2IN3A

Crystal structure of a putative protein disulfide isomerase from nitrosomonas europaea
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
204
Chain Sequence
EKPVLWYIADPMCSWCWGFAPVIENIRQEYSAFLTVKIMPGGTNTPLLPEKRAQILHHWHSVHITTGQPFTFENALPEGFIYDTEPACRGVVSVSLIEPEKVFPFFAAIQRAFYVGQEDVAQLAILKKLAVDLGIPESRFTPVFQSDEAKQRTLAGFQRVAQWGISGFPALVVESGTDRYLITTGYRPIEALRQLLDTWLQQHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of a putative protein disulfide isomerase from Nitrosomonas europaea
rcsb
source organism Nitrosomonas europaea
molecule tags Isomerase
total genus 63
structure length 204
sequence length 208
ec nomenclature
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.60 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 putative protein disulfide isomerase domain 2in3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2in3A01
2KLXA 16GSA 2IFQA 4K2DA 1AQXA 2PPTA 4EVMA 1Z9HA 4IP1A 5F07A 4OFNA 2P5RA 5HFIA 3RPPA 4NHWA 3AY8A 4MH2A 2XHFA 2WRTA 5B6NA 1SK0A 4HU9A 2JADA 2AJQB 1Z6NA 2RUFA 2QKEA 1F37A 3UVHA 1HQOA 2H0GA 5C00A 1H75A 2B5EA 3CSHA 4HQZA 4K1FA 1DUGA 1G6WA 4XHMA 3F4SA 2L5LA 3F4RA 2RIIA 3VLNA 2PUKC 1YF0A 4ZL9A 4YAVA 5GSTA 3LXTA 4D73B 3VI7A 1K3YA 4XS1A 3IOSA 3UARA 1E6BA 2HFDA 2RM5A 2F9SA 5DCHA 4KH7A 1W89A 3ZL5A 3HVVA 4YH2A 1ZL9A 1OKTA 2VIMA 2FLSA 2DJJA 1XWKA 3DWVA 3VWXA 4XCSA 2IIYA 2RUEA 5C04A 4ZB8A 4O5RA 4KDYA 5F06A 1XVWA 4WF5A 1DBYA 4POLA 1V2AA 5G5EA 3FRCA 2MBTA 4GRFA 1YKAA 2HI7A 4DSSB 1PGTA 1OC8A 4TW5A 4OO5A 2YPMA 3L9SA 4XS4B 1Q4JA 2G0FA 2C3NA 1XCCA 2VM2A 1A23A 2HZEA 3GX0A 1MD4A 2A2RA 3ZFBA 4FYUA 3TKPA 1XXUA 2OKAA 5ENUA 3LGCA 2DIZA 1QQ2A 1SJ6A 1WJKA 2H1GA 3I69A 2IMFA 5HR3A 1F3AA 1EV4A 4WETA 2GSQA 3C73A 5IPHA 3RHBA 3E3EA 4ECIA 5GAND 1AIUA 4OWYA 3GH6A 2PGTA 5A4VA 4G9HA 1AAZA 3ZVJA 1S3AA 1EZKA 4EUYA 2KHPA 1O8WA 2GDRA 1SU9A 5IM9A 1NM3A 1X9MB 2PBJA 1TI1A 1GRXA 2C80A 2A4VA 4MDCA 3EVIA 4JBBA 5DJLA 1M2DA 1ZCPA 5ECRB 3IHQA 4GSNA 2FWHA 1URMA 3GIXA 4KB3A 2GGTA 1TK8B 2B7KA 1OC9A 14GSA 3LORA 1EWXA 3IPZA 3GMFA 1FO5A 4ZL7A 3H93A 5DCGA 4TR1B 4NAXA 3UMAA 1K0BA 2O8VB 1MD3A 3PGTA 1ABAA 3TJKA 4J56E 1ZYQB 5ECMB 2GSTA 1SD9A 5F8BA 2WGRA 2QC7A 3G7JA 3LSZA 5IMVA 4BPYA 2H73A 2CVDA 1YKCA 2M72A 5J4UA 4LMWA 2H70A 3IR4A 2R2JA 1MDKA 2CX3A 1ST9A 4K7IA 3CTFA 4WBRD 5JWOB 1TK5B 4G19A 18GSA 2GSRA 1K0MA 3TJJA 3C7MA 1T7PB 4X1UA 2XBIA 4MZWA 3VWWA 7GSSA 4Q5RA 1Z7PA 2IL3A 3EC3A 4KDUA 3M1GA 1SJIA 1F3BA 4LLRA 2H75A 2WZ9A 1EGOA 1BAYA 2GZPA 2DJ1A 2P0GA 2VOCA 3G9BA 5INYA 1T4YA 1M2AA 4DSSA 3A5WA 1OVNA 1KEBA 1LJRA 2JU5A 3CSJA 3L4NA 2DC5A 4XS4A 1XVQA 2QGVA 3Q19A 1B48A 1Z6MA 3FEUA 4BVXA 1CQGA 2HE3A 4HZ2A 1EV9A 5H5SA 3P8WA 3QFBC 2H72A 1E2YA 1F6MC 1WP0A 2L4QA 5J9BA 4KA0A 3HVSA 2E2GA 4CHSA 2N5FA 3F8UA 2VLVA 2C3QA 4IS0A 3EMXA 1B4QA 2YWOA 4GXZA 1ERWA 4EDYA 1YQ1A 3IAM2 4ZB9A 2D2ZA 1BG5A 4TN8A 11GSA 3GTUB 2TRCP 4L5LA 4GTUA 3WD6A 1GWCA 3TOUA 1VGLA 1XOBA 3W8SA 1A2LA 1JZOA 1RK4A 4N30A 1PN9A 2OE1A 2O89A 2WCIA 2V2GA 1R26A 4OMVA 1XWCA 3E9JB 3A2WA 5LD0A 1OYJA 2X8CA 3D5JA 2HSYA 4XRAA 10GSA 1GP1A 5G1LA 4NXIA 1M2BA 4BVYA 5JCWA 2R6KA 4ZXGA 4TR1A 3RBTA 4F03A 2DJ0A 4P3YB 3BOAA 2VL3A 3ED3A 4EKZA 5G2ZA 4RQXA 2MMNA 3DD3A 2E7PA 2OJLA 3WT1A 5AIVA 4K0GA 4K9ZA 5KN1A 2LSTA 2DJ3A 3GSTA 2M46A 1O8XA 1XW9A 3DXBA 3SBCA 5D73A 2L59A 3FW2A 2FWFA 3KEBA 1GNWA 2FWEA 4N0ZA 5CRDA 4HI7A 2HZFA 4AJ7A 4FH8A 5GSSA 1XW5A 1ZGNA 3EU3A 4MH3A 4WEYA 1JHBA 2B5XA 6GSWA 1PMTA 2FHEA 4RUVA 4MABA 1TRUA 4IQ1A 5G30A 2WS2A 2LEGA 1OAZA 4Q5QA 3LG6A 1XOAA 3DKSA 3APSA 3IRAA 1FVKA 1GUMA 2B5YA 4ML6A 2V32A 4PXOA 3GUSA 3EE2A 1ZYEA 3GURA 4O92A 1PRXA 3Q18A 4ZBAA 1HYUA 1R4WA 3ZIJA 2J9HA 2PVOC 2DLXA 4K6XA 2P31A 3IK9A 2JSZA 4MF5A 2H0HA 1UC7A 4EE0A 5ECNB 1MDIA 2LJAA 4RI6A 2L6CA 3GTUA 4HUAA 1BYEA 3EU4A 2WDUA 2GT6A 1ERUA 4MP4A 5CRHA 2HLSA 3WT2A 4DSQA 4CW9A 3TOTA 2GQMA 3HJMA 3HY2A 3F4TA 2FNOA 5IMFA 1BEDA 4KDXA 2I1UA 3HZ4A 4V2NA 5J5NA 5CREA 2PU9C 2VO4A 3G7YA 2H30A 1TRVA 2H74A 5IOWA 1VRSD 2YCDA 3HJPA 4ECCA 2VCVA 3DVWA 1RQMA 1R5PA 2H1DA 2N5BA 5HQPA 4ULXA 2O7KA 3LYKA 1W4VA 3GSSA 4KCEA 2H1BA 3KTLA 3I43A 2HYXA 4I6XA 4GQFA 2IMIA 3J7Yk 2B7JA 3UJ1A 3KJYA 1FG4A 4MZBA 4MA9A 2WJUA 4X0XA 3H4KA 1K0AA 5FWGA 1G0TA 3CYNA 3QCPA 2ZNMA 2H6YA 1JZWA 3DIEA 3UBLA 1OC9B 4ZL8A 2BTOT 2VCTA 2H6ZA 3KP8A 3N5OA 4PQHA 2X8HA 1QUWA 3QPMA 3TUEA 2RLIA 3RHCA 3UBKA 1FAAA 3GX8A 2AHEA 3IDVA 2YJ7A 2B1LA 2CZ2A 3UAPA 3FK8A 1NW2A 1NHOA 5G5FA 3FZAA 1PKWA 1S3DA 2FUG2 4IHUA 3M9KA 4IQAA 4NV2A 1WMJA 4EL1A 4YQMA 5H5QA 1GSQA 3HHVA 4NMUA 3F0IA 1OE7A 1EOHA 2LS5A 3TKRA 1TW9A 4CDOA 1AUCA 4WR5A 2MZCA 17GSA 1QXHA 2C0FA 2OACA 3LWAA 1B9YC 2ON7A 3CMIA 4TR3A 1SL1B 1R7HA 1T00A 2VL9A 2CAIA 2VAFA 2L57A 2HXKA 2R3XA 1ON4A 2DMLA 3VK9A 1GSSA 1H4OA 2B3SA 3UVTA 1A0RP 3UIWA 3I9V2 2IMKA 4KCAA 5LNKe 1J9BA 3MAKA 2JZSA 3ZITA 2B6MA 1S3CA 1V40A 3TKSE 1M0UA 1O73A 4GSTA 3FYGA 1AC1A 1K0OA 1LBKA 2IWTA 1TK0B 19GSA 1XZOA 3GKNA 3GKMA 4IJIA 4LMVA 2VCWA 3CXGA 3HYPA 1UN2A 5IMDA 4GLTA 4I2UA 2KP1A 2ON5A 5ABRA 1SKWB 3P2AA 4LL4B 1TU7A 2VD1A 2X99A 1KBNA 3UEMA 2NDOA 1UVZA 3EURA 5G1KA 3U6VA 3TRPA 4KW6A 2RM6A 5D93A 4IBPA 4ML1A 1YDKA 4JZQA 1PQNA 5JCUA 2MMZA 3ZFLA 1FHEA 5AIXA 2O87A 4FO5A 1A0FA 5CRGA 1ERVA 3RDWA 2LV3A 4WXTA 2L5OA 5DAKB 2G2QA 2LUSA 1C72A 2YWMA 2LKUA 1GNEA 3BJ5A 1GLPA 4H86A 1HD2A 2H66A 2KP2A 5IPGA 1EP7A 3V1WA 4PURA 3FKFA 3TJFA 4FYBA 4WF4A 5DQSA 2LRNA 5E59A 2YZUA 2VLTA 5B6MA 2K9FA 3M9JA 4YQVA 3IAS2 4PUFC 2DSAA 5JWRB 4F0BA 1X9SB 1DSBA 5KN0A 1GLQA 1V58A 1J08A 1T3BA 5A4UA 1Z3EA 1NSWA 4PNGA 4XIHA 5CAXA 3LJRA 2DBCA 2DIYA 1FW1A 3GRXA 3KGKA 3A2VA 2YANA 3SWLA 2EC4A 3KH9A 2DMMA 4IVFA 1TRSA 4EF0A 4DSRA 3DRNA 4XTSA 4IGJA 1KNGA 1EGRA 5HR1A 4TVEA 1M7TA 3GFKA 3NOFA 3VPQA 3TJGA 2EIQA 1GSFA 1G7OA 2VUPA 4N10A 4K7OA 5H5RA 4KSOA 3GL5A 3DEXA 1TXXA 4PX1A 3PINA 1SKSB 1VF4A 3KXOA 3GA4A 4JE1A 3EMPA 3P90A 1OE8A 2OBIA 2K8VA 2NTOA 3WGEA 3IXRA 2CQ9A 4MJCA 4F82A 2DJ2A 2LNTA 5AGYA 5CO3A 5J41A 1JLWA 2JL4A 2I4AA 3CRUA 3JCML 1N2AA 5KN3A 4Z7XA 1K3OA 4HU7A 2GZYA 2OE0A 3QFAC 4ECBA 4NPBA 3J7Yb 5COHA 3TRXA 5FHIA 1AQVA 1N8JA 1XWAA 3ERFA 1GULA 4ZBBA 1XWBA 3ZZXA 4GSSA 3Q74A 2Z9SA 1GSUA 3U5RE 2C4JA 3L9UA 3TB2A 2LTKA 4GCIA 4EDZA 2AAWA 4LL1B 5DBQA 4PGTA 2C0GA 3CBUA 5J3RA 2E2MA 5IMCA 4ILFA 1SL2B 5DDLA 4K7NA 2K8SA 4I97A 1U87A 3LYPA 5DAKA 2IMDA 3KD0A 3ZTLA 1GL8A 4MJEA 2PWJA 1J0FA 4N11A 2K18A 4KUNA 4ID0A 2IN3A 4O32A 4MJAA 4POMA 2CX4A 2OADA 3Q6OA 1U6TA 5ECOB 3FY7A 2LJKA 3GNJA 2FGXA 5HR2A 1R5AA 2GTUA 5D96A 3D6IA 2CVKA 3ZREA 3KIJA 1GSEA 2BJXA 1XIYA 4NV5A 2LRCA 3KMNA 4MMMA 2WULA 1WRYA 5GAPD 3IK7A 1VF1A 3HDCA 3I6AA 1JLVA 4LA1A 1Y6EA 2I3YA 5IOXA 3F6FA 2GZZA 1MDJA 2NVLA 3TGZA 5IO0A 2WFCA 4FIWA 4KAEA 1PSQA 1B4PA 1ERTA 1I5GA 4MF6A 1THOA 3WYWA 1BJXA 1T1VA 1PL1A 5F0GA 3WGXA 1XWGA 5IMZA 2CZ3A 4AF2A 4QQ7A 1TP9A 2L6DA 1EOGA 1M9BA 1NHYA 5A5KA 2LRTA 1GH2A 2A2SA 2JZRA 4EO3A 1ML6A 2YWNA 5DVBA 2GQKA 2DJKA 4TR4A 3HXSA 2CAQA 4L5OA 1UA5A 3EYTA 1HNBA 2C0DA 4EXJA 1FVJA 1K0DA 4L0WA 4WBJA 2N5AA 3CTGA 1YY7A 1EP8A 3TCOA 3S9FA 2V41A 1SENA 5B8BA 3QAWA 2EIRA 3GKKA 4I5QA 1XBSA 1HNAA 1K0NA 2ES7A 4JR6A 5ECSA 1M9AA 3ZYWA 2VD0A 2VLUA 3DYRA 3HKRA 3FZ5A 5DALB 3N9JA 3VWUA 6GSYA 2MYGA 5ECPB 3C71A 4HQSA 3DGQA 2WB9A 1TTZA 3MNGA 2ZUPA 3HVXA 4XS6A 1Q98A 3IC4A 2IPAA 3RAZA 1PA3A 4TOPA 4MZCA 1SL0B 5D9WA 2VCXA 5D9TA 3LFLA 2VM1A 3WGDA 3H1NA 2LJRA 1GSDA 2YV7A 2H1AA 1TOFA 3UOMA 3ZMKA 1XW6A 1Z7RA 1FB0A 1TJDA 4V1Ag 5A4WA 4G2EA 2REMA 5CNWA 2NBSA 2K6VA 1O81A 5ELGA 2OE3A 1IYHA 3W6GA 2C0EA 1BX9A 3ERGA 1V9WA 3FZ4A 1FB6A 22GSA 1EEJA 3F3RA 5CRWA 4RQRA 2LQOA 1OC3A 1VF3A 1DE1A 3GH9A 4QL9A 4HDEA 3TJBA 3PH9A 1QK8A 3QMXA 3KTBA 1V98A 1QGVA 2C3TA 3ERWA 20GSA 4AJ8A 3D0ZA 1SD8A 2NPBA 3G7IA 2XPDA 2V1MA 2FCHA 5HFKA 2XBQA 3L78A 3VWVA 5KN2A 2KUCA 2V6KA 1IYIA 1O6JA 3IBHA 2JZTA 3M3MA 4TRXA 2LQQA 5D9VA 5EL8A 4YAPA 3GL3A 1K0CA 6GSUA 3ZVJD 1LU4A 3M8NA 1A8LA 1QFNA 1BQ7A 2XPEA 3PR8A 5AN1A 1O7UA 4OO4A 5JWQB 2VL2C 1TI3A 5CP1A 3H79A 1A24A 3FZ9A 2X64A 2FWGA 2GSSA 3DMLA 5DJMA 1X5CA 5IIZA 5CYYA 1WPIA 6GSSA 4BWSA 4AGSA 2CVBA 3GN3A 1X0RA 2F8FA 3W8JA 3NZNA 5HFGA 4KGIA 1WE0A 4IKHA 2VL2A 3ME7A 1PL2A 1CQHA 1X5DA 1GTIA 1F2EA 5DALA 4F2IA 4RI7A 1VF2A 2CT6A 2H6XA 1YJ6A 2PVQA 3TDGA 1G6YA 3F6DA 2HRNA 2IJYA 3E0UA 1AW9A 2MMOA 2YV9A 4X43A 4K0NA 4TKYA 3OR5A 4EC0A 3ZRDA 2HSHA 4WR4A 3P7XA 1XPVA 4ZBDA 1PKZA 2PMTA 3K8NA 4MJBA 6GSVA 1YF1A 4TXOB 3ZIVA 3H8QA 13GSA 1WOUA 2R4VA 1X5EA 2FD3A 1B9XC 3HZ8A 4V1Ap 2R37A 2FA8A 2XC2A 3RPNA 4F0CA 3C8EA 5ECIB 4QL7A 4POBA 4NWYA 3FR3A 4TR0A 5D8IA 3BBYA 4GWRA 1ZMAA 4L8EA 3C1SA 3D4TA 3QAVA 3QOUA 1ZOFA 4J57E 2HNLA 4DEJA 2AV4A 2O85A 5EVOA 3KCMA 4JEDA 3L0HA 2H01A 1MEKA 5ID2B 4GF0A 6GSTA 5HR0A 12GSA 3LEFA 1JZRA 1SK2A 4D73A 1ACVA 3ISOA 2MMAA 3GHAA 4ACSA 5EY6A 4DVCA 4HJMA 2EIOA 3KP9A 2E0QA 1G7EA 1U3IA 2H0IA 3UL3A 3ZLPA 2H8LA 3VPTA 4POKA 1QMVA 2L4CA 2JSYA 1RW1A 3F3QA 1FOVA 4OCFA 2KOKA 5B7CA 2YZHA 4IP6A 4NHZA 4MPGA 1WWJA 3F63A 1SJZA 8GSSA 1EEMA 3EINA 1GTAA 5E4WA 2C1YA 4JR4A 2F51A 4K8MA 5FT3A 3APQA 4HZ4A 1GTBA 5JCGA 4IJ3A 5EPFA 1YZXA 4XRDA 2GLRA 3QD9A 5L71A 1TRWA 2HRFA 4ISDA 4F9ZA 4Q5NA 4BA7A 4E8HA 4GQCA 4MPFA 4MK3A 4MF7A 4OCEA 3GKXA 5DQYA 3FR6A 3O76A 4HJ2A 1GSYA 2OA7A 3VI5A 3BCIA 4ECJA 3CRTA 5ELAA 4MCUA 1THXA 1A2MA 3GV1A 2LNSA 3DVXA 5IMAA 3LQ7A 2BMXA 2ALBA 5KEJA 4V2MA 2VCQA 3HD5A 1JFUA 3KMOA 1U88A 3LXZA 1B8XA 3KH7A 3VURA 4JRRA 1A8YA 3L9VA 5ECLB 3M0FA 3ME8A 3O6TA 1PX6A 4TXOA 1U3AA 3GYKA 3FR9A 3IV4A 4Q5FA 9GSSA 4YQUA 3D4MA 3BD2A 1T8EB 5J9CA 3HA9A 4L0UA 4OD7A 5LCZA 2YOIA 3QDNA 3BCKA 4OFTA 2YNXA 1K3LA 4ZB6A 2YJHA 2AUVA 4MLYA 1ZZYA 2AB6A 3MDKA 1SYXA 4WKWA 4HS1A 1TKDB 4TXVA 1M99A 2MBSA 4IELA 5AISA 1HNCA 4J2FA 1TDIA 2VCZA 1WIKA 3D22A 4IN0A 2IFQB 2YWIA 3ZMLA 3HCZA 4I8BA 4KSMA 2ZCTA 2H71A 2HT9A 5ID2A 4HOJA 1DE2A 2C8UA 1XFLA 2TIRA 6GSXA 4OFMA 2R5GA 3NIVA 2YP6A 4BL7A 1X9WB 3QR6A 4ZIJA 1SYRA 2H76A 2P5QA 2CV4A 4BWQA 4O7HA 4PUAA 2F3MA 5IQYA 1PD21 1I9DA 5D9XA 5GZZB 1F9MA 2FA4A 2F8AA 1T4ZA 1YEPA 1PX7A 4N0VA 1JZDA 1V57A 4KE3A 3TKSC 5ECKB 3TRQA 2GS3A 5B8AA 4IW9A 4HEA2 1USBA 2FY6A 1O85A 3VFIA 2I81A 1YEXA 3A2XA 3IE3A 2YN1A 3EWLA 1GUHA 2I9HA 1MTCA 4E8EA 4G10A 3IA1A 4PQIA 2PERA 1OKDA 2OBKA 3MWHA 3TKQA 2J23A 3TKSA 2QSIA 3QAGA 2CA8A 3KZQA 4AJ6A 2GQLA 3HJOA 1A2JA 3KM6A 1TU8A 2GT5A 1ILOA 5G31A 3C1RA 2GVPA 1Y25A 3MSZA 3F9UA 4I2TA 2M80A 1AQWA 1GTUA 4KX4A 2H19A 3A3TA 2B1KA 2HZEB 4V2LA 5F05A 4FYCA 1SKRB 5ECHB 2PN8A 2V6OA 2TRXA 2JACA 3O3TA 2AYTA 3R2QA 2X8GA 1Z5YE 1SK1A 4ZILA 3APOA 3CSIA 3D21A 4KNDA 1AXDA 5ECQB 4PNFA 1GUKA 5IO2A 3FHKA 4PQ1A 2IMEA 4JU5A 3US3A 1KTEA
chains in the Genus database with same CATH superfamily
3DJBA 4KF9A 2KLXA 16GSA 2IFQA 4K2DA 1AQXA 3TNHB 2PPTA 4HLQA 4EVMA 1Z9HA 4IP1A 5F07A 4OFNA 2P5RA 5HFIA 3RPPA 4NHWA 1ZP2A 3AY8A 4MH2A 2XHFA 2WRTA 5B6NA 5KOXA 1SK0A 4HU9A 2JADA 2AJQB 3K7AM 3QWLA 3QHWB 1Z6NA 2RUFA 2QKEA 1F37A 3UVHA 1HQOA 2H0GA 3TNIB 5C00A 3TW7A 1H75A 2B5EA 1M3JA 3CSHA 4HQZA 4K1FA 1DUGA 2I53A 1G6WA 4XHMA 3F4SA 2L5LA 3F4RA 2RIIA 3VLNA 2PUKC 1YF0A 4ZL9A 4YAVA 5GSTA 3LXTA 4D73B 2G77A 3VI7A 1K3YA 4XS1A 3IOSA 3UARA 1E6BA 2HFDA 2DD5B 2F9SA 2RM5A 2WMBB 4HSCX 3QZ5B 5DCHA 2DXCB 4KH7A 4K5SA 1W89A 3ZL5A 3HVVA 4YH2A 2F2CA 1ZL9A 1OKTA 2VIMA 3DTOA 3MY1B 2FLSA 2DJJA 1XWKA 3DWVA 3VWXA 4XCSA 4PTSA 2IIYA 2RUEA 5C04A 4ZB8A 4O5RA 4KDYA 5F06A 1E9HB 1XVWA 4WF5A 1DBYA 3A8LB 4POLA 1V2AA 3BHUB 4CFUB 5G5EA 3FRCA 2UZEB 1GUXB 2MBTA 2AHJB 4GRFA 1YKAA 2HI7A 1UNGD 4DSSB 1PGTA 1OC8A 4TW5A 2BS2A 3B57A 4OO5A 1KXUA 2YPMA 3L9SA 4XS4B 1Q4JA 4MIMA 2G0FA 2C3NA 2PJQA 1XCCA 2VM2A 4BVXB 1A23A 3DDPB 2HZEA 3GX0A 1MD4A 2A2RA 2R0GA 3ZFBA 4FYUA 3TKPA 3HVNA 1XXUA 2OKAA 5ENUA 4F6SB 2W96A 3LGCA 3QYHB 2DIZA 1QQ2A 1SJ6A 1WJKA 2H1GA 3I69A 2IMFA 5HR3A 4EORB 1F3AA 1AD6A 1EV4A 4WETA 2GSQA 3C73A 5IPHA 3RHBA 3E3EA 4ECIA 2HRKA 5GAND 2ZPHB 1AIUA 2BS3A 4OWYA 3GH6A 2PGTA 5A4VA 4G9HA 1AAZA 3ZVJA 1S3AA 1EZKA 4EUYA 4BCJB 2KHPA 1O8WA 4BCMD 2GDRA 3VYGB 1SU9A 5HBEB 5IM9A 1NM3A 1X9MB 2PBJA 1TI1A 1GRXA 2C80A 2A4VA 2QGSA 4MDCA 3EVIA 4JBBA 5DJLA 4EOMB 1M2DA 1ZCPA 5ECRB 4OB0B 4EONB 3IHQA 4GSNA 2FWHA 1URMA 4EIQA 2C4GB 3GIXA 4KB3A 3EJ1B 2GGTA 1TK8B 2B7KA 1OC9A 14GSA 4BVYB 3LORA 1EWXA 3IPZA 3GMFA 1FO5A 4ZL7A 3H93A 5DCGA 4TR1B 4NAXA 3UMAA 1K0BA 2O8VB 1MD3A 3PGTA 1ABAA 3TJKA 4J56E 1ZYQB 4CRLB 5ECMB 2GSTA 1SD9A 5F8BA 2WGRA 2QC7A 3G7JA 3LSZA 5IMVA 4BPYA 2H73A 2CVDA 1YKCA 2M72A 5J4UA 4LMWA 2H70A 3IR4A 4F6UB 2R2JA 1MDKA 2CX3A 1ST9A 4K7IA 3CTFA 4EOLB 4WBRD 5JWOB 1TK5B 4G19A 5DQWA 18GSA 1TD6A 2GSRA 1K0MA 3TJJA 3C7MA 3RGFB 1T7PB 4X1UA 2XBIA 4MZWA 3VWWA 7GSSA 4Q5RA 1Z7PA 2IL3A 3EC3A 4KDUA 3M1GA 4AKIA 1SJIA 2QA2A 1F3BA 4LLRA 2H75A 2WZ9A 1EGOA 1BAYA 2GZPA 1GUXA 2DJ1A 2P0GA 2VOCA 3G9BA 1W98B 5INYA 1T4YA 1M2AA 4DSSA 3A5WA 1OVNA 1KEBA 1LJRA 2ZCFB 2JU5A 3CSJA 3L4NA 2DC5A 4XS4A 1XVQA 4O5UA 3BLQB 2QGVA 3Q19A 1B48A 1Z6MA 3FEUA 4BVXA 1CQGA 2HE3A 4HZ2A 3F5XB 1EV9A 5H5SA 3P8WA 4CY8A 3QFBC 2H72A 1E2YA 1F6MC 1WP0A 2L4QA 5J9BA 4KA0A 2WXVB 5IDNB 3HVSA 2E2GA 4EOJB 4CHSA 2N5FA 3F8UA 2VLVA 2C3QA 4IS0A 3GTMS 1ENWA 3EMXA 1B4QA 2YWOA 4GXZA 1ERWA 4EDYA 1YQ1A 3IAM2 4ZB9A 2D2ZA 1F5QB 1BG5A 4TN8A 3X25B 11GSA 3GTUB 2TRCP 4L5LA 4GTUA 3WD6A 1GWCA 3TOUA 1VGLA 1XOBA 3W8SA 1A2LA 1JZOA 1RK4A 4N30A 5EFQB 2UZ8A 1PN9A 2OE1A 2O89A 4EOOB 2WCIA 4X4JA 2V2GA 1R26A 4OMVA 1XWCA 3E9JB 5CYIB 4AKGA 4BCNB 3A2WA 5LD0A 1OYJA 2UZBB 3D5JA 2X8CA 2HSYA 4XRAA 10GSA 2W9FA 1GP1A 5G1LA 4NXIA 1M2BA 4BVYA 5JCWA 4Z2UA 2DPPB 2R6KA 4ZXGA 4TR1A 3RBTA 4F03A 2DJ0A 4P3YB 3BOAA 2VL3A 3ED3A 4EKZA 1AISB 4ROEA 4OB2B 5G2ZA 4Z2RA 5IDPB 4RQXA 2MMNA 4ELJA 3DD3A 2E7PA 4JX6A 2OJLA 3WT1A 5AIVA 4K0GA 4K9ZA 1GY3B 5KN1A 2LSTA 2DJ3A 3GSTA 2M46A 1O8XA 1XW9A 4ROCA 3DXBA 3SBCA 5D73A 2X49A 2L59A 3FW2A 2FWFA 3KEBA 1GNWA 3X28B 2FWEA 4N0ZA 5CRDA 4HI7A 2HZFA 4AJ7A 4FH8A 5GSSA 1XW5A 1ZGNA 4G0IA 3EU3A 4MH3A 4WEYA 1JHBA 4BCQB 2B5XA 6GSWA 1PMTA 2FHEA 4F70B 4MABA 4RUVA 3LW9A 1TRUA 4IQ1A 5G30A 2WS2A 1OIUB 2LEGA 1OAZA 4Q5QA 1JSTB 3LG6A 4YOZA 1XOAA 3DKSA 3APSA 3IRAA 1FVKA 1GUMA 2B5YA 2ZPFB 4ML6A 2X4AA 2V32A 2PHGA 4PXOA 3GUSA 3EE2A 1P5EB 1OI9B 1ZYEA 3GURA 4O92A 1PRXA 3Q18A 4ZBAA 1HYUA 1R4WA 3ZIJA 2J9HA 2PVOC 2DLXA 4K6XA 2P31A 3IK9A 2JSZA 4MF5A 2H0HA 1UC7A 2PMIB 4EE0A 5ECNB 1MDIA 2LJAA 4MFDA 4RI6A 2L6CA 3GTUA 4HUAA 1BYEA 3EU4A 2WDUA 2GT6A 2KR6A 1ERUA 4MP4A 1ZYPA 3NDQA 4TTHA 2HLSA 5CRHA 3WT2A 4DSQA 4CW9A 3TOTA 2GQMA 3HJMA 3HY2A 3F4TA 2FNOA 5IMFA 1BEDA 4KDXA 2I1UA 3DL1A 3HZ4A 4V2NA 5J5NA 5CREA 2PU9C 2VO4A 3G7YA 2H30A 1TRVA 2H74A 5IOWA 1VRSD 2YCDA 3HJPA 4ECCA 2VCVA 3DVWA 1RQMA 1R5PA 2H1DA 2N5BA 5HQPA 4ULXA 2O7KA 3LYKA 3X26B 1O9KB 1W4VA 3GSSA 2CCHB 4KCEA 2H1BA 3KTLA 3I43A 4BCPB 2HYXA 4I6XA 4GQFA 3MIXA 2IMIA 3J7Yk 2B7JA 4MNNA 3UJ1A 3KJYA 1FG4A 4MZBA 4MA9A 2EUFA 2WJUA 4X0XA 1UNLD 3H4KA 1K0AA 5FWGA 1G0TA 3QYGB 3CQFA 3CYNA 3QCPA 2ZNMA 2H6YA 1JZWA 3DIEA 3UBLA 1OC9B 4ZL8A 4F6WB 2BTOT 2VCTA 2H6ZA 3KP8A 3N5OA 4PQHA 2X8HA 1G3NC 1QUWA 3QPMA 3TUEA 2RLIA 2UZLB 3RHCA 3UBKA 1FAAA 3GX8A 1OKVB 3MYDA 4NSTB 2AHEA 3IDVA 2YJ7A 2B1LA 2CZ2A 3UAPA 3FK8A 1NW2A 4BCGB 1NHOA 5G5FA 3FZAA 3DDQB 1PKWA 1S3DA 2FUG2 4IHUA 3M9KA 4IQAA 4NV2A 2X1NB 1WMJA 4EL1A 4YQMA 5H5QA 1GSQA 3HHVA 4NMUA 3F0IA 1OE7A 1EOHA 2LS5A 3TKRA 1TW9A 4CDOA 1AUCA 4WR5A 2MZCA 17GSA 1QXHA 2C0FA 2HRAA 4K2XA 2OACA 3LWAA 4EOKB 1B9YC 2ON7A 3CMIA 2PK9B 4TR3A 1SL1B 1R7HA 1T00A 2VL9A 2CAIA 2VAFA 1URCB 2L57A 2HXKA 1FINB 2R3XA 1H27B 4HNUA 1ON4A 1E7PA 2DMLA 3VK9A 1GSSA 1H4OA 2B3SA 3UVTA 1A0RP 3UIWA 3I9V2 2IMKA 4KCAA 4A5PA 5LNKe 1J9BA 3MAKA 2JZSA 3ZITA 2B6MA 1S3CA 4YKFA 1V40A 2WMAB 3TKSE 1M0UA 1O73A 4GSTA 3FYGA 3A8HB 1AC1A 1K0OA 3BG9A 1LBKA 3EIDB 2IWTA 1TK0B 19GSA 2W9ZA 1XZOA 3GKNA 3GKMA 4IJIA 4LMVA 1O9KA 2VCWA 3CXGA 3HYPA 1UN2A 5IMDA 5ICPB 1S3RA 4GLTA 4I2UA 3X20B 2KP1A 2ON5A 5ABRA 1SKWB 3P2AA 1JKWA 4LL4B 5HBJB 1TU7A 4EOQB 2VD1A 2X99A 4OB3B 1KBNA 1C9BA 3MI9B 5LQFB 3MIAB 3O0GD 3UEMA 2A2PA 2NDOA 5I5ZB 1UVZA 3EURA 5G1KA 3U6VA 3TRPA 3HBLA 4KW6A 2RM6A 5D93A 4IBPA 4ML1A 1YDKA 4JZQA 1PQNA 4KRCB 5JCUA 2MMZA 3ZFLA 1FHEA 5AIXA 4CFUD 4FQUA 2O87A 4FO5A 3MY5B 1A0FA 5CRGA 1ERVA 3RDWA 2LV3A 4WXTA 3M03A 2L5OA 5DAKB 2DXBB 2G2QA 2LUSA 1C72A 2WIPB 3BHVB 2YWMA 2W2HA 2LKUA 1GNEA 3BJ5A 1GLPA 4H86A 1HD2A 2H66A 2KP2A 5IPGA 1EP7A 3V1WA 4KRDB 4PURA 3FKFA 1VINA 3TJFA 4FYBA 4WF4A 5DQSA 2LRNA 5E59A 5HBHB 3BG3A 2UZDB 2YZUA 2WJ9A 2VLTA 5B6MA 4ZGEB 2K9FA 3M9JA 4YQVA 3IAS2 4PUFC 2DSAA 4HNVA 5JWRB 1N4MA 4F0BA 1X9SB 1DSBA 5KN0A 1GLQA 1V58A 2KMGA 1J08A 1T3BA 2D0QB 5A4UA 1Z3EA 1NSWA 4PNGA 4XIHA 5CAXA 3LJRA 4Z6YA 2DBCA 1UGPB 2DIYA 1FW1A 3GRXA 3KGKA 3POMA 3A2VA 2YANA 4BXXX 3SWLA 2EC4A 3KH9A 2DMMA 4IVFA 2ZPBB 1TRSA 4IMYB 3QYBA 4EF0A 4DSRA 3DRNA 4XTSA 4IGJA 1KNGA 1EGRA 5HR1A 4TVEA 1M7TA 3GFKA 3NOFA 1OIYB 3VPQA 3TJGA 2EIQA 1GSFA 1PFOA 1G7OA 2VUPA 4MFEA 4N10A 3X24B 4K7OA 5H5RA 4KSOA 3GL5A 3DEXA 4AI6A 1TXXA 5LMKB 4PX1A 1H26B 3PINA 1SKSB 1VF4A 3KXOA 3GA4A 2IW8B 5ACBA 4BBSM 4JE1A 3EMPA 3P90A 1OE8A 2OBIA 2K8VA 1VOLA 3EOCB 2NTOA 3WGEA 3A5IA 3IXRA 2CQ9A 4MJCA 4F82A 2CZ6B 2DJ2A 2LNTA 1TFBA 5AGYA 5CO3A 2DD4B 5J41A 1JLWA 2JL4A 2I4AA 3CRUA 3JCML 2LW4A 1N2AA 5KN3A 4G6LB 4Z7XA 1ZYNA 1K3OA 4HU7A 2GZYA 2OE0A 3QFAC 4ECBA 4NPBA 3J7Yb 1PN0A 5COHA 3TRXA 5FHIA 1AQVA 1N8JA 3HZJA 3TW6A 1XWAA 3ERFA 1GULA 4ZBBA 1XWBA 3ZZXA 4GSSA 3Q74A 2Z9SA 1GSUA 3U5RE 2C4JA 3L9UA 3TB2A 3A8GB 2LTKA 3QXEB 4GCIA 4EDZA 2AAWA 4LL1B 5DBQA 5L2WB 3A8OB 4PGTA 2C0GA 3CBUA 5J3RA 2E2MA 5IMCA 4ILFA 1SL2B 5DDLA 4K7NA 2HSMA 2K8SA 4I97A 1U87A 3LYPA 5DAKA 4OGRB 2IMDA 2IW6B 3KD0A 3ZTLA 3VKHA 1GL8A 4MJEA 2PWJA 1J0FA 4AKHA 4N11A 2K18A 4KUNA 4ID0A 2IN3A 4O32A 3TN8B 4MJAA 4POMA 2CX4A 3PO3S 2OADA 3Q6OA 1U6TA 5ECOB 3FY7A 2LJKA 3GNJA 2FGXA 5HR2A 1R5AA 2GTUA 5D96A 3H4CA 3D6IA 2CVKA 3ZREA 3KIJA 1GSEA 2BJXA 1XIYA 4NV5A 2LRCA 2CZ7B 3KMNA 4MMMA 2WULA 5BMUA 2WHBB 1WRYA 5GAPD 3IK7A 1VF1A 3HDCA 3I6AA 1JLVA 4LA1A 1Y6EA 4EOIB 2I3YA 5IOXA 3F6FA 4BCHB 2GZZA 4YOOA 4LOCA 1MDJA 2NVLA 4BBRM 3TGZA 5IO0A 2JGZB 2WFCA 4FIWA 4KAEA 1PSQA 1B4PA 1ERTA 1I5GA 4MF6A 1THOA 3WYWA 2CYZB 4BCND 1BJXA 1T1VA 1PL1A 2I40B 3PPUA 5F0GA 3WGXA 2DKHA 1XWGA 5IMZA 2CZ3A 4AF2A 5BRTA 4QQ7A 1TP9A 2L6DA 1EOGA 1M9BA 1NHYA 5A5KA 2LRTA 1GH2A 3WVEB 2A2SA 2JZRA 4EO3A 1ML6A 2YWNA 5DVBA 3FMWA 2GQKA 2DJKA 4TR4A 3HXSA 2CAQA 2BS4A 4BCOB 4L5OA 1UGSB 1UA5A 3EYTA 1HNBA 2C0DA 4EXJA 4F7JB 1FVJA 1K0DA 4G0KA 4L0WA 4WBJA 2N5AA 4OR5B 3CTGA 1YY7A 2R0PA 1EP8A 4I3ZB 4G0LA 3TCOA 3S9FA 3VYHB 1OGUB 2V41A 2QFZA 1SENA 5B8BA 3QAWA 2EIRA 3GKKA 4I5QA 1XBSA 1HNAA 1K0NA 2ES7A 4JR6A 1BU2A 4ZGJB 5ECSA 1M9AA 2CZ0B 3ZYWA 2VD0A 2VLUA 3DYRA 3HKRA 1UNHD 3FZ5A 5DALB 3N9JA 3VWUA 6GSYA 4BCQD 2MYGA 5ECPB 3C71A 4HQSA 3DGQA 1GH6B 2WB9A 1TTZA 3MNGA 2ZUPA 3HVXA 4XS6A 1Q98A 3IC4A 2IPAA 3RAZA 1PA3A 4ELLA 4TOPA 4MZCA 1SL0B 1JSUB 1D3UB 4HL4A 4JX4A 5D9WA 2VCXA 5D9TA 3LFLA 1UGQB 2VM1A 3WGDA 4ZGDB 3H1NA 2LJRA 1GSDA 4YC3B 2YV7A 2H1AA 1TOFA 3UOMA 3ZMKA 1XW6A 4ICYA 1Z7RA 1FB0A 1TJDA 2BKZB 4V1Ag 5A4WA 5KOWA 4G2EA 4CFNB 2REMA 5CNWA 2NBSA 2K6VA 1PKDB 1O81A 5EJCA 5ELGA 2OE3A 1IYHA 2WFYB 3W6GA 2C0EA 3HB9A 1BX9A 3ERGA 1V9WA 3FZ4A 1FB6A 22GSA 1EEJA 3F3RA 5CRWA 4RQRA 2LQOA 5HNBB 1OC3A 1VF3A 1DE1A 3GH9A 4QL9A 4HDEA 3TJBA 3PH9A 1QK8A 3QMXA 3KTBA 1V98A 1QGVA 2C3TA 3ERWA 20GSA 4BCMB 4AJ8A 3D0ZA 3HO8A 1SD8A 2NPBA 3G7IA 2XPDA 2V1MA 2FCHA 5HFKA 2XBQA 3L78A 3VWVA 5KN2A 2KUCA 2V6KA 1IYIA 4JX5A 1O6JA 3IBHA 1OKWB 2JZTA 1H1PB 5FGKB 3M3MA 4HNTA 2LQQA 4TRXA 5D9VA 5EL8A 4YAPA 3GL3A 1K0CA 6GSUA 3ZVJD 2QDJA 1LU4A 3M8NA 3BLRB 1A8LA 1QFNA 1IREB 1BQ7A 2XPEA 2V22B 3PR8A 5AN1A 1O7UA 4OO4A 5JWQB 2VL2C 2ZPGB 1TI3A 5CP1A 3H79A 1M3IA 1A24A 3FZ9A 2X64A 2FWGA 2IVXA 2GSSA 3DMLA 5DJMA 1X5CA 5IIZA 5CYYA 1WPIA 6GSSA 4BWSA 4AGSA 4CFVB 2CVBA 3GN3A 1X0RA 2F8FA 4YOSA 3W8JA 3NZNA 5HFGA 4KGIA 1WE0A 4IKHA 2VL2A 2ZPEB 3LQ5B 3ME7A 1PL2A 1CQHA 1X5DA 1GTIA 1F2EA 3WVDB 4FX3B 5DALA 4F2IA 4RI7A 4CXAB 5BNJB 1VF2A 2CT6A 3TNWB 2H6XA 1YJ6A 2PVQA 2A4HA 3TDGA 1G6YA 3F6DA 2HRNA 2IJYA 4EOSB 4UN0A 3E0UA 1AW9A 2MMOA 2YV9A 4X43A 4K0NA 4TKYA 3OR5A 4EC0A 3BG5A 3ZRDA 2HSHA 4WR4A 3P7XA 1XPVA 4ZBDA 3QZ9B 1PKZA 2PMTA 3K8NA 4MJBA 6GSVA 1YF1A 5CEIB 4TXOB 3ZIVA 3H8QA 4EC9B 13GSA 1WOUA 2R4VA 1X5EA 2FD3A 4BY7X 1B9XC 3HZ8A 4V1Ap 2R37A 2FA8A 2XC2A 3RPNA 1QLBA 4F0CA 3C8EA 4CFMB 5ECIB 4QL7A 4POBA 4NWYA 3FR3A 4TR0A 1H4LD 5D8IA 2PK2A 2C5VB 3BBYA 4CFWB 4GWRA 1ZMAA 4L8EA 3C1SA 3D4TA 3QAVA 1H1RB 3QOUA 1ZOFA 4J57E 2R0CA 2HNLA 4DEJA 2AV4A 2O85A 5EVOA 3KCMA 2CZ1B 4JEDA 3L0HA 2H01A 1MEKA 2BPMB 4GF0A 5ID2B 4F7LB 6GSTA 5HVYB 5HR0A 12GSA 3LEFA 4CY6A 1JZRA 1SK2A 4D73A 1ACVA 3ISOA 2MMAA 3GHAA 4ACSA 5EY6A 3KHIA 4DVCA 4HJMA 2EIOA 3KP9A 1UGRB 2E0QA 2QA1A 2G9XB 4BL7B 1G7EA 1U3IA 2H0IA 1OL2B 3UL3A 3ZLPA 2H8LA 3VPTA 2C5NB 4POKA 4NC6A 1XO2A 1QMVA 2L4CA 2JSYA 1RW1A 3F3QA 1FOVA 4OCFA 4EOPB 2KOKA 5B7CA 4CFXB 2YZHA 4IP6A 4NHZA 4MPGA 1WWJA 3F63A 1SJZA 8GSSA 1EEMA 3EINA 1GTAA 5E4WA 2C1YA 4JR4A 2F51A 4K8MA 5FT3A 3APQA 4HZ4A 1GTBA 3EPTA 2B9RA 5JCGA 4IJ3A 5EPFA 1YZXA 3VKGA 4XRDA 2GLRA 3QD9A 5L71A 1TRWA 2HRFA 1H1SB 4ISDA 4F9ZA 4Q5NA 4BA7A 4E8HA 4GQCA 4OB1B 4MPFA 4MK3A 4MF7A 4OCEA 3GKXA 5DQYA 3FR6A 3O76A 3IHGA 4HJ2A 1GSYA 2OA7A 3VI5A 3BCIA 1FVVB 2C6TB 4ECJA 3CRTA 2UUEB 5ELAA 1OL1B 4MCUA 4O5QA 1THXA 1JOWA 1A2MA 3GV1A 2LNSA 3DVXA 5IMAA 3LQ7A 2BMXA 2ALBA 5KEJA 4V2MA 2VCQA 3HD5A 1JFUA 2WPAB 4F7NB 3KMOA 1U88A 3LXZA 1B8XA 3KH7A 3VURA 4JRRA 1A8YA 3L9VA 5ECLB 3M0FA 2W99A 1V29B 3ME8A 3O6TA 1PX6A 4TXOA 1U3AA 3GYKA 3FR9A 3IV4A 4Q5FA 9GSSA 4YQUA 3D4MA 3BD2A 1T8EB 5J9CA 4F7SB 3HA9A 1AHJB 4L0UA 4OD7A 5LCZA 4II5B 2YOIA 3QDNA 3BCKA 4OFTA 3G33B 2YNXA 1K3LA 4EIPA 4ZB6A 2YJHA 2AUVA 5HQ0B 1ZZYA 4MLYA 2AB6A 3MDKA 1FKMA 1SYXA 4WKWA 1H1QB 4HS1A 4TXVA 1FOHA 1M99A 2MBSA 1TKDB 4IELA 4BY1X 5AISA 3R3EA 1HNCA 4J2FA 1TDIA 2VCZA 1WIKA 3D22A 1XG8A 2ZZDB 2IFQB 4IN0A 3QHRB 4USSA 2YWIA 3ZMLA 3HCZA 2QDYB 4I8BA 4KSMA 3QYEA 2ZCTA 2H71A 2HT9A 5ID2A 1QMZB 4BCFB 2DKIA 4HOJA 1DE2A 2C8UA 1XFLA 2TIRA 6GSXA 4OFMA 2R5GA 4Z2TA 3NIVA 2YP6A 4BL7A 1X9WB 3BLHB 3QR6A 3BHTB 4YKGA 4ZIJA 1SYRA 2H76A 2P5QA 2CV4A 4BWQA 4O7HA 4PUAA 3A8MB 2F3MA 5IQYA 1PD21 1I9DA 5D9XA 5GZZB 1F9MA 2FA4A 2F8AA 1T4ZA 1YEPA 1PX7A 4N0VA 1JZDA 2QF7A 2IW9B 1V57A 1VYWB 4KE3A 1H25B 4Y72B 3TKSC 5ECKB 3TRQA 2GS3A 2C5XB 5B8AA 4IW9A 1H28B 4HEA2 1USBA 2FY6A 1O85A 4EC8B 3VFIA 2I81A 5DQVA 1YEXA 3A2XA 3IE3A 2YN1A 4FM4B 2CJMB 3EWLA 1GUHA 2I9HA 1MTCA 3DOGB 2DMEA 4RODA 4E8EA 4BCKB 4G10A 3IA1A 4PQIA 4K5RA 2PERA 1OKDA 4QSHA 2OBKA 2R7GA 3MWHA 4BCIB 3TKQA 2J23A 3TKSA 2QSIA 3QAGA 2CA8A 3KZQA 4AJ6A 3HHTB 2GQLA 3HJOA 4BIKA 2CCIB 2QQ8A 1A2JA 3KM6A 1TU8A 2GT5A 1H24B 1ILOA 2ZPIB 5G31A 3C1RA 2GVPA 1Y25A 3MSZA 3F9UA 4I2TA 2M80A 1AQWA 1GTUA 4KX4A 2H19A 3A3TA 2B1KA 2WIHB 2HZEB 4V2LA 5F05A 4FYCA 1SKRB 5ECHB 2PN8A 2V6OA 2TRXA 2JACA 3O3TA 2AYTA 3R2QA 2C5OB 3IC8A 2X8GA 1Z5YE 2WEVB 5IF1B 1SK1A 4ZILA 3APOA 3CSIA 3D21A 4KNDA 1AXDA 4M6VA 5ECQB 4PNFA 1GUKA 5IO2A 3FHKA 4PQ1A 2IMEA 4JU5A 5IHYA 3US3A 1KTEA
chains in the Genus database with same CATH topology
4KF9A 2KLXA 16GSA 2IFQA 4K2DA 1AQXA 2PPTA 4EVMA 1Z9HA 4IP1A 5F07A 4OFNA 2P5RA 5HFIA 3RPPA 4NHWA 3AY8A 4MH2A 2XHFA 2WRTA 5B6NA 5KOXA 1SK0A 4HU9A 2JADA 2AJQB 1Z6NA 2RUFA 2QKEA 1F37A 3UVHA 1HQOA 2H0GA 5C00A 1H75A 2B5EA 3CSHA 4HQZA 4K1FA 1DUGA 1G6WA 4XHMA 3F4SA 2L5LA 3F4RA 2RIIA 3VLNA 2PUKC 1YF0A 4ZL9A 4YAVA 5GSTA 3LXTA 4D73B 3VI7A 1K3YA 4XS1A 3IOSA 3UARA 1E6BA 2HFDA 2RM5A 2F9SA 5DCHA 4KH7A 4K5SA 1W89A 3ZL5A 3HVVA 4YH2A 1ZL9A 1OKTA 2VIMA 2FLSA 2DJJA 1XWKA 3DWVA 3VWXA 4XCSA 4PTSA 2IIYA 2RUEA 5C04A 4ZB8A 4O5RA 4KDYA 5F06A 1XVWA 4WF5A 1DBYA 4POLA 1V2AA 5G5EA 3FRCA 2MBTA 4GRFA 1YKAA 2HI7A 4DSSB 1PGTA 1OC8A 4TW5A 4OO5A 2YPMA 3L9SA 4XS4B 1Q4JA 2G0FA 2C3NA 1XCCA 2VM2A 4BVXB 1A23A 2HZEA 3GX0A 1MD4A 2A2RA 2R0GA 3ZFBA 4FYUA 3TKPA 1XXUA 2OKAA 5ENUA 3LGCA 2DIZA 1QQ2A 1SJ6A 1WJKA 2H1GA 3I69A 2IMFA 5HR3A 1F3AA 1EV4A 4WETA 2GSQA 3C73A 5IPHA 3RHBA 3E3EA 4ECIA 2HRKA 5GAND 1AIUA 4OWYA 3GH6A 2PGTA 5A4VA 4G9HA 1AAZA 3ZVJA 1S3AA 1EZKA 4EUYA 2KHPA 1O8WA 2GDRA 1SU9A 5IM9A 1NM3A 1X9MB 2PBJA 1TI1A 1GRXA 2C80A 2A4VA 4MDCA 3EVIA 4JBBA 5DJLA 1M2DA 1ZCPA 5ECRB 3IHQA 4GSNA 2FWHA 1URMA 4EIQA 3GIXA 4KB3A 2GGTA 1TK8B 2B7KA 1OC9A 14GSA 4BVYB 3LORA 1EWXA 3IPZA 3GMFA 1FO5A 4ZL7A 3H93A 5DCGA 4TR1B 4NAXA 3UMAA 1K0BA 2O8VB 1MD3A 3PGTA 1ABAA 3TJKA 4J56E 1ZYQB 5ECMB 2GSTA 1SD9A 5F8BA 2WGRA 2QC7A 3G7JA 3LSZA 5IMVA 4BPYA 2H73A 2CVDA 1YKCA 2M72A 5J4UA 4LMWA 2H70A 3IR4A 2R2JA 1MDKA 2CX3A 1ST9A 4K7IA 3CTFA 4WBRD 5JWOB 1TK5B 4G19A 18GSA 2GSRA 1K0MA 3TJJA 3C7MA 1T7PB 4X1UA 2XBIA 4MZWA 3VWWA 7GSSA 4Q5RA 1Z7PA 2IL3A 3EC3A 4KDUA 3M1GA 1SJIA 2QA2A 1F3BA 4LLRA 2H75A 2WZ9A 1EGOA 1BAYA 2GZPA 2DJ1A 2P0GA 2VOCA 3G9BA 5INYA 1T4YA 1M2AA 4DSSA 3A5WA 1OVNA 1KEBA 1LJRA 2JU5A 3CSJA 3L4NA 2DC5A 4XS4A 1XVQA 4O5UA 2QGVA 3Q19A 1B48A 1Z6MA 3FEUA 4BVXA 1CQGA 2HE3A 4HZ2A 1EV9A 5H5SA 3P8WA 4CY8A 3QFBC 2H72A 1E2YA 1F6MC 1WP0A 2L4QA 5J9BA 4KA0A 3HVSA 2E2GA 4CHSA 2N5FA 3F8UA 2VLVA 2C3QA 4IS0A 3EMXA 1B4QA 2YWOA 4GXZA 1ERWA 4EDYA 1YQ1A 3IAM2 4ZB9A 2D2ZA 1BG5A 4TN8A 11GSA 3GTUB 2TRCP 4L5LA 4GTUA 3WD6A 1GWCA 3TOUA 1VGLA 1XOBA 3W8SA 1A2LA 1JZOA 1RK4A 4N30A 2UZ8A 1PN9A 2OE1A 2O89A 2WCIA 4X4JA 2V2GA 1R26A 4OMVA 1XWCA 3E9JB 3A2WA 5LD0A 1OYJA 2X8CA 3D5JA 2HSYA 4XRAA 10GSA 1GP1A 5G1LA 4NXIA 1M2BA 4BVYA 5JCWA 4Z2UA 2R6KA 4ZXGA 4TR1A 3RBTA 4F03A 2DJ0A 4P3YB 3BOAA 2VL3A 3ED3A 4EKZA 5G2ZA 4Z2RA 4RQXA 2MMNA 3DD3A 2E7PA 2OJLA 3WT1A 5AIVA 4K0GA 4K9ZA 5KN1A 2LSTA 2DJ3A 3GSTA 2M46A 1O8XA 1XW9A 3DXBA 3SBCA 5D73A 2X49A 2L59A 3FW2A 2FWFA 3KEBA 1GNWA 2FWEA 4N0ZA 5CRDA 4HI7A 2HZFA 4AJ7A 4FH8A 5GSSA 1XW5A 1ZGNA 4G0IA 3EU3A 4MH3A 4WEYA 1JHBA 2B5XA 6GSWA 1PMTA 2FHEA 4RUVA 4MABA 3LW9A 1TRUA 4IQ1A 5G30A 2WS2A 2LEGA 1OAZA 4Q5QA 3LG6A 1XOAA 3DKSA 3APSA 3IRAA 1FVKA 1GUMA 2B5YA 4ML6A 2X4AA 2V32A 4PXOA 3GUSA 3EE2A 1ZYEA 3GURA 4O92A 1PRXA 3Q18A 4ZBAA 1HYUA 1R4WA 3ZIJA 2J9HA 2PVOC 2DLXA 4K6XA 2P31A 3IK9A 2JSZA 4MF5A 2H0HA 1UC7A 4EE0A 5ECNB 1MDIA 2LJAA 4RI6A 2L6CA 3GTUA 4HUAA 1BYEA 3EU4A 2WDUA 2GT6A 1ERUA 4MP4A 1ZYPA 5CRHA 2HLSA 3WT2A 4DSQA 4CW9A 3TOTA 2GQMA 3HJMA 3HY2A 3F4TA 2FNOA 5IMFA 1BEDA 4KDXA 2I1UA 3HZ4A 4V2NA 5J5NA 5CREA 2PU9C 2VO4A 3G7YA 2H30A 1TRVA 2H74A 5IOWA 1VRSD 2YCDA 3HJPA 4ECCA 2VCVA 3DVWA 1RQMA 1R5PA 2H1DA 2N5BA 5HQPA 4ULXA 2O7KA 3LYKA 1W4VA 3GSSA 4KCEA 2H1BA 3KTLA 3I43A 2HYXA 4I6XA 4GQFA 3MIXA 2IMIA 3J7Yk 2B7JA 4MNNA 3UJ1A 3KJYA 1FG4A 4MZBA 4MA9A 2WJUA 4X0XA 3H4KA 1K0AA 5FWGA 1G0TA 3CYNA 3QCPA 2ZNMA 2H6YA 1JZWA 3DIEA 3UBLA 1OC9B 4ZL8A 2BTOT 2VCTA 2H6ZA 3KP8A 3N5OA 4PQHA 2X8HA 1QUWA 3QPMA 3TUEA 2RLIA 3RHCA 3UBKA 1FAAA 3GX8A 3MYDA 2AHEA 3IDVA 2YJ7A 2B1LA 2CZ2A 3UAPA 3FK8A 1NW2A 1NHOA 5G5FA 3FZAA 1PKWA 1S3DA 2FUG2 4IHUA 3M9KA 4IQAA 4NV2A 1WMJA 4EL1A 4YQMA 5H5QA 1GSQA 4NMUA 3HHVA 3F0IA 1OE7A 1EOHA 2LS5A 3TKRA 1TW9A 4CDOA 1AUCA 4WR5A 2MZCA 17GSA 1QXHA 2C0FA 2HRAA 4K2XA 2OACA 3LWAA 1B9YC 2ON7A 3CMIA 4TR3A 1SL1B 1R7HA 1T00A 2VL9A 2CAIA 2VAFA 2L57A 2HXKA 2R3XA 1ON4A 2DMLA 3VK9A 1GSSA 1H4OA 2B3SA 3UVTA 1A0RP 3UIWA 3I9V2 2IMKA 4KCAA 4A5PA 5LNKe 1J9BA 3MAKA 2JZSA 3ZITA 2B6MA 1S3CA 4YKFA 1V40A 3TKSE 1M0UA 1O73A 4GSTA 3FYGA 1AC1A 1K0OA 1LBKA 2IWTA 1TK0B 19GSA 1XZOA 3GKNA 3GKMA 4IJIA 4LMVA 2VCWA 3CXGA 3HYPA 1UN2A 5IMDA 4GLTA 4I2UA 2KP1A 2ON5A 5ABRA 1SKWB 3P2AA 4LL4B 1TU7A 2VD1A 2X99A 1KBNA 3UEMA 2A2PA 2NDOA 1UVZA 3EURA 5G1KA 3U6VA 3TRPA 4KW6A 2RM6A 5D93A 4IBPA 4ML1A 1YDKA 4JZQA 1PQNA 5JCUA 2MMZA 3ZFLA 1FHEA 5AIXA 4FQUA 2O87A 4FO5A 1A0FA 5CRGA 1ERVA 3RDWA 2LV3A 4WXTA 2L5OA 5DAKB 2G2QA 2LUSA 1C72A 2YWMA 2LKUA 1GNEA 3BJ5A 1GLPA 4H86A 1HD2A 2H66A 2KP2A 5IPGA 1EP7A 3V1WA 4PURA 3FKFA 3TJFA 4FYBA 4WF4A 5DQSA 2LRNA 5E59A 2YZUA 2VLTA 5B6MA 2K9FA 3M9JA 4YQVA 3IAS2 4PUFC 2DSAA 5JWRB 4F0BA 1X9SB 1DSBA 5KN0A 1GLQA 1V58A 1J08A 1T3BA 5A4UA 1Z3EA 1NSWA 4PNGA 4XIHA 5CAXA 3LJRA 2DBCA 2DIYA 1FW1A 3GRXA 3KGKA 3A2VA 2YANA 3SWLA 2EC4A 3KH9A 2DMMA 4IVFA 1TRSA 4EF0A 4DSRA 3DRNA 4XTSA 4IGJA 1KNGA 1EGRA 5HR1A 4TVEA 1M7TA 3GFKA 3NOFA 3VPQA 3TJGA 2EIQA 1GSFA 1G7OA 2VUPA 4N10A 4K7OA 5H5RA 4KSOA 3GL5A 3DEXA 1TXXA 4PX1A 3PINA 1SKSB 1VF4A 3KXOA 3GA4A 4JE1A 3EMPA 3P90A 1OE8A 2OBIA 2K8VA 2NTOA 3WGEA 3A5IA 3IXRA 2CQ9A 4MJCA 4F82A 2DJ2A 2LNTA 5AGYA 5CO3A 5J41A 1JLWA 2JL4A 2I4AA 3CRUA 3JCML 1N2AA 5KN3A 4Z7XA 1ZYNA 1K3OA 4HU7A 2GZYA 2OE0A 3QFAC 4ECBA 4NPBA 3J7Yb 1PN0A 5COHA 3TRXA 5FHIA 1AQVA 1N8JA 1XWAA 3ERFA 1GULA 4ZBBA 1XWBA 3ZZXA 4GSSA 3Q74A 2Z9SA 1GSUA 3U5RE 2C4JA 3L9UA 3TB2A 2LTKA 4GCIA 4EDZA 2AAWA 4LL1B 5DBQA 4PGTA 2C0GA 3CBUA 5J3RA 2E2MA 5IMCA 4ILFA 1SL2B 5DDLA 4K7NA 2HSMA 2K8SA 4I97A 1U87A 3LYPA 5DAKA 2IMDA 3KD0A 3ZTLA 1GL8A 4MJEA 2PWJA 1J0FA 4N11A 2K18A 4KUNA 4ID0A 2IN3A 4O32A 4MJAA 4POMA 2CX4A 2OADA 3Q6OA 1U6TA 5ECOB 3FY7A 2LJKA 3GNJA 2FGXA 5HR2A 1R5AA 2GTUA 5D96A 3D6IA 2CVKA 3ZREA 3KIJA 1GSEA 2BJXA 1XIYA 4NV5A 2LRCA 3KMNA 4MMMA 2WULA 5BMUA 1WRYA 5GAPD 3IK7A 1VF1A 3HDCA 3I6AA 1JLVA 4LA1A 1Y6EA 2I3YA 5IOXA 3F6FA 2GZZA 1MDJA 2NVLA 3TGZA 5IO0A 2WFCA 4FIWA 4KAEA 1PSQA 1B4PA 1ERTA 1I5GA 4MF6A 1THOA 3WYWA 1BJXA 1T1VA 1PL1A 3PPUA 5F0GA 3WGXA 2DKHA 1XWGA 5IMZA 2CZ3A 4AF2A 5BRTA 4QQ7A 1TP9A 2L6DA 1EOGA 1M9BA 1NHYA 5A5KA 2LRTA 1GH2A 2A2SA 2JZRA 4EO3A 1ML6A 2YWNA 5DVBA 3FMWA 2GQKA 2DJKA 4TR4A 3HXSA 2CAQA 4L5OA 1UA5A 3EYTA 1HNBA 2C0DA 4EXJA 1FVJA 1K0DA 4G0KA 4L0WA 4WBJA 2N5AA 3CTGA 1YY7A 2R0PA 1EP8A 4G0LA 3TCOA 3S9FA 2V41A 1SENA 5B8BA 3QAWA 2EIRA 3GKKA 4I5QA 1XBSA 1HNAA 1K0NA 2ES7A 4JR6A 5ECSA 1M9AA 3ZYWA 2VD0A 2VLUA 3DYRA 3HKRA 3FZ5A 5DALB 3N9JA 3VWUA 6GSYA 2MYGA 5ECPB 3C71A 4HQSA 3DGQA 2WB9A 1TTZA 3MNGA 2ZUPA 3HVXA 4XS6A 1Q98A 3IC4A 2IPAA 3RAZA 1PA3A 4TOPA 4MZCA 1SL0B 5D9WA 2VCXA 5D9TA 3LFLA 2VM1A 3WGDA 3H1NA 2LJRA 1GSDA 2YV7A 2H1AA 1TOFA 3UOMA 3ZMKA 1XW6A 4ICYA 1Z7RA 1FB0A 1TJDA 4V1Ag 5A4WA 5KOWA 4G2EA 2REMA 5CNWA 2NBSA 2K6VA 1O81A 5ELGA 2OE3A 1IYHA 3W6GA 2C0EA 1BX9A 3ERGA 1V9WA 3FZ4A 1FB6A 22GSA 1EEJA 3F3RA 5CRWA 4RQRA 2LQOA 1OC3A 1VF3A 1DE1A 3GH9A 4QL9A 4HDEA 3TJBA 3PH9A 1QK8A 3QMXA 3KTBA 1V98A 1QGVA 2C3TA 3ERWA 20GSA 4AJ8A 3D0ZA 1SD8A 2NPBA 3G7IA 2XPDA 2V1MA 2FCHA 5HFKA 2XBQA 3L78A 3VWVA 5KN2A 2KUCA 2V6KA 1IYIA 1O6JA 3IBHA 2JZTA 3M3MA 4TRXA 2LQQA 5D9VA 5EL8A 4YAPA 3GL3A 1K0CA 6GSUA 3ZVJD 1LU4A 3M8NA 1A8LA 1QFNA 1BQ7A 2XPEA 3PR8A 5AN1A 1O7UA 4OO4A 5JWQB 2VL2C 1TI3A 5CP1A 3H79A 1A24A 3FZ9A 2X64A 2FWGA 2GSSA 3DMLA 5DJMA 1X5CA 5IIZA 5CYYA 1WPIA 6GSSA 4BWSA 4AGSA 2CVBA 3GN3A 1X0RA 2F8FA 3W8JA 3NZNA 5HFGA 4KGIA 1WE0A 4IKHA 2VL2A 3ME7A 1PL2A 1CQHA 1X5DA 1GTIA 1F2EA 5DALA 4F2IA 4RI7A 1VF2A 2CT6A 2H6XA 1YJ6A 2PVQA 2A4HA 3TDGA 1G6YA 3F6DA 2HRNA 2IJYA 3E0UA 1AW9A 2MMOA 2YV9A 4X43A 4K0NA 4TKYA 3OR5A 4EC0A 3ZRDA 2HSHA 4WR4A 3P7XA 1XPVA 4ZBDA 1PKZA 2PMTA 3K8NA 4MJBA 6GSVA 1YF1A 4TXOB 3ZIVA 3H8QA 13GSA 1WOUA 2R4VA 1X5EA 2FD3A 1B9XC 3HZ8A 4V1Ap 2R37A 2FA8A 2XC2A 3RPNA 4F0CA 3C8EA 5ECIB 4QL7A 4POBA 4NWYA 3FR3A 4TR0A 5D8IA 3BBYA 4GWRA 1ZMAA 4L8EA 3C1SA 3D4TA 3QAVA 3QOUA 1ZOFA 4J57E 2R0CA 2HNLA 4DEJA 2AV4A 2O85A 5EVOA 3KCMA 4JEDA 3L0HA 2H01A 1MEKA 5ID2B 4GF0A 6GSTA 5HR0A 12GSA 3LEFA 4CY6A 1JZRA 1SK2A 4D73A 1ACVA 3ISOA 2MMAA 3GHAA 4ACSA 5EY6A 4DVCA 4HJMA 2EIOA 3KP9A 2E0QA 2QA1A 4BL7B 1G7EA 1U3IA 2H0IA 3UL3A 3ZLPA 2H8LA 3VPTA 4POKA 1QMVA 2L4CA 2JSYA 1RW1A 3F3QA 1FOVA 4OCFA 2KOKA 5B7CA 2YZHA 4IP6A 4NHZA 4MPGA 1WWJA 3F63A 1SJZA 8GSSA 1EEMA 3EINA 1GTAA 5E4WA 2C1YA 4JR4A 2F51A 4K8MA 5FT3A 3APQA 4HZ4A 1GTBA 3EPTA 5JCGA 4IJ3A 5EPFA 1YZXA 4XRDA 2GLRA 3QD9A 5L71A 1TRWA 2HRFA 4ISDA 4F9ZA 4Q5NA 4BA7A 4E8HA 4GQCA 4MPFA 4MK3A 4MF7A 4OCEA 3GKXA 5DQYA 3FR6A 3O76A 3IHGA 4HJ2A 1GSYA 2OA7A 3VI5A 3BCIA 4ECJA 3CRTA 5ELAA 4MCUA 4O5QA 1THXA 1A2MA 3GV1A 2LNSA 3DVXA 5IMAA 3LQ7A 2BMXA 2ALBA 5KEJA 4V2MA 2VCQA 3HD5A 1JFUA 3KMOA 1U88A 3LXZA 1B8XA 3KH7A 3VURA 4JRRA 1A8YA 3L9VA 5ECLB 3M0FA 3ME8A 3O6TA 1PX6A 4TXOA 1U3AA 3GYKA 3FR9A 3IV4A 4Q5FA 9GSSA 4YQUA 3D4MA 3BD2A 1T8EB 5J9CA 3HA9A 4L0UA 4OD7A 5LCZA 2YOIA 3QDNA 3BCKA 4OFTA 2YNXA 1K3LA 4EIPA 4ZB6A 2YJHA 2AUVA 4MLYA 1ZZYA 2AB6A 3MDKA 1SYXA 4WKWA 4HS1A 1TKDB 4TXVA 1FOHA 1M99A 2MBSA 4IELA 5AISA 3R3EA 1HNCA 4J2FA 1TDIA 2VCZA 1WIKA 3D22A 4IN0A 2IFQB 4USSA 2YWIA 3ZMLA 3HCZA 4I8BA 4KSMA 2ZCTA 2H71A 2HT9A 5ID2A 2DKIA 4HOJA 1DE2A 2C8UA 1XFLA 2TIRA 6GSXA 4OFMA 2R5GA 4Z2TA 3NIVA 2YP6A 4BL7A 1X9WB 3QR6A 4YKGA 4ZIJA 1SYRA 2H76A 2P5QA 2CV4A 4BWQA 4O7HA 4PUAA 2F3MA 5IQYA 1PD21 1I9DA 5D9XA 5GZZB 1F9MA 2FA4A 2F8AA 1T4ZA 1YEPA 1PX7A 4N0VA 1JZDA 1V57A 4KE3A 3TKSC 5ECKB 3TRQA 2GS3A 5B8AA 4IW9A 4HEA2 1USBA 2FY6A 1O85A 3VFIA 2I81A 1YEXA 3A2XA 3IE3A 2YN1A 3EWLA 1GUHA 2I9HA 1MTCA 4E8EA 4G10A 3IA1A 4PQIA 4K5RA 2PERA 1OKDA 2OBKA 3MWHA 3TKQA 2J23A 3TKSA 2QSIA 3QAGA 2CA8A 3KZQA 4AJ6A 2GQLA 3HJOA 1A2JA 3KM6A 1TU8A 2GT5A 1ILOA 5G31A 3C1RA 2GVPA 1Y25A 3MSZA 3F9UA 4I2TA 2M80A 1AQWA 1GTUA 4KX4A 2H19A 3A3TA 2B1KA 2HZEB 4V2LA 5F05A 4FYCA 1SKRB 5ECHB 2PN8A 2V6OA 2TRXA 2JACA 3O3TA 2AYTA 3R2QA 3IC8A 2X8GA 1Z5YE 1SK1A 4ZILA 3APOA 3CSIA 3D21A 4KNDA 1AXDA 5ECQB 4PNFA 1GUKA 5IO2A 3FHKA 4PQ1A 2IMEA 4JU5A 3US3A 1KTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLX A;  16GS A;  2IFQ A;  4K2D A;  1AQX A;  2PPT A;  4EVM A;  1Z9H A;  4IP1 A;  5F07 A;  4OFN A;  2P5R A;  5HFI A;  3RPP A;  4NHW A;  3AY8 A;  4MH2 A;  2XHF A;  2WRT A;  5B6N A;  1SK0 A;  4HU9 A;  2JAD A;  2AJQ B;  1Z6N A;  2RUF A;  2QKE A;  1F37 A;  3UVH A;  1HQO A;  2H0G A;  5C00 A;  1H75 A;  2B5E A;  3CSH A;  4HQZ A;  4K1F A;  1DUG A;  1G6W A;  4XHM A;  3F4S A;  2L5L A;  3F4R A;  2RII A;  3VLN A;  2PUK C;  1YF0 A;  4ZL9 A;  4YAV A;  5GST A;  3LXT A;  4D73 B;  3VI7 A;  1K3Y A;  4XS1 A;  3IOS A;  3UAR A;  1E6B A;  2HFD A;  2RM5 A;  2F9S A;  5DCH A;  4KH7 A;  1W89 A;  3ZL5 A;  3HVV A;  4YH2 A;  1ZL9 A;  1OKT A;  2VIM A;  2FLS A;  2DJJ A;  1XWK A;  3DWV A;  3VWX A;  4XCS A;  2IIY A;  2RUE A;  5C04 A;  4ZB8 A;  4O5R A;  4KDY A;  5F06 A;  1XVW A;  4WF5 A;  1DBY A;  4POL A;  1V2A A;  5G5E A;  3FRC A;  2MBT A;  4GRF A;  1YKA A;  2HI7 A;  4DSS B;  1PGT A;  1OC8 A;  4TW5 A;  4OO5 A;  2YPM A;  3L9S A;  4XS4 B;  1Q4J A;  2G0F A;  2C3N A;  1XCC A;  2VM2 A;  1A23 A;  2HZE A;  3GX0 A;  1MD4 A;  2A2R A;  3ZFB A;  4FYU A;  3TKP A;  1XXU A;  2OKA A;  5ENU A;  3LGC A;  2DIZ A;  1QQ2 A;  1SJ6 A;  1WJK A;  2H1G A;  3I69 A;  2IMF A;  5HR3 A;  1F3A A;  1EV4 A;  4WET A;  2GSQ A;  3C73 A;  5IPH A;  3RHB A;  3E3E A;  4ECI A;  5GAN D;  1AIU A;  4OWY A;  3GH6 A;  2PGT A;  5A4V A;  4G9H A;  1AAZ A;  3ZVJ A;  1S3A A;  1EZK A;  4EUY A;  2KHP A;  1O8W A;  2GDR A;  1SU9 A;  5IM9 A;  1NM3 A;  1X9M B;  2PBJ A;  1TI1 A;  1GRX A;  2C80 A;  2A4V A;  4MDC A;  3EVI A;  4JBB A;  5DJL A;  1M2D A;  1ZCP A;  5ECR B;  3IHQ A;  4GSN A;  2FWH A;  1URM A;  3GIX A;  4KB3 A;  2GGT A;  1TK8 B;  2B7K A;  1OC9 A;  14GS A;  3LOR A;  1EWX A;  3IPZ A;  3GMF A;  1FO5 A;  4ZL7 A;  3H93 A;  5DCG A;  4TR1 B;  4NAX A;  3UMA A;  1K0B A;  2O8V B;  1MD3 A;  3PGT A;  1ABA A;  3TJK A;  4J56 E;  1ZYQ B;  5ECM B;  2GST A;  1SD9 A;  5F8B A;  2WGR A;  2QC7 A;  3G7J A;  3LSZ A;  5IMV A;  4BPY A;  2H73 A;  2CVD A;  1YKC A;  2M72 A;  5J4U A;  4LMW A;  2H70 A;  3IR4 A;  2R2J A;  1MDK A;  2CX3 A;  1ST9 A;  4K7I A;  3CTF A;  4WBR D;  5JWO B;  1TK5 B;  4G19 A;  18GS A;  2GSR A;  1K0M A;  3TJJ A;  3C7M A;  1T7P B;  4X1U A;  2XBI A;  4MZW A;  3VWW A;  7GSS A;  4Q5R A;  1Z7P A;  2IL3 A;  3EC3 A;  4KDU A;  3M1G A;  1SJI A;  1F3B A;  4LLR A;  2H75 A;  2WZ9 A;  1EGO A;  1BAY A;  2GZP A;  2DJ1 A;  2P0G A;  2VOC A;  3G9B A;  5INY A;  1T4Y A;  1M2A A;  4DSS A;  3A5W A;  1OVN A;  1KEB A;  1LJR A;  2JU5 A;  3CSJ A;  3L4N A;  2DC5 A;  4XS4 A;  1XVQ A;  2QGV A;  3Q19 A;  1B48 A;  1Z6M A;  3FEU A;  4BVX A;  1CQG A;  2HE3 A;  4HZ2 A;  1EV9 A;  5H5S A;  3P8W A;  3QFB C;  2H72 A;  1E2Y A;  1F6M C;  1WP0 A;  2L4Q A;  5J9B A;  4KA0 A;  3HVS A;  2E2G A;  4CHS A;  2N5F A;  3F8U A;  2VLV A;  2C3Q A;  4IS0 A;  3EMX A;  1B4Q A;  2YWO A;  4GXZ A;  1ERW A;  4EDY A;  1YQ1 A;  3IAM 2;  4ZB9 A;  2D2Z A;  1BG5 A;  4TN8 A;  11GS A;  3GTU B;  2TRC P;  4L5L A;  4GTU A;  3WD6 A;  1GWC A;  3TOU A;  1VGL A;  1XOB A;  3W8S A;  1A2L A;  1JZO A;  1RK4 A;  4N30 A;  1PN9 A;  2OE1 A;  2O89 A;  2WCI A;  2V2G A;  1R26 A;  4OMV A;  1XWC A;  3E9J B;  3A2W A;  5LD0 A;  1OYJ A;  2X8C A;  3D5J A;  2HSY A;  4XRA A;  10GS A;  1GP1 A;  5G1L A;  4NXI A;  1M2B A;  4BVY A;  5JCW A;  2R6K A;  4ZXG A;  4TR1 A;  3RBT A;  4F03 A;  2DJ0 A;  4P3Y B;  3BOA A;  2VL3 A;  3ED3 A;  4EKZ A;  5G2Z A;  4RQX A;  2MMN A;  3DD3 A;  2E7P A;  2OJL A;  3WT1 A;  5AIV A;  4K0G A;  4K9Z A;  5KN1 A;  2LST A;  2DJ3 A;  3GST A;  2M46 A;  1O8X A;  1XW9 A;  3DXB A;  3SBC A;  5D73 A;  2L59 A;  3FW2 A;  2FWF A;  3KEB A;  1GNW A;  2FWE A;  4N0Z A;  5CRD A;  4HI7 A;  2HZF A;  4AJ7 A;  4FH8 A;  5GSS A;  1XW5 A;  1ZGN A;  3EU3 A;  4MH3 A;  4WEY A;  1JHB A;  2B5X A;  6GSW A;  1PMT A;  2FHE A;  4RUV A;  4MAB A;  1TRU A;  4IQ1 A;  5G30 A;  2WS2 A;  2LEG A;  1OAZ A;  4Q5Q A;  3LG6 A;  1XOA A;  3DKS A;  3APS A;  3IRA A;  1FVK A;  1GUM A;  2B5Y A;  4ML6 A;  2V32 A;  4PXO A;  3GUS A;  3EE2 A;  1ZYE A;  3GUR A;  4O92 A;  1PRX A;  3Q18 A;  4ZBA A;  1HYU A;  1R4W A;  3ZIJ A;  2J9H A;  2PVO C;  2DLX A;  4K6X A;  2P31 A;  3IK9 A;  2JSZ A;  4MF5 A;  2H0H A;  1UC7 A;  4EE0 A;  5ECN B;  1MDI A;  2LJA A;  4RI6 A;  2L6C A;  3GTU A;  4HUA A;  1BYE A;  3EU4 A;  2WDU A;  2GT6 A;  1ERU A;  4MP4 A;  5CRH A;  2HLS A;  3WT2 A;  4DSQ A;  4CW9 A;  3TOT A;  2GQM A;  3HJM A;  3HY2 A;  3F4T A;  2FNO A;  5IMF A;  1BED A;  4KDX A;  2I1U A;  3HZ4 A;  4V2N A;  5J5N A;  5CRE A;  2PU9 C;  2VO4 A;  3G7Y A;  2H30 A;  1TRV A;  2H74 A;  5IOW A;  1VRS D;  2YCD A;  3HJP A;  4ECC A;  2VCV A;  3DVW A;  1RQM A;  1R5P A;  2H1D A;  2N5B A;  5HQP A;  4ULX A;  2O7K A;  3LYK A;  1W4V A;  3GSS A;  4KCE A;  2H1B A;  3KTL A;  3I43 A;  2HYX A;  4I6X A;  4GQF A;  2IMI A;  3J7Y k;  2B7J A;  3UJ1 A;  3KJY A;  1FG4 A;  4MZB A;  4MA9 A;  2WJU A;  4X0X A;  3H4K A;  1K0A A;  5FWG A;  1G0T A;  3CYN A;  3QCP A;  2ZNM A;  2H6Y A;  1JZW A;  3DIE A;  3UBL A;  1OC9 B;  4ZL8 A;  2BTO T;  2VCT A;  2H6Z A;  3KP8 A;  3N5O A;  4PQH A;  2X8H A;  1QUW A;  3QPM A;  3TUE A;  2RLI A;  3RHC A;  3UBK A;  1FAA A;  3GX8 A;  2AHE A;  3IDV A;  2YJ7 A;  2B1L A;  2CZ2 A;  3UAP A;  3FK8 A;  1NW2 A;  1NHO A;  5G5F A;  3FZA A;  1PKW A;  1S3D A;  2FUG 2;  4IHU A;  3M9K A;  4IQA A;  4NV2 A;  1WMJ A;  4EL1 A;  4YQM A;  5H5Q A;  1GSQ A;  3HHV A;  4NMU A;  3F0I A;  1OE7 A;  1EOH A;  2LS5 A;  3TKR A;  1TW9 A;  4CDO A;  1AUC A;  4WR5 A;  2MZC A;  17GS A;  1QXH A;  2C0F A;  2OAC A;  3LWA A;  1B9Y C;  2ON7 A;  3CMI A;  4TR3 A;  1SL1 B;  1R7H A;  1T00 A;  2VL9 A;  2CAI A;  2VAF A;  2L57 A;  2HXK A;  2R3X A;  1ON4 A;  2DML A;  3VK9 A;  1GSS A;  1H4O A;  2B3S A;  3UVT A;  1A0R P;  3UIW A;  3I9V 2;  2IMK A;  4KCA A;  5LNK e;  1J9B A;  3MAK A;  2JZS A;  3ZIT A;  2B6M A;  1S3C A;  1V40 A;  3TKS E;  1M0U A;  1O73 A;  4GST A;  3FYG A;  1AC1 A;  1K0O A;  1LBK A;  2IWT A;  1TK0 B;  19GS A;  1XZO A;  3GKN A;  3GKM A;  4IJI A;  4LMV A;  2VCW A;  3CXG A;  3HYP A;  1UN2 A;  5IMD A;  4GLT A;  4I2U A;  2KP1 A;  2ON5 A;  5ABR A;  1SKW B;  3P2A A;  4LL4 B;  1TU7 A;  2VD1 A;  2X99 A;  1KBN A;  3UEM A;  2NDO A;  1UVZ A;  3EUR A;  5G1K A;  3U6V A;  3TRP A;  4KW6 A;  2RM6 A;  5D93 A;  4IBP A;  4ML1 A;  1YDK A;  4JZQ A;  1PQN A;  5JCU A;  2MMZ A;  3ZFL A;  1FHE A;  5AIX A;  2O87 A;  4FO5 A;  1A0F A;  5CRG A;  1ERV A;  3RDW A;  2LV3 A;  4WXT A;  2L5O A;  5DAK B;  2G2Q A;  2LUS A;  1C72 A;  2YWM A;  2LKU A;  1GNE A;  3BJ5 A;  1GLP A;  4H86 A;  1HD2 A;  2H66 A;  2KP2 A;  5IPG A;  1EP7 A;  3V1W A;  4PUR A;  3FKF A;  3TJF A;  4FYB A;  4WF4 A;  5DQS A;  2LRN A;  5E59 A;  2YZU A;  2VLT A;  5B6M A;  2K9F A;  3M9J A;  4YQV A;  3IAS 2;  4PUF C;  2DSA A;  5JWR B;  4F0B A;  1X9S B;  1DSB A;  5KN0 A;  1GLQ A;  1V58 A;  1J08 A;  1T3B A;  5A4U A;  1Z3E A;  1NSW A;  4PNG A;  4XIH A;  5CAX A;  3LJR A;  2DBC A;  2DIY A;  1FW1 A;  3GRX A;  3KGK A;  3A2V A;  2YAN A;  3SWL A;  2EC4 A;  3KH9 A;  2DMM A;  4IVF A;  1TRS A;  4EF0 A;  4DSR A;  3DRN A;  4XTS A;  4IGJ A;  1KNG A;  1EGR A;  5HR1 A;  4TVE A;  1M7T A;  3GFK A;  3NOF A;  3VPQ A;  3TJG A;  2EIQ A;  1GSF A;  1G7O A;  2VUP A;  4N10 A;  4K7O A;  5H5R A;  4KSO A;  3GL5 A;  3DEX A;  1TXX A;  4PX1 A;  3PIN A;  1SKS B;  1VF4 A;  3KXO A;  3GA4 A;  4JE1 A;  3EMP A;  3P90 A;  1OE8 A;  2OBI A;  2K8V A;  2NTO A;  3WGE A;  3IXR A;  2CQ9 A;  4MJC A;  4F82 A;  2DJ2 A;  2LNT A;  5AGY A;  5CO3 A;  5J41 A;  1JLW A;  2JL4 A;  2I4A A;  3CRU A;  3JCM L;  1N2A A;  5KN3 A;  4Z7X A;  1K3O A;  4HU7 A;  2GZY A;  2OE0 A;  3QFA C;  4ECB A;  4NPB A;  3J7Y b;  5COH A;  3TRX A;  5FHI A;  1AQV A;  1N8J A;  1XWA A;  3ERF A;  1GUL A;  4ZBB A;  1XWB A;  3ZZX A;  4GSS A;  3Q74 A;  2Z9S A;  1GSU A;  3U5R E;  2C4J A;  3L9U A;  3TB2 A;  2LTK A;  4GCI A;  4EDZ A;  2AAW A;  4LL1 B;  5DBQ A;  4PGT A;  2C0G A;  3CBU A;  5J3R A;  2E2M A;  5IMC A;  4ILF A;  1SL2 B;  5DDL A;  4K7N A;  2K8S A;  4I97 A;  1U87 A;  3LYP A;  5DAK A;  2IMD A;  3KD0 A;  3ZTL A;  1GL8 A;  4MJE A;  2PWJ A;  1J0F A;  4N11 A;  2K18 A;  4KUN A;  4ID0 A;  2IN3 A;  4O32 A;  4MJA A;  4POM A;  2CX4 A;  2OAD A;  3Q6O A;  1U6T A;  5ECO B;  3FY7 A;  2LJK A;  3GNJ A;  2FGX A;  5HR2 A;  1R5A A;  2GTU A;  5D96 A;  3D6I A;  2CVK A;  3ZRE A;  3KIJ A;  1GSE A;  2BJX A;  1XIY A;  4NV5 A;  2LRC A;  3KMN A;  4MMM A;  2WUL A;  1WRY A;  5GAP D;  3IK7 A;  1VF1 A;  3HDC A;  3I6A A;  1JLV A;  4LA1 A;  1Y6E A;  2I3Y A;  5IOX A;  3F6F A;  2GZZ A;  1MDJ A;  2NVL A;  3TGZ A;  5IO0 A;  2WFC A;  4FIW A;  4KAE A;  1PSQ A;  1B4P A;  1ERT A;  1I5G A;  4MF6 A;  1THO A;  3WYW A;  1BJX A;  1T1V A;  1PL1 A;  5F0G A;  3WGX A;  1XWG A;  5IMZ A;  2CZ3 A;  4AF2 A;  4QQ7 A;  1TP9 A;  2L6D A;  1EOG A;  1M9B A;  1NHY A;  5A5K A;  2LRT A;  1GH2 A;  2A2S A;  2JZR A;  4EO3 A;  1ML6 A;  2YWN A;  5DVB A;  2GQK A;  2DJK A;  4TR4 A;  3HXS A;  2CAQ A;  4L5O A;  1UA5 A;  3EYT A;  1HNB A;  2C0D A;  4EXJ A;  1FVJ A;  1K0D A;  4L0W A;  4WBJ A;  2N5A A;  3CTG A;  1YY7 A;  1EP8 A;  3TCO A;  3S9F A;  2V41 A;  1SEN A;  5B8B A;  3QAW A;  2EIR A;  3GKK A;  4I5Q A;  1XBS A;  1HNA A;  1K0N A;  2ES7 A;  4JR6 A;  5ECS A;  1M9A A;  3ZYW A;  2VD0 A;  2VLU A;  3DYR A;  3HKR A;  3FZ5 A;  5DAL B;  3N9J A;  3VWU A;  6GSY A;  2MYG A;  5ECP B;  3C71 A;  4HQS A;  3DGQ A;  2WB9 A;  1TTZ A;  3MNG A;  2ZUP A;  3HVX A;  4XS6 A;  1Q98 A;  3IC4 A;  2IPA A;  3RAZ A;  1PA3 A;  4TOP A;  4MZC A;  1SL0 B;  5D9W A;  2VCX A;  5D9T A;  3LFL A;  2VM1 A;  3WGD A;  3H1N A;  2LJR A;  1GSD A;  2YV7 A;  2H1A A;  1TOF A;  3UOM A;  3ZMK A;  1XW6 A;  1Z7R A;  1FB0 A;  1TJD A;  4V1A g;  5A4W A;  4G2E A;  2REM A;  5CNW A;  2NBS A;  2K6V A;  1O81 A;  5ELG A;  2OE3 A;  1IYH A;  3W6G A;  2C0E A;  1BX9 A;  3ERG A;  1V9W A;  3FZ4 A;  1FB6 A;  22GS A;  1EEJ A;  3F3R A;  5CRW A;  4RQR A;  2LQO A;  1OC3 A;  1VF3 A;  1DE1 A;  3GH9 A;  4QL9 A;  4HDE A;  3TJB A;  3PH9 A;  1QK8 A;  3QMX A;  3KTB A;  1V98 A;  1QGV A;  2C3T A;  3ERW A;  20GS A;  4AJ8 A;  3D0Z A;  1SD8 A;  2NPB A;  3G7I A;  2XPD A;  2V1M A;  2FCH A;  5HFK A;  2XBQ A;  3L78 A;  3VWV A;  5KN2 A;  2KUC A;  2V6K A;  1IYI A;  1O6J A;  3IBH A;  2JZT A;  3M3M A;  4TRX A;  2LQQ A;  5D9V A;  5EL8 A;  4YAP A;  3GL3 A;  1K0C A;  6GSU A;  3ZVJ D;  1LU4 A;  3M8N A;  1A8L A;  1QFN A;  1BQ7 A;  2XPE A;  3PR8 A;  5AN1 A;  1O7U A;  4OO4 A;  5JWQ B;  2VL2 C;  1TI3 A;  5CP1 A;  3H79 A;  1A24 A;  3FZ9 A;  2X64 A;  2FWG A;  2GSS A;  3DML A;  5DJM A;  1X5C A;  5IIZ A;  5CYY A;  1WPI A;  6GSS A;  4BWS A;  4AGS A;  2CVB A;  3GN3 A;  1X0R A;  2F8F A;  3W8J A;  3NZN A;  5HFG A;  4KGI A;  1WE0 A;  4IKH A;  2VL2 A;  3ME7 A;  1PL2 A;  1CQH A;  1X5D A;  1GTI A;  1F2E A;  5DAL A;  4F2I A;  4RI7 A;  1VF2 A;  2CT6 A;  2H6X A;  1YJ6 A;  2PVQ A;  3TDG A;  1G6Y A;  3F6D A;  2HRN A;  2IJY A;  3E0U A;  1AW9 A;  2MMO A;  2YV9 A;  4X43 A;  4K0N A;  4TKY A;  3OR5 A;  4EC0 A;  3ZRD A;  2HSH A;  4WR4 A;  3P7X A;  1XPV A;  4ZBD A;  1PKZ A;  2PMT A;  3K8N A;  4MJB A;  6GSV A;  1YF1 A;  4TXO B;  3ZIV A;  3H8Q A;  13GS A;  1WOU A;  2R4V A;  1X5E A;  2FD3 A;  1B9X C;  3HZ8 A;  4V1A p;  2R37 A;  2FA8 A;  2XC2 A;  3RPN A;  4F0C A;  3C8E A;  5ECI B;  4QL7 A;  4POB A;  4NWY A;  3FR3 A;  4TR0 A;  5D8I A;  3BBY A;  4GWR A;  1ZMA A;  4L8E A;  3C1S A;  3D4T A;  3QAV A;  3QOU A;  1ZOF A;  4J57 E;  2HNL A;  4DEJ A;  2AV4 A;  2O85 A;  5EVO A;  3KCM A;  4JED A;  3L0H A;  2H01 A;  1MEK A;  5ID2 B;  4GF0 A;  6GST A;  5HR0 A;  12GS A;  3LEF A;  1JZR A;  1SK2 A;  4D73 A;  1ACV A;  3ISO A;  2MMA A;  3GHA A;  4ACS A;  5EY6 A;  4DVC A;  4HJM A;  2EIO A;  3KP9 A;  2E0Q A;  1G7E A;  1U3I A;  2H0I A;  3UL3 A;  3ZLP A;  2H8L A;  3VPT A;  4POK A;  1QMV A;  2L4C A;  2JSY A;  1RW1 A;  3F3Q A;  1FOV A;  4OCF A;  2KOK A;  5B7C A;  2YZH A;  4IP6 A;  4NHZ A;  4MPG A;  1WWJ A;  3F63 A;  1SJZ A;  8GSS A;  1EEM A;  3EIN A;  1GTA A;  5E4W A;  2C1Y A;  4JR4 A;  2F51 A;  4K8M A;  5FT3 A;  3APQ A;  4HZ4 A;  1GTB A;  5JCG A;  4IJ3 A;  5EPF A;  1YZX A;  4XRD A;  2GLR A;  3QD9 A;  5L71 A;  1TRW A;  2HRF A;  4ISD A;  4F9Z A;  4Q5N A;  4BA7 A;  4E8H A;  4GQC A;  4MPF A;  4MK3 A;  4MF7 A;  4OCE A;  3GKX A;  5DQY A;  3FR6 A;  3O76 A;  4HJ2 A;  1GSY A;  2OA7 A;  3VI5 A;  3BCI A;  4ECJ A;  3CRT A;  5ELA A;  4MCU A;  1THX A;  1A2M A;  3GV1 A;  2LNS A;  3DVX A;  5IMA A;  3LQ7 A;  2BMX A;  2ALB A;  5KEJ A;  4V2M A;  2VCQ A;  3HD5 A;  1JFU A;  3KMO A;  1U88 A;  3LXZ A;  1B8X A;  3KH7 A;  3VUR A;  4JRR A;  1A8Y A;  3L9V A;  5ECL B;  3M0F A;  3ME8 A;  3O6T A;  1PX6 A;  4TXO A;  1U3A A;  3GYK A;  3FR9 A;  3IV4 A;  4Q5F A;  9GSS A;  4YQU A;  3D4M A;  3BD2 A;  1T8E B;  5J9C A;  3HA9 A;  4L0U A;  4OD7 A;  5LCZ A;  2YOI A;  3QDN A;  3BCK A;  4OFT A;  2YNX A;  1K3L A;  4ZB6 A;  2YJH A;  2AUV A;  4MLY A;  1ZZY A;  2AB6 A;  3MDK A;  1SYX A;  4WKW A;  4HS1 A;  1TKD B;  4TXV A;  1M99 A;  2MBS A;  4IEL A;  5AIS A;  1HNC A;  4J2F A;  1TDI A;  2VCZ A;  1WIK A;  3D22 A;  4IN0 A;  2IFQ B;  2YWI A;  3ZML A;  3HCZ A;  4I8B A;  4KSM A;  2ZCT A;  2H71 A;  2HT9 A;  5ID2 A;  4HOJ A;  1DE2 A;  2C8U A;  1XFL A;  2TIR A;  6GSX A;  4OFM A;  2R5G A;  3NIV A;  2YP6 A;  4BL7 A;  1X9W B;  3QR6 A;  4ZIJ A;  1SYR A;  2H76 A;  2P5Q A;  2CV4 A;  4BWQ A;  4O7H A;  4PUA A;  2F3M A;  5IQY A;  1PD2 1;  1I9D A;  5D9X A;  5GZZ B;  1F9M A;  2FA4 A;  2F8A A;  1T4Z A;  1YEP A;  1PX7 A;  4N0V A;  1JZD A;  1V57 A;  4KE3 A;  3TKS C;  5ECK B;  3TRQ A;  2GS3 A;  5B8A A;  4IW9 A;  4HEA 2;  1USB A;  2FY6 A;  1O85 A;  3VFI A;  2I81 A;  1YEX A;  3A2X A;  3IE3 A;  2YN1 A;  3EWL A;  1GUH A;  2I9H A;  1MTC A;  4E8E A;  4G10 A;  3IA1 A;  4PQI A;  2PER A;  1OKD A;  2OBK A;  3MWH A;  3TKQ A;  2J23 A;  3TKS A;  2QSI A;  3QAG A;  2CA8 A;  3KZQ A;  4AJ6 A;  2GQL A;  3HJO A;  1A2J A;  3KM6 A;  1TU8 A;  2GT5 A;  1ILO A;  5G31 A;  3C1R A;  2GVP A;  1Y25 A;  3MSZ A;  3F9U A;  4I2T A;  2M80 A;  1AQW A;  1GTU A;  4KX4 A;  2H19 A;  3A3T A;  2B1K A;  2HZE B;  4V2L A;  5F05 A;  4FYC A;  1SKR B;  5ECH B;  2PN8 A;  2V6O A;  2TRX A;  2JAC A;  3O3T A;  2AYT A;  3R2Q A;  2X8G A;  1Z5Y E;  1SK1 A;  4ZIL A;  3APO A;  3CSI A;  3D21 A;  4KND A;  1AXD A;  5ECQ B;  4PNF A;  1GUK A;  5IO2 A;  3FHK A;  4PQ1 A;  2IME A;  4JU5 A;  3US3 A;  1KTE A; 
#chains in the Genus database with same CATH topology
 3DJB A;  4KF9 A;  2KLX A;  16GS A;  2IFQ A;  4K2D A;  1AQX A;  3TNH B;  2PPT A;  4HLQ A;  4EVM A;  1Z9H A;  4IP1 A;  5F07 A;  4OFN A;  2P5R A;  5HFI A;  3RPP A;  4NHW A;  1ZP2 A;  3AY8 A;  4MH2 A;  2XHF A;  2WRT A;  5B6N A;  5KOX A;  1SK0 A;  4HU9 A;  2JAD A;  2AJQ B;  3K7A M;  3QWL A;  3QHW B;  1Z6N A;  2RUF A;  2QKE A;  1F37 A;  3UVH A;  1HQO A;  2H0G A;  3TNI B;  5C00 A;  3TW7 A;  1H75 A;  2B5E A;  1M3J A;  3CSH A;  4HQZ A;  4K1F A;  1DUG A;  2I53 A;  1G6W A;  4XHM A;  3F4S A;  2L5L A;  3F4R A;  2RII A;  3VLN A;  2PUK C;  1YF0 A;  4ZL9 A;  4YAV A;  5GST A;  3LXT A;  4D73 B;  2G77 A;  3VI7 A;  1K3Y A;  4XS1 A;  3IOS A;  3UAR A;  1E6B A;  2HFD A;  2DD5 B;  2F9S A;  2RM5 A;  2WMB B;  4HSC X;  3QZ5 B;  5DCH A;  2DXC B;  4KH7 A;  4K5S A;  1W89 A;  3ZL5 A;  3HVV A;  4YH2 A;  2F2C A;  1ZL9 A;  1OKT A;  2VIM A;  3DTO A;  3MY1 B;  2FLS A;  2DJJ A;  1XWK A;  3DWV A;  3VWX A;  4XCS A;  4PTS A;  2IIY A;  2RUE A;  5C04 A;  4ZB8 A;  4O5R A;  4KDY A;  5F06 A;  1E9H B;  1XVW A;  4WF5 A;  1DBY A;  3A8L B;  4POL A;  1V2A A;  3BHU B;  4CFU B;  5G5E A;  3FRC A;  2UZE B;  1GUX B;  2MBT A;  2AHJ B;  4GRF A;  1YKA A;  2HI7 A;  1UNG D;  4DSS B;  1PGT A;  1OC8 A;  4TW5 A;  2BS2 A;  3B57 A;  4OO5 A;  1KXU A;  2YPM A;  3L9S A;  4XS4 B;  1Q4J A;  4MIM A;  2G0F A;  2C3N A;  2PJQ A;  1XCC A;  2VM2 A;  4BVX B;  1A23 A;  3DDP B;  2HZE A;  3GX0 A;  1MD4 A;  2A2R A;  2R0G A;  3ZFB A;  4FYU A;  3TKP A;  3HVN A;  1XXU A;  2OKA A;  5ENU A;  4F6S B;  2W96 A;  3LGC A;  3QYH B;  2DIZ A;  1QQ2 A;  1SJ6 A;  1WJK A;  2H1G A;  3I69 A;  2IMF A;  5HR3 A;  4EOR B;  1F3A A;  1AD6 A;  1EV4 A;  4WET A;  2GSQ A;  3C73 A;  5IPH A;  3RHB A;  3E3E A;  4ECI A;  2HRK A;  5GAN D;  2ZPH B;  1AIU A;  2BS3 A;  4OWY A;  3GH6 A;  2PGT A;  5A4V A;  4G9H A;  1AAZ A;  3ZVJ A;  1S3A A;  1EZK A;  4EUY A;  4BCJ B;  2KHP A;  1O8W A;  4BCM D;  2GDR A;  3VYG B;  1SU9 A;  5HBE B;  5IM9 A;  1NM3 A;  1X9M B;  2PBJ A;  1TI1 A;  1GRX A;  2C80 A;  2A4V A;  2QGS A;  4MDC A;  3EVI A;  4JBB A;  5DJL A;  4EOM B;  1M2D A;  1ZCP A;  5ECR B;  4OB0 B;  4EON B;  3IHQ A;  4GSN A;  2FWH A;  1URM A;  4EIQ A;  2C4G B;  3GIX A;  4KB3 A;  3EJ1 B;  2GGT A;  1TK8 B;  2B7K A;  1OC9 A;  14GS A;  4BVY B;  3LOR A;  1EWX A;  3IPZ A;  3GMF A;  1FO5 A;  4ZL7 A;  3H93 A;  5DCG A;  4TR1 B;  4NAX A;  3UMA A;  1K0B A;  2O8V B;  1MD3 A;  3PGT A;  1ABA A;  3TJK A;  4J56 E;  1ZYQ B;  4CRL B;  5ECM B;  2GST A;  1SD9 A;  5F8B A;  2WGR A;  2QC7 A;  3G7J A;  3LSZ A;  5IMV A;  4BPY A;  2H73 A;  2CVD A;  1YKC A;  2M72 A;  5J4U A;  4LMW A;  2H70 A;  3IR4 A;  4F6U B;  2R2J A;  1MDK A;  2CX3 A;  1ST9 A;  4K7I A;  3CTF A;  4EOL B;  4WBR D;  5JWO B;  1TK5 B;  4G19 A;  5DQW A;  18GS A;  1TD6 A;  2GSR A;  1K0M A;  3TJJ A;  3C7M A;  3RGF B;  1T7P B;  4X1U A;  2XBI A;  4MZW A;  3VWW A;  7GSS A;  4Q5R A;  1Z7P A;  2IL3 A;  3EC3 A;  4KDU A;  3M1G A;  4AKI A;  1SJI A;  2QA2 A;  1F3B A;  4LLR A;  2H75 A;  2WZ9 A;  1EGO A;  1BAY A;  2GZP A;  1GUX A;  2DJ1 A;  2P0G A;  2VOC A;  3G9B A;  1W98 B;  5INY A;  1T4Y A;  1M2A A;  4DSS A;  3A5W A;  1OVN A;  1KEB A;  1LJR A;  2ZCF B;  2JU5 A;  3CSJ A;  3L4N A;  2DC5 A;  4XS4 A;  1XVQ A;  4O5U A;  3BLQ B;  2QGV A;  3Q19 A;  1B48 A;  1Z6M A;  3FEU A;  4BVX A;  1CQG A;  2HE3 A;  4HZ2 A;  3F5X B;  1EV9 A;  5H5S A;  3P8W A;  4CY8 A;  3QFB C;  2H72 A;  1E2Y A;  1F6M C;  1WP0 A;  2L4Q A;  5J9B A;  4KA0 A;  2WXV B;  5IDN B;  3HVS A;  2E2G A;  4EOJ B;  4CHS A;  2N5F A;  3F8U A;  2VLV A;  2C3Q A;  4IS0 A;  3GTM S;  1ENW A;  3EMX A;  1B4Q A;  2YWO A;  4GXZ A;  1ERW A;  4EDY A;  1YQ1 A;  3IAM 2;  4ZB9 A;  2D2Z A;  1F5Q B;  1BG5 A;  4TN8 A;  3X25 B;  11GS A;  3GTU B;  2TRC P;  4L5L A;  4GTU A;  3WD6 A;  1GWC A;  3TOU A;  1VGL A;  1XOB A;  3W8S A;  1A2L A;  1JZO A;  1RK4 A;  4N30 A;  5EFQ B;  2UZ8 A;  1PN9 A;  2OE1 A;  2O89 A;  4EOO B;  2WCI A;  4X4J A;  2V2G A;  1R26 A;  4OMV A;  1XWC A;  3E9J B;  5CYI B;  4AKG A;  4BCN B;  3A2W A;  5LD0 A;  1OYJ A;  2UZB B;  3D5J A;  2X8C A;  2HSY A;  4XRA A;  10GS A;  2W9F A;  1GP1 A;  5G1L A;  4NXI A;  1M2B A;  4BVY A;  5JCW A;  4Z2U A;  2DPP B;  2R6K A;  4ZXG A;  4TR1 A;  3RBT A;  4F03 A;  2DJ0 A;  4P3Y B;  3BOA A;  2VL3 A;  3ED3 A;  4EKZ A;  1AIS B;  4ROE A;  4OB2 B;  5G2Z A;  4Z2R A;  5IDP B;  4RQX A;  2MMN A;  4ELJ A;  3DD3 A;  2E7P A;  4JX6 A;  2OJL A;  3WT1 A;  5AIV A;  4K0G A;  4K9Z A;  1GY3 B;  5KN1 A;  2LST A;  2DJ3 A;  3GST A;  2M46 A;  1O8X A;  1XW9 A;  4ROC A;  3DXB A;  3SBC A;  5D73 A;  2X49 A;  2L59 A;  3FW2 A;  2FWF A;  3KEB A;  1GNW A;  3X28 B;  2FWE A;  4N0Z A;  5CRD A;  4HI7 A;  2HZF A;  4AJ7 A;  4FH8 A;  5GSS A;  1XW5 A;  1ZGN A;  4G0I A;  3EU3 A;  4MH3 A;  4WEY A;  1JHB A;  4BCQ B;  2B5X A;  6GSW A;  1PMT A;  2FHE A;  4F70 B;  4MAB A;  4RUV A;  3LW9 A;  1TRU A;  4IQ1 A;  5G30 A;  2WS2 A;  1OIU B;  2LEG A;  1OAZ A;  4Q5Q A;  1JST B;  3LG6 A;  4YOZ A;  1XOA A;  3DKS A;  3APS A;  3IRA A;  1FVK A;  1GUM A;  2B5Y A;  2ZPF B;  4ML6 A;  2X4A A;  2V32 A;  2PHG A;  4PXO A;  3GUS A;  3EE2 A;  1P5E B;  1OI9 B;  1ZYE A;  3GUR A;  4O92 A;  1PRX A;  3Q18 A;  4ZBA A;  1HYU A;  1R4W A;  3ZIJ A;  2J9H A;  2PVO C;  2DLX A;  4K6X A;  2P31 A;  3IK9 A;  2JSZ A;  4MF5 A;  2H0H A;  1UC7 A;  2PMI B;  4EE0 A;  5ECN B;  1MDI A;  2LJA A;  4MFD A;  4RI6 A;  2L6C A;  3GTU A;  4HUA A;  1BYE A;  3EU4 A;  2WDU A;  2GT6 A;  2KR6 A;  1ERU A;  4MP4 A;  1ZYP A;  3NDQ A;  4TTH A;  2HLS A;  5CRH A;  3WT2 A;  4DSQ A;  4CW9 A;  3TOT A;  2GQM A;  3HJM A;  3HY2 A;  3F4T A;  2FNO A;  5IMF A;  1BED A;  4KDX A;  2I1U A;  3DL1 A;  3HZ4 A;  4V2N A;  5J5N A;  5CRE A;  2PU9 C;  2VO4 A;  3G7Y A;  2H30 A;  1TRV A;  2H74 A;  5IOW A;  1VRS D;  2YCD A;  3HJP A;  4ECC A;  2VCV A;  3DVW A;  1RQM A;  1R5P A;  2H1D A;  2N5B A;  5HQP A;  4ULX A;  2O7K A;  3LYK A;  3X26 B;  1O9K B;  1W4V A;  3GSS A;  2CCH B;  4KCE A;  2H1B A;  3KTL A;  3I43 A;  4BCP B;  2HYX A;  4I6X A;  4GQF A;  3MIX A;  2IMI A;  3J7Y k;  2B7J A;  4MNN A;  3UJ1 A;  3KJY A;  1FG4 A;  4MZB A;  4MA9 A;  2EUF A;  2WJU A;  4X0X A;  1UNL D;  3H4K A;  1K0A A;  5FWG A;  1G0T A;  3QYG B;  3CQF A;  3CYN A;  3QCP A;  2ZNM A;  2H6Y A;  1JZW A;  3DIE A;  3UBL A;  1OC9 B;  4ZL8 A;  4F6W B;  2BTO T;  2VCT A;  2H6Z A;  3KP8 A;  3N5O A;  4PQH A;  2X8H A;  1G3N C;  1QUW A;  3QPM A;  3TUE A;  2RLI A;  2UZL B;  3RHC A;  3UBK A;  1FAA A;  3GX8 A;  1OKV B;  3MYD A;  4NST B;  2AHE A;  3IDV A;  2YJ7 A;  2B1L A;  2CZ2 A;  3UAP A;  3FK8 A;  1NW2 A;  4BCG B;  1NHO A;  5G5F A;  3FZA A;  3DDQ B;  1PKW A;  1S3D A;  2FUG 2;  4IHU A;  3M9K A;  4IQA A;  4NV2 A;  2X1N B;  1WMJ A;  4EL1 A;  4YQM A;  5H5Q A;  1GSQ A;  3HHV A;  4NMU A;  3F0I A;  1OE7 A;  1EOH A;  2LS5 A;  3TKR A;  1TW9 A;  4CDO A;  1AUC A;  4WR5 A;  2MZC A;  17GS A;  1QXH A;  2C0F A;  2HRA A;  4K2X A;  2OAC A;  3LWA A;  4EOK B;  1B9Y C;  2ON7 A;  3CMI A;  2PK9 B;  4TR3 A;  1SL1 B;  1R7H A;  1T00 A;  2VL9 A;  2CAI A;  2VAF A;  1URC B;  2L57 A;  2HXK A;  1FIN B;  2R3X A;  1H27 B;  4HNU A;  1ON4 A;  1E7P A;  2DML A;  3VK9 A;  1GSS A;  1H4O A;  2B3S A;  3UVT A;  1A0R P;  3UIW A;  3I9V 2;  2IMK A;  4KCA A;  4A5P A;  5LNK e;  1J9B A;  3MAK A;  2JZS A;  3ZIT A;  2B6M A;  1S3C A;  4YKF A;  1V40 A;  2WMA B;  3TKS E;  1M0U A;  1O73 A;  4GST A;  3FYG A;  3A8H B;  1AC1 A;  1K0O A;  3BG9 A;  1LBK A;  3EID B;  2IWT A;  1TK0 B;  19GS A;  2W9Z A;  1XZO A;  3GKN A;  3GKM A;  4IJI A;  4LMV A;  1O9K A;  2VCW A;  3CXG A;  3HYP A;  1UN2 A;  5IMD A;  5ICP B;  1S3R A;  4GLT A;  4I2U A;  3X20 B;  2KP1 A;  2ON5 A;  5ABR A;  1SKW B;  3P2A A;  1JKW A;  4LL4 B;  5HBJ B;  1TU7 A;  4EOQ B;  2VD1 A;  2X99 A;  4OB3 B;  1KBN A;  1C9B A;  3MI9 B;  5LQF B;  3MIA B;  3O0G D;  3UEM A;  2A2P A;  2NDO A;  5I5Z B;  1UVZ A;  3EUR A;  5G1K A;  3U6V A;  3TRP A;  3HBL A;  4KW6 A;  2RM6 A;  5D93 A;  4IBP A;  4ML1 A;  1YDK A;  4JZQ A;  1PQN A;  4KRC B;  5JCU A;  2MMZ A;  3ZFL A;  1FHE A;  5AIX A;  4CFU D;  4FQU A;  2O87 A;  4FO5 A;  3MY5 B;  1A0F A;  5CRG A;  1ERV A;  3RDW A;  2LV3 A;  4WXT A;  3M03 A;  2L5O A;  5DAK B;  2DXB B;  2G2Q A;  2LUS A;  1C72 A;  2WIP B;  3BHV B;  2YWM A;  2W2H A;  2LKU A;  1GNE A;  3BJ5 A;  1GLP A;  4H86 A;  1HD2 A;  2H66 A;  2KP2 A;  5IPG A;  1EP7 A;  3V1W A;  4KRD B;  4PUR A;  3FKF A;  1VIN A;  3TJF A;  4FYB A;  4WF4 A;  5DQS A;  2LRN A;  5E59 A;  5HBH B;  3BG3 A;  2UZD B;  2YZU A;  2WJ9 A;  2VLT A;  5B6M A;  4ZGE B;  2K9F A;  3M9J A;  4YQV A;  3IAS 2;  4PUF C;  2DSA A;  4HNV A;  5JWR B;  1N4M A;  4F0B A;  1X9S B;  1DSB A;  5KN0 A;  1GLQ A;  1V58 A;  2KMG A;  1J08 A;  1T3B A;  2D0Q B;  5A4U A;  1Z3E A;  1NSW A;  4PNG A;  4XIH A;  5CAX A;  3LJR A;  4Z6Y A;  2DBC A;  1UGP B;  2DIY A;  1FW1 A;  3GRX A;  3KGK A;  3POM A;  3A2V A;  2YAN A;  4BXX X;  3SWL A;  2EC4 A;  3KH9 A;  2DMM A;  4IVF A;  2ZPB B;  1TRS A;  4IMY B;  3QYB A;  4EF0 A;  4DSR A;  3DRN A;  4XTS A;  4IGJ A;  1KNG A;  1EGR A;  5HR1 A;  4TVE A;  1M7T A;  3GFK A;  3NOF A;  1OIY B;  3VPQ A;  3TJG A;  2EIQ A;  1GSF A;  1PFO A;  1G7O A;  2VUP A;  4MFE A;  4N10 A;  3X24 B;  4K7O A;  5H5R A;  4KSO A;  3GL5 A;  3DEX A;  4AI6 A;  1TXX A;  5LMK B;  4PX1 A;  1H26 B;  3PIN A;  1SKS B;  1VF4 A;  3KXO A;  3GA4 A;  2IW8 B;  5ACB A;  4BBS M;  4JE1 A;  3EMP A;  3P90 A;  1OE8 A;  2OBI A;  2K8V A;  1VOL A;  3EOC B;  2NTO A;  3WGE A;  3A5I A;  3IXR A;  2CQ9 A;  4MJC A;  4F82 A;  2CZ6 B;  2DJ2 A;  2LNT A;  1TFB A;  5AGY A;  5CO3 A;  2DD4 B;  5J41 A;  1JLW A;  2JL4 A;  2I4A A;  3CRU A;  3JCM L;  2LW4 A;  1N2A A;  5KN3 A;  4G6L B;  4Z7X A;  1ZYN A;  1K3O A;  4HU7 A;  2GZY A;  2OE0 A;  3QFA C;  4ECB A;  4NPB A;  3J7Y b;  1PN0 A;  5COH A;  3TRX A;  5FHI A;  1AQV A;  1N8J A;  3HZJ A;  3TW6 A;  1XWA A;  3ERF A;  1GUL A;  4ZBB A;  1XWB A;  3ZZX A;  4GSS A;  3Q74 A;  2Z9S A;  1GSU A;  3U5R E;  2C4J A;  3L9U A;  3TB2 A;  3A8G B;  2LTK A;  3QXE B;  4GCI A;  4EDZ A;  2AAW A;  4LL1 B;  5DBQ A;  5L2W B;  3A8O B;  4PGT A;  2C0G A;  3CBU A;  5J3R A;  2E2M A;  5IMC A;  4ILF A;  1SL2 B;  5DDL A;  4K7N A;  2HSM A;  2K8S A;  4I97 A;  1U87 A;  3LYP A;  5DAK A;  4OGR B;  2IMD A;  2IW6 B;  3KD0 A;  3ZTL A;  3VKH A;  1GL8 A;  4MJE A;  2PWJ A;  1J0F A;  4AKH A;  4N11 A;  2K18 A;  4KUN A;  4ID0 A;  2IN3 A;  4O32 A;  3TN8 B;  4MJA A;  4POM A;  2CX4 A;  3PO3 S;  2OAD A;  3Q6O A;  1U6T A;  5ECO B;  3FY7 A;  2LJK A;  3GNJ A;  2FGX A;  5HR2 A;  1R5A A;  2GTU A;  5D96 A;  3H4C A;  3D6I A;  2CVK A;  3ZRE A;  3KIJ A;  1GSE A;  2BJX A;  1XIY A;  4NV5 A;  2LRC A;  2CZ7 B;  3KMN A;  4MMM A;  2WUL A;  5BMU A;  2WHB B;  1WRY A;  5GAP D;  3IK7 A;  1VF1 A;  3HDC A;  3I6A A;  1JLV A;  4LA1 A;  1Y6E A;  4EOI B;  2I3Y A;  5IOX A;  3F6F A;  4BCH B;  2GZZ A;  4YOO A;  4LOC A;  1MDJ A;  2NVL A;  4BBR M;  3TGZ A;  5IO0 A;  2JGZ B;  2WFC A;  4FIW A;  4KAE A;  1PSQ A;  1B4P A;  1ERT A;  1I5G A;  4MF6 A;  1THO A;  3WYW A;  2CYZ B;  4BCN D;  1BJX A;  1T1V A;  1PL1 A;  2I40 B;  3PPU A;  5F0G A;  3WGX A;  2DKH A;  1XWG A;  5IMZ A;  2CZ3 A;  4AF2 A;  5BRT A;  4QQ7 A;  1TP9 A;  2L6D A;  1EOG A;  1M9B A;  1NHY A;  5A5K A;  2LRT A;  1GH2 A;  3WVE B;  2A2S A;  2JZR A;  4EO3 A;  1ML6 A;  2YWN A;  5DVB A;  3FMW A;  2GQK A;  2DJK A;  4TR4 A;  3HXS A;  2CAQ A;  2BS4 A;  4BCO B;  4L5O A;  1UGS B;  1UA5 A;  3EYT A;  1HNB A;  2C0D A;  4EXJ A;  4F7J B;  1FVJ A;  1K0D A;  4G0K A;  4L0W A;  4WBJ A;  2N5A A;  4OR5 B;  3CTG A;  1YY7 A;  2R0P A;  1EP8 A;  4I3Z B;  4G0L A;  3TCO A;  3S9F A;  3VYH B;  1OGU B;  2V41 A;  2QFZ A;  1SEN A;  5B8B A;  3QAW A;  2EIR A;  3GKK A;  4I5Q A;  1XBS A;  1HNA A;  1K0N A;  2ES7 A;  4JR6 A;  1BU2 A;  4ZGJ B;  5ECS A;  1M9A A;  2CZ0 B;  3ZYW A;  2VD0 A;  2VLU A;  3DYR A;  3HKR A;  1UNH D;  3FZ5 A;  5DAL B;  3N9J A;  3VWU A;  6GSY A;  4BCQ D;  2MYG A;  5ECP B;  3C71 A;  4HQS A;  3DGQ A;  1GH6 B;  2WB9 A;  1TTZ A;  3MNG A;  2ZUP A;  3HVX A;  4XS6 A;  1Q98 A;  3IC4 A;  2IPA A;  3RAZ A;  1PA3 A;  4ELL A;  4TOP A;  4MZC A;  1SL0 B;  1JSU B;  1D3U B;  4HL4 A;  4JX4 A;  5D9W A;  2VCX A;  5D9T A;  3LFL A;  1UGQ B;  2VM1 A;  3WGD A;  4ZGD B;  3H1N A;  2LJR A;  1GSD A;  4YC3 B;  2YV7 A;  2H1A A;  1TOF A;  3UOM A;  3ZMK A;  1XW6 A;  4ICY A;  1Z7R A;  1FB0 A;  1TJD A;  2BKZ B;  4V1A g;  5A4W A;  5KOW A;  4G2E A;  4CFN B;  2REM A;  5CNW A;  2NBS A;  2K6V A;  1PKD B;  1O81 A;  5EJC A;  5ELG A;  2OE3 A;  1IYH A;  2WFY B;  3W6G A;  2C0E A;  3HB9 A;  1BX9 A;  3ERG A;  1V9W A;  3FZ4 A;  1FB6 A;  22GS A;  1EEJ A;  3F3R A;  5CRW A;  4RQR A;  2LQO A;  5HNB B;  1OC3 A;  1VF3 A;  1DE1 A;  3GH9 A;  4QL9 A;  4HDE A;  3TJB A;  3PH9 A;  1QK8 A;  3QMX A;  3KTB A;  1V98 A;  1QGV A;  2C3T A;  3ERW A;  20GS A;  4BCM B;  4AJ8 A;  3D0Z A;  3HO8 A;  1SD8 A;  2NPB A;  3G7I A;  2XPD A;  2V1M A;  2FCH A;  5HFK A;  2XBQ A;  3L78 A;  3VWV A;  5KN2 A;  2KUC A;  2V6K A;  1IYI A;  4JX5 A;  1O6J A;  3IBH A;  1OKW B;  2JZT A;  1H1P B;  5FGK B;  3M3M A;  4HNT A;  2LQQ A;  4TRX A;  5D9V A;  5EL8 A;  4YAP A;  3GL3 A;  1K0C A;  6GSU A;  3ZVJ D;  2QDJ A;  1LU4 A;  3M8N A;  3BLR B;  1A8L A;  1QFN A;  1IRE B;  1BQ7 A;  2XPE A;  2V22 B;  3PR8 A;  5AN1 A;  1O7U A;  4OO4 A;  5JWQ B;  2VL2 C;  2ZPG B;  1TI3 A;  5CP1 A;  3H79 A;  1M3I A;  1A24 A;  3FZ9 A;  2X64 A;  2FWG A;  2IVX A;  2GSS A;  3DML A;  5DJM A;  1X5C A;  5IIZ A;  5CYY A;  1WPI A;  6GSS A;  4BWS A;  4AGS A;  4CFV B;  2CVB A;  3GN3 A;  1X0R A;  2F8F A;  4YOS A;  3W8J A;  3NZN A;  5HFG A;  4KGI A;  1WE0 A;  4IKH A;  2VL2 A;  2ZPE B;  3LQ5 B;  3ME7 A;  1PL2 A;  1CQH A;  1X5D A;  1GTI A;  1F2E A;  3WVD B;  4FX3 B;  5DAL A;  4F2I A;  4RI7 A;  4CXA B;  5BNJ B;  1VF2 A;  2CT6 A;  3TNW B;  2H6X A;  1YJ6 A;  2PVQ A;  2A4H A;  3TDG A;  1G6Y A;  3F6D A;  2HRN A;  2IJY A;  4EOS B;  4UN0 A;  3E0U A;  1AW9 A;  2MMO A;  2YV9 A;  4X43 A;  4K0N A;  4TKY A;  3OR5 A;  4EC0 A;  3BG5 A;  3ZRD A;  2HSH A;  4WR4 A;  3P7X A;  1XPV A;  4ZBD A;  3QZ9 B;  1PKZ A;  2PMT A;  3K8N A;  4MJB A;  6GSV A;  1YF1 A;  5CEI B;  4TXO B;  3ZIV A;  3H8Q A;  4EC9 B;  13GS A;  1WOU A;  2R4V A;  1X5E A;  2FD3 A;  4BY7 X;  1B9X C;  3HZ8 A;  4V1A p;  2R37 A;  2FA8 A;  2XC2 A;  3RPN A;  1QLB A;  4F0C A;  3C8E A;  4CFM B;  5ECI B;  4QL7 A;  4POB A;  4NWY A;  3FR3 A;  4TR0 A;  1H4L D;  5D8I A;  2PK2 A;  2C5V B;  3BBY A;  4CFW B;  4GWR A;  1ZMA A;  4L8E A;  3C1S A;  3D4T A;  3QAV A;  1H1R B;  3QOU A;  1ZOF A;  4J57 E;  2R0C A;  2HNL A;  4DEJ A;  2AV4 A;  2O85 A;  5EVO A;  3KCM A;  2CZ1 B;  4JED A;  3L0H A;  2H01 A;  1MEK A;  2BPM B;  4GF0 A;  5ID2 B;  4F7L B;  6GST A;  5HVY B;  5HR0 A;  12GS A;  3LEF A;  4CY6 A;  1JZR A;  1SK2 A;  4D73 A;  1ACV A;  3ISO A;  2MMA A;  3GHA A;  4ACS A;  5EY6 A;  3KHI A;  4DVC A;  4HJM A;  2EIO A;  3KP9 A;  1UGR B;  2E0Q A;  2QA1 A;  2G9X B;  4BL7 B;  1G7E A;  1U3I A;  2H0I A;  1OL2 B;  3UL3 A;  3ZLP A;  2H8L A;  3VPT A;  2C5N B;  4POK A;  4NC6 A;  1XO2 A;  1QMV A;  2L4C A;  2JSY A;  1RW1 A;  3F3Q A;  1FOV A;  4OCF A;  4EOP B;  2KOK A;  5B7C A;  4CFX B;  2YZH A;  4IP6 A;  4NHZ A;  4MPG A;  1WWJ A;  3F63 A;  1SJZ A;  8GSS A;  1EEM A;  3EIN A;  1GTA A;  5E4W A;  2C1Y A;  4JR4 A;  2F51 A;  4K8M A;  5FT3 A;  3APQ A;  4HZ4 A;  1GTB A;  3EPT A;  2B9R A;  5JCG A;  4IJ3 A;  5EPF A;  1YZX A;  3VKG A;  4XRD A;  2GLR A;  3QD9 A;  5L71 A;  1TRW A;  2HRF A;  1H1S B;  4ISD A;  4F9Z A;  4Q5N A;  4BA7 A;  4E8H A;  4GQC A;  4OB1 B;  4MPF A;  4MK3 A;  4MF7 A;  4OCE A;  3GKX A;  5DQY A;  3FR6 A;  3O76 A;  3IHG A;  4HJ2 A;  1GSY A;  2OA7 A;  3VI5 A;  3BCI A;  1FVV B;  2C6T B;  4ECJ A;  3CRT A;  2UUE B;  5ELA A;  1OL1 B;  4MCU A;  4O5Q A;  1THX A;  1JOW A;  1A2M A;  3GV1 A;  2LNS A;  3DVX A;  5IMA A;  3LQ7 A;  2BMX A;  2ALB A;  5KEJ A;  4V2M A;  2VCQ A;  3HD5 A;  1JFU A;  2WPA B;  4F7N B;  3KMO A;  1U88 A;  3LXZ A;  1B8X A;  3KH7 A;  3VUR A;  4JRR A;  1A8Y A;  3L9V A;  5ECL B;  3M0F A;  2W99 A;  1V29 B;  3ME8 A;  3O6T A;  1PX6 A;  4TXO A;  1U3A A;  3GYK A;  3FR9 A;  3IV4 A;  4Q5F A;  9GSS A;  4YQU A;  3D4M A;  3BD2 A;  1T8E B;  5J9C A;  4F7S B;  3HA9 A;  1AHJ B;  4L0U A;  4OD7 A;  5LCZ A;  4II5 B;  2YOI A;  3QDN A;  3BCK A;  4OFT A;  3G33 B;  2YNX A;  1K3L A;  4EIP A;  4ZB6 A;  2YJH A;  2AUV A;  5HQ0 B;  1ZZY A;  4MLY A;  2AB6 A;  3MDK A;  1FKM A;  1SYX A;  4WKW A;  1H1Q B;  4HS1 A;  4TXV A;  1FOH A;  1M99 A;  2MBS A;  1TKD B;  4IEL A;  4BY1 X;  5AIS A;  3R3E A;  1HNC A;  4J2F A;  1TDI A;  2VCZ A;  1WIK A;  3D22 A;  1XG8 A;  2ZZD B;  2IFQ B;  4IN0 A;  3QHR B;  4USS A;  2YWI A;  3ZML A;  3HCZ A;  2QDY B;  4I8B A;  4KSM A;  3QYE A;  2ZCT A;  2H71 A;  2HT9 A;  5ID2 A;  1QMZ B;  4BCF B;  2DKI A;  4HOJ A;  1DE2 A;  2C8U A;  1XFL A;  2TIR A;  6GSX A;  4OFM A;  2R5G A;  4Z2T A;  3NIV A;  2YP6 A;  4BL7 A;  1X9W B;  3BLH B;  3QR6 A;  3BHT B;  4YKG A;  4ZIJ A;  1SYR A;  2H76 A;  2P5Q A;  2CV4 A;  4BWQ A;  4O7H A;  4PUA A;  3A8M B;  2F3M A;  5IQY A;  1PD2 1;  1I9D A;  5D9X A;  5GZZ B;  1F9M A;  2FA4 A;  2F8A A;  1T4Z A;  1YEP A;  1PX7 A;  4N0V A;  1JZD A;  2QF7 A;  2IW9 B;  1V57 A;  1VYW B;  4KE3 A;  1H25 B;  4Y72 B;  3TKS C;  5ECK B;  3TRQ A;  2GS3 A;  2C5X B;  5B8A A;  4IW9 A;  1H28 B;  4HEA 2;  1USB A;  2FY6 A;  1O85 A;  4EC8 B;  3VFI A;  2I81 A;  5DQV A;  1YEX A;  3A2X A;  3IE3 A;  2YN1 A;  4FM4 B;  2CJM B;  3EWL A;  1GUH A;  2I9H A;  1MTC A;  3DOG B;  2DME A;  4ROD A;  4E8E A;  4BCK B;  4G10 A;  3IA1 A;  4PQI A;  4K5R A;  2PER A;  1OKD A;  4QSH A;  2OBK A;  2R7G A;  3MWH A;  4BCI B;  3TKQ A;  2J23 A;  3TKS A;  2QSI A;  3QAG A;  2CA8 A;  3KZQ A;  4AJ6 A;  3HHT B;  2GQL A;  3HJO A;  4BIK A;  2CCI B;  2QQ8 A;  1A2J A;  3KM6 A;  1TU8 A;  2GT5 A;  1H24 B;  1ILO A;  2ZPI B;  5G31 A;  3C1R A;  2GVP A;  1Y25 A;  3MSZ A;  3F9U A;  4I2T A;  2M80 A;  1AQW A;  1GTU A;  4KX4 A;  2H19 A;  3A3T A;  2B1K A;  2WIH B;  2HZE B;  4V2L A;  5F05 A;  4FYC A;  1SKR B;  5ECH B;  2PN8 A;  2V6O A;  2TRX A;  2JAC A;  3O3T A;  2AYT A;  3R2Q A;  2C5O B;  3IC8 A;  2X8G A;  1Z5Y E;  2WEV B;  5IF1 B;  1SK1 A;  4ZIL A;  3APO A;  3CSI A;  3D21 A;  4KND A;  1AXD A;  4M6V A;  5ECQ B;  4PNF A;  1GUK A;  5IO2 A;  3FHK A;  4PQ1 A;  2IME A;  4JU5 A;  5IHY A;  3US3 A;  1KTE A; 
#chains in the Genus database with same CATH homology
 4KF9 A;  2KLX A;  16GS A;  2IFQ A;  4K2D A;  1AQX A;  2PPT A;  4EVM A;  1Z9H A;  4IP1 A;  5F07 A;  4OFN A;  2P5R A;  5HFI A;  3RPP A;  4NHW A;  3AY8 A;  4MH2 A;  2XHF A;  2WRT A;  5B6N A;  5KOX A;  1SK0 A;  4HU9 A;  2JAD A;  2AJQ B;  1Z6N A;  2RUF A;  2QKE A;  1F37 A;  3UVH A;  1HQO A;  2H0G A;  5C00 A;  1H75 A;  2B5E A;  3CSH A;  4HQZ A;  4K1F A;  1DUG A;  1G6W A;  4XHM A;  3F4S A;  2L5L A;  3F4R A;  2RII A;  3VLN A;  2PUK C;  1YF0 A;  4ZL9 A;  4YAV A;  5GST A;  3LXT A;  4D73 B;  3VI7 A;  1K3Y A;  4XS1 A;  3IOS A;  3UAR A;  1E6B A;  2HFD A;  2RM5 A;  2F9S A;  5DCH A;  4KH7 A;  4K5S A;  1W89 A;  3ZL5 A;  3HVV A;  4YH2 A;  1ZL9 A;  1OKT A;  2VIM A;  2FLS A;  2DJJ A;  1XWK A;  3DWV A;  3VWX A;  4XCS A;  4PTS A;  2IIY A;  2RUE A;  5C04 A;  4ZB8 A;  4O5R A;  4KDY A;  5F06 A;  1XVW A;  4WF5 A;  1DBY A;  4POL A;  1V2A A;  5G5E A;  3FRC A;  2MBT A;  4GRF A;  1YKA A;  2HI7 A;  4DSS B;  1PGT A;  1OC8 A;  4TW5 A;  4OO5 A;  2YPM A;  3L9S A;  4XS4 B;  1Q4J A;  2G0F A;  2C3N A;  1XCC A;  2VM2 A;  4BVX B;  1A23 A;  2HZE A;  3GX0 A;  1MD4 A;  2A2R A;  2R0G A;  3ZFB A;  4FYU A;  3TKP A;  1XXU A;  2OKA A;  5ENU A;  3LGC A;  2DIZ A;  1QQ2 A;  1SJ6 A;  1WJK A;  2H1G A;  3I69 A;  2IMF A;  5HR3 A;  1F3A A;  1EV4 A;  4WET A;  2GSQ A;  3C73 A;  5IPH A;  3RHB A;  3E3E A;  4ECI A;  2HRK A;  5GAN D;  1AIU A;  4OWY A;  3GH6 A;  2PGT A;  5A4V A;  4G9H A;  1AAZ A;  3ZVJ A;  1S3A A;  1EZK A;  4EUY A;  2KHP A;  1O8W A;  2GDR A;  1SU9 A;  5IM9 A;  1NM3 A;  1X9M B;  2PBJ A;  1TI1 A;  1GRX A;  2C80 A;  2A4V A;  4MDC A;  3EVI A;  4JBB A;  5DJL A;  1M2D A;  1ZCP A;  5ECR B;  3IHQ A;  4GSN A;  2FWH A;  1URM A;  4EIQ A;  3GIX A;  4KB3 A;  2GGT A;  1TK8 B;  2B7K A;  1OC9 A;  14GS A;  4BVY B;  3LOR A;  1EWX A;  3IPZ A;  3GMF A;  1FO5 A;  4ZL7 A;  3H93 A;  5DCG A;  4TR1 B;  4NAX A;  3UMA A;  1K0B A;  2O8V B;  1MD3 A;  3PGT A;  1ABA A;  3TJK A;  4J56 E;  1ZYQ B;  5ECM B;  2GST A;  1SD9 A;  5F8B A;  2WGR A;  2QC7 A;  3G7J A;  3LSZ A;  5IMV A;  4BPY A;  2H73 A;  2CVD A;  1YKC A;  2M72 A;  5J4U A;  4LMW A;  2H70 A;  3IR4 A;  2R2J A;  1MDK A;  2CX3 A;  1ST9 A;  4K7I A;  3CTF A;  4WBR D;  5JWO B;  1TK5 B;  4G19 A;  18GS A;  2GSR A;  1K0M A;  3TJJ A;  3C7M A;  1T7P B;  4X1U A;  2XBI A;  4MZW A;  3VWW A;  7GSS A;  4Q5R A;  1Z7P A;  2IL3 A;  3EC3 A;  4KDU A;  3M1G A;  1SJI A;  2QA2 A;  1F3B A;  4LLR A;  2H75 A;  2WZ9 A;  1EGO A;  1BAY A;  2GZP A;  2DJ1 A;  2P0G A;  2VOC A;  3G9B A;  5INY A;  1T4Y A;  1M2A A;  4DSS A;  3A5W A;  1OVN A;  1KEB A;  1LJR A;  2JU5 A;  3CSJ A;  3L4N A;  2DC5 A;  4XS4 A;  1XVQ A;  4O5U A;  2QGV A;  3Q19 A;  1B48 A;  1Z6M A;  3FEU A;  4BVX A;  1CQG A;  2HE3 A;  4HZ2 A;  1EV9 A;  5H5S A;  3P8W A;  4CY8 A;  3QFB C;  2H72 A;  1E2Y A;  1F6M C;  1WP0 A;  2L4Q A;  5J9B A;  4KA0 A;  3HVS A;  2E2G A;  4CHS A;  2N5F A;  3F8U A;  2VLV A;  2C3Q A;  4IS0 A;  3EMX A;  1B4Q A;  2YWO A;  4GXZ A;  1ERW A;  4EDY A;  1YQ1 A;  3IAM 2;  4ZB9 A;  2D2Z A;  1BG5 A;  4TN8 A;  11GS A;  3GTU B;  2TRC P;  4L5L A;  4GTU A;  3WD6 A;  1GWC A;  3TOU A;  1VGL A;  1XOB A;  3W8S A;  1A2L A;  1JZO A;  1RK4 A;  4N30 A;  2UZ8 A;  1PN9 A;  2OE1 A;  2O89 A;  2WCI A;  4X4J A;  2V2G A;  1R26 A;  4OMV A;  1XWC A;  3E9J B;  3A2W A;  5LD0 A;  1OYJ A;  2X8C A;  3D5J A;  2HSY A;  4XRA A;  10GS A;  1GP1 A;  5G1L A;  4NXI A;  1M2B A;  4BVY A;  5JCW A;  4Z2U A;  2R6K A;  4ZXG A;  4TR1 A;  3RBT A;  4F03 A;  2DJ0 A;  4P3Y B;  3BOA A;  2VL3 A;  3ED3 A;  4EKZ A;  5G2Z A;  4Z2R A;  4RQX A;  2MMN A;  3DD3 A;  2E7P A;  2OJL A;  3WT1 A;  5AIV A;  4K0G A;  4K9Z A;  5KN1 A;  2LST A;  2DJ3 A;  3GST A;  2M46 A;  1O8X A;  1XW9 A;  3DXB A;  3SBC A;  5D73 A;  2X49 A;  2L59 A;  3FW2 A;  2FWF A;  3KEB A;  1GNW A;  2FWE A;  4N0Z A;  5CRD A;  4HI7 A;  2HZF A;  4AJ7 A;  4FH8 A;  5GSS A;  1XW5 A;  1ZGN A;  4G0I A;  3EU3 A;  4MH3 A;  4WEY A;  1JHB A;  2B5X A;  6GSW A;  1PMT A;  2FHE A;  4RUV A;  4MAB A;  3LW9 A;  1TRU A;  4IQ1 A;  5G30 A;  2WS2 A;  2LEG A;  1OAZ A;  4Q5Q A;  3LG6 A;  1XOA A;  3DKS A;  3APS A;  3IRA A;  1FVK A;  1GUM A;  2B5Y A;  4ML6 A;  2X4A A;  2V32 A;  4PXO A;  3GUS A;  3EE2 A;  1ZYE A;  3GUR A;  4O92 A;  1PRX A;  3Q18 A;  4ZBA A;  1HYU A;  1R4W A;  3ZIJ A;  2J9H A;  2PVO C;  2DLX A;  4K6X A;  2P31 A;  3IK9 A;  2JSZ A;  4MF5 A;  2H0H A;  1UC7 A;  4EE0 A;  5ECN B;  1MDI A;  2LJA A;  4RI6 A;  2L6C A;  3GTU A;  4HUA A;  1BYE A;  3EU4 A;  2WDU A;  2GT6 A;  1ERU A;  4MP4 A;  1ZYP A;  5CRH A;  2HLS A;  3WT2 A;  4DSQ A;  4CW9 A;  3TOT A;  2GQM A;  3HJM A;  3HY2 A;  3F4T A;  2FNO A;  5IMF A;  1BED A;  4KDX A;  2I1U A;  3HZ4 A;  4V2N A;  5J5N A;  5CRE A;  2PU9 C;  2VO4 A;  3G7Y A;  2H30 A;  1TRV A;  2H74 A;  5IOW A;  1VRS D;  2YCD A;  3HJP A;  4ECC A;  2VCV A;  3DVW A;  1RQM A;  1R5P A;  2H1D A;  2N5B A;  5HQP A;  4ULX A;  2O7K A;  3LYK A;  1W4V A;  3GSS A;  4KCE A;  2H1B A;  3KTL A;  3I43 A;  2HYX A;  4I6X A;  4GQF A;  3MIX A;  2IMI A;  3J7Y k;  2B7J A;  4MNN A;  3UJ1 A;  3KJY A;  1FG4 A;  4MZB A;  4MA9 A;  2WJU A;  4X0X A;  3H4K A;  1K0A A;  5FWG A;  1G0T A;  3CYN A;  3QCP A;  2ZNM A;  2H6Y A;  1JZW A;  3DIE A;  3UBL A;  1OC9 B;  4ZL8 A;  2BTO T;  2VCT A;  2H6Z A;  3KP8 A;  3N5O A;  4PQH A;  2X8H A;  1QUW A;  3QPM A;  3TUE A;  2RLI A;  3RHC A;  3UBK A;  1FAA A;  3GX8 A;  3MYD A;  2AHE A;  3IDV A;  2YJ7 A;  2B1L A;  2CZ2 A;  3UAP A;  3FK8 A;  1NW2 A;  1NHO A;  5G5F A;  3FZA A;  1PKW A;  1S3D A;  2FUG 2;  4IHU A;  3M9K A;  4IQA A;  4NV2 A;  1WMJ A;  4EL1 A;  4YQM A;  5H5Q A;  1GSQ A;  4NMU A;  3HHV A;  3F0I A;  1OE7 A;  1EOH A;  2LS5 A;  3TKR A;  1TW9 A;  4CDO A;  1AUC A;  4WR5 A;  2MZC A;  17GS A;  1QXH A;  2C0F A;  2HRA A;  4K2X A;  2OAC A;  3LWA A;  1B9Y C;  2ON7 A;  3CMI A;  4TR3 A;  1SL1 B;  1R7H A;  1T00 A;  2VL9 A;  2CAI A;  2VAF A;  2L57 A;  2HXK A;  2R3X A;  1ON4 A;  2DML A;  3VK9 A;  1GSS A;  1H4O A;  2B3S A;  3UVT A;  1A0R P;  3UIW A;  3I9V 2;  2IMK A;  4KCA A;  4A5P A;  5LNK e;  1J9B A;  3MAK A;  2JZS A;  3ZIT A;  2B6M A;  1S3C A;  4YKF A;  1V40 A;  3TKS E;  1M0U A;  1O73 A;  4GST A;  3FYG A;  1AC1 A;  1K0O A;  1LBK A;  2IWT A;  1TK0 B;  19GS A;  1XZO A;  3GKN A;  3GKM A;  4IJI A;  4LMV A;  2VCW A;  3CXG A;  3HYP A;  1UN2 A;  5IMD A;  4GLT A;  4I2U A;  2KP1 A;  2ON5 A;  5ABR A;  1SKW B;  3P2A A;  4LL4 B;  1TU7 A;  2VD1 A;  2X99 A;  1KBN A;  3UEM A;  2A2P A;  2NDO A;  1UVZ A;  3EUR A;  5G1K A;  3U6V A;  3TRP A;  4KW6 A;  2RM6 A;  5D93 A;  4IBP A;  4ML1 A;  1YDK A;  4JZQ A;  1PQN A;  5JCU A;  2MMZ A;  3ZFL A;  1FHE A;  5AIX A;  4FQU A;  2O87 A;  4FO5 A;  1A0F A;  5CRG A;  1ERV A;  3RDW A;  2LV3 A;  4WXT A;  2L5O A;  5DAK B;  2G2Q A;  2LUS A;  1C72 A;  2YWM A;  2LKU A;  1GNE A;  3BJ5 A;  1GLP A;  4H86 A;  1HD2 A;  2H66 A;  2KP2 A;  5IPG A;  1EP7 A;  3V1W A;  4PUR A;  3FKF A;  3TJF A;  4FYB A;  4WF4 A;  5DQS A;  2LRN A;  5E59 A;  2YZU A;  2VLT A;  5B6M A;  2K9F A;  3M9J A;  4YQV A;  3IAS 2;  4PUF C;  2DSA A;  5JWR B;  4F0B A;  1X9S B;  1DSB A;  5KN0 A;  1GLQ A;  1V58 A;  1J08 A;  1T3B A;  5A4U A;  1Z3E A;  1NSW A;  4PNG A;  4XIH A;  5CAX A;  3LJR A;  2DBC A;  2DIY A;  1FW1 A;  3GRX A;  3KGK A;  3A2V A;  2YAN A;  3SWL A;  2EC4 A;  3KH9 A;  2DMM A;  4IVF A;  1TRS A;  4EF0 A;  4DSR A;  3DRN A;  4XTS A;  4IGJ A;  1KNG A;  1EGR A;  5HR1 A;  4TVE A;  1M7T A;  3GFK A;  3NOF A;  3VPQ A;  3TJG A;  2EIQ A;  1GSF A;  1G7O A;  2VUP A;  4N10 A;  4K7O A;  5H5R A;  4KSO A;  3GL5 A;  3DEX A;  1TXX A;  4PX1 A;  3PIN A;  1SKS B;  1VF4 A;  3KXO A;  3GA4 A;  4JE1 A;  3EMP A;  3P90 A;  1OE8 A;  2OBI A;  2K8V A;  2NTO A;  3WGE A;  3A5I A;  3IXR A;  2CQ9 A;  4MJC A;  4F82 A;  2DJ2 A;  2LNT A;  5AGY A;  5CO3 A;  5J41 A;  1JLW A;  2JL4 A;  2I4A A;  3CRU A;  3JCM L;  1N2A A;  5KN3 A;  4Z7X A;  1ZYN A;  1K3O A;  4HU7 A;  2GZY A;  2OE0 A;  3QFA C;  4ECB A;  4NPB A;  3J7Y b;  1PN0 A;  5COH A;  3TRX A;  5FHI A;  1AQV A;  1N8J A;  1XWA A;  3ERF A;  1GUL A;  4ZBB A;  1XWB A;  3ZZX A;  4GSS A;  3Q74 A;  2Z9S A;  1GSU A;  3U5R E;  2C4J A;  3L9U A;  3TB2 A;  2LTK A;  4GCI A;  4EDZ A;  2AAW A;  4LL1 B;  5DBQ A;  4PGT A;  2C0G A;  3CBU A;  5J3R A;  2E2M A;  5IMC A;  4ILF A;  1SL2 B;  5DDL A;  4K7N A;  2HSM A;  2K8S A;  4I97 A;  1U87 A;  3LYP A;  5DAK A;  2IMD A;  3KD0 A;  3ZTL A;  1GL8 A;  4MJE A;  2PWJ A;  1J0F A;  4N11 A;  2K18 A;  4KUN A;  4ID0 A;  2IN3 A;  4O32 A;  4MJA A;  4POM A;  2CX4 A;  2OAD A;  3Q6O A;  1U6T A;  5ECO B;  3FY7 A;  2LJK A;  3GNJ A;  2FGX A;  5HR2 A;  1R5A A;  2GTU A;  5D96 A;  3D6I A;  2CVK A;  3ZRE A;  3KIJ A;  1GSE A;  2BJX A;  1XIY A;  4NV5 A;  2LRC A;  3KMN A;  4MMM A;  2WUL A;  5BMU A;  1WRY A;  5GAP D;  3IK7 A;  1VF1 A;  3HDC A;  3I6A A;  1JLV A;  4LA1 A;  1Y6E A;  2I3Y A;  5IOX A;  3F6F A;  2GZZ A;  1MDJ A;  2NVL A;  3TGZ A;  5IO0 A;  2WFC A;  4FIW A;  4KAE A;  1PSQ A;  1B4P A;  1ERT A;  1I5G A;  4MF6 A;  1THO A;  3WYW A;  1BJX A;  1T1V A;  1PL1 A;  3PPU A;  5F0G A;  3WGX A;  2DKH A;  1XWG A;  5IMZ A;  2CZ3 A;  4AF2 A;  5BRT A;  4QQ7 A;  1TP9 A;  2L6D A;  1EOG A;  1M9B A;  1NHY A;  5A5K A;  2LRT A;  1GH2 A;  2A2S A;  2JZR A;  4EO3 A;  1ML6 A;  2YWN A;  5DVB A;  3FMW A;  2GQK A;  2DJK A;  4TR4 A;  3HXS A;  2CAQ A;  4L5O A;  1UA5 A;  3EYT A;  1HNB A;  2C0D A;  4EXJ A;  1FVJ A;  1K0D A;  4G0K A;  4L0W A;  4WBJ A;  2N5A A;  3CTG A;  1YY7 A;  2R0P A;  1EP8 A;  4G0L A;  3TCO A;  3S9F A;  2V41 A;  1SEN A;  5B8B A;  3QAW A;  2EIR A;  3GKK A;  4I5Q A;  1XBS A;  1HNA A;  1K0N A;  2ES7 A;  4JR6 A;  5ECS A;  1M9A A;  3ZYW A;  2VD0 A;  2VLU A;  3DYR A;  3HKR A;  3FZ5 A;  5DAL B;  3N9J A;  3VWU A;  6GSY A;  2MYG A;  5ECP B;  3C71 A;  4HQS A;  3DGQ A;  2WB9 A;  1TTZ A;  3MNG A;  2ZUP A;  3HVX A;  4XS6 A;  1Q98 A;  3IC4 A;  2IPA A;  3RAZ A;  1PA3 A;  4TOP A;  4MZC A;  1SL0 B;  5D9W A;  2VCX A;  5D9T A;  3LFL A;  2VM1 A;  3WGD A;  3H1N A;  2LJR A;  1GSD A;  2YV7 A;  2H1A A;  1TOF A;  3UOM A;  3ZMK A;  1XW6 A;  4ICY A;  1Z7R A;  1FB0 A;  1TJD A;  4V1A g;  5A4W A;  5KOW A;  4G2E A;  2REM A;  5CNW A;  2NBS A;  2K6V A;  1O81 A;  5ELG A;  2OE3 A;  1IYH A;  3W6G A;  2C0E A;  1BX9 A;  3ERG A;  1V9W A;  3FZ4 A;  1FB6 A;  22GS A;  1EEJ A;  3F3R A;  5CRW A;  4RQR A;  2LQO A;  1OC3 A;  1VF3 A;  1DE1 A;  3GH9 A;  4QL9 A;  4HDE A;  3TJB A;  3PH9 A;  1QK8 A;  3QMX A;  3KTB A;  1V98 A;  1QGV A;  2C3T A;  3ERW A;  20GS A;  4AJ8 A;  3D0Z A;  1SD8 A;  2NPB A;  3G7I A;  2XPD A;  2V1M A;  2FCH A;  5HFK A;  2XBQ A;  3L78 A;  3VWV A;  5KN2 A;  2KUC A;  2V6K A;  1IYI A;  1O6J A;  3IBH A;  2JZT A;  3M3M A;  4TRX A;  2LQQ A;  5D9V A;  5EL8 A;  4YAP A;  3GL3 A;  1K0C A;  6GSU A;  3ZVJ D;  1LU4 A;  3M8N A;  1A8L A;  1QFN A;  1BQ7 A;  2XPE A;  3PR8 A;  5AN1 A;  1O7U A;  4OO4 A;  5JWQ B;  2VL2 C;  1TI3 A;  5CP1 A;  3H79 A;  1A24 A;  3FZ9 A;  2X64 A;  2FWG A;  2GSS A;  3DML A;  5DJM A;  1X5C A;  5IIZ A;  5CYY A;  1WPI A;  6GSS A;  4BWS A;  4AGS A;  2CVB A;  3GN3 A;  1X0R A;  2F8F A;  3W8J A;  3NZN A;  5HFG A;  4KGI A;  1WE0 A;  4IKH A;  2VL2 A;  3ME7 A;  1PL2 A;  1CQH A;  1X5D A;  1GTI A;  1F2E A;  5DAL A;  4F2I A;  4RI7 A;  1VF2 A;  2CT6 A;  2H6X A;  1YJ6 A;  2PVQ A;  2A4H A;  3TDG A;  1G6Y A;  3F6D A;  2HRN A;  2IJY A;  3E0U A;  1AW9 A;  2MMO A;  2YV9 A;  4X43 A;  4K0N A;  4TKY A;  3OR5 A;  4EC0 A;  3ZRD A;  2HSH A;  4WR4 A;  3P7X A;  1XPV A;  4ZBD A;  1PKZ A;  2PMT A;  3K8N A;  4MJB A;  6GSV A;  1YF1 A;  4TXO B;  3ZIV A;  3H8Q A;  13GS A;  1WOU A;  2R4V A;  1X5E A;  2FD3 A;  1B9X C;  3HZ8 A;  4V1A p;  2R37 A;  2FA8 A;  2XC2 A;  3RPN A;  4F0C A;  3C8E A;  5ECI B;  4QL7 A;  4POB A;  4NWY A;  3FR3 A;  4TR0 A;  5D8I A;  3BBY A;  4GWR A;  1ZMA A;  4L8E A;  3C1S A;  3D4T A;  3QAV A;  3QOU A;  1ZOF A;  4J57 E;  2R0C A;  2HNL A;  4DEJ A;  2AV4 A;  2O85 A;  5EVO A;  3KCM A;  4JED A;  3L0H A;  2H01 A;  1MEK A;  5ID2 B;  4GF0 A;  6GST A;  5HR0 A;  12GS A;  3LEF A;  4CY6 A;  1JZR A;  1SK2 A;  4D73 A;  1ACV A;  3ISO A;  2MMA A;  3GHA A;  4ACS A;  5EY6 A;  4DVC A;  4HJM A;  2EIO A;  3KP9 A;  2E0Q A;  2QA1 A;  4BL7 B;  1G7E A;  1U3I A;  2H0I A;  3UL3 A;  3ZLP A;  2H8L A;  3VPT A;  4POK A;  1QMV A;  2L4C A;  2JSY A;  1RW1 A;  3F3Q A;  1FOV A;  4OCF A;  2KOK A;  5B7C A;  2YZH A;  4IP6 A;  4NHZ A;  4MPG A;  1WWJ A;  3F63 A;  1SJZ A;  8GSS A;  1EEM A;  3EIN A;  1GTA A;  5E4W A;  2C1Y A;  4JR4 A;  2F51 A;  4K8M A;  5FT3 A;  3APQ A;  4HZ4 A;  1GTB A;  3EPT A;  5JCG A;  4IJ3 A;  5EPF A;  1YZX A;  4XRD A;  2GLR A;  3QD9 A;  5L71 A;  1TRW A;  2HRF A;  4ISD A;  4F9Z A;  4Q5N A;  4BA7 A;  4E8H A;  4GQC A;  4MPF A;  4MK3 A;  4MF7 A;  4OCE A;  3GKX A;  5DQY A;  3FR6 A;  3O76 A;  3IHG A;  4HJ2 A;  1GSY A;  2OA7 A;  3VI5 A;  3BCI A;  4ECJ A;  3CRT A;  5ELA A;  4MCU A;  4O5Q A;  1THX A;  1A2M A;  3GV1 A;  2LNS A;  3DVX A;  5IMA A;  3LQ7 A;  2BMX A;  2ALB A;  5KEJ A;  4V2M A;  2VCQ A;  3HD5 A;  1JFU A;  3KMO A;  1U88 A;  3LXZ A;  1B8X A;  3KH7 A;  3VUR A;  4JRR A;  1A8Y A;  3L9V A;  5ECL B;  3M0F A;  3ME8 A;  3O6T A;  1PX6 A;  4TXO A;  1U3A A;  3GYK A;  3FR9 A;  3IV4 A;  4Q5F A;  9GSS A;  4YQU A;  3D4M A;  3BD2 A;  1T8E B;  5J9C A;  3HA9 A;  4L0U A;  4OD7 A;  5LCZ A;  2YOI A;  3QDN A;  3BCK A;  4OFT A;  2YNX A;  1K3L A;  4EIP A;  4ZB6 A;  2YJH A;  2AUV A;  4MLY A;  1ZZY A;  2AB6 A;  3MDK A;  1SYX A;  4WKW A;  4HS1 A;  1TKD B;  4TXV A;  1FOH A;  1M99 A;  2MBS A;  4IEL A;  5AIS A;  3R3E A;  1HNC A;  4J2F A;  1TDI A;  2VCZ A;  1WIK A;  3D22 A;  4IN0 A;  2IFQ B;  4USS A;  2YWI A;  3ZML A;  3HCZ A;  4I8B A;  4KSM A;  2ZCT A;  2H71 A;  2HT9 A;  5ID2 A;  2DKI A;  4HOJ A;  1DE2 A;  2C8U A;  1XFL A;  2TIR A;  6GSX A;  4OFM A;  2R5G A;  4Z2T A;  3NIV A;  2YP6 A;  4BL7 A;  1X9W B;  3QR6 A;  4YKG A;  4ZIJ A;  1SYR A;  2H76 A;  2P5Q A;  2CV4 A;  4BWQ A;  4O7H A;  4PUA A;  2F3M A;  5IQY A;  1PD2 1;  1I9D A;  5D9X A;  5GZZ B;  1F9M A;  2FA4 A;  2F8A A;  1T4Z A;  1YEP A;  1PX7 A;  4N0V A;  1JZD A;  1V57 A;  4KE3 A;  3TKS C;  5ECK B;  3TRQ A;  2GS3 A;  5B8A A;  4IW9 A;  4HEA 2;  1USB A;  2FY6 A;  1O85 A;  3VFI A;  2I81 A;  1YEX A;  3A2X A;  3IE3 A;  2YN1 A;  3EWL A;  1GUH A;  2I9H A;  1MTC A;  4E8E A;  4G10 A;  3IA1 A;  4PQI A;  4K5R A;  2PER A;  1OKD A;  2OBK A;  3MWH A;  3TKQ A;  2J23 A;  3TKS A;  2QSI A;  3QAG A;  2CA8 A;  3KZQ A;  4AJ6 A;  2GQL A;  3HJO A;  1A2J A;  3KM6 A;  1TU8 A;  2GT5 A;  1ILO A;  5G31 A;  3C1R A;  2GVP A;  1Y25 A;  3MSZ A;  3F9U A;  4I2T A;  2M80 A;  1AQW A;  1GTU A;  4KX4 A;  2H19 A;  3A3T A;  2B1K A;  2HZE B;  4V2L A;  5F05 A;  4FYC A;  1SKR B;  5ECH B;  2PN8 A;  2V6O A;  2TRX A;  2JAC A;  3O3T A;  2AYT A;  3R2Q A;  3IC8 A;  2X8G A;  1Z5Y E;  1SK1 A;  4ZIL A;  3APO A;  3CSI A;  3D21 A;  4KND A;  1AXD A;  5ECQ B;  4PNF A;  1GUK A;  5IO2 A;  3FHK A;  4PQ1 A;  2IME A;  4JU5 A;  3US3 A;  1KTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...