED3A 2YWMA 2CAIA 3E3EA 3TKSA 3F3RA 5J9CA 1PX7A 1O6JA 5CP1A 2GSSA 1WWJA 2OKAA 3P2AA 1N8JA 1TXXA 5F05A 2MMNA 1U6TA 1ZL9A 3UL3A 2WRTA 13GSA 4MPGA 1M2BA 5DBQA 1K0BA 4O7HA 2V2GA 3J7Yb 2DBCA 2VIMA 3DEXA 2L6DA 4NV5A 2IMFA 4IJ3A 3LWAA 1XWCA 1GSUA 4YH2A 4BWQA 1K0OA 4XTSA 1AC1A 3UBLA 3DIEA 3L9UA 1A24A 2GGTA 4Q5RA 1B9YC 2CVBA 5DAKA 5CO3A 4MDCA 3QAGA 2LTKA 1R7HA 3N9JA 3GNJA 4NMUA 4GSNA 2PVOC 3IA1A 1XW6A 1K0DA 4MH3A 2A4VA 5ID2B 5IIZA 4N10A 3UBKA 3CTFA 3P90A 5J4UA 3LG6A 3GMFA 5LCZA 4TW5A 4PQHA 1RK4A 4KDXA 1Y25A 2JZTA 1X9WB 1GULA 4G9HA 1ILOA 3APQA 5JCUA 1X0RA 5F06A 1YZXA 1F37A 2HRFA 2PERA 2GDRA 3C1SA 2H66A 4L8EA 4AJ6A 5INYA 3BBYA 3MDKA 2DMMA 20GSA 1MTCA 3M1GA 2H6ZA 4HUAA 2AB6A 4GXZA 1WMJA 3GTUB 5IPGA 2GZPA 3FW2A 4KNDA 4ZB8A 1THXA 4L5LA 5ABRA 2OJLA 3VPTA 1TP9A 2C1YA 1JZRA 3I43A 1SENA 1EOGA 3KTLA 2DJ3A 3ZIJA 1K3LA 3UMAA 4E8HA 1CQGA 4EC0A 3GSSA 1JFUA 1RW1A 2H76A 1GNWA 3NIVA 1EV4A 3D22A 3RHBA 1KBNA 5IOWA 2FHEA 5DCGA 1J0FA 3FR6A 3FR3A 2C3NA 3L9VA 3C8EA 4TR1B 1XCCA 1SKRB 3LXZA 2C3QA 4LLRA 4N30A 4I5QA 6GSTA 4WBJA 1Z5YE 1G6YA 5AIXA 4RQXA 5J9BA 3VWVA 3DD3A 3MWHA 1NSWA 2LEGA 3QPMA 4NV2A 2WS2A 2FUG2 2FGXA 4IBPA 3U6VA 1PX6A 3EMPA 3TKSC 2HYXA 4G10A 3QFBC 5ECMB 4WBRD 1Z7PA 4PNFA 2YOIA 4JU5A 4HJMA 3UIWA 3FZAA 4POLA 1NW2A 2HE3A 1V40A 2CZ3A 1GL8A 3APOA 1EEJA 2XBIA 2HZEA 3C7MA 4Q5FA 3V1WA 1TRWA 4FH8A 1FVKA 2MBSA 1KEBA 2B1KA 2TRXA 3O76A 3NOFA 1K0AA 2LS5A 4GTUA 2KHPA 2JL4A 2FY6A 3D6IA 4ZXGA 4GQCA 5B6MA 1ML6A 3HJPA 4TR3A 1QGVA 1BEDA 3CTGA 4HQZA 3HY2A 4HQSA 2AYTA 1A8YA 3KIJA 2IFQB 4CW9A 3FZ5A 2F8AA 1TJDA 5D93A 2ES7A 2CX3A 2H1DA 1AQXA 2H1AA 5IPHA 5ENUA 2H30A 4NAXA 1OYJA 1OKTA 6GSYA 3NZNA 1GUMA 4RI6A 1U3IA 3VPQA 2WZ9A 4X0XA 5D96A 4HI7A 2KP1A 1HD2A 2R5GA 2H1BA 2K8VA 5GSSA 2YWOA 4PURA 4OCEA 4NHWA 4HS1A 3UVHA 1GTUA 1T3BA 2XBQA 2E7PA 4IP6A 3VWUA 2VLVA 1A23A 3HZ4A 3HXSA 5DCHA 5B8AA 3RHCA 2ZUPA 5JCGA 3Q19A 4FYUA 2C8UA 3UAPA 1FVJA 3HKRA 4OO5A 1M0UA 5J41A 1B8XA 2GTUA 1B9XC 1WRYA 2FWHA 5ECNB 4OD7A 4TKYA 2PVQA 4KSOA 2LSTA 1PGTA 2L59A 5CRWA 1AUCA 1VF4A 3ZZXA 3DVXA 1XFLA 2L6CA 1Q4JA 1SK2A 1SK1A 5ECIB 2JZRA 2R3XA 3DMLA 3VFIA 1ZYQB 1LU4A 1G7EA 3A2XA 4PUAA 4IQ1A 1UVZA 1PL2A 3GKMA 4MMMA 1U3AA 2I1UA 2CAQA 1GTBA 2YZUA 3H4KA 2YANA 3GRXA 3IK9A 4KGIA 1JLWA 4LA1A 1S3CA 3PGTA 3KP8A 4JE1A 3VI5A 1Y6EA 3TOUA 12GSA 4BVYA 5G2ZA 3US3A 3IBHA 1ZGNA 1TU7A 4MF5A 3IR4A 5CREA 4RUVA 4QL9A 2K9FA 1GSFA 2L4CA 2WB9A 2X99A 3KMNA 2B7JA 4BVXA 1T1VA 2XPDA 4WEYA 1XWAA 2I81A 3HDCA 3FK8A 2RM5A 3WGDA 2OE3A 1KTEA 1W4VA 3GA4A 3GKKA 4PUFC 3KMOA 2VL2C 2A2RA 4KCAA 5EVOA 3M9JA 4JR4A 3I6AA 3U5RE 2G2QA 2B5XA 2JZSA 18GSA 1E2YA 4DSSA 1K0CA 5H5SA 3RPPA 1Z6MA 2PMTA 2MYGA 3GH6A 3CXGA 4ECCA 4BWSA 2L5OA 2FWGA 4MF6A 3GN3A 2H71A 4PQ1A 3ZRDA 1XWGA 2PWJA 4FYBA 3HJMA 1PSQA 3QR6A 3F4SA 4TXOA 4K0GA 4FIWA 1SJ6A 3IK7A 1TDIA 2RM6A 3TKQA 1FO5A 1MDKA 2K8SA 3C1RA 2M46A 5C04A 1HNBA 1PKZA 4G19A 1LJRA 1GSQA 1EEMA 1XWKA 1GUKA 2MZCA 5FHIA 4L0UA 2C0FA 4D73B 1ZZYA 4JEDA 1FW1A 1JZDA 4ISDA 2GT5A 2C0DA 3LQ7A 3KD0A 3TKPA 4X43A 1EGRA 2CVKA 3KCMA 5IMDA 1EV9A 4KUNA 4OO4A 2VD1A 3HVXA 4OMVA 4ML6A 3TJFA 4LMVA 1UC7A 1N2AA 5ECQB 4EDZA 2PUKC 8GSSA 2IL3A 5KEJA 2VL3A 2CX4A 5GSTA 5IM9A 1BX9A 2HT9A 4ACSA 1YF1A 4P3YB 1F9MA 2YV7A 4ZL9A 2O8VB 3BJ5A 3TKRA 2FA8A 3F3QA 5DJMA 1JLVA 2LRTA 3TJJA 3A2VA 2KP2A 2VCVA 4CHSA 6GSVA 3IV4A 2GQMA 3IHQA 3TRPA 1ERWA 4AF2A 3GL5A 4XCSA 2B1LA 3KGKA 4KB3A 2V32A 2RUFA 2QKEA 2O7KA 4POMA 3RAZA 5CNWA 4MZBA 4H86A 2V41A 3P8WA 1FOVA 3GIXA 3GYKA 5ECHB 4O5RA 3DRNA 3BCKA 3Q74A 3D4MA 2BTOT 1EWXA 1ERUA 4OFMA 2V6KA 1RQMA 5D9WA 2M72A 4MZCA 1PL1A 1DUGA 1BG5A 1ACVA 3L78A 1I9DA 3APSA 1T8EB 1K0MA 4NXIA 1OC9B 2YV9A 2H0IA 4Q5QA 2YZHA 4IQAA 1SJIA 3D21A 5HR3A 4MPFA 5ID2A 3W8SA 1FB6A 4K7IA 4F2IA 3G7YA 1B4QA 1R4WA 3I69A 2PGTA 4MJCA 4MA9A 4TN8A 1SL2B 2K18A 4PXOA 4GWRA 3HD5A 4ECBA 2AJQB 4EDYA 2HSHA 3FRCA 1F3BA 2F9SA 2OBIA 4IJIA 1A2LA 1GSEA 1FHEA 5HFKA 1XOAA 2C0EA 3VURA 3ZITA 3LSZA 2NPBA 1M7TA 2ZNMA 4I6XA 2K6VA 2FA4A 2HZFA 2G0FA 3L9SA 2FWEA 3TCOA 2ALBA 3ISOA 4YAPA 2I9HA 4JBBA 1HQOA 5LD0A 3LGCA 4GRFA 2KOKA 4IKHA 4V1Ap 3QAVA 5IMZA 3K8NA 3KH9A 4K0NA 1XPVA 1TK0B 5FWGA 1GLPA 2N5BA 1MDIA 2F3MA 3ZL5A 1O8WA 2YJ7A 3DKSA 3TKSE 3BCIA 5ECOB 2GS3A 2E2GA 1Z7RA 1SJZA 2GVPA 3RBTA 5L71A 2VM2A 2VOCA 3IDVA 1HNCA 1T7PB 1M2AA 2H70A 1X5CA 3ZFLA 2CQ9A 3GX8A 5E59A 5D9VA 3KZQA 4XS1A 4MABA 2O89A 3IRAA 2HFDA 2TIRA 4TXVA 3GHAA 4MH2A 1YEPA 3L4NA 3UVTA 3EVIA 4OCFA 4MJBA 1DE2A 1KNGA 1S3AA 2MMZA 5COHA 10GSA 5DDLA 2IN3A 5GAPD 1OC3A
chains in the Genus database with same CATH superfamily
1OAZA 1XW9A 1QQ2A 2L5LA 2QDYB 3TUEA 1I5GA 3TW6A 2GSTA 4IN0A 1FG4A 5A4VA 3VLNA 4FX3B 2H72A 1TD6A 5F07A 4AKIA 3UJ1A 1OKDA 1YEXA 3MAKA 3PR8A 4IHUA 3QD9A 4EF0A 3WD6A 5G1LA 5G5FA 2VL9A 1ZYPA 3ZVJD 3PINA 2F2CA 1TI3A 2CZ7B 4J56E 1X9MB 1TTZA 4UN0A 3EIDB 2WEVB 3QHWB 3GSTA 3GX0A 1UN2A 2R2JA 5LNKe 1Z6NA 2LNSA 4EOQB 2QDJA 2GZZA 5ECSA 2E0QA 1URCB 4Z2RA 3GL3A 3IAM2 4KH7A 2F51A 2MMOA 1ABAA 1JHBA 3A8HB 2XPEA 4YKGA 4J57E 1FKMA 1E9HB 4OB2B 4CFNB 3D0ZA 1OC8A 3GFKA 4L0WA 3QOUA 3KXOA 2LRCA 3EC3A 4BCPB 4ZL7A 2MMAA 3M8NA 1IYHA 3HHVA 2RLIA 4Z2UA 1G7OA 4V1Ag 1THOA 1C72A 2WFCA 3CRTA 1GRXA 4G2EA 2IFQA 2H6XA 5DALB 3EWLA 3HJOA 4BCJB 3FZ4A 3QWLA 4BCGB 1R26A 4K7NA 2A2SA 4MJEA 1V57A 1O8XA 1B48A 3ZLPA 1USBA 1XBSA 5J3RA 4IELA 3DJBA 2R37A 4O92A 1WOUA 2PBJA 2RUEA 4WR4A 1OL2B 5DQWA 2PK9B 1AIUA 4K5RA 1O81A 3QXEB 3CSIA 2CT6A 3FKFA 3ZVJA 3R2QA 2W2HA 1E6BA 2CZ1B 4F9ZA 4K9ZA 1PA3A 3BHVB 3ERFA 5HBJB 3KJYA 2PPTA 4PNGA 3MSZA 1T4YA 3H79A 4NWYA 3ZIVA 2VCZA 3TOTA 2W96A 3QYGB 2FLSA 1YJ6A 2DMLA 1BYEA 1SL1B 4EE0A 4QQ7A 1GH2A 2IJYA 1WIKA 2JADA 4DVCA 2X8HA 1XIYA 1DE1A 3OR5A 4F82A 4K2XA 2H75A 2P5RA 1XVWA 1YQ1A 1TFBA 2V6OA 2EIRA 3E9JB 4K8MA 4FYCA 5CRDA 5AN1A 4KCEA 1XWBA 1Q98A 3GTMS 3WT2A 2W99A 4POKA 5ELGA 1ZMAA 5DQYA 1BQ7A 5D9TA 1M9BA 4G0KA 4WETA 2VUPA 3CMIA 2JSYA 1UGQB 1TRSA 2DJ0A 4JRRA 2C0GA 2D2ZA 11GSA 1UGSB 3EOCB 4NSTB 2H0HA 3HA9A 2B9RA 4IGJA 5D9XA 4XS4B 3VWWA 4XS6A 2V1MA 2EIQA 2B7KA 1ERTA 1GNEA 2R6KA 1VOLA 5KN0A 4BL7B 3JCML 2EC4A 1TK5B 2NDOA 2LQOA 1QMVA 4HOJA 2IMIA 1GY3B 5CRGA 4NPBA 5D73A 3IC8A 1BU2A 3FEUA 2P0GA 3DXBA 4Z6YA 3R3EA 1ON4A 5KN1A 4ID0A 5F0GA 3D5JA 3H1NA 1SKWB 2WCIA 2RIIA 1G0TA 3MIAB 1QLBA 2H0GA 3IHGA 4TRXA 3SBCA 1NHYA 4IS0A 3DOGB 2PHGA 3F4RA 4LL1B 4HZ2A 2X64A 1R5PA 1SD8A 3RPNA 1LBKA 4GQFA 4ML1A 3UEMA 3QYBA 3X28B 4BPYA 1FB0A 4EOPB 3ZMKA 4TVEA 4EVMA 3RDWA 1ZYEA 1S3DA 3CBUA 1EP7A 3TRQA 2OACA 2I4AA 5EPFA 2DXCB 3W6GA 5EY6A 3NDQA 4MFDA 1XW5A 1URMA 1X9SB 1TW9A 3O6TA 5G31A 4F0CA 2YNXA 4G0LA 1WJKA 4HDEA 4OFTA 5E4WA 4G6LB 1AAZA 1PRXA 3QYHB 3HZ8A 4F6UB 1AD6A 4EOLB 2LUSA 4KA0A 4F03A 4BCQB 1UA5A 1YKAA 1OKWB 1HNAA 2YJHA 4DEJA 2F8FA 2YP6A 1ZCPA 3KM6A 5BMUA 3GUSA 4AJ8A 5EJCA 2C4GB 2BS4A 4EO3A 5IHYA 2VCQA 2PU9C 4CY8A 1J08A 2M80A 1PD21 2H73A 3H4CA 3DYRA 4V2MA 3BOAA 2AV4A 4MK3A 3ZREA 5L2WB 2UZDB 1H4OA 5IMVA 1X5DA 1IREB 1A2JA 3EYTA 1W89A 2VD0A 4ZL8A 2BPMB 2OE0A 1SL0B 2GLRA 3TJKA 1TRVA 2EIOA 3LJRA 4D73A 4MCUA 2IMEA 3A8OB 4EC9B 3IXRA 4I8BA 1VINA 1OE8A 4F70B 16GSA 2LNTA 3HYPA 2QF7A 1JSUB 4EXJA 4GSSA 4PX1A 1SU9A 1BJXA 1ERVA 3FZ9A 3TGZA 1TRUA 5GZZB 4YOSA 3CRUA 1Z3EA 5KN3A 2OADA 2WHBB 3F5XB 1AW9A 3BD2A 1A0RP 3Q18A 2R0PA 22GSA 2H19A 1MD4A 3IC4A 6GSWA 1OVNA 4XHMA 4HSCX 3QZ5B 1XVQA 4IW9A 1TK8B 1SKSB 2DMEA 4K5SA 5IDPB 2QA2A 4XIHA 4BCMD 2DLXA 4MJAA 4F7SB 5GAND 4IVFA 1SYRA 3KP9A 1YDKA 4KAEA 2AHJB 2BS3A 3QYEA 3DL1A 1ENWA 4JZQA 3H93A 3VYHB 3BLQB 5DAKB 2R0GA 1EGOA 4DSRA 5AGYA 2R7GA 5IDNB 1X5EA 2IIYA 3TB2A 3TW7A 2FD3A 1H1PB 5F8BA 3EPTA 2IMKA 5JWOB 2C5XB 1H25B 2LRNA 4V2LA 2J9HA 3A8MB 2WJUA 3C71A 1V2AA 3G9BA 2BMXA 2I3YA 1M2DA 1E7PA 2HI7A 2IWTA 2DIZA 5ECRB 1U88A 2WXVB 3GV1A 2N5AA 1GP1A 4Q5NA 1M3IA 4AJ7A 4QSHA 2DKHA 3VI7A 2PN8A 5EL8A 4K7OA 5H5QA 1QK8A 5JWQB 4ECIA 4JR6A 3QDNA 2HRNA 4OB0B 1O73A 2IW9B 3EJ1B 4YOZA 4X4JA 2H8LA 4HEA2 4M6VA 4ZB9A 4CDOA 1UNLD 3HB9A 4JX6A 4LMWA 1AXDA 1OC9A 2FCHA 4POBA 4ZBDA 5IMAA 5B8BA 2UUEB 5DVBA 3M9KA 1QFNA 5IOXA 4CFXB 4YKFA 4TTHA 5CAXA 4X1UA 3LYKA 5HR0A 5AIVA 3WT1A 3Q6OA 2QGVA 5BNJB 2DJJA 3QAWA 2LJKA 2WJ9A 5B7CA 4YQUA 5HVYB 3G7IA 1XG8A 1K3YA 4XRDA 4O5QA 4TR4A 3VWXA 2QA1A 3GTUA 1SD9A 4K6XA 1VRSD 4ECJA 3TNIB 2ZPBB 3FY7A 2R4VA 4PTSA 3HVVA 2AUVA 1QUWA 4ZILA 1W98B 1V98A 1AQWA 3IE3A 1MD3A 4WKWA 1YY7A 4RI7A 3EURA 3KH7A 4KE3A 5IMFA 1B4PA 4CFVB 3HVSA 2X8GA 4MZWA 1XXUA 2LV3A 3A2WA 5DJLA 4ELLA 5G5EA 2HXKA 1PMTA 1V58A 5HR2A 4ZB6A 5D8IA 5ECKB 1PKDB 3TJGA 3ERGA 1HYUA 4ULXA 4LL4B 5CEIB 2REMA 4EOIB 4DSQA 3F0IA 4GF0A 1NHOA 5JWRB 5ECPB 2VCTA 3ZTLA 3VKHA 3HCZA 2H1GA 2GSQA 4F7JB 4TR1A 2GT6A 1JZWA 17GSA 4KDUA 2CA8A 1QMZB 4EOSB 1XOBA 3L0HA 4TR0A 3TRXA 4OGRB 5IQYA 5HFGA 1M9AA 2LJAA 1JOWA 3EMXA 3WGXA 5G30A 1CQHA 1K0NA 3GURA 1O7UA 6GSUA 6GSXA 3CSHA 5CYYA 2VM1A 1UGRB 1U87A 2CCHB 2Z9SA 3EINA 3S9FA 3DTOA 2EUFA 4PQIA 2HZEB 2LJRA 2DPPB 2CV4A 5HQPA 3QFAC 3O3TA 4CFUB 2P5QA 2O87A 4J2FA 3J7Yk 3P7XA 2NBSA 3DVWA 4F0BA 2VLUA 4I97A 2WDUA 2VO4A 3G7JA 2QC7A 2L57A 5ICPB 2X8CA 4MLYA 3A5WA 3CSJA 1VGLA 1Z9HA 2VL2A 3ZFBA 1DBYA 4N0VA 4FO5A 4HZ4A 1O85A 2BJXA 4F6WB 1VF3A 2P31A 4CRLB 4BY1X 5B6NA 2WIHB 2B3SA 4MNNA 1H4LD 1MDJA 14GSA 1XZOA 2NVLA 4HU9A 5G1KA 2OBKA 5HBHB 4HU7A 3BG3A 3DWVA 4N0ZA 3D4TA 3FHKA 3H8QA 2VAFA 2JU5A 1A2MA 4YQVA 3EU3A 3TJBA 3E0UA 1KXUA 4ZIJA 3ME8A 2B5EA 2X1NB 4HJ2A 2H6YA 3LFLA 3QMXA 3HBLA 1TKDB 5A5KA 4WF4A 1FAAA 1H26B 1GSSA 1JSTB 2HNLA 3KTBA 4YQMA 4EKZA 5DALA 4BCNB 5I5ZB 5J5NA 1F6MC 3GKNA 2BS2A 3QCPA 1GUXB 1ZOFA 1F5QB 1P5EB 2VCWA 1PQNA 4YAVA 3GH9A 6GSSA 3FYGA 4GLTA 3F4TA 2DKIA 2QSIA 2FNOA 4WR5A 4E8EA 1GTIA 1QXHA 3IAS2 3I9V2 1EZKA 1FOHA 1GSYA 3WGEA 2GQKA 3TDGA 3X25B 3UOMA 1T00A 5FT3A 1WPIA 3F6FA 4AGSA 3ZYWA 3W8JA 4OWYA 2LQQA 4KX4A 5A4UA 1YKCA 2WIPB 3VYGB 3ZMLA 1NM3A 3WYWA 3LXTA 2DC5A 2L4QA 1IYIA 1F3AA 3LORA 2GZYA 1V9WA 2J23A 4O32A 1O9KB 2IW8B 3LYPA 2CZ2A 4EOOB 4EOMB 1GTAA 1OI9B 4YC3B 3VK9A 1OE7A 2YN1A 3GKXA 3MYDA 3EE2A 1WE0A 1PN9A 4I2UA 1PKWA 1T4ZA 1VF2A 4BA7A 3F6DA 4NC6A 5IMCA 1TU8A 3ME7A 1WP0A 2DJKA 4EL1A 2VLTA 1EOHA 4HNTA 4RQRA 2KUCA 3DGQA 3C73A 2XHFA 2B6MA 1VF1A 4V2NA 5HNBB 4BVYB 3MI9B 4XS4A 3WVDB 4ZBAA 4MP4A 2IVXA 3KEBA 3M0FA 2WULA 4BL7A 2HSYA 2FWFA 5AISA 3FR9A 4ILFA 3LW9A 1A0FA 4BVXB 2PJQA 2C4JA 19GSA 5H5RA 1UGPB 1GUHA 1MEKA 3FMWA 3F63A 1F2EA 4MFEA 4BCQD 4BY7X 4L5OA 5ELAA 3DDQB 3AY8A 2N5FA 4GSTA 5KOWA 2ZCTA 3TNWB 4KSMA 4BBSM 2DJ2A 2E2MA 1GWCA 2ON7A 9GSSA 1TOFA 1J9BA 4G0IA 1GH6B 2C80A 1SK0A 2H01A 4EOKB 4II5B 4BCHB 4DSSB 2UZ8A 4N11A 1G6WA 4F7LB 1EP8A 4ZBBA 1DSBA 2O85A 3LEFA 3PO3S 2C5NB 4XRAA 1K3OA 2JSZA 5KN2A 2H74A 5LMKB 5IO0A 5CRHA 1A8LA 4IP1A 4WXTA 3ERWA 3F9UA 4EIPA 2YWNA 2YWIA 3CYNA 3RGFB 1BAYA 4HNUA 4Z7XA 2OA7A 2DSAA 2OE1A 1GLQA 2ZCFB 2C3TA 2ON5A 3SWLA 5C00A 4HNVA 1AQVA 1M99A 4K2DA 4KDYA 4TXOB 1R5AA 4MF7A 1ST9A 2IPAA 4PGTA 2MBTA 5JCWA 2WGRA 4QL7A 2PK2A 2GQLA 4CFWB 3LQ5B 2HLSA 2JGZB 5ECLB 4TOPA 4EORB 5HR1A 3HVNA 2DXBB 4EUYA 5IO2A 2YPMA 7GSSA 3UARA 4NHZA 3M3MA 3A3TA 3N5OA 2AHEA 2XC2A 3MNGA 1TI1A 1YF0A 3F8UA 3IPZA 2C5OB 4K1FA 1OIYB 1SYXA 1H75A 4WF5A 3PH9A 2YCDA 4BBRM 2B5YA 1JZOA 1H24B 2KLXA 2LKUA 5DQSA 5A4WA 2JACA 1ZYNA 2VCXA 2AAWA 1GSDA 2IMDA 5HFIA 2TRCP 3IOSA 2DIYA 4I2TA 2NTOA 2GSRA 2CVDA 2DJ1A 4KW6A 4OFNA 4GCIA 3EU4A 3ED3A 2YWMA 2CAIA 3E3EA 3TKSA 3F3RA 5J9CA 2HSMA 1PX7A 1O6JA 5CP1A 2GSSA 1WWJA 2OKAA 1H27B 3P2AA 1N8JA 1TXXA 5F05A 4EONB 4ELJA 2MMNA 1U6TA 1ZL9A 3UL3A 3VKGA 2D0QB 2WRTA 1M3JA 13GSA 4MPGA 5KOXA 2V22B 1M2BA 5DBQA 1K0BA 4O7HA 2V2GA 2ZPHB 3J7Yb 2DBCA 2VIMA 3DEXA 2L6DA 4NV5A 2IMFA 4IJ3A 3LWAA 1XWCA 1GSUA 4YH2A 4BWQA 3A8LB 5HQ0B 1K0OA 4XTSA 1AC1A 3UBLA 3DIEA 1OIUB 3L9UA 1A24A 2GGTA 4Q5RA 4CFMB 1B9YC 2CVBA 5DAKA 5CO3A 4MDCA 3BG5A 3QAGA 2LTKA 1R7HA 3N9JA 1AHJB 2X4AA 4HL4A 3GNJA 4NMUA 3KHIA 4GSNA 2PVOC 3IA1A 1XW6A 1K0DA 4MH3A 2A4VA 5ID2B 5IIZA 4N10A 3UBKA 3CTFA 3P90A 5J4UA 3LG6A 3M03A 3GMFA 5LCZA 4TW5A 4PQHA 1RK4A 4KDXA 1Y25A 2JZTA 1X9WB 1GULA 4G9HA 1ILOA 4BCMB 3HHTB 3APQA 5JCUA 1X0RA 5F06A 1YZXA 1F37A 2HRFA 2PERA 4BXXX 1JKWA 2GDRA 3C1SA 4BCFB 2H66A 4L8EA 4AJ6A 5INYA 3BBYA 3MDKA 2A4HA 4ROEA 2DMMA 20GSA 3PPUA 1MTCA 3M1GA 2H6ZA 4HUAA 2AB6A 4GXZA 1WMJA 3GTUB 5IPGA 4KF9A 2GZPA 5CYIB 2UZBB 3FW2A 4KNDA 4ZB8A 1THXA 4L5LA 5ABRA 2OJLA 3VPTA 1TP9A 2C1YA 1JZRA 3I43A 1SENA 1EOGA 1H1QB 3KTLA 2DJ3A 3ZIJA 1K3LA 3UMAA 4E8HA 1CQGA 4EC0A 3GSSA 1JFUA 1RW1A 3X20B 2H76A 1AISB 5ACBA 1GNWA 3NIVA 3MIXA 1EV4A 4CFUD 3D22A 3RHBA 1KBNA 5IOWA 3QHRB 2FHEA 5DCGA 1J0FA 3FR6A 3FR3A 2ZPGB 2C3NA 2I53A 3L9VA 3C8EA 2ZPIB 4TR1B 1XCCA 1SKRB 3LXZA 2C3QA 4LLRA 4N30A 4I5QA 2DD5B 2WPAB 6GSTA 4WBJA 1Z5YE 1G6YA 5AIXA 4RQXA 5J9BA 3VWVA 3DD3A 3MWHA 1NSWA 2LEGA 3QPMA 4NV2A 2WS2A 4ROCA 2FUG2 2FGXA 4IBPA 3U6VA 1PX6A 3EMPA 4O5UA 3TKSC 2HYXA 4G10A 4YOOA 3QFBC 5ECMB 4WBRD 1Z7PA 4PNFA 4ZGEB 2YOIA 4JU5A 4HJMA 3UIWA 3FZAA 4POLA 1NW2A 2HE3A 1V40A 2CZ3A 1GL8A 3APOA 4BCIB 2CJMB 1EEJA 4EOJB 4EC8B 2LW4A 2XBIA 2HZEA 3C7MA 4Q5FA 2G77A 3V1WA 1TRWA 4FH8A 1FVKA 2MBSA 4BCND 1KEBA 2B1KA 2TRXA 3O76A 3NOFA 1K0AA 2LS5A 4GTUA 2KHPA 2JL4A 2FY6A 3D6IA 4ZXGA 4GQCA 5B6MA 3CQFA 1ML6A 3HJPA 4TR3A 4Z2TA 1QGVA 1BEDA 3CTGA 4HQZA 3HY2A 4HQSA 2HRAA 2AYTA 1A8YA 5DQVA 3KIJA 4ZGDB 2IFQB 4CW9A 3BHUB 3FZ5A 2F8AA 1TJDA 5D93A 4KRCB 2ES7A 2CX3A 2H1DA 1AQXA 2KR6A 2H1AA 5IPHA 5ENUA 2H30A 1UNGD 4NAXA 1OYJA 1OKTA 4EIQA 6GSYA 3NZNA 1GUMA 5IF1B 4RI6A 1U3IA 3VPQA 2WZ9A 4X0XA 5D96A 4HI7A 1H1SB 3DDPB 2KP1A 1HD2A 2R5GA 2H1BA 2K8VA 5GSSA 1FINB 2YWOA 4PURA 4OCEA 2A2PA 4NHWA 4HS1A 4AKGA 3UVHA 1GTUA 1T3BA 2XBQA 2E7PA 4IP6A 3VWUA 3A8GB 1A23A 2VLVA 3HZ4A 3HXSA 5DCHA 1GUXA 5B8AA 5BRTA 3A5IA 3RHCA 1FVVB 3BLHB 3POMA 4Y72B 2ZUPA 5JCGA 3Q19A 4FYUA 2C8UA 3UAPA 4MIMA 1FVJA 3HKRA 4OO5A 3X26B 1M0UA 5J41A 1B8XA 2GTUA 1B9XC 1WRYA 2FWHA 5ECNB 2DD4B 1OKVB 4OD7A 2W9ZA 4JX4A 4TKYA 2PVQA 4KSOA 2BKZB 2LSTA 1PGTA 2L59A 5CRWA 2W9FA 1AUCA 1VF4A 3ZZXA 3DVXA 1XFLA 2L6CA 1Q4JA 1SK2A 1SK1A 5ECIB 1PN0A 3BLRB 2JZRA 2R3XA 1O9KA 3DMLA 3VFIA 2PMIB 1ZYQB 1LU4A 1G7EA 4AI6A 3A2XA 4PUAA 4IQ1A 1UVZA 1PL2A 2G9XB 2WFYB 1V29B 3GKMA 4BCOB 4MMMA 1U3AA 2I1UA 3K7AM 4ZGJB 2CAQA 3WVEB 1GTBA 2YZUA 3H4KA 2YANA 3HZJA 3GRXA 3IK9A 4KGIA 1JLWA 4LA1A 1S3CA 3PGTA 3KP8A 4JE1A 3VI5A 1Y6EA 5EFQB 3TOUA 12GSA 4BVYA 5G2ZA 3US3A 3IBHA 1ZGNA 1TU7A 4CY6A 4MF5A 3IR4A 5CREA 1UNHD 4RUVA 4QL9A 2K9FA 1GSFA 2L4CA 2WB9A 2X99A 3KMNA 2CZ6B 2B7JA 4BVXA 1T1VA 2XPDA 4WEYA 1XWAA 2I81A 3HDCA 3B57A 3FK8A 2RM5A 3WGDA 2OE3A 1KTEA 3G33B 1W4VA 3GA4A 3GKKA 4PUFC 3KMOA 2VL2C 2A2RA 4KCAA 5EVOA 3M9JA 4JR4A 3I6AA 3U5RE 2G2QA 1C9BA 2B5XA 2JZSA 18GSA 1E2YA 4DSSA 1K0CA 4F7NB 5H5SA 3RPPA 1G3NC 1Z6MA 2PMTA 2MYGA 3GH6A 3CXGA 4ECCA 5HBEB 4BCKB 4BWSA 2L5OA 2FWGA 4MF6A 3GN3A 2H71A 4PQ1A 3ZRDA 1XWGA 4OR5B 2PWJA 4FYBA 3HJMA 1PSQA 3QR6A 3F4SA 4TXOA 4K0GA 4FIWA 1SJ6A 3IK7A 1TDIA 2RM6A 2CZ0B 3TKQA 1FO5A 3O0GD 1MDKA 2K8SA 1H1RB 3C1RA 2M46A 5C04A 1HNBA 4HLQA 5LQFB 1PKZA 4G19A 3TN8B 1XO2A 1LJRA 1GSQA 1EEMA 1XWKA 1GUKA 2MZCA 5FHIA 4L0UA 2C0FA 4D73B 1ZZYA 4JEDA 1FW1A 1JZDA 4A5PA 4ISDA 2GT5A 2C0DA 3LQ7A 3KD0A 3TKPA 4X43A 1EGRA 2CVKA 3KCMA 5IMDA 3BHTB 1EV9A 4KUNA 3MY5B 4OO4A 2VD1A 3HVXA 4OMVA 4ML6A 3TJFA 2CCIB 1UC7A 4JX5A 1N2AA 4FQUA 4LMVA 5ECQB 4LOCA 4EDZA 2PUKC 8GSSA 2IL3A 5KEJA 2VL3A 2CX4A 5GSTA 5IM9A 2QGSA 1BX9A 2HT9A 2R0CA 4ACSA 4OB3B 1YF1A 4P3YB 2C6TB 1F9MA 2YV7A 4ZL9A 2O8VB 3BJ5A 3TKRA 1VYWB 2FA8A 3F3QA 5DJMA 1JLVA 2LRTA 3TJJA 3A2VA 2KP2A 2VCVA 4CHSA 6GSVA 3IV4A 2GQMA 3IHQA 3TRPA 1ERWA 4AF2A 3GL5A 4XCSA 2B1LA 3KGKA 4ICYA 4KB3A 2V32A 2RUFA 2QKEA 2O7KA 4OB1B 4POMA 3RAZA 5CNWA 4MZBA 4H86A 2V41A 3P8WA 1FOVA 3GIXA 3GYKA 5ECHB 4O5RA 3DRNA 3BCKA 3Q74A 1PFOA 3D4MA 2ZPFB 2HRKA 2BTOT 1EWXA 4RODA 1ERUA 4OFMA 2V6KA 1RQMA 1OGUB 5D9WA 2M72A 4MZCA 1PL1A 3BG9A 1DUGA 2UZEB 1BG5A 1ACVA 3L78A 1I9DA 3APSA 2QQ8A 1H28B 1T8EB 1K0MA 4NXIA 1OC9B 2YV9A 2H0IA 2ZZDB 4Q5QA 2CYZB 2YZHA 4AKHA 4IQAA 1SJIA 3D21A 5HR3A 2IW6B 4MPFA 5ID2A 3W8SA 1FB6A 4K7IA 4F2IA 3G7YA 1B4QA 1R4WA 2WMBB 4FM4B 3X24B 3I69A 2QFZA 2UZLB 2PGTA 4MJCA 3HO8A 4MA9A 4TN8A 1SL2B 2KMGA 1ZP2A 1OL1B 4I3ZB 2K18A 4PXOA 4GWRA 3HD5A 4ECBA 2I40B 2AJQB 4EDYA 2HSHA 3FRCA 1F3BA 2F9SA 2OBIA 4IJIA 1A2LA 1GSEA 5FGKB 4BIKA 1FHEA 5HFKA 1XOAA 2C0EA 1S3RA 4F6SB 3VURA 3ZITA 3LSZA 2NPBA 1M7TA 2X49A 2ZNMA 4I6XA 4USSA 3MY1B 2K6VA 2FA4A 2HZFA 2G0FA 3L9SA 1N4MA 2FWEA 3TCOA 2ALBA 3ISOA 4IMYB 4YAPA 2I9HA 3QZ9B 2C5VB 4JBBA 1HQOA 5LD0A 3LGCA 4GRFA 2KOKA 4IKHA 4V1Ap 3QAVA 4KRDB 3K8NA 5IMZA 3KH9A 4K0NA 1XPVA 1TK0B 5FWGA 1GLPA 2N5BA 1MDIA 2F3MA 3ZL5A 1O8WA 2YJ7A 3DKSA 3TKSE 3BCIA 5ECOB 2GS3A 2E2GA 1Z7RA 2WMAB 1SJZA 2GVPA 3RBTA 5L71A 2VM2A 2VOCA 3IDVA 1HNCA 1T7PB 1M2AA 2H70A 1X5CA 3ZFLA 2CQ9A 3GX8A 5E59A 5D9VA 3KZQA 4XS1A 4MABA 4CXAB 2O89A 2ZPEB 3IRAA 2HFDA 2TIRA 4TXVA 3GHAA 3TNHB 4MH2A 1YEPA 3L4NA 3UVTA 3EVIA 4OCFA 4MJBA 1DE2A 1D3UB 1KNGA 1S3AA 2MMZA 5COHA 10GSA 5DDLA 2IN3A 5GAPD 1OC3A
chains in the Genus database with same CATH topology
1OAZA 1XW9A 1QQ2A 2L5LA 3TUEA 1I5GA 2GSTA 4IN0A 1FG4A 5A4VA 3VLNA 2H72A 5F07A 3UJ1A 1OKDA 1YEXA 3MAKA 3PR8A 4IHUA 3QD9A 4EF0A 3WD6A 5G1LA 5G5FA 2VL9A 1ZYPA 3ZVJD 3PINA 1TI3A 4J56E 1X9MB 1TTZA 3GSTA 3GX0A 1UN2A 2R2JA 5LNKe 1Z6NA 2LNSA 2GZZA 5ECSA 2E0QA 4Z2RA 3GL3A 3IAM2 4KH7A 2F51A 2MMOA 1ABAA 1JHBA 2XPEA 4YKGA 4J57E 3D0ZA 1OC8A 3GFKA 4L0WA 3QOUA 3KXOA 2LRCA 3EC3A 4ZL7A 2MMAA 3M8NA 1IYHA 3HHVA 2RLIA 4Z2UA 1G7OA 4V1Ag 1THOA 1C72A 2WFCA 3CRTA 1GRXA 4G2EA 2IFQA 2H6XA 5DALB 3EWLA 3HJOA 3FZ4A 1R26A 4K7NA 2A2SA 4MJEA 1V57A 1O8XA 1B48A 3ZLPA 1USBA 1XBSA 5J3RA 4IELA 2R37A 4O92A 1WOUA 2PBJA 2RUEA 4WR4A 1AIUA 4K5RA 1O81A 3CSIA 2CT6A 3FKFA 3ZVJA 3R2QA 1E6BA 4F9ZA 4K9ZA 1PA3A 3ERFA 3KJYA 2PPTA 4PNGA 3MSZA 1T4YA 3H79A 4NWYA 3ZIVA 2VCZA 3TOTA 2FLSA 1YJ6A 2DMLA 1BYEA 1SL1B 4EE0A 4QQ7A 1GH2A 2IJYA 1WIKA 2JADA 4DVCA 2X8HA 1XIYA 1DE1A 3OR5A 4F82A 4K2XA 2H75A 2P5RA 1XVWA 1YQ1A 2V6OA 2EIRA 3E9JB 4K8MA 4FYCA 5CRDA 5AN1A 4KCEA 1XWBA 1Q98A 3WT2A 4POKA 5ELGA 1ZMAA 5DQYA 1BQ7A 5D9TA 1M9BA 4G0KA 4WETA 2VUPA 3CMIA 2JSYA 1TRSA 2DJ0A 4JRRA 2C0GA 2D2ZA 11GSA 2H0HA 3HA9A 4IGJA 5D9XA 4XS4B 3VWWA 4XS6A 2V1MA 2EIQA 2B7KA 1ERTA 1GNEA 2R6KA 5KN0A 4BL7B 3JCML 2EC4A 1TK5B 2NDOA 2LQOA 1QMVA 4HOJA 2IMIA 5CRGA 4NPBA 5D73A 3IC8A 3FEUA 2P0GA 3DXBA 3R3EA 1ON4A 5KN1A 4ID0A 5F0GA 3D5JA 3H1NA 1SKWB 2WCIA 2RIIA 1G0TA 2H0GA 3IHGA 4TRXA 3SBCA 1NHYA 4IS0A 3F4RA 4LL1B 4HZ2A 2X64A 1R5PA 1SD8A 3RPNA 1LBKA 4GQFA 4ML1A 3UEMA 4BPYA 1FB0A 3ZMKA 4TVEA 4EVMA 3RDWA 1ZYEA 1S3DA 3CBUA 1EP7A 3TRQA 2OACA 2I4AA 5EPFA 3W6GA 5EY6A 1XW5A 1URMA 1X9SB 1TW9A 3O6TA 5G31A 4F0CA 2YNXA 4G0LA 1WJKA 4HDEA 4OFTA 5E4WA 1AAZA 1PRXA 3HZ8A 2LUSA 4KA0A 4F03A 1UA5A 1YKAA 1HNAA 2YJHA 4DEJA 2F8FA 2YP6A 1ZCPA 3KM6A 5BMUA 3GUSA 4AJ8A 4EO3A 2VCQA 2PU9C 4CY8A 1J08A 2M80A 1PD21 2H73A 3DYRA 4V2MA 3BOAA 2AV4A 4MK3A 3ZREA 1H4OA 5IMVA 1X5DA 1A2JA 3EYTA 1W89A 2VD0A 4ZL8A 2OE0A 1SL0B 2GLRA 3TJKA 1TRVA 2EIOA 3LJRA 4D73A 4MCUA 2IMEA 3IXRA 4I8BA 1OE8A 16GSA 2LNTA 3HYPA 4EXJA 4PX1A 4GSSA 1SU9A 1BJXA 1ERVA 3FZ9A 3TGZA 1TRUA 5GZZB 3CRUA 1Z3EA 5KN3A 2OADA 1AW9A 3BD2A 1A0RP 3Q18A 2R0PA 22GSA 2H19A 1MD4A 3IC4A 6GSWA 1OVNA 4XHMA 1XVQA 4IW9A 1TK8B 1SKSB 4K5SA 2QA2A 4XIHA 2DLXA 4MJAA 5GAND 4IVFA 1SYRA 3KP9A 1YDKA 4KAEA 4JZQA 3H93A 5DAKB 2R0GA 1EGOA 4DSRA 5AGYA 1X5EA 2IIYA 3TB2A 2FD3A 5F8BA 3EPTA 2IMKA 5JWOB 2LRNA 4V2LA 2J9HA 3C71A 2WJUA 1V2AA 3G9BA 2BMXA 2I3YA 1M2DA 2HI7A 2IWTA 2DIZA 5ECRB 1U88A 3GV1A 2N5AA 1GP1A 4Q5NA 4AJ7A 2DKHA 3VI7A 2PN8A 5EL8A 4K7OA 5H5QA 1QK8A 5JWQB 4ECIA 4JR6A 3QDNA 2HRNA 1O73A 4X4JA 2H8LA 4HEA2 4ZB9A 4CDOA 4LMWA 1AXDA 1OC9A 2FCHA 4POBA 4ZBDA 5IMAA 5B8BA 5DVBA 3M9KA 1QFNA 5IOXA 4YKFA 5CAXA 4X1UA 3LYKA 5HR0A 5AIVA 3WT1A 3Q6OA 2QGVA 2DJJA 3QAWA 2LJKA 5B7CA 4YQUA 3G7IA 1K3YA 4XRDA 4O5QA 4TR4A 3VWXA 2QA1A 3GTUA 1SD9A 4K6XA 1VRSD 4ECJA 3FY7A 2R4VA 4PTSA 3HVVA 2AUVA 1QUWA 4ZILA 1V98A 1AQWA 3IE3A 1MD3A 4WKWA 1YY7A 4RI7A 3EURA 3KH7A 4KE3A 5IMFA 1B4PA 3HVSA 2X8GA 4MZWA 1XXUA 2LV3A 3A2WA 5DJLA 5G5EA 2HXKA 1PMTA 1V58A 5HR2A 4ZB6A 5D8IA 5ECKB 3TJGA 3ERGA 1HYUA 4ULXA 4LL4B 2REMA 4DSQA 3F0IA 4GF0A 1NHOA 5JWRB 5ECPB 2VCTA 3ZTLA 3HCZA 2H1GA 2GSQA 4TR1A 2GT6A 1JZWA 17GSA 4KDUA 2CA8A 1XOBA 3L0HA 4TR0A 3TRXA 5IQYA 5HFGA 1M9AA 2LJAA 3WGXA 3EMXA 5G30A 1CQHA 1K0NA 3GURA 1O7UA 6GSUA 6GSXA 3CSHA 5CYYA 2VM1A 1U87A 2Z9SA 3EINA 3S9FA 4PQIA 2HZEB 2LJRA 2CV4A 5HQPA 3QFAC 3O3TA 2P5QA 2O87A 4J2FA 3J7Yk 3P7XA 2NBSA 3DVWA 4F0BA 2VLUA 4I97A 2WDUA 2VO4A 3G7JA 2QC7A 2L57A 2X8CA 4MLYA 3A5WA 3CSJA 1VGLA 1Z9HA 2VL2A 3ZFBA 1DBYA 4N0VA 4FO5A 4HZ4A 1O85A 2BJXA 1VF3A 2P31A 5B6NA 2B3SA 4MNNA 1MDJA 14GSA 1XZOA 2NVLA 4HU9A 5G1KA 2OBKA 4HU7A 3DWVA 4N0ZA 3D4TA 3FHKA 3H8QA 2VAFA 2JU5A 1A2MA 4YQVA 3EU3A 3TJBA 3E0UA 4ZIJA 3ME8A 2B5EA 4HJ2A 2H6YA 3LFLA 3QMXA 1TKDB 5A5KA 4WF4A 1FAAA 1GSSA 2HNLA 3KTBA 4YQMA 4EKZA 5DALA 5J5NA 1F6MC 3GKNA 3QCPA 1ZOFA 2VCWA 1PQNA 4YAVA 3GH9A 6GSSA 3FYGA 4GLTA 3F4TA 2DKIA 2QSIA 2FNOA 4WR5A 4E8EA 1GTIA 1QXHA 3IAS2 3I9V2 1EZKA 1FOHA 1GSYA 3WGEA 2GQKA 3TDGA 3UOMA 1T00A 5FT3A 1WPIA 3F6FA 4AGSA 3ZYWA 3W8JA 4OWYA 2LQQA 4KX4A 5A4UA 1YKCA 3ZMLA 1NM3A 3WYWA 3LXTA 2DC5A 2L4QA 1IYIA 1F3AA 3LORA 2GZYA 1V9WA 2J23A 4O32A 3LYPA 2CZ2A 1GTAA 3VK9A 1OE7A 2YN1A 3GKXA 3MYDA 3EE2A 1WE0A 1PN9A 4I2UA 1PKWA 1T4ZA 1VF2A 4BA7A 3F6DA 5IMCA 1TU8A 3ME7A 1WP0A 2DJKA 4EL1A 2VLTA 1EOHA 4RQRA 2KUCA 3DGQA 3C73A 2XHFA 2B6MA 1VF1A 4V2NA 4BVYB 4XS4A 4ZBAA 4MP4A 3KEBA 3M0FA 2WULA 4BL7A 2HSYA 2FWFA 5AISA 3FR9A 4ILFA 3LW9A 1A0FA 4BVXB 2C4JA 19GSA 5H5RA 1GUHA 1MEKA 3FMWA 3F63A 1F2EA 4L5OA 5ELAA 3AY8A 2N5FA 4GSTA 5KOWA 2ZCTA 4KSMA 2DJ2A 2E2MA 1GWCA 2ON7A 9GSSA 1TOFA 1J9BA 4G0IA 2C80A 1SK0A 2H01A 4DSSB 2UZ8A 4N11A 1G6WA 1EP8A 4ZBBA 1DSBA 2O85A 3LEFA 4XRAA 1K3OA 2JSZA 5KN2A 2H74A 5IO0A 5CRHA 1A8LA 4IP1A 4WXTA 3ERWA 3F9UA 4EIPA 2YWNA 2YWIA 3CYNA 1BAYA 4Z7XA 2OA7A 2DSAA 2OE1A 1GLQA 2C3TA 2ON5A 3SWLA 5C00A 1AQVA 1M99A 4K2DA 4KDYA 4TXOB 1R5AA 4MF7A 1ST9A 2IPAA 4PGTA 2MBTA 5JCWA 2WGRA 4QL7A 2GQLA 2HLSA 5ECLB 4TOPA 5HR1A 4EUYA 5IO2A 2YPMA 7GSSA 3UARA 4NHZA 3M3MA 3A3TA 3N5OA 2AHEA 2XC2A 3MNGA 1TI1A 1YF0A 3F8UA 3IPZA 4K1FA 1SYXA 1H75A 4WF5A 3PH9A 2YCDA 2B5YA 1JZOA 2KLXA 2LKUA 5DQSA 5A4WA 2JACA 1ZYNA 2VCXA 2AAWA 1GSDA 2IMDA 5HFIA 2TRCP 3IOSA 2DIYA 4I2TA 2NTOA 2GSRA 2CVDA 2DJ1A 4KW6A 4OFNA 4GCIA 3EU4A 3ED3A 2YWMA 2CAIA 3E3EA 3TKSA 3F3RA 5J9CA 2HSMA 1PX7A 1O6JA 5CP1A 2GSSA 1WWJA 2OKAA 3P2AA 1N8JA 1TXXA 5F05A 2MMNA 1U6TA 1ZL9A 3UL3A 2WRTA 13GSA 4MPGA 5KOXA 1M2BA 5DBQA 1K0BA 4O7HA 2V2GA 3J7Yb 2DBCA 2VIMA 3DEXA 2L6DA 4NV5A 2IMFA 4IJ3A 3LWAA 1XWCA 1GSUA 4YH2A 4BWQA 1K0OA 4XTSA 1AC1A 3UBLA 3DIEA 3L9UA 1A24A 2GGTA 4Q5RA 1B9YC 2CVBA 5DAKA 5CO3A 4MDCA 3QAGA 2LTKA 1R7HA 3N9JA 2X4AA 3GNJA 4NMUA 4GSNA 2PVOC 3IA1A 1XW6A 1K0DA 4MH3A 2A4VA 5ID2B 5IIZA 4N10A 3UBKA 3CTFA 3P90A 5J4UA 3LG6A 3GMFA 5LCZA 4TW5A 4PQHA 1RK4A 4KDXA 1Y25A 2JZTA 1X9WB 1GULA 4G9HA 1ILOA 3APQA 5JCUA 1X0RA 5F06A 1YZXA 1F37A 2HRFA 2PERA 2GDRA 3C1SA 2H66A 4L8EA 4AJ6A 5INYA 3BBYA 3MDKA 2A4HA 2DMMA 20GSA 3PPUA 1MTCA 3M1GA 2H6ZA 4HUAA 2AB6A 4GXZA 1WMJA 3GTUB 5IPGA 4KF9A 2GZPA 3FW2A 4KNDA 4ZB8A 1THXA 4L5LA 5ABRA 2OJLA 3VPTA 1TP9A 2C1YA 1JZRA 3I43A 1SENA 1EOGA 3KTLA 2DJ3A 3ZIJA 1K3LA 3UMAA 4E8HA 1CQGA 4EC0A 3GSSA 1JFUA 1RW1A 2H76A 1GNWA 3NIVA 3MIXA 1EV4A 3D22A 3RHBA 1KBNA 5IOWA 2FHEA 5DCGA 1J0FA 3FR6A 3FR3A 2C3NA 3L9VA 3C8EA 4TR1B 1XCCA 1SKRB 3LXZA 2C3QA 4LLRA 4N30A 4I5QA 6GSTA 4WBJA 1Z5YE 1G6YA 5AIXA 4RQXA 5J9BA 3VWVA 3DD3A 3MWHA 1NSWA 2LEGA 3QPMA 4NV2A 2WS2A 2FUG2 2FGXA 4IBPA 3U6VA 1PX6A 3EMPA 4O5UA 3TKSC 2HYXA 4G10A 3QFBC 5ECMB 4WBRD 1Z7PA 4PNFA 2YOIA 4JU5A 4HJMA 3UIWA 3FZAA 4POLA 1NW2A 2HE3A 1V40A 2CZ3A 1GL8A 3APOA 1EEJA 2XBIA 2HZEA 3C7MA 4Q5FA 3V1WA 1TRWA 4FH8A 1FVKA 2MBSA 1KEBA 2B1KA 2TRXA 3O76A 3NOFA 1K0AA 2LS5A 4GTUA 2KHPA 2JL4A 2FY6A 3D6IA 4ZXGA 4GQCA 5B6MA 1ML6A 3HJPA 4TR3A 4Z2TA 1QGVA 1BEDA 3CTGA 4HQZA 3HY2A 4HQSA 2HRAA 2AYTA 1A8YA 3KIJA 2IFQB 4CW9A 3FZ5A 2F8AA 1TJDA 5D93A 2ES7A 2CX3A 2H1DA 1AQXA 2H1AA 5IPHA 5ENUA 2H30A 4NAXA 1OYJA 1OKTA 4EIQA 6GSYA 3NZNA 1GUMA 4RI6A 1U3IA 3VPQA 2WZ9A 4X0XA 5D96A 4HI7A 2KP1A 1HD2A 2R5GA 2H1BA 2K8VA 5GSSA 2YWOA 4PURA 4OCEA 2A2PA 4NHWA 4HS1A 3UVHA 1GTUA 1T3BA 2XBQA 2E7PA 4IP6A 3VWUA 2VLVA 1A23A 3HZ4A 3HXSA 5DCHA 5B8AA 5BRTA 3A5IA 3RHCA 2ZUPA 5JCGA 3Q19A 4FYUA 2C8UA 3UAPA 1FVJA 3HKRA 4OO5A 1M0UA 5J41A 1B8XA 2GTUA 1B9XC 1WRYA 2FWHA 5ECNB 4OD7A 4TKYA 2PVQA 4KSOA 2LSTA 1PGTA 2L59A 5CRWA 1AUCA 1VF4A 3ZZXA 3DVXA 1XFLA 2L6CA 1Q4JA 1SK2A 1SK1A 5ECIB 1PN0A 2JZRA 2R3XA 3DMLA 3VFIA 1ZYQB 1LU4A 1G7EA 3A2XA 4PUAA 4IQ1A 1UVZA 1PL2A 3GKMA 4MMMA 1U3AA 2I1UA 2CAQA 1GTBA 2YZUA 3H4KA 2YANA 3GRXA 3IK9A 4KGIA 1JLWA 4LA1A 1S3CA 3PGTA 3KP8A 4JE1A 3VI5A 1Y6EA 3TOUA 12GSA 4BVYA 5G2ZA 3US3A 3IBHA 1ZGNA 1TU7A 4CY6A 4MF5A 3IR4A 5CREA 4RUVA 4QL9A 2K9FA 1GSFA 2L4CA 2WB9A 2X99A 3KMNA 2B7JA 4BVXA 1T1VA 2XPDA 4WEYA 1XWAA 2I81A 3HDCA 3FK8A 2RM5A 3WGDA 2OE3A 1KTEA 1W4VA 3GA4A 3GKKA 4PUFC 3KMOA 2VL2C 2A2RA 4KCAA 5EVOA 3M9JA 4JR4A 3I6AA 3U5RE 2G2QA 2B5XA 2JZSA 18GSA 1E2YA 4DSSA 1K0CA 5H5SA 3RPPA 1Z6MA 2PMTA 2MYGA 3GH6A 3CXGA 4ECCA 4BWSA 2L5OA 2FWGA 4MF6A 3GN3A 2H71A 4PQ1A 3ZRDA 1XWGA 2PWJA 4FYBA 3HJMA 1PSQA 3QR6A 3F4SA 4TXOA 4K0GA 4FIWA 1SJ6A 3IK7A 1TDIA 2RM6A 3TKQA 1FO5A 1MDKA 2K8SA 3C1RA 2M46A 5C04A 1HNBA 1PKZA 4G19A 1LJRA 1GSQA 1EEMA 1XWKA 1GUKA 2MZCA 5FHIA 4L0UA 2C0FA 4D73B 1ZZYA 4JEDA 1FW1A 1JZDA 4A5PA 4ISDA 2GT5A 2C0DA 3LQ7A 3KD0A 3TKPA 4X43A 1EGRA 2CVKA 3KCMA 5IMDA 1EV9A 4KUNA 4OO4A 2VD1A 3HVXA 4OMVA 4ML6A 3TJFA 4LMVA 1UC7A 4FQUA 1N2AA 5ECQB 4EDZA 2PUKC 8GSSA 2IL3A 5KEJA 2VL3A 2CX4A 5GSTA 5IM9A 1BX9A 2HT9A 2R0CA 4ACSA 1YF1A 4P3YB 1F9MA 2YV7A 4ZL9A 2O8VB 3BJ5A 3TKRA 2FA8A 3F3QA 5DJMA 1JLVA 2LRTA 3TJJA 3A2VA 2KP2A 2VCVA 4CHSA 6GSVA 3IV4A 2GQMA 3IHQA 3TRPA 1ERWA 4AF2A 3GL5A 4XCSA 2B1LA 3KGKA 4ICYA 4KB3A 2V32A 2RUFA 2QKEA 2O7KA 4POMA 3RAZA 5CNWA 4MZBA 4H86A 2V41A 3P8WA 1FOVA 3GIXA 3GYKA 5ECHB 4O5RA 3DRNA 3BCKA 3Q74A 3D4MA 2HRKA 2BTOT 1EWXA 1ERUA 4OFMA 2V6KA 1RQMA 5D9WA 2M72A 4MZCA 1PL1A 1DUGA 1BG5A 1ACVA 3L78A 1I9DA 3APSA 1T8EB 1K0MA 4NXIA 1OC9B 2YV9A 2H0IA 4Q5QA 2YZHA 4IQAA 1SJIA 3D21A 5HR3A 4MPFA 5ID2A 3W8SA 1FB6A 4K7IA 4F2IA 3G7YA 1B4QA 1R4WA 3I69A 2PGTA 4MJCA 4MA9A 4TN8A 1SL2B 2K18A 4PXOA 4GWRA 3HD5A 4ECBA 2AJQB 4EDYA 2HSHA 3FRCA 1F3BA 2F9SA 2OBIA 4IJIA 1A2LA 1GSEA 1FHEA 5HFKA 1XOAA 2C0EA 3VURA 3ZITA 3LSZA 2NPBA 1M7TA 2X49A 2ZNMA 4I6XA 4USSA 2K6VA 2FA4A 2HZFA 2G0FA 3L9SA 2FWEA 3TCOA 2ALBA 3ISOA 4YAPA 2I9HA 4JBBA 1HQOA 5LD0A 3LGCA 4GRFA 2KOKA 4IKHA 4V1Ap 3QAVA 5IMZA 3K8NA 3KH9A 4K0NA 1XPVA 1TK0B 5FWGA 1GLPA 2N5BA 1MDIA 2F3MA 3ZL5A 1O8WA 2YJ7A 3DKSA 3TKSE 3BCIA 5ECOB 2GS3A 2E2GA 1Z7RA 1SJZA 2GVPA 3RBTA 5L71A 2VM2A 2VOCA 3IDVA 1HNCA 1T7PB 1M2AA 2H70A 1X5CA 3ZFLA 2CQ9A 3GX8A 5E59A 5D9VA 3KZQA 4XS1A 4MABA 2O89A 3IRAA 2HFDA 2TIRA 4TXVA 3GHAA 4MH2A 1YEPA 3L4NA 3UVTA 3EVIA 4OCFA 4MJBA 1DE2A 1KNGA 1S3AA 2MMZA 5COHA 10GSA 5DDLA 2IN3A 5GAPD 1OC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OAZ A;  1XW9 A;  1QQ2 A;  2L5L A;  3TUE A;  1I5G A;  2GST A;  4IN0 A;  1FG4 A;  5A4V A;  3VLN A;  2H72 A;  5F07 A;  3UJ1 A;  1OKD A;  1YEX A;  3MAK A;  3PR8 A;  4IHU A;  3QD9 A;  4EF0 A;  3WD6 A;  5G1L A;  5G5F A;  2VL9 A;  3ZVJ D;  3PIN A;  1TI3 A;  4J56 E;  1X9M B;  1TTZ A;  3GST A;  3GX0 A;  1UN2 A;  2R2J A;  5LNK e;  1Z6N A;  2LNS A;  2GZZ A;  5ECS A;  2E0Q A;  3GL3 A;  3IAM 2;  4KH7 A;  2F51 A;  2MMO A;  1ABA A;  1JHB A;  2XPE A;  4J57 E;  3D0Z A;  1OC8 A;  3GFK A;  4L0W A;  3QOU A;  3KXO A;  2LRC A;  3EC3 A;  4ZL7 A;  2MMA A;  3M8N A;  1IYH A;  3HHV A;  2RLI A;  1G7O A;  4V1A g;  1THO A;  1C72 A;  2WFC A;  3CRT A;  1GRX A;  4G2E A;  2IFQ A;  2H6X A;  5DAL B;  3EWL A;  3HJO A;  3FZ4 A;  1R26 A;  4K7N A;  2A2S A;  4MJE A;  1V57 A;  1O8X A;  1B48 A;  3ZLP A;  1USB A;  1XBS A;  5J3R A;  4IEL A;  2R37 A;  4O92 A;  1WOU A;  2PBJ A;  2RUE A;  4WR4 A;  1AIU A;  1O81 A;  3CSI A;  2CT6 A;  3FKF A;  3ZVJ A;  3R2Q A;  1E6B A;  4F9Z A;  4K9Z A;  1PA3 A;  3ERF A;  3KJY A;  2PPT A;  4PNG A;  3MSZ A;  1T4Y A;  3H79 A;  4NWY A;  3ZIV A;  2VCZ A;  3TOT A;  2FLS A;  1YJ6 A;  2DML A;  1BYE A;  1SL1 B;  4EE0 A;  4QQ7 A;  1GH2 A;  2IJY A;  1WIK A;  2JAD A;  4DVC A;  2X8H A;  1XIY A;  1DE1 A;  3OR5 A;  4F82 A;  2H75 A;  2P5R A;  1XVW A;  1YQ1 A;  2V6O A;  2EIR A;  3E9J B;  4K8M A;  4FYC A;  5CRD A;  5AN1 A;  4KCE A;  1XWB A;  1Q98 A;  3WT2 A;  4POK A;  5ELG A;  1ZMA A;  5DQY A;  1BQ7 A;  5D9T A;  1M9B A;  4WET A;  2VUP A;  3CMI A;  2JSY A;  1TRS A;  2DJ0 A;  4JRR A;  2C0G A;  2D2Z A;  11GS A;  2H0H A;  3HA9 A;  4IGJ A;  5D9X A;  4XS4 B;  3VWW A;  4XS6 A;  2V1M A;  2EIQ A;  2B7K A;  1ERT A;  1GNE A;  2R6K A;  5KN0 A;  3JCM L;  2EC4 A;  1TK5 B;  2NDO A;  2LQO A;  1QMV A;  4HOJ A;  2IMI A;  5CRG A;  4NPB A;  5D73 A;  3FEU A;  2P0G A;  3DXB A;  1ON4 A;  5KN1 A;  4ID0 A;  5F0G A;  3D5J A;  3H1N A;  1SKW B;  2WCI A;  2RII A;  1G0T A;  2H0G A;  4TRX A;  3SBC A;  1NHY A;  4IS0 A;  3F4R A;  4LL1 B;  4HZ2 A;  2X64 A;  1R5P A;  1SD8 A;  3RPN A;  1LBK A;  4GQF A;  4ML1 A;  3UEM A;  4BPY A;  1FB0 A;  3ZMK A;  4TVE A;  4EVM A;  3RDW A;  1ZYE A;  1S3D A;  3CBU A;  1EP7 A;  3TRQ A;  2OAC A;  2I4A A;  5EPF A;  3W6G A;  5EY6 A;  1XW5 A;  1URM A;  1X9S B;  1TW9 A;  3O6T A;  5G31 A;  4F0C A;  2YNX A;  1WJK A;  4HDE A;  4OFT A;  5E4W A;  1AAZ A;  1PRX A;  3HZ8 A;  2LUS A;  4KA0 A;  4F03 A;  1UA5 A;  1YKA A;  1HNA A;  2YJH A;  4DEJ A;  2F8F A;  2YP6 A;  1ZCP A;  3KM6 A;  3GUS A;  4AJ8 A;  4EO3 A;  2VCQ A;  2PU9 C;  1J08 A;  2M80 A;  1PD2 1;  2H73 A;  3DYR A;  4V2M A;  3BOA A;  2AV4 A;  4MK3 A;  3ZRE A;  1H4O A;  5IMV A;  1X5D A;  1A2J A;  3EYT A;  1W89 A;  2VD0 A;  4ZL8 A;  2OE0 A;  1SL0 B;  2GLR A;  3TJK A;  1TRV A;  2EIO A;  3LJR A;  4D73 A;  4MCU A;  2IME A;  3IXR A;  4I8B A;  1OE8 A;  16GS A;  2LNT A;  3HYP A;  4EXJ A;  4GSS A;  4PX1 A;  1SU9 A;  1BJX A;  1ERV A;  3FZ9 A;  3TGZ A;  1TRU A;  5GZZ B;  3CRU A;  1Z3E A;  5KN3 A;  2OAD A;  1AW9 A;  3BD2 A;  1A0R P;  3Q18 A;  22GS A;  2H19 A;  1MD4 A;  3IC4 A;  6GSW A;  1OVN A;  4XHM A;  1XVQ A;  4IW9 A;  1TK8 B;  1SKS B;  4XIH A;  2DLX A;  4MJA A;  5GAN D;  4IVF A;  1SYR A;  3KP9 A;  1YDK A;  4KAE A;  4JZQ A;  3H93 A;  5DAK B;  1EGO A;  4DSR A;  5AGY A;  1X5E A;  2IIY A;  3TB2 A;  2FD3 A;  5F8B A;  2IMK A;  5JWO B;  2LRN A;  4V2L A;  2J9H A;  3C71 A;  2WJU A;  1V2A A;  3G9B A;  2BMX A;  2I3Y A;  1M2D A;  2HI7 A;  2IWT A;  2DIZ A;  5ECR B;  1U88 A;  3GV1 A;  2N5A A;  1GP1 A;  4Q5N A;  4AJ7 A;  3VI7 A;  2PN8 A;  5EL8 A;  4K7O A;  5H5Q A;  1QK8 A;  5JWQ B;  4ECI A;  4JR6 A;  3QDN A;  2HRN A;  1O73 A;  2H8L A;  4HEA 2;  4ZB9 A;  4CDO A;  4LMW A;  1AXD A;  1OC9 A;  2FCH A;  4POB A;  4ZBD A;  5IMA A;  5B8B A;  5DVB A;  3M9K A;  1QFN A;  5IOX A;  5CAX A;  4X1U A;  3LYK A;  5HR0 A;  5AIV A;  3WT1 A;  3Q6O A;  2QGV A;  2DJJ A;  3QAW A;  2LJK A;  5B7C A;  4YQU A;  3G7I A;  1K3Y A;  4XRD A;  4TR4 A;  3VWX A;  3GTU A;  1SD9 A;  4K6X A;  1VRS D;  4ECJ A;  3FY7 A;  2R4V A;  3HVV A;  2AUV A;  1QUW A;  4ZIL A;  1V98 A;  1AQW A;  3IE3 A;  1MD3 A;  4WKW A;  1YY7 A;  4RI7 A;  3EUR A;  3KH7 A;  4KE3 A;  5IMF A;  1B4P A;  3HVS A;  2X8G A;  4MZW A;  1XXU A;  2LV3 A;  3A2W A;  5DJL A;  5G5E A;  2HXK A;  1PMT A;  1V58 A;  5HR2 A;  4ZB6 A;  5D8I A;  5ECK B;  3TJG A;  3ERG A;  1HYU A;  4ULX A;  4LL4 B;  2REM A;  4DSQ A;  3F0I A;  4GF0 A;  1NHO A;  5JWR B;  5ECP B;  2VCT A;  3ZTL A;  3HCZ A;  2H1G A;  2GSQ A;  4TR1 A;  2GT6 A;  1JZW A;  17GS A;  4KDU A;  2CA8 A;  1XOB A;  3L0H A;  4TR0 A;  3TRX A;  5IQY A;  5HFG A;  1M9A A;  2LJA A;  3WGX A;  3EMX A;  5G30 A;  1CQH A;  1K0N A;  3GUR A;  1O7U A;  6GSU A;  6GSX A;  3CSH A;  5CYY A;  2VM1 A;  1U87 A;  2Z9S A;  3EIN A;  3S9F A;  4PQI A;  2HZE B;  2LJR A;  2CV4 A;  5HQP A;  3QFA C;  3O3T A;  2P5Q A;  2O87 A;  4J2F A;  3J7Y k;  3P7X A;  2NBS A;  3DVW A;  4F0B A;  2VLU A;  4I97 A;  2WDU A;  2VO4 A;  3G7J A;  2QC7 A;  2L57 A;  2X8C A;  4MLY A;  3A5W A;  3CSJ A;  1VGL A;  1Z9H A;  2VL2 A;  3ZFB A;  1DBY A;  4N0V A;  4FO5 A;  4HZ4 A;  1O85 A;  2BJX A;  1VF3 A;  2P31 A;  5B6N A;  2B3S A;  14GS A;  1MDJ A;  1XZO A;  2NVL A;  4HU9 A;  5G1K A;  2OBK A;  4HU7 A;  3DWV A;  4N0Z A;  3D4T A;  3FHK A;  3H8Q A;  2VAF A;  2JU5 A;  1A2M A;  4YQV A;  3EU3 A;  3TJB A;  3E0U A;  4ZIJ A;  3ME8 A;  2B5E A;  4HJ2 A;  2H6Y A;  3LFL A;  3QMX A;  1TKD B;  5A5K A;  4WF4 A;  1FAA A;  1GSS A;  2HNL A;  3KTB A;  4YQM A;  4EKZ A;  5DAL A;  5J5N A;  1F6M C;  3GKN A;  3QCP A;  1ZOF A;  2VCW A;  1PQN A;  4YAV A;  3GH9 A;  6GSS A;  3FYG A;  4GLT A;  3F4T A;  2QSI A;  2FNO A;  4WR5 A;  4E8E A;  1GTI A;  1QXH A;  3IAS 2;  3I9V 2;  1EZK A;  1GSY A;  3WGE A;  2GQK A;  3TDG A;  3UOM A;  1T00 A;  5FT3 A;  1WPI A;  3F6F A;  4AGS A;  3ZYW A;  3W8J A;  4OWY A;  2LQQ A;  4KX4 A;  5A4U A;  1YKC A;  3ZML A;  1NM3 A;  3WYW A;  3LXT A;  2DC5 A;  2L4Q A;  1IYI A;  1F3A A;  3LOR A;  2GZY A;  1V9W A;  2J23 A;  4O32 A;  3LYP A;  2CZ2 A;  1GTA A;  3VK9 A;  1OE7 A;  2YN1 A;  3GKX A;  3EE2 A;  1WE0 A;  1PN9 A;  4I2U A;  1PKW A;  1T4Z A;  1VF2 A;  4BA7 A;  3F6D A;  5IMC A;  1TU8 A;  3ME7 A;  1WP0 A;  2DJK A;  4EL1 A;  2VLT A;  1EOH A;  4RQR A;  2KUC A;  3DGQ A;  3C73 A;  2XHF A;  2B6M A;  1VF1 A;  4V2N A;  4XS4 A;  4ZBA A;  4MP4 A;  3KEB A;  3M0F A;  2WUL A;  4BL7 A;  2HSY A;  2FWF A;  5AIS A;  3FR9 A;  4ILF A;  1A0F A;  2C4J A;  19GS A;  5H5R A;  1GUH A;  1MEK A;  3F63 A;  1F2E A;  4L5O A;  5ELA A;  3AY8 A;  2N5F A;  4GST A;  2ZCT A;  4KSM A;  2DJ2 A;  2E2M A;  1GWC A;  2ON7 A;  9GSS A;  1TOF A;  1J9B A;  2C80 A;  1SK0 A;  2H01 A;  4DSS B;  4N11 A;  1G6W A;  1EP8 A;  4ZBB A;  1DSB A;  2O85 A;  3LEF A;  4XRA A;  1K3O A;  2JSZ A;  5KN2 A;  2H74 A;  5IO0 A;  5CRH A;  1A8L A;  4IP1 A;  4WXT A;  3ERW A;  3F9U A;  2YWN A;  2YWI A;  3CYN A;  1BAY A;  4Z7X A;  2OA7 A;  2DSA A;  2OE1 A;  1GLQ A;  2C3T A;  2ON5 A;  3SWL A;  5C00 A;  1AQV A;  1M99 A;  4K2D A;  4KDY A;  4TXO B;  1R5A A;  4MF7 A;  1ST9 A;  2IPA A;  4PGT A;  2MBT A;  5JCW A;  2WGR A;  4QL7 A;  2GQL A;  2HLS A;  5ECL B;  4TOP A;  5HR1 A;  4EUY A;  5IO2 A;  2YPM A;  7GSS A;  3UAR A;  4NHZ A;  3M3M A;  3A3T A;  3N5O A;  2AHE A;  2XC2 A;  3MNG A;  1TI1 A;  1YF0 A;  3F8U A;  3IPZ A;  4K1F A;  1SYX A;  1H75 A;  4WF5 A;  3PH9 A;  2YCD A;  2B5Y A;  1JZO A;  2KLX A;  2LKU A;  5DQS A;  5A4W A;  2JAC A;  2VCX A;  2AAW A;  1GSD A;  2IMD A;  5HFI A;  2TRC P;  3IOS A;  2DIY A;  4I2T A;  2NTO A;  2GSR A;  2CVD A;  2DJ1 A;  4KW6 A;  4OFN A;  4GCI A;  3EU4 A;  3ED3 A;  2YWM A;  2CAI A;  3E3E A;  3TKS A;  3F3R A;  5J9C A;  1PX7 A;  1O6J A;  5CP1 A;  2GSS A;  1WWJ A;  2OKA A;  3P2A A;  1N8J A;  1TXX A;  5F05 A;  2MMN A;  1U6T A;  1ZL9 A;  3UL3 A;  2WRT A;  13GS A;  4MPG A;  1M2B A;  5DBQ A;  1K0B A;  4O7H A;  2V2G A;  3J7Y b;  2DBC A;  2VIM A;  3DEX A;  2L6D A;  4NV5 A;  2IMF A;  4IJ3 A;  3LWA A;  1XWC A;  1GSU A;  4YH2 A;  4BWQ A;  1K0O A;  4XTS A;  1AC1 A;  3UBL A;  3DIE A;  3L9U A;  1A24 A;  2GGT A;  4Q5R A;  1B9Y C;  2CVB A;  5DAK A;  5CO3 A;  4MDC A;  3QAG A;  2LTK A;  1R7H A;  3N9J A;  3GNJ A;  4NMU A;  4GSN A;  2PVO C;  3IA1 A;  1XW6 A;  1K0D A;  4MH3 A;  2A4V A;  5ID2 B;  5IIZ A;  4N10 A;  3UBK A;  3CTF A;  3P90 A;  5J4U A;  3LG6 A;  3GMF A;  5LCZ A;  4TW5 A;  4PQH A;  1RK4 A;  4KDX A;  1Y25 A;  2JZT A;  1X9W B;  1GUL A;  4G9H A;  1ILO A;  3APQ A;  5JCU A;  1X0R A;  5F06 A;  1YZX A;  1F37 A;  2HRF A;  2PER A;  2GDR A;  3C1S A;  2H66 A;  4L8E A;  4AJ6 A;  5INY A;  3BBY A;  3MDK A;  2DMM A;  20GS A;  1MTC A;  3M1G A;  2H6Z A;  4HUA A;  2AB6 A;  4GXZ A;  1WMJ A;  3GTU B;  5IPG A;  2GZP A;  3FW2 A;  4KND A;  4ZB8 A;  1THX A;  4L5L A;  5ABR A;  2OJL A;  3VPT A;  1TP9 A;  2C1Y A;  1JZR A;  3I43 A;  1SEN A;  1EOG A;  3KTL A;  2DJ3 A;  3ZIJ A;  1K3L A;  3UMA A;  4E8H A;  1CQG A;  4EC0 A;  3GSS A;  1JFU A;  1RW1 A;  2H76 A;  1GNW A;  3NIV A;  1EV4 A;  3D22 A;  3RHB A;  1KBN A;  5IOW A;  2FHE A;  5DCG A;  1J0F A;  3FR6 A;  3FR3 A;  2C3N A;  3L9V A;  3C8E A;  4TR1 B;  1XCC A;  1SKR B;  3LXZ A;  2C3Q A;  4LLR A;  4N30 A;  4I5Q A;  6GST A;  4WBJ A;  1Z5Y E;  1G6Y A;  5AIX A;  4RQX A;  5J9B A;  3VWV A;  3DD3 A;  3MWH A;  1NSW A;  2LEG A;  3QPM A;  4NV2 A;  2WS2 A;  2FUG 2;  2FGX A;  4IBP A;  3U6V A;  1PX6 A;  3EMP A;  3TKS C;  2HYX A;  4G10 A;  3QFB C;  5ECM B;  4WBR D;  1Z7P A;  4PNF A;  2YOI A;  4JU5 A;  4HJM A;  3UIW A;  3FZA A;  4POL A;  1NW2 A;  2HE3 A;  1V40 A;  2CZ3 A;  1GL8 A;  3APO A;  1EEJ A;  2XBI A;  2HZE A;  3C7M A;  4Q5F A;  3V1W A;  1TRW A;  4FH8 A;  1FVK A;  2MBS A;  1KEB A;  2B1K A;  2TRX A;  3O76 A;  3NOF A;  1K0A A;  2LS5 A;  4GTU A;  2KHP A;  2JL4 A;  2FY6 A;  3D6I A;  4ZXG A;  4GQC A;  5B6M A;  1ML6 A;  3HJP A;  4TR3 A;  1QGV A;  1BED A;  3CTG A;  4HQZ A;  3HY2 A;  4HQS A;  2AYT A;  1A8Y A;  3KIJ A;  2IFQ B;  4CW9 A;  3FZ5 A;  2F8A A;  1TJD A;  5D93 A;  2ES7 A;  2CX3 A;  2H1D A;  1AQX A;  2H1A A;  5IPH A;  5ENU A;  2H30 A;  4NAX A;  1OYJ A;  1OKT A;  6GSY A;  3NZN A;  1GUM A;  4RI6 A;  1U3I A;  3VPQ A;  2WZ9 A;  4X0X A;  5D96 A;  4HI7 A;  2KP1 A;  1HD2 A;  2R5G A;  2H1B A;  2K8V A;  5GSS A;  2YWO A;  4PUR A;  4OCE A;  4NHW A;  4HS1 A;  3UVH A;  1GTU A;  1T3B A;  2XBQ A;  2E7P A;  4IP6 A;  3VWU A;  2VLV A;  1A23 A;  3HZ4 A;  3HXS A;  5DCH A;  5B8A A;  3RHC A;  2ZUP A;  5JCG A;  3Q19 A;  4FYU A;  2C8U A;  3UAP A;  1FVJ A;  3HKR A;  4OO5 A;  1M0U A;  5J41 A;  1B8X A;  2GTU A;  1B9X C;  1WRY A;  2FWH A;  5ECN B;  4OD7 A;  4TKY A;  2PVQ A;  4KSO A;  2LST A;  1PGT A;  2L59 A;  5CRW A;  1AUC A;  1VF4 A;  3ZZX A;  3DVX A;  1XFL A;  2L6C A;  1Q4J A;  1SK2 A;  1SK1 A;  5ECI B;  2JZR A;  2R3X A;  3DML A;  3VFI A;  1ZYQ B;  1LU4 A;  1G7E A;  3A2X A;  4PUA A;  4IQ1 A;  1UVZ A;  1PL2 A;  3GKM A;  4MMM A;  1U3A A;  2I1U A;  2CAQ A;  1GTB A;  2YZU A;  3H4K A;  2YAN A;  3GRX A;  3IK9 A;  4KGI A;  1JLW A;  4LA1 A;  1S3C A;  3PGT A;  3KP8 A;  4JE1 A;  3VI5 A;  1Y6E A;  3TOU A;  12GS A;  4BVY A;  5G2Z A;  3US3 A;  3IBH A;  1ZGN A;  1TU7 A;  4MF5 A;  3IR4 A;  5CRE A;  4RUV A;  4QL9 A;  2K9F A;  1GSF A;  2L4C A;  2WB9 A;  2X99 A;  3KMN A;  2B7J A;  4BVX A;  1T1V A;  2XPD A;  4WEY A;  1XWA A;  2I81 A;  3HDC A;  3FK8 A;  2RM5 A;  3WGD A;  2OE3 A;  1KTE A;  1W4V A;  3GA4 A;  3GKK A;  4PUF C;  3KMO A;  2VL2 C;  2A2R A;  4KCA A;  5EVO A;  3M9J A;  4JR4 A;  3I6A A;  3U5R E;  2G2Q A;  2B5X A;  2JZS A;  18GS A;  1E2Y A;  4DSS A;  1K0C A;  5H5S A;  3RPP A;  1Z6M A;  2PMT A;  2MYG A;  3GH6 A;  3CXG A;  4ECC A;  4BWS A;  2L5O A;  2FWG A;  4MF6 A;  3GN3 A;  2H71 A;  4PQ1 A;  3ZRD A;  1XWG A;  2PWJ A;  4FYB A;  3HJM A;  1PSQ A;  3QR6 A;  3F4S A;  4TXO A;  4K0G A;  4FIW A;  1SJ6 A;  3IK7 A;  1TDI A;  2RM6 A;  3TKQ A;  1FO5 A;  1MDK A;  2K8S A;  3C1R A;  2M46 A;  5C04 A;  1HNB A;  1PKZ A;  4G19 A;  1LJR A;  1GSQ A;  1EEM A;  1XWK A;  1GUK A;  2MZC A;  5FHI A;  4L0U A;  2C0F A;  4D73 B;  1ZZY A;  4JED A;  1FW1 A;  1JZD A;  4ISD A;  2GT5 A;  2C0D A;  3LQ7 A;  3KD0 A;  3TKP A;  4X43 A;  1EGR A;  2CVK A;  3KCM A;  5IMD A;  1EV9 A;  4KUN A;  4OO4 A;  2VD1 A;  3HVX A;  4OMV A;  4ML6 A;  3TJF A;  4LMV A;  1UC7 A;  1N2A A;  5ECQ B;  4EDZ A;  2PUK C;  8GSS A;  2IL3 A;  5KEJ A;  2VL3 A;  2CX4 A;  5GST A;  5IM9 A;  1BX9 A;  2HT9 A;  4ACS A;  1YF1 A;  4P3Y B;  1F9M A;  2YV7 A;  4ZL9 A;  2O8V B;  3BJ5 A;  3TKR A;  2FA8 A;  3F3Q A;  5DJM A;  1JLV A;  2LRT A;  3TJJ A;  3A2V A;  2KP2 A;  2VCV A;  4CHS A;  6GSV A;  3IV4 A;  2GQM A;  3IHQ A;  3TRP A;  1ERW A;  4AF2 A;  3GL5 A;  4XCS A;  2B1L A;  3KGK A;  4KB3 A;  2V32 A;  2RUF A;  2QKE A;  2O7K A;  4POM A;  3RAZ A;  5CNW A;  4MZB A;  4H86 A;  2V41 A;  3P8W A;  1FOV A;  3GIX A;  3GYK A;  5ECH B;  4O5R A;  3DRN A;  3BCK A;  3Q74 A;  3D4M A;  2BTO T;  1EWX A;  1ERU A;  4OFM A;  2V6K A;  1RQM A;  5D9W A;  2M72 A;  4MZC A;  1PL1 A;  1DUG A;  1BG5 A;  1ACV A;  3L78 A;  1I9D A;  3APS A;  1T8E B;  1K0M A;  4NXI A;  1OC9 B;  2YV9 A;  2H0I A;  4Q5Q A;  2YZH A;  4IQA A;  1SJI A;  3D21 A;  5HR3 A;  4MPF A;  5ID2 A;  3W8S A;  1FB6 A;  4K7I A;  4F2I A;  3G7Y A;  1B4Q A;  1R4W A;  3I69 A;  2PGT A;  4MJC A;  4MA9 A;  4TN8 A;  1SL2 B;  2K18 A;  4PXO A;  4GWR A;  3HD5 A;  4ECB A;  2AJQ B;  4EDY A;  2HSH A;  3FRC A;  1F3B A;  2F9S A;  2OBI A;  4IJI A;  1A2L A;  1GSE A;  1FHE A;  5HFK A;  1XOA A;  2C0E A;  3VUR A;  3ZIT A;  3LSZ A;  2NPB A;  1M7T A;  2ZNM A;  4I6X A;  2K6V A;  2FA4 A;  2HZF A;  2G0F A;  3L9S A;  2FWE A;  3TCO A;  2ALB A;  3ISO A;  4YAP A;  2I9H A;  4JBB A;  1HQO A;  5LD0 A;  3LGC A;  4GRF A;  2KOK A;  4IKH A;  4V1A p;  3QAV A;  5IMZ A;  3K8N A;  3KH9 A;  4K0N A;  1XPV A;  1TK0 B;  5FWG A;  1GLP A;  2N5B A;  1MDI A;  2F3M A;  3ZL5 A;  1O8W A;  2YJ7 A;  3DKS A;  3TKS E;  3BCI A;  5ECO B;  2GS3 A;  2E2G A;  1Z7R A;  1SJZ A;  2GVP A;  3RBT A;  5L71 A;  2VM2 A;  2VOC A;  3IDV A;  1HNC A;  1T7P B;  1M2A A;  2H70 A;  1X5C A;  3ZFL A;  2CQ9 A;  3GX8 A;  5E59 A;  5D9V A;  3KZQ A;  4XS1 A;  4MAB A;  2O89 A;  3IRA A;  2HFD A;  2TIR A;  4TXV A;  3GHA A;  4MH2 A;  1YEP A;  3L4N A;  3UVT A;  3EVI A;  4OCF A;  4MJB A;  1DE2 A;  1KNG A;  1S3A A;  2MMZ A;  5COH A;  10GS A;  5DDL A;  2IN3 A;  5GAP D;  1OC3 A; 
#chains in the Genus database with same CATH topology
 1OAZ A;  1XW9 A;  1QQ2 A;  2L5L A;  2QDY B;  3TUE A;  1I5G A;  3TW6 A;  2GST A;  4IN0 A;  1FG4 A;  5A4V A;  3VLN A;  4FX3 B;  2H72 A;  1TD6 A;  5F07 A;  4AKI A;  3UJ1 A;  1OKD A;  1YEX A;  3MAK A;  3PR8 A;  4IHU A;  3QD9 A;  4EF0 A;  3WD6 A;  5G1L A;  5G5F A;  2VL9 A;  1ZYP A;  3ZVJ D;  3PIN A;  2F2C A;  1TI3 A;  2CZ7 B;  4J56 E;  1X9M B;  1TTZ A;  4UN0 A;  3EID B;  2WEV B;  3QHW B;  3GST A;  3GX0 A;  1UN2 A;  2R2J A;  5LNK e;  1Z6N A;  2LNS A;  4EOQ B;  2QDJ A;  2GZZ A;  5ECS A;  2E0Q A;  1URC B;  4Z2R A;  3GL3 A;  3IAM 2;  4KH7 A;  2F51 A;  2MMO A;  1ABA A;  1JHB A;  3A8H B;  2XPE A;  4YKG A;  4J57 E;  1FKM A;  1E9H B;  4OB2 B;  4CFN B;  3D0Z A;  1OC8 A;  3GFK A;  4L0W A;  3QOU A;  3KXO A;  2LRC A;  3EC3 A;  4BCP B;  4ZL7 A;  2MMA A;  3M8N A;  1IYH A;  3HHV A;  2RLI A;  4Z2U A;  1G7O A;  4V1A g;  1THO A;  1C72 A;  2WFC A;  3CRT A;  1GRX A;  4G2E A;  2IFQ A;  2H6X A;  5DAL B;  3EWL A;  3HJO A;  4BCJ B;  3FZ4 A;  3QWL A;  4BCG B;  1R26 A;  4K7N A;  2A2S A;  4MJE A;  1V57 A;  1O8X A;  1B48 A;  3ZLP A;  1USB A;  1XBS A;  5J3R A;  4IEL A;  3DJB A;  2R37 A;  4O92 A;  1WOU A;  2PBJ A;  2RUE A;  4WR4 A;  1OL2 B;  5DQW A;  2PK9 B;  1AIU A;  4K5R A;  1O81 A;  3QXE B;  3CSI A;  2CT6 A;  3FKF A;  3ZVJ A;  3R2Q A;  2W2H A;  1E6B A;  2CZ1 B;  4F9Z A;  4K9Z A;  1PA3 A;  3BHV B;  3ERF A;  5HBJ B;  3KJY A;  2PPT A;  4PNG A;  3MSZ A;  1T4Y A;  3H79 A;  4NWY A;  3ZIV A;  2VCZ A;  3TOT A;  2W96 A;  3QYG B;  2FLS A;  1YJ6 A;  2DML A;  1BYE A;  1SL1 B;  4EE0 A;  4QQ7 A;  1GH2 A;  2IJY A;  1WIK A;  2JAD A;  4DVC A;  2X8H A;  1XIY A;  1DE1 A;  3OR5 A;  4F82 A;  4K2X A;  2H75 A;  2P5R A;  1XVW A;  1YQ1 A;  1TFB A;  2V6O A;  2EIR A;  3E9J B;  4K8M A;  4FYC A;  5CRD A;  5AN1 A;  4KCE A;  1XWB A;  1Q98 A;  3GTM S;  3WT2 A;  2W99 A;  4POK A;  5ELG A;  1ZMA A;  5DQY A;  1BQ7 A;  5D9T A;  1M9B A;  4G0K A;  4WET A;  2VUP A;  3CMI A;  2JSY A;  1UGQ B;  1TRS A;  2DJ0 A;  4JRR A;  2C0G A;  2D2Z A;  11GS A;  1UGS B;  3EOC B;  4NST B;  2H0H A;  3HA9 A;  2B9R A;  4IGJ A;  5D9X A;  4XS4 B;  3VWW A;  4XS6 A;  2V1M A;  2EIQ A;  2B7K A;  1ERT A;  1GNE A;  2R6K A;  1VOL A;  5KN0 A;  4BL7 B;  3JCM L;  2EC4 A;  1TK5 B;  2NDO A;  2LQO A;  1QMV A;  4HOJ A;  2IMI A;  1GY3 B;  5CRG A;  4NPB A;  5D73 A;  3IC8 A;  1BU2 A;  3FEU A;  2P0G A;  3DXB A;  4Z6Y A;  3R3E A;  1ON4 A;  5KN1 A;  4ID0 A;  5F0G A;  3D5J A;  3H1N A;  1SKW B;  2WCI A;  2RII A;  1G0T A;  3MIA B;  1QLB A;  2H0G A;  3IHG A;  4TRX A;  3SBC A;  1NHY A;  4IS0 A;  3DOG B;  2PHG A;  3F4R A;  4LL1 B;  4HZ2 A;  2X64 A;  1R5P A;  1SD8 A;  3RPN A;  1LBK A;  4GQF A;  4ML1 A;  3UEM A;  3QYB A;  3X28 B;  4BPY A;  1FB0 A;  4EOP B;  3ZMK A;  4TVE A;  4EVM A;  3RDW A;  1ZYE A;  1S3D A;  3CBU A;  1EP7 A;  3TRQ A;  2OAC A;  2I4A A;  5EPF A;  2DXC B;  3W6G A;  5EY6 A;  3NDQ A;  4MFD A;  1XW5 A;  1URM A;  1X9S B;  1TW9 A;  3O6T A;  5G31 A;  4F0C A;  2YNX A;  4G0L A;  1WJK A;  4HDE A;  4OFT A;  5E4W A;  4G6L B;  1AAZ A;  1PRX A;  3QYH B;  3HZ8 A;  4F6U B;  1AD6 A;  4EOL B;  2LUS A;  4KA0 A;  4F03 A;  4BCQ B;  1UA5 A;  1YKA A;  1OKW B;  1HNA A;  2YJH A;  4DEJ A;  2F8F A;  2YP6 A;  1ZCP A;  3KM6 A;  5BMU A;  3GUS A;  4AJ8 A;  5EJC A;  2C4G B;  2BS4 A;  4EO3 A;  5IHY A;  2VCQ A;  2PU9 C;  4CY8 A;  1J08 A;  2M80 A;  1PD2 1;  2H73 A;  3H4C A;  3DYR A;  4V2M A;  3BOA A;  2AV4 A;  4MK3 A;  3ZRE A;  5L2W B;  2UZD B;  1H4O A;  5IMV A;  1X5D A;  1IRE B;  1A2J A;  3EYT A;  1W89 A;  2VD0 A;  4ZL8 A;  2BPM B;  2OE0 A;  1SL0 B;  2GLR A;  3TJK A;  1TRV A;  2EIO A;  3LJR A;  4D73 A;  4MCU A;  2IME A;  3A8O B;  4EC9 B;  3IXR A;  4I8B A;  1VIN A;  1OE8 A;  4F70 B;  16GS A;  2LNT A;  3HYP A;  2QF7 A;  1JSU B;  4EXJ A;  4GSS A;  4PX1 A;  1SU9 A;  1BJX A;  1ERV A;  3FZ9 A;  3TGZ A;  1TRU A;  5GZZ B;  4YOS A;  3CRU A;  1Z3E A;  5KN3 A;  2OAD A;  2WHB B;  3F5X B;  1AW9 A;  3BD2 A;  1A0R P;  3Q18 A;  2R0P A;  22GS A;  2H19 A;  1MD4 A;  3IC4 A;  6GSW A;  1OVN A;  4XHM A;  4HSC X;  3QZ5 B;  1XVQ A;  4IW9 A;  1TK8 B;  1SKS B;  2DME A;  4K5S A;  5IDP B;  2QA2 A;  4XIH A;  4BCM D;  2DLX A;  4MJA A;  4F7S B;  5GAN D;  4IVF A;  1SYR A;  3KP9 A;  1YDK A;  4KAE A;  2AHJ B;  2BS3 A;  3QYE A;  3DL1 A;  1ENW A;  4JZQ A;  3H93 A;  3VYH B;  3BLQ B;  5DAK B;  2R0G A;  1EGO A;  4DSR A;  5AGY A;  2R7G A;  5IDN B;  1X5E A;  2IIY A;  3TB2 A;  3TW7 A;  2FD3 A;  1H1P B;  5F8B A;  3EPT A;  2IMK A;  5JWO B;  2C5X B;  1H25 B;  2LRN A;  4V2L A;  2J9H A;  3A8M B;  2WJU A;  3C71 A;  1V2A A;  3G9B A;  2BMX A;  2I3Y A;  1M2D A;  1E7P A;  2HI7 A;  2IWT A;  2DIZ A;  5ECR B;  1U88 A;  2WXV B;  3GV1 A;  2N5A A;  1GP1 A;  4Q5N A;  1M3I A;  4AJ7 A;  4QSH A;  2DKH A;  3VI7 A;  2PN8 A;  5EL8 A;  4K7O A;  5H5Q A;  1QK8 A;  5JWQ B;  4ECI A;  4JR6 A;  3QDN A;  2HRN A;  4OB0 B;  1O73 A;  2IW9 B;  3EJ1 B;  4YOZ A;  4X4J A;  2H8L A;  4HEA 2;  4M6V A;  4ZB9 A;  4CDO A;  1UNL D;  3HB9 A;  4JX6 A;  4LMW A;  1AXD A;  1OC9 A;  2FCH A;  4POB A;  4ZBD A;  5IMA A;  5B8B A;  2UUE B;  5DVB A;  3M9K A;  1QFN A;  5IOX A;  4CFX B;  4YKF A;  4TTH A;  5CAX A;  4X1U A;  3LYK A;  5HR0 A;  5AIV A;  3WT1 A;  3Q6O A;  2QGV A;  5BNJ B;  2DJJ A;  3QAW A;  2LJK A;  2WJ9 A;  5B7C A;  4YQU A;  5HVY B;  3G7I A;  1XG8 A;  1K3Y A;  4XRD A;  4O5Q A;  4TR4 A;  3VWX A;  2QA1 A;  3GTU A;  1SD9 A;  4K6X A;  1VRS D;  4ECJ A;  3TNI B;  2ZPB B;  3FY7 A;  2R4V A;  4PTS A;  3HVV A;  2AUV A;  1QUW A;  4ZIL A;  1W98 B;  1V98 A;  1AQW A;  3IE3 A;  1MD3 A;  4WKW A;  1YY7 A;  4RI7 A;  3EUR A;  3KH7 A;  4KE3 A;  5IMF A;  1B4P A;  4CFV B;  3HVS A;  2X8G A;  4MZW A;  1XXU A;  2LV3 A;  3A2W A;  5DJL A;  4ELL A;  5G5E A;  2HXK A;  1PMT A;  1V58 A;  5HR2 A;  4ZB6 A;  5D8I A;  5ECK B;  1PKD B;  3TJG A;  3ERG A;  1HYU A;  4ULX A;  4LL4 B;  5CEI B;  2REM A;  4EOI B;  4DSQ A;  3F0I A;  4GF0 A;  1NHO A;  5JWR B;  5ECP B;  2VCT A;  3ZTL A;  3VKH A;  3HCZ A;  2H1G A;  2GSQ A;  4F7J B;  4TR1 A;  2GT6 A;  1JZW A;  17GS A;  4KDU A;  2CA8 A;  1QMZ B;  4EOS B;  1XOB A;  3L0H A;  4TR0 A;  3TRX A;  4OGR B;  5IQY A;  5HFG A;  1M9A A;  2LJA A;  1JOW A;  3EMX A;  3WGX A;  5G30 A;  1CQH A;  1K0N A;  3GUR A;  1O7U A;  6GSU A;  6GSX A;  3CSH A;  5CYY A;  2VM1 A;  1UGR B;  1U87 A;  2CCH B;  2Z9S A;  3EIN A;  3S9F A;  3DTO A;  2EUF A;  4PQI A;  2HZE B;  2LJR A;  2DPP B;  2CV4 A;  5HQP A;  3QFA C;  3O3T A;  4CFU B;  2P5Q A;  2O87 A;  4J2F A;  3J7Y k;  3P7X A;  2NBS A;  3DVW A;  4F0B A;  2VLU A;  4I97 A;  2WDU A;  2VO4 A;  3G7J A;  2QC7 A;  2L57 A;  5ICP B;  2X8C A;  4MLY A;  3A5W A;  3CSJ A;  1VGL A;  1Z9H A;  2VL2 A;  3ZFB A;  1DBY A;  4N0V A;  4FO5 A;  4HZ4 A;  1O85 A;  2BJX A;  4F6W B;  1VF3 A;  2P31 A;  4CRL B;  4BY1 X;  5B6N A;  2WIH B;  2B3S A;  4MNN A;  1H4L D;  1MDJ A;  14GS A;  1XZO A;  2NVL A;  4HU9 A;  5G1K A;  2OBK A;  5HBH B;  4HU7 A;  3BG3 A;  3DWV A;  4N0Z A;  3D4T A;  3FHK A;  3H8Q A;  2VAF A;  2JU5 A;  1A2M A;  4YQV A;  3EU3 A;  3TJB A;  3E0U A;  1KXU A;  4ZIJ A;  3ME8 A;  2B5E A;  2X1N B;  4HJ2 A;  2H6Y A;  3LFL A;  3QMX A;  3HBL A;  1TKD B;  5A5K A;  4WF4 A;  1FAA A;  1H26 B;  1GSS A;  1JST B;  2HNL A;  3KTB A;  4YQM A;  4EKZ A;  5DAL A;  4BCN B;  5I5Z B;  5J5N A;  1F6M C;  3GKN A;  2BS2 A;  3QCP A;  1GUX B;  1ZOF A;  1F5Q B;  1P5E B;  2VCW A;  1PQN A;  4YAV A;  3GH9 A;  6GSS A;  3FYG A;  4GLT A;  3F4T A;  2DKI A;  2QSI A;  2FNO A;  4WR5 A;  4E8E A;  1GTI A;  1QXH A;  3IAS 2;  3I9V 2;  1EZK A;  1FOH A;  1GSY A;  3WGE A;  2GQK A;  3TDG A;  3X25 B;  3UOM A;  1T00 A;  5FT3 A;  1WPI A;  3F6F A;  4AGS A;  3ZYW A;  3W8J A;  4OWY A;  2LQQ A;  4KX4 A;  5A4U A;  1YKC A;  2WIP B;  3VYG B;  3ZML A;  1NM3 A;  3WYW A;  3LXT A;  2DC5 A;  2L4Q A;  1IYI A;  1F3A A;  3LOR A;  2GZY A;  1V9W A;  2J23 A;  4O32 A;  1O9K B;  2IW8 B;  3LYP A;  2CZ2 A;  4EOO B;  4EOM B;  1GTA A;  1OI9 B;  4YC3 B;  3VK9 A;  1OE7 A;  2YN1 A;  3GKX A;  3MYD A;  3EE2 A;  1WE0 A;  1PN9 A;  4I2U A;  1PKW A;  1T4Z A;  1VF2 A;  4BA7 A;  3F6D A;  4NC6 A;  5IMC A;  1TU8 A;  3ME7 A;  1WP0 A;  2DJK A;  4EL1 A;  2VLT A;  1EOH A;  4HNT A;  4RQR A;  2KUC A;  3DGQ A;  3C73 A;  2XHF A;  2B6M A;  1VF1 A;  4V2N A;  5HNB B;  4BVY B;  3MI9 B;  4XS4 A;  3WVD B;  4ZBA A;  4MP4 A;  2IVX A;  3KEB A;  3M0F A;  2WUL A;  4BL7 A;  2HSY A;  2FWF A;  5AIS A;  3FR9 A;  4ILF A;  3LW9 A;  1A0F A;  4BVX B;  2PJQ A;  2C4J A;  19GS A;  5H5R A;  1UGP B;  1GUH A;  1MEK A;  3FMW A;  3F63 A;  1F2E A;  4MFE A;  4BCQ D;  4BY7 X;  4L5O A;  5ELA A;  3DDQ B;  3AY8 A;  2N5F A;  4GST A;  5KOW A;  2ZCT A;  3TNW B;  4KSM A;  4BBS M;  2DJ2 A;  2E2M A;  1GWC A;  2ON7 A;  9GSS A;  1TOF A;  1J9B A;  4G0I A;  1GH6 B;  2C80 A;  1SK0 A;  2H01 A;  4EOK B;  4II5 B;  4BCH B;  4DSS B;  2UZ8 A;  4N11 A;  1G6W A;  4F7L B;  1EP8 A;  4ZBB A;  1DSB A;  2O85 A;  3LEF A;  3PO3 S;  2C5N B;  4XRA A;  1K3O A;  2JSZ A;  5KN2 A;  2H74 A;  5LMK B;  5IO0 A;  5CRH A;  1A8L A;  4IP1 A;  4WXT A;  3ERW A;  3F9U A;  4EIP A;  2YWN A;  2YWI A;  3CYN A;  3RGF B;  1BAY A;  4HNU A;  4Z7X A;  2OA7 A;  2DSA A;  2OE1 A;  1GLQ A;  2ZCF B;  2C3T A;  2ON5 A;  3SWL A;  5C00 A;  4HNV A;  1AQV A;  1M99 A;  4K2D A;  4KDY A;  4TXO B;  1R5A A;  4MF7 A;  1ST9 A;  2IPA A;  4PGT A;  2MBT A;  5JCW A;  2WGR A;  4QL7 A;  2PK2 A;  2GQL A;  4CFW B;  3LQ5 B;  2HLS A;  2JGZ B;  5ECL B;  4TOP A;  4EOR B;  5HR1 A;  3HVN A;  2DXB B;  4EUY A;  5IO2 A;  2YPM A;  7GSS A;  3UAR A;  4NHZ A;  3M3M A;  3A3T A;  3N5O A;  2AHE A;  2XC2 A;  3MNG A;  1TI1 A;  1YF0 A;  3F8U A;  3IPZ A;  2C5O B;  4K1F A;  1OIY B;  1SYX A;  1H75 A;  4WF5 A;  3PH9 A;  2YCD A;  4BBR M;  2B5Y A;  1JZO A;  1H24 B;  2KLX A;  2LKU A;  5DQS A;  5A4W A;  2JAC A;  1ZYN A;  2VCX A;  2AAW A;  1GSD A;  2IMD A;  5HFI A;  2TRC P;  3IOS A;  2DIY A;  4I2T A;  2NTO A;  2GSR A;  2CVD A;  2DJ1 A;  4KW6 A;  4OFN A;  4GCI A;  3EU4 A;  3ED3 A;  2YWM A;  2CAI A;  3E3E A;  3TKS A;  3F3R A;  5J9C A;  2HSM A;  1PX7 A;  1O6J A;  5CP1 A;  2GSS A;  1WWJ A;  2OKA A;  1H27 B;  3P2A A;  1N8J A;  1TXX A;  5F05 A;  4EON B;  4ELJ A;  2MMN A;  1U6T A;  1ZL9 A;  3UL3 A;  3VKG A;  2D0Q B;  2WRT A;  1M3J A;  13GS A;  4MPG A;  5KOX A;  2V22 B;  1M2B A;  5DBQ A;  1K0B A;  4O7H A;  2V2G A;  2ZPH B;  3J7Y b;  2DBC A;  2VIM A;  3DEX A;  2L6D A;  4NV5 A;  2IMF A;  4IJ3 A;  3LWA A;  1XWC A;  1GSU A;  4YH2 A;  4BWQ A;  3A8L B;  5HQ0 B;  1K0O A;  4XTS A;  1AC1 A;  3UBL A;  3DIE A;  1OIU B;  3L9U A;  1A24 A;  2GGT A;  4Q5R A;  4CFM B;  1B9Y C;  2CVB A;  5DAK A;  5CO3 A;  4MDC A;  3BG5 A;  3QAG A;  2LTK A;  1R7H A;  3N9J A;  1AHJ B;  2X4A A;  4HL4 A;  3GNJ A;  4NMU A;  3KHI A;  4GSN A;  2PVO C;  3IA1 A;  1XW6 A;  1K0D A;  4MH3 A;  2A4V A;  5ID2 B;  5IIZ A;  4N10 A;  3UBK A;  3CTF A;  3P90 A;  5J4U A;  3LG6 A;  3M03 A;  3GMF A;  5LCZ A;  4TW5 A;  4PQH A;  1RK4 A;  4KDX A;  1Y25 A;  2JZT A;  1X9W B;  1GUL A;  4G9H A;  1ILO A;  4BCM B;  3HHT B;  3APQ A;  5JCU A;  1X0R A;  5F06 A;  1YZX A;  1F37 A;  2HRF A;  2PER A;  4BXX X;  1JKW A;  2GDR A;  3C1S A;  4BCF B;  2H66 A;  4L8E A;  4AJ6 A;  5INY A;  3BBY A;  3MDK A;  2A4H A;  4ROE A;  2DMM A;  20GS A;  3PPU A;  1MTC A;  3M1G A;  2H6Z A;  4HUA A;  2AB6 A;  4GXZ A;  1WMJ A;  3GTU B;  5IPG A;  4KF9 A;  2GZP A;  5CYI B;  2UZB B;  3FW2 A;  4KND A;  4ZB8 A;  1THX A;  4L5L A;  5ABR A;  2OJL A;  3VPT A;  1TP9 A;  2C1Y A;  1JZR A;  3I43 A;  1SEN A;  1EOG A;  1H1Q B;  3KTL A;  2DJ3 A;  3ZIJ A;  1K3L A;  3UMA A;  4E8H A;  1CQG A;  4EC0 A;  3GSS A;  1JFU A;  1RW1 A;  3X20 B;  2H76 A;  1AIS B;  5ACB A;  1GNW A;  3NIV A;  3MIX A;  1EV4 A;  4CFU D;  3D22 A;  3RHB A;  1KBN A;  5IOW A;  3QHR B;  2FHE A;  5DCG A;  1J0F A;  3FR6 A;  3FR3 A;  2ZPG B;  2C3N A;  2I53 A;  3L9V A;  3C8E A;  2ZPI B;  4TR1 B;  1XCC A;  1SKR B;  3LXZ A;  2C3Q A;  4LLR A;  4N30 A;  4I5Q A;  2DD5 B;  2WPA B;  6GST A;  4WBJ A;  1Z5Y E;  1G6Y A;  5AIX A;  4RQX A;  5J9B A;  3VWV A;  3DD3 A;  3MWH A;  1NSW A;  2LEG A;  3QPM A;  4NV2 A;  2WS2 A;  4ROC A;  2FUG 2;  2FGX A;  4IBP A;  3U6V A;  1PX6 A;  3EMP A;  4O5U A;  3TKS C;  2HYX A;  4G10 A;  4YOO A;  3QFB C;  5ECM B;  4WBR D;  1Z7P A;  4PNF A;  4ZGE B;  2YOI A;  4JU5 A;  4HJM A;  3UIW A;  3FZA A;  4POL A;  1NW2 A;  2HE3 A;  1V40 A;  2CZ3 A;  1GL8 A;  3APO A;  4BCI B;  2CJM B;  1EEJ A;  4EOJ B;  4EC8 B;  2LW4 A;  2XBI A;  2HZE A;  3C7M A;  4Q5F A;  2G77 A;  3V1W A;  1TRW A;  4FH8 A;  1FVK A;  2MBS A;  4BCN D;  1KEB A;  2B1K A;  2TRX A;  3O76 A;  3NOF A;  1K0A A;  2LS5 A;  4GTU A;  2KHP A;  2JL4 A;  2FY6 A;  3D6I A;  4ZXG A;  4GQC A;  5B6M A;  3CQF A;  1ML6 A;  3HJP A;  4TR3 A;  4Z2T A;  1QGV A;  1BED A;  3CTG A;  4HQZ A;  3HY2 A;  4HQS A;  2HRA A;  2AYT A;  1A8Y A;  5DQV A;  3KIJ A;  4ZGD B;  2IFQ B;  4CW9 A;  3BHU B;  3FZ5 A;  2F8A A;  1TJD A;  5D93 A;  4KRC B;  2ES7 A;  2CX3 A;  2H1D A;  1AQX A;  2KR6 A;  2H1A A;  5IPH A;  5ENU A;  2H30 A;  1UNG D;  4NAX A;  1OYJ A;  1OKT A;  4EIQ A;  6GSY A;  3NZN A;  1GUM A;  5IF1 B;  4RI6 A;  1U3I A;  3VPQ A;  2WZ9 A;  4X0X A;  5D96 A;  4HI7 A;  1H1S B;  3DDP B;  2KP1 A;  1HD2 A;  2R5G A;  2H1B A;  2K8V A;  5GSS A;  1FIN B;  2YWO A;  4PUR A;  4OCE A;  2A2P A;  4NHW A;  4HS1 A;  4AKG A;  3UVH A;  1GTU A;  1T3B A;  2XBQ A;  2E7P A;  4IP6 A;  3VWU A;  3A8G B;  1A23 A;  2VLV A;  3HZ4 A;  3HXS A;  5DCH A;  1GUX A;  5B8A A;  5BRT A;  3A5I A;  3RHC A;  1FVV B;  3BLH B;  3POM A;  4Y72 B;  2ZUP A;  5JCG A;  3Q19 A;  4FYU A;  2C8U A;  3UAP A;  4MIM A;  1FVJ A;  3HKR A;  4OO5 A;  3X26 B;  1M0U A;  5J41 A;  1B8X A;  2GTU A;  1B9X C;  1WRY A;  2FWH A;  5ECN B;  2DD4 B;  1OKV B;  4OD7 A;  2W9Z A;  4JX4 A;  4TKY A;  2PVQ A;  4KSO A;  2BKZ B;  2LST A;  1PGT A;  2L59 A;  5CRW A;  2W9F A;  1AUC A;  1VF4 A;  3ZZX A;  3DVX A;  1XFL A;  2L6C A;  1Q4J A;  1SK2 A;  1SK1 A;  5ECI B;  1PN0 A;  3BLR B;  2JZR A;  2R3X A;  1O9K A;  3DML A;  3VFI A;  2PMI B;  1ZYQ B;  1LU4 A;  1G7E A;  4AI6 A;  3A2X A;  4PUA A;  4IQ1 A;  1UVZ A;  1PL2 A;  2G9X B;  2WFY B;  1V29 B;  3GKM A;  4BCO B;  4MMM A;  1U3A A;  2I1U A;  3K7A M;  4ZGJ B;  2CAQ A;  3WVE B;  1GTB A;  2YZU A;  3H4K A;  2YAN A;  3HZJ A;  3GRX A;  3IK9 A;  4KGI A;  1JLW A;  4LA1 A;  1S3C A;  3PGT A;  3KP8 A;  4JE1 A;  3VI5 A;  1Y6E A;  5EFQ B;  3TOU A;  12GS A;  4BVY A;  5G2Z A;  3US3 A;  3IBH A;  1ZGN A;  1TU7 A;  4CY6 A;  4MF5 A;  3IR4 A;  5CRE A;  1UNH D;  4RUV A;  4QL9 A;  2K9F A;  1GSF A;  2L4C A;  2WB9 A;  2X99 A;  3KMN A;  2CZ6 B;  2B7J A;  4BVX A;  1T1V A;  2XPD A;  4WEY A;  1XWA A;  2I81 A;  3HDC A;  3B57 A;  3FK8 A;  2RM5 A;  3WGD A;  2OE3 A;  1KTE A;  3G33 B;  1W4V A;  3GA4 A;  3GKK A;  4PUF C;  3KMO A;  2VL2 C;  2A2R A;  4KCA A;  5EVO A;  3M9J A;  4JR4 A;  3I6A A;  3U5R E;  2G2Q A;  1C9B A;  2B5X A;  2JZS A;  18GS A;  1E2Y A;  4DSS A;  1K0C A;  4F7N B;  5H5S A;  3RPP A;  1G3N C;  1Z6M A;  2PMT A;  2MYG A;  3GH6 A;  3CXG A;  4ECC A;  5HBE B;  4BCK B;  4BWS A;  2L5O A;  2FWG A;  4MF6 A;  3GN3 A;  2H71 A;  4PQ1 A;  3ZRD A;  1XWG A;  4OR5 B;  2PWJ A;  4FYB A;  3HJM A;  1PSQ A;  3QR6 A;  3F4S A;  4TXO A;  4K0G A;  4FIW A;  1SJ6 A;  3IK7 A;  1TDI A;  2RM6 A;  2CZ0 B;  3TKQ A;  1FO5 A;  3O0G D;  1MDK A;  2K8S A;  1H1R B;  3C1R A;  2M46 A;  5C04 A;  1HNB A;  4HLQ A;  5LQF B;  1PKZ A;  4G19 A;  3TN8 B;  1XO2 A;  1LJR A;  1GSQ A;  1EEM A;  1XWK A;  1GUK A;  2MZC A;  5FHI A;  4L0U A;  2C0F A;  4D73 B;  1ZZY A;  4JED A;  1FW1 A;  1JZD A;  4A5P A;  4ISD A;  2GT5 A;  2C0D A;  3LQ7 A;  3KD0 A;  3TKP A;  4X43 A;  1EGR A;  2CVK A;  3KCM A;  5IMD A;  3BHT B;  1EV9 A;  4KUN A;  3MY5 B;  4OO4 A;  2VD1 A;  3HVX A;  4OMV A;  4ML6 A;  3TJF A;  2CCI B;  1UC7 A;  4JX5 A;  1N2A A;  4FQU A;  4LMV A;  5ECQ B;  4LOC A;  4EDZ A;  2PUK C;  8GSS A;  2IL3 A;  5KEJ A;  2VL3 A;  2CX4 A;  5GST A;  5IM9 A;  2QGS A;  1BX9 A;  2HT9 A;  2R0C A;  4ACS A;  4OB3 B;  1YF1 A;  4P3Y B;  2C6T B;  1F9M A;  2YV7 A;  4ZL9 A;  2O8V B;  3BJ5 A;  3TKR A;  1VYW B;  2FA8 A;  3F3Q A;  5DJM A;  1JLV A;  2LRT A;  3TJJ A;  3A2V A;  2KP2 A;  2VCV A;  4CHS A;  6GSV A;  3IV4 A;  2GQM A;  3IHQ A;  3TRP A;  1ERW A;  4AF2 A;  3GL5 A;  4XCS A;  2B1L A;  3KGK A;  4ICY A;  4KB3 A;  2V32 A;  2RUF A;  2QKE A;  2O7K A;  4OB1 B;  4POM A;  3RAZ A;  5CNW A;  4MZB A;  4H86 A;  2V41 A;  3P8W A;  1FOV A;  3GIX A;  3GYK A;  5ECH B;  4O5R A;  3DRN A;  3BCK A;  3Q74 A;  1PFO A;  3D4M A;  2ZPF B;  2HRK A;  2BTO T;  1EWX A;  4ROD A;  1ERU A;  4OFM A;  2V6K A;  1RQM A;  1OGU B;  5D9W A;  2M72 A;  4MZC A;  1PL1 A;  3BG9 A;  1DUG A;  2UZE B;  1BG5 A;  1ACV A;  3L78 A;  1I9D A;  3APS A;  2QQ8 A;  1H28 B;  1T8E B;  1K0M A;  4NXI A;  1OC9 B;  2YV9 A;  2H0I A;  2ZZD B;  4Q5Q A;  2CYZ B;  2YZH A;  4AKH A;  4IQA A;  1SJI A;  3D21 A;  5HR3 A;  2IW6 B;  4MPF A;  5ID2 A;  3W8S A;  1FB6 A;  4K7I A;  4F2I A;  3G7Y A;  1B4Q A;  1R4W A;  2WMB B;  4FM4 B;  3X24 B;  3I69 A;  2QFZ A;  2UZL B;  2PGT A;  4MJC A;  3HO8 A;  4MA9 A;  4TN8 A;  1SL2 B;  2KMG A;  1ZP2 A;  1OL1 B;  4I3Z B;  2K18 A;  4PXO A;  4GWR A;  3HD5 A;  4ECB A;  2I40 B;  2AJQ B;  4EDY A;  2HSH A;  3FRC A;  1F3B A;  2F9S A;  2OBI A;  4IJI A;  1A2L A;  1GSE A;  5FGK B;  4BIK A;  1FHE A;  5HFK A;  1XOA A;  2C0E A;  1S3R A;  4F6S B;  3VUR A;  3ZIT A;  3LSZ A;  2NPB A;  1M7T A;  2X49 A;  2ZNM A;  4I6X A;  4USS A;  3MY1 B;  2K6V A;  2FA4 A;  2HZF A;  2G0F A;  3L9S A;  1N4M A;  2FWE A;  3TCO A;  2ALB A;  3ISO A;  4IMY B;  4YAP A;  2I9H A;  3QZ9 B;  2C5V B;  4JBB A;  1HQO A;  5LD0 A;  3LGC A;  4GRF A;  2KOK A;  4IKH A;  4V1A p;  3QAV A;  4KRD B;  3K8N A;  5IMZ A;  3KH9 A;  4K0N A;  1XPV A;  1TK0 B;  5FWG A;  1GLP A;  2N5B A;  1MDI A;  2F3M A;  3ZL5 A;  1O8W A;  2YJ7 A;  3DKS A;  3TKS E;  3BCI A;  5ECO B;  2GS3 A;  2E2G A;  1Z7R A;  2WMA B;  1SJZ A;  2GVP A;  3RBT A;  5L71 A;  2VM2 A;  2VOC A;  3IDV A;  1HNC A;  1T7P B;  1M2A A;  2H70 A;  1X5C A;  3ZFL A;  2CQ9 A;  3GX8 A;  5E59 A;  5D9V A;  3KZQ A;  4XS1 A;  4MAB A;  4CXA B;  2O89 A;  2ZPE B;  3IRA A;  2HFD A;  2TIR A;  4TXV A;  3GHA A;  3TNH B;  4MH2 A;  1YEP A;  3L4N A;  3UVT A;  3EVI A;  4OCF A;  4MJB A;  1DE2 A;  1D3U B;  1KNG A;  1S3A A;  2MMZ A;  5COH A;  10GS A;  5DDL A;  2IN3 A;  5GAP D;  1OC3 A; 
#chains in the Genus database with same CATH homology
 1OAZ A;  1XW9 A;  1QQ2 A;  2L5L A;  3TUE A;  1I5G A;  2GST A;  4IN0 A;  1FG4 A;  5A4V A;  3VLN A;  2H72 A;  5F07 A;  3UJ1 A;  1OKD A;  1YEX A;  3MAK A;  3PR8 A;  4IHU A;  3QD9 A;  4EF0 A;  3WD6 A;  5G1L A;  5G5F A;  2VL9 A;  1ZYP A;  3ZVJ D;  3PIN A;  1TI3 A;  4J56 E;  1X9M B;  1TTZ A;  3GST A;  3GX0 A;  1UN2 A;  2R2J A;  5LNK e;  1Z6N A;  2LNS A;  2GZZ A;  5ECS A;  2E0Q A;  4Z2R A;  3GL3 A;  3IAM 2;  4KH7 A;  2F51 A;  2MMO A;  1ABA A;  1JHB A;  2XPE A;  4YKG A;  4J57 E;  3D0Z A;  1OC8 A;  3GFK A;  4L0W A;  3QOU A;  3KXO A;  2LRC A;  3EC3 A;  4ZL7 A;  2MMA A;  3M8N A;  1IYH A;  3HHV A;  2RLI A;  4Z2U A;  1G7O A;  4V1A g;  1THO A;  1C72 A;  2WFC A;  3CRT A;  1GRX A;  4G2E A;  2IFQ A;  2H6X A;  5DAL B;  3EWL A;  3HJO A;  3FZ4 A;  1R26 A;  4K7N A;  2A2S A;  4MJE A;  1V57 A;  1O8X A;  1B48 A;  3ZLP A;  1USB A;  1XBS A;  5J3R A;  4IEL A;  2R37 A;  4O92 A;  1WOU A;  2PBJ A;  2RUE A;  4WR4 A;  1AIU A;  4K5R A;  1O81 A;  3CSI A;  2CT6 A;  3FKF A;  3ZVJ A;  3R2Q A;  1E6B A;  4F9Z A;  4K9Z A;  1PA3 A;  3ERF A;  3KJY A;  2PPT A;  4PNG A;  3MSZ A;  1T4Y A;  3H79 A;  4NWY A;  3ZIV A;  2VCZ A;  3TOT A;  2FLS A;  1YJ6 A;  2DML A;  1BYE A;  1SL1 B;  4EE0 A;  4QQ7 A;  1GH2 A;  2IJY A;  1WIK A;  2JAD A;  4DVC A;  2X8H A;  1XIY A;  1DE1 A;  3OR5 A;  4F82 A;  4K2X A;  2H75 A;  2P5R A;  1XVW A;  1YQ1 A;  2V6O A;  2EIR A;  3E9J B;  4K8M A;  4FYC A;  5CRD A;  5AN1 A;  4KCE A;  1XWB A;  1Q98 A;  3WT2 A;  4POK A;  5ELG A;  1ZMA A;  5DQY A;  1BQ7 A;  5D9T A;  1M9B A;  4G0K A;  4WET A;  2VUP A;  3CMI A;  2JSY A;  1TRS A;  2DJ0 A;  4JRR A;  2C0G A;  2D2Z A;  11GS A;  2H0H A;  3HA9 A;  4IGJ A;  5D9X A;  4XS4 B;  3VWW A;  4XS6 A;  2V1M A;  2EIQ A;  2B7K A;  1ERT A;  1GNE A;  2R6K A;  5KN0 A;  4BL7 B;  3JCM L;  2EC4 A;  1TK5 B;  2NDO A;  2LQO A;  1QMV A;  4HOJ A;  2IMI A;  5CRG A;  4NPB A;  5D73 A;  3IC8 A;  3FEU A;  2P0G A;  3DXB A;  3R3E A;  1ON4 A;  5KN1 A;  4ID0 A;  5F0G A;  3D5J A;  3H1N A;  1SKW B;  2WCI A;  2RII A;  1G0T A;  2H0G A;  3IHG A;  4TRX A;  3SBC A;  1NHY A;  4IS0 A;  3F4R A;  4LL1 B;  4HZ2 A;  2X64 A;  1R5P A;  1SD8 A;  3RPN A;  1LBK A;  4GQF A;  4ML1 A;  3UEM A;  4BPY A;  1FB0 A;  3ZMK A;  4TVE A;  4EVM A;  3RDW A;  1ZYE A;  1S3D A;  3CBU A;  1EP7 A;  3TRQ A;  2OAC A;  2I4A A;  5EPF A;  3W6G A;  5EY6 A;  1XW5 A;  1URM A;  1X9S B;  1TW9 A;  3O6T A;  5G31 A;  4F0C A;  2YNX A;  4G0L A;  1WJK A;  4HDE A;  4OFT A;  5E4W A;  1AAZ A;  1PRX A;  3HZ8 A;  2LUS A;  4KA0 A;  4F03 A;  1UA5 A;  1YKA A;  1HNA A;  2YJH A;  4DEJ A;  2F8F A;  2YP6 A;  1ZCP A;  3KM6 A;  5BMU A;  3GUS A;  4AJ8 A;  4EO3 A;  2VCQ A;  2PU9 C;  4CY8 A;  1J08 A;  2M80 A;  1PD2 1;  2H73 A;  3DYR A;  4V2M A;  3BOA A;  2AV4 A;  4MK3 A;  3ZRE A;  1H4O A;  5IMV A;  1X5D A;  1A2J A;  3EYT A;  1W89 A;  2VD0 A;  4ZL8 A;  2OE0 A;  1SL0 B;  2GLR A;  3TJK A;  1TRV A;  2EIO A;  3LJR A;  4D73 A;  4MCU A;  2IME A;  3IXR A;  4I8B A;  1OE8 A;  16GS A;  2LNT A;  3HYP A;  4EXJ A;  4PX1 A;  4GSS A;  1SU9 A;  1BJX A;  1ERV A;  3FZ9 A;  3TGZ A;  1TRU A;  5GZZ B;  3CRU A;  1Z3E A;  5KN3 A;  2OAD A;  1AW9 A;  3BD2 A;  1A0R P;  3Q18 A;  2R0P A;  22GS A;  2H19 A;  1MD4 A;  3IC4 A;  6GSW A;  1OVN A;  4XHM A;  1XVQ A;  4IW9 A;  1TK8 B;  1SKS B;  4K5S A;  2QA2 A;  4XIH A;  2DLX A;  4MJA A;  5GAN D;  4IVF A;  1SYR A;  3KP9 A;  1YDK A;  4KAE A;  4JZQ A;  3H93 A;  5DAK B;  2R0G A;  1EGO A;  4DSR A;  5AGY A;  1X5E A;  2IIY A;  3TB2 A;  2FD3 A;  5F8B A;  3EPT A;  2IMK A;  5JWO B;  2LRN A;  4V2L A;  2J9H A;  3C71 A;  2WJU A;  1V2A A;  3G9B A;  2BMX A;  2I3Y A;  1M2D A;  2HI7 A;  2IWT A;  2DIZ A;  5ECR B;  1U88 A;  3GV1 A;  2N5A A;  1GP1 A;  4Q5N A;  4AJ7 A;  2DKH A;  3VI7 A;  2PN8 A;  5EL8 A;  4K7O A;  5H5Q A;  1QK8 A;  5JWQ B;  4ECI A;  4JR6 A;  3QDN A;  2HRN A;  1O73 A;  4X4J A;  2H8L A;  4HEA 2;  4ZB9 A;  4CDO A;  4LMW A;  1AXD A;  1OC9 A;  2FCH A;  4POB A;  4ZBD A;  5IMA A;  5B8B A;  5DVB A;  3M9K A;  1QFN A;  5IOX A;  4YKF A;  5CAX A;  4X1U A;  3LYK A;  5HR0 A;  5AIV A;  3WT1 A;  3Q6O A;  2QGV A;  2DJJ A;  3QAW A;  2LJK A;  5B7C A;  4YQU A;  3G7I A;  1K3Y A;  4XRD A;  4O5Q A;  4TR4 A;  3VWX A;  2QA1 A;  3GTU A;  1SD9 A;  4K6X A;  1VRS D;  4ECJ A;  3FY7 A;  2R4V A;  4PTS A;  3HVV A;  2AUV A;  1QUW A;  4ZIL A;  1V98 A;  1AQW A;  3IE3 A;  1MD3 A;  4WKW A;  1YY7 A;  4RI7 A;  3EUR A;  3KH7 A;  4KE3 A;  5IMF A;  1B4P A;  3HVS A;  2X8G A;  4MZW A;  1XXU A;  2LV3 A;  3A2W A;  5DJL A;  5G5E A;  2HXK A;  1PMT A;  1V58 A;  5HR2 A;  4ZB6 A;  5D8I A;  5ECK B;  3TJG A;  3ERG A;  1HYU A;  4ULX A;  4LL4 B;  2REM A;  4DSQ A;  3F0I A;  4GF0 A;  1NHO A;  5JWR B;  5ECP B;  2VCT A;  3ZTL A;  3HCZ A;  2H1G A;  2GSQ A;  4TR1 A;  2GT6 A;  1JZW A;  17GS A;  4KDU A;  2CA8 A;  1XOB A;  3L0H A;  4TR0 A;  3TRX A;  5IQY A;  5HFG A;  1M9A A;  2LJA A;  3WGX A;  3EMX A;  5G30 A;  1CQH A;  1K0N A;  3GUR A;  1O7U A;  6GSU A;  6GSX A;  3CSH A;  5CYY A;  2VM1 A;  1U87 A;  2Z9S A;  3EIN A;  3S9F A;  4PQI A;  2HZE B;  2LJR A;  2CV4 A;  5HQP A;  3QFA C;  3O3T A;  2P5Q A;  2O87 A;  4J2F A;  3J7Y k;  3P7X A;  2NBS A;  3DVW A;  4F0B A;  2VLU A;  4I97 A;  2WDU A;  2VO4 A;  3G7J A;  2QC7 A;  2L57 A;  2X8C A;  4MLY A;  3A5W A;  3CSJ A;  1VGL A;  1Z9H A;  2VL2 A;  3ZFB A;  1DBY A;  4N0V A;  4FO5 A;  4HZ4 A;  1O85 A;  2BJX A;  1VF3 A;  2P31 A;  5B6N A;  2B3S A;  4MNN A;  1MDJ A;  14GS A;  1XZO A;  2NVL A;  4HU9 A;  5G1K A;  2OBK A;  4HU7 A;  3DWV A;  4N0Z A;  3D4T A;  3FHK A;  3H8Q A;  2VAF A;  2JU5 A;  1A2M A;  4YQV A;  3EU3 A;  3TJB A;  3E0U A;  4ZIJ A;  3ME8 A;  2B5E A;  4HJ2 A;  2H6Y A;  3LFL A;  3QMX A;  1TKD B;  5A5K A;  4WF4 A;  1FAA A;  1GSS A;  2HNL A;  3KTB A;  4YQM A;  4EKZ A;  5DAL A;  5J5N A;  1F6M C;  3GKN A;  3QCP A;  1ZOF A;  2VCW A;  1PQN A;  4YAV A;  3GH9 A;  6GSS A;  3FYG A;  4GLT A;  3F4T A;  2DKI A;  2QSI A;  2FNO A;  4WR5 A;  4E8E A;  1GTI A;  1QXH A;  3IAS 2;  3I9V 2;  1EZK A;  1FOH A;  1GSY A;  3WGE A;  2GQK A;  3TDG A;  3UOM A;  1T00 A;  5FT3 A;  1WPI A;  3F6F A;  4AGS A;  3ZYW A;  3W8J A;  4OWY A;  2LQQ A;  4KX4 A;  5A4U A;  1YKC A;  3ZML A;  1NM3 A;  3WYW A;  3LXT A;  2DC5 A;  2L4Q A;  1IYI A;  1F3A A;  3LOR A;  2GZY A;  1V9W A;  2J23 A;  4O32 A;  3LYP A;  2CZ2 A;  1GTA A;  3VK9 A;  1OE7 A;  2YN1 A;  3GKX A;  3MYD A;  3EE2 A;  1WE0 A;  1PN9 A;  4I2U A;  1PKW A;  1T4Z A;  1VF2 A;  4BA7 A;  3F6D A;  5IMC A;  1TU8 A;  3ME7 A;  1WP0 A;  2DJK A;  4EL1 A;  2VLT A;  1EOH A;  4RQR A;  2KUC A;  3DGQ A;  3C73 A;  2XHF A;  2B6M A;  1VF1 A;  4V2N A;  4BVY B;  4XS4 A;  4ZBA A;  4MP4 A;  3KEB A;  3M0F A;  2WUL A;  4BL7 A;  2HSY A;  2FWF A;  5AIS A;  3FR9 A;  4ILF A;  3LW9 A;  1A0F A;  4BVX B;  2C4J A;  19GS A;  5H5R A;  1GUH A;  1MEK A;  3FMW A;  3F63 A;  1F2E A;  4L5O A;  5ELA A;  3AY8 A;  2N5F A;  4GST A;  5KOW A;  2ZCT A;  4KSM A;  2DJ2 A;  2E2M A;  1GWC A;  2ON7 A;  9GSS A;  1TOF A;  1J9B A;  4G0I A;  2C80 A;  1SK0 A;  2H01 A;  4DSS B;  2UZ8 A;  4N11 A;  1G6W A;  1EP8 A;  4ZBB A;  1DSB A;  2O85 A;  3LEF A;  4XRA A;  1K3O A;  2JSZ A;  5KN2 A;  2H74 A;  5IO0 A;  5CRH A;  1A8L A;  4IP1 A;  4WXT A;  3ERW A;  3F9U A;  4EIP A;  2YWN A;  2YWI A;  3CYN A;  1BAY A;  4Z7X A;  2OA7 A;  2DSA A;  2OE1 A;  1GLQ A;  2C3T A;  2ON5 A;  3SWL A;  5C00 A;  1AQV A;  1M99 A;  4K2D A;  4KDY A;  4TXO B;  1R5A A;  4MF7 A;  1ST9 A;  2IPA A;  4PGT A;  2MBT A;  5JCW A;  2WGR A;  4QL7 A;  2GQL A;  2HLS A;  5ECL B;  4TOP A;  5HR1 A;  4EUY A;  5IO2 A;  2YPM A;  7GSS A;  3UAR A;  4NHZ A;  3M3M A;  3A3T A;  3N5O A;  2AHE A;  2XC2 A;  3MNG A;  1TI1 A;  1YF0 A;  3F8U A;  3IPZ A;  4K1F A;  1SYX A;  1H75 A;  4WF5 A;  3PH9 A;  2YCD A;  2B5Y A;  1JZO A;  2KLX A;  2LKU A;  5DQS A;  5A4W A;  2JAC A;  1ZYN A;  2VCX A;  2AAW A;  1GSD A;  2IMD A;  5HFI A;  2TRC P;  3IOS A;  2DIY A;  4I2T A;  2NTO A;  2GSR A;  2CVD A;  2DJ1 A;  4KW6 A;  4OFN A;  4GCI A;  3EU4 A;  3ED3 A;  2YWM A;  2CAI A;  3E3E A;  3TKS A;  3F3R A;  5J9C A;  2HSM A;  1PX7 A;  1O6J A;  5CP1 A;  2GSS A;  1WWJ A;  2OKA A;  3P2A A;  1N8J A;  1TXX A;  5F05 A;  2MMN A;  1U6T A;  1ZL9 A;  3UL3 A;  2WRT A;  13GS A;  4MPG A;  5KOX A;  1M2B A;  5DBQ A;  1K0B A;  4O7H A;  2V2G A;  3J7Y b;  2DBC A;  2VIM A;  3DEX A;  2L6D A;  4NV5 A;  2IMF A;  4IJ3 A;  3LWA A;  1XWC A;  1GSU A;  4YH2 A;  4BWQ A;  1K0O A;  4XTS A;  1AC1 A;  3UBL A;  3DIE A;  3L9U A;  1A24 A;  2GGT A;  4Q5R A;  1B9Y C;  2CVB A;  5DAK A;  5CO3 A;  4MDC A;  3QAG A;  2LTK A;  1R7H A;  3N9J A;  2X4A A;  3GNJ A;  4NMU A;  4GSN A;  2PVO C;  3IA1 A;  1XW6 A;  1K0D A;  4MH3 A;  2A4V A;  5ID2 B;  5IIZ A;  4N10 A;  3UBK A;  3CTF A;  3P90 A;  5J4U A;  3LG6 A;  3GMF A;  5LCZ A;  4TW5 A;  4PQH A;  1RK4 A;  4KDX A;  1Y25 A;  2JZT A;  1X9W B;  1GUL A;  4G9H A;  1ILO A;  3APQ A;  5JCU A;  1X0R A;  5F06 A;  1YZX A;  1F37 A;  2HRF A;  2PER A;  2GDR A;  3C1S A;  2H66 A;  4L8E A;  4AJ6 A;  5INY A;  3BBY A;  3MDK A;  2A4H A;  2DMM A;  20GS A;  3PPU A;  1MTC A;  3M1G A;  2H6Z A;  4HUA A;  2AB6 A;  4GXZ A;  1WMJ A;  3GTU B;  5IPG A;  4KF9 A;  2GZP A;  3FW2 A;  4KND A;  4ZB8 A;  1THX A;  4L5L A;  5ABR A;  2OJL A;  3VPT A;  1TP9 A;  2C1Y A;  1JZR A;  3I43 A;  1SEN A;  1EOG A;  3KTL A;  2DJ3 A;  3ZIJ A;  1K3L A;  3UMA A;  4E8H A;  1CQG A;  4EC0 A;  3GSS A;  1JFU A;  1RW1 A;  2H76 A;  1GNW A;  3NIV A;  3MIX A;  1EV4 A;  3D22 A;  3RHB A;  1KBN A;  5IOW A;  2FHE A;  5DCG A;  1J0F A;  3FR6 A;  3FR3 A;  2C3N A;  3L9V A;  3C8E A;  4TR1 B;  1XCC A;  1SKR B;  3LXZ A;  2C3Q A;  4LLR A;  4N30 A;  4I5Q A;  6GST A;  4WBJ A;  1Z5Y E;  1G6Y A;  5AIX A;  4RQX A;  5J9B A;  3VWV A;  3DD3 A;  3MWH A;  1NSW A;  2LEG A;  3QPM A;  4NV2 A;  2WS2 A;  2FUG 2;  2FGX A;  4IBP A;  3U6V A;  1PX6 A;  3EMP A;  4O5U A;  3TKS C;  2HYX A;  4G10 A;  3QFB C;  5ECM B;  4WBR D;  1Z7P A;  4PNF A;  2YOI A;  4JU5 A;  4HJM A;  3UIW A;  3FZA A;  4POL A;  1NW2 A;  2HE3 A;  1V40 A;  2CZ3 A;  1GL8 A;  3APO A;  1EEJ A;  2XBI A;  2HZE A;  3C7M A;  4Q5F A;  3V1W A;  1TRW A;  4FH8 A;  1FVK A;  2MBS A;  1KEB A;  2B1K A;  2TRX A;  3O76 A;  3NOF A;  1K0A A;  2LS5 A;  4GTU A;  2KHP A;  2JL4 A;  2FY6 A;  3D6I A;  4ZXG A;  4GQC A;  5B6M A;  1ML6 A;  3HJP A;  4TR3 A;  4Z2T A;  1QGV A;  1BED A;  3CTG A;  4HQZ A;  3HY2 A;  4HQS A;  2HRA A;  2AYT A;  1A8Y A;  3KIJ A;  2IFQ B;  4CW9 A;  3FZ5 A;  2F8A A;  1TJD A;  5D93 A;  2ES7 A;  2CX3 A;  2H1D A;  1AQX A;  2H1A A;  5IPH A;  5ENU A;  2H30 A;  4NAX A;  1OYJ A;  1OKT A;  4EIQ A;  6GSY A;  3NZN A;  1GUM A;  4RI6 A;  1U3I A;  3VPQ A;  2WZ9 A;  4X0X A;  5D96 A;  4HI7 A;  2KP1 A;  1HD2 A;  2R5G A;  2H1B A;  2K8V A;  5GSS A;  2YWO A;  4PUR A;  4OCE A;  2A2P A;  4NHW A;  4HS1 A;  3UVH A;  1GTU A;  1T3B A;  2XBQ A;  2E7P A;  4IP6 A;  3VWU A;  2VLV A;  1A23 A;  3HZ4 A;  3HXS A;  5DCH A;  5B8A A;  5BRT A;  3A5I A;  3RHC A;  2ZUP A;  5JCG A;  3Q19 A;  4FYU A;  2C8U A;  3UAP A;  1FVJ A;  3HKR A;  4OO5 A;  1M0U A;  5J41 A;  1B8X A;  2GTU A;  1B9X C;  1WRY A;  2FWH A;  5ECN B;  4OD7 A;  4TKY A;  2PVQ A;  4KSO A;  2LST A;  1PGT A;  2L59 A;  5CRW A;  1AUC A;  1VF4 A;  3ZZX A;  3DVX A;  1XFL A;  2L6C A;  1Q4J A;  1SK2 A;  1SK1 A;  5ECI B;  1PN0 A;  2JZR A;  2R3X A;  3DML A;  3VFI A;  1ZYQ B;  1LU4 A;  1G7E A;  3A2X A;  4PUA A;  4IQ1 A;  1UVZ A;  1PL2 A;  3GKM A;  4MMM A;  1U3A A;  2I1U A;  2CAQ A;  1GTB A;  2YZU A;  3H4K A;  2YAN A;  3GRX A;  3IK9 A;  4KGI A;  1JLW A;  4LA1 A;  1S3C A;  3PGT A;  3KP8 A;  4JE1 A;  3VI5 A;  1Y6E A;  3TOU A;  12GS A;  4BVY A;  5G2Z A;  3US3 A;  3IBH A;  1ZGN A;  1TU7 A;  4CY6 A;  4MF5 A;  3IR4 A;  5CRE A;  4RUV A;  4QL9 A;  2K9F A;  1GSF A;  2L4C A;  2WB9 A;  2X99 A;  3KMN A;  2B7J A;  4BVX A;  1T1V A;  2XPD A;  4WEY A;  1XWA A;  2I81 A;  3HDC A;  3FK8 A;  2RM5 A;  3WGD A;  2OE3 A;  1KTE A;  1W4V A;  3GA4 A;  3GKK A;  4PUF C;  3KMO A;  2VL2 C;  2A2R A;  4KCA A;  5EVO A;  3M9J A;  4JR4 A;  3I6A A;  3U5R E;  2G2Q A;  2B5X A;  2JZS A;  18GS A;  1E2Y A;  4DSS A;  1K0C A;  5H5S A;  3RPP A;  1Z6M A;  2PMT A;  2MYG A;  3GH6 A;  3CXG A;  4ECC A;  4BWS A;  2L5O A;  2FWG A;  4MF6 A;  3GN3 A;  2H71 A;  4PQ1 A;  3ZRD A;  1XWG A;  2PWJ A;  4FYB A;  3HJM A;  1PSQ A;  3QR6 A;  3F4S A;  4TXO A;  4K0G A;  4FIW A;  1SJ6 A;  3IK7 A;  1TDI A;  2RM6 A;  3TKQ A;  1FO5 A;  1MDK A;  2K8S A;  3C1R A;  2M46 A;  5C04 A;  1HNB A;  1PKZ A;  4G19 A;  1LJR A;  1GSQ A;  1EEM A;  1XWK A;  1GUK A;  2MZC A;  5FHI A;  4L0U A;  2C0F A;  4D73 B;  1ZZY A;  4JED A;  1FW1 A;  1JZD A;  4A5P A;  4ISD A;  2GT5 A;  2C0D A;  3LQ7 A;  3KD0 A;  3TKP A;  4X43 A;  1EGR A;  2CVK A;  3KCM A;  5IMD A;  1EV9 A;  4KUN A;  4OO4 A;  2VD1 A;  3HVX A;  4OMV A;  4ML6 A;  3TJF A;  4LMV A;  1UC7 A;  4FQU A;  1N2A A;  5ECQ B;  4EDZ A;  2PUK C;  8GSS A;  2IL3 A;  5KEJ A;  2VL3 A;  2CX4 A;  5GST A;  5IM9 A;  1BX9 A;  2HT9 A;  2R0C A;  4ACS A;  1YF1 A;  4P3Y B;  1F9M A;  2YV7 A;  4ZL9 A;  2O8V B;  3BJ5 A;  3TKR A;  2FA8 A;  3F3Q A;  5DJM A;  1JLV A;  2LRT A;  3TJJ A;  3A2V A;  2KP2 A;  2VCV A;  4CHS A;  6GSV A;  3IV4 A;  2GQM A;  3IHQ A;  3TRP A;  1ERW A;  4AF2 A;  3GL5 A;  4XCS A;  2B1L A;  3KGK A;  4ICY A;  4KB3 A;  2V32 A;  2RUF A;  2QKE A;  2O7K A;  4POM A;  3RAZ A;  5CNW A;  4MZB A;  4H86 A;  2V41 A;  3P8W A;  1FOV A;  3GIX A;  3GYK A;  5ECH B;  4O5R A;  3DRN A;  3BCK A;  3Q74 A;  3D4M A;  2HRK A;  2BTO T;  1EWX A;  1ERU A;  4OFM A;  2V6K A;  1RQM A;  5D9W A;  2M72 A;  4MZC A;  1PL1 A;  1DUG A;  1BG5 A;  1ACV A;  3L78 A;  1I9D A;  3APS A;  1T8E B;  1K0M A;  4NXI A;  1OC9 B;  2YV9 A;  2H0I A;  4Q5Q A;  2YZH A;  4IQA A;  1SJI A;  3D21 A;  5HR3 A;  4MPF A;  5ID2 A;  3W8S A;  1FB6 A;  4K7I A;  4F2I A;  3G7Y A;  1B4Q A;  1R4W A;  3I69 A;  2PGT A;  4MJC A;  4MA9 A;  4TN8 A;  1SL2 B;  2K18 A;  4PXO A;  4GWR A;  3HD5 A;  4ECB A;  2AJQ B;  4EDY A;  2HSH A;  3FRC A;  1F3B A;  2F9S A;  2OBI A;  4IJI A;  1A2L A;  1GSE A;  1FHE A;  5HFK A;  1XOA A;  2C0E A;  3VUR A;  3ZIT A;  3LSZ A;  2NPB A;  1M7T A;  2X49 A;  2ZNM A;  4I6X A;  4USS A;  2K6V A;  2FA4 A;  2HZF A;  2G0F A;  3L9S A;  2FWE A;  3TCO A;  2ALB A;  3ISO A;  4YAP A;  2I9H A;  4JBB A;  1HQO A;  5LD0 A;  3LGC A;  4GRF A;  2KOK A;  4IKH A;  4V1A p;  3QAV A;  5IMZ A;  3K8N A;  3KH9 A;  4K0N A;  1XPV A;  1TK0 B;  5FWG A;  1GLP A;  2N5B A;  1MDI A;  2F3M A;  3ZL5 A;  1O8W A;  2YJ7 A;  3DKS A;  3TKS E;  3BCI A;  5ECO B;  2GS3 A;  2E2G A;  1Z7R A;  1SJZ A;  2GVP A;  3RBT A;  5L71 A;  2VM2 A;  2VOC A;  3IDV A;  1HNC A;  1T7P B;  1M2A A;  2H70 A;  1X5C A;  3ZFL A;  2CQ9 A;  3GX8 A;  5E59 A;  5D9V A;  3KZQ A;  4XS1 A;  4MAB A;  2O89 A;  3IRA A;  2HFD A;  2TIR A;  4TXV A;  3GHA A;  4MH2 A;  1YEP A;  3L4N A;  3UVT A;  3EVI A;  4OCF A;  4MJB A;  1DE2 A;  1KNG A;  1S3A A;  2MMZ A;  5COH A;  10GS A;  5DDL A;  2IN3 A;  5GAP D;  1OC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...