2INCC

Native toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
b'TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene, o-xylene monooxygenase oxygenase subunit
publication title X-ray crystal structures of manganese(II)-reconstituted and native toluene/o-xylene monooxygenase hydroxylase reveal rotamer shifts in conserved residues and an enhanced view of the protein interior.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 2incC00
4P1CC 3DHGC 4P1BC 3RNCC 3RN9C 3RMKC 3Q2AC 3RNBC 3GE8C 3Q14C 3RNFC 2INCC 3Q3MC 3N1YC 2RDBC 3DHHC 1T0RC 1T0SC 3RNAC 3I5JC 3RNGC 3N1ZC 2INDC 3DHIC 3Q3OC 1T0QC 3RNEC 3GE3C 3N20C 3I63C 3N1XC 3Q3NC 3RI7C
chains in the Genus database with same CATH superfamily
2HE7A 1NYQA 1GUAB 3DBHB 4RM9A 4HJKA 1VDVA 2ZW0A 3GP7A 2JZZA 2M4NA 2JX5A 3EA6A 3MJWA 2NBVB 2NBUA 1I7HA 4IUMB 3GZNB 2OHFA 1E7PB 3TCAA 1SJHD 5HHDG 1EM7A 1A5RA 4RFBA 3U4EG 5BO4B 2IPKD 2LHEA 4UDUC 1TS5A 3AE3B 1F77A 2N7JA 4C4VA 2DAFA 2IYDB 4RMAA 1L2NA 2M1MA 1G6JA 3MFGA 3Q8AA 3W2DA 4IM0A 2O6VA 1J0GA 4L2YA 1KRHA 3AEGB 3L08A 1EO6A 3O13A 1SJED 2RSUA 2WS3B 3Q2AC 3QK0A 4WJOA 3RZWC 3A9JA 5L95C 3DVGY 4KDIC 3ABVB 2K0PA 3H7PB 3N1XC 1Y8RC 2IDYA 3UIOB 3BIID 3MC9A 3P42A 3DBRB 1OQRA 5D2MB 4DHJB 2I1JA 2LFIA 1WJ6A 4ITKA 2RR9A 3TEWA 2BS3B 2I38A 3AXCA 3VUWA 2G4SA 1CMXB 3RCZA 4OZAA 2INDC 1Y56A 4MACA 2J52A 1E0ZA 3NHEB 4GOCA 4WAFA 3UQBA 3HK0A 1WGHA 2LVOA 1WFYA 4A55A 3PRPB 1STEA 2WDTB 4BOZB 1AWDA 3ZDTA 3R2TA 2LZ6A 1OQYA 1L4DB 2G9HD 4RH6A 3ZNHB 3SDLC 3ZRFA 5C23A 2MLBA 3W9CB 2YEPF 4M8NA 2IJ0A 4KSLC 2QILA 2QMTA 3KUDB 2ZCCA 3ZNID 3PHXB 1WXAA 4OZCA 2JWZA 4I6PA 1UNSA 2EKEC 3WAOA 3MP9A 3I63C 4PK1A 4M0WB 2XK5B 2D11A 1GG3A 1RAXA 1TY0A 2JYEA 3AE6B 4YSXB 1ZUD2 2KX3A 4O1NA 4W9KA 1FFUA 1K51A 4LDTD 1QOAA 1TZOA 4EE2A 4OVUA 2E6XA 3X23A 2GBMA 4USAA 3VUYA 2R2QA 3P4RB 1NBFC 4JWUC 3N20C 4AUQC 1YD8U 3BVMA 4IM3A 2D07B 3RI7C 3DVNU 4HVBA 5LXHA 4IM2A 4JQWC 3EGRA 3SR6A 2K6DB 2KOXA 1V97A 4JIOU 4B9KA 1SE9A 4MH0E 4C4VB 2V9HA 2J0JA 3DOWA 1T0QC 1J7BA 1XCTL 3NVYA 1GB1A 2O6VB 2GMIC 1ZDVA 4HPMB 3PZDA 1J7CA 4BAXA 1TYGB 3W1SC 2LJ5A 4LK0M 4MJSA 3A9JB 2MBOA 2LASA 4HPLB 1C79A 3ZNZB 1WY8A 2FCQA 1SB3C 2LGSA 3CWIA 3LYYA 4ZRJA 3SFDB 3N30A 1JWAD 3DPDA 3APDA 2W55A 3KYDD 3VQIA 4IG7B 1WXQA 2V1YA 1D3ZA 2QCZA 1ZOYB 2IBIB 1Q1OA 3A1QB 3I57A 3OG5A 3PLVA 2WU2B 2RGFA 5IP4D 2IO0B 1A70A 4R3DA 3RNEC 2NCNA 2BGFA 2M0AA 4MELA 2WYQA 2MWSB 2IY1B 1IUEA 1UUPA 4W9CA 5KHQA 1SXTA 2MBQA 1NDDA 2RMMA 1EU3A 1FIQA 4GIVA 1IP9A 3ZKJC 5J17A 1C4PA 1CZPA 2KWDA 3P4PB 4KDLB 3ZJTA 1EWYC 3V62A 1YN4A 4HCNB 2KKCA 1XLQA 1GAQB 4DDGD 1I4PA 4FBJB 4G11A 3ZUNA 1YN5A 1DOIA 2XBBC 1WE7A 2K8BA 2KN5A 5IOIA 4RGOS 3UQAA 1C1YB 2PTLA 1WGRA 4WWNA 5MPOA 1FFVA 1GC7A 2L52A 5AUIA 2O2VA 2V3SA 3ETRA 3AH7A 2BVCA 3CSTA 3J9CA 4AJWA 3M3JA 4IC7B 1TJEA 3L54A 1D4BA 1ISNA 4ICVA 3RULA 2GBRA 1FO4A 4ZRKA 4IW0A 2XNAC 3TEZA 5L83A 3VDZA 5G2NA 1BUIC 3NZ3A 1QF6A 1JCKB 4FN2A 4J3OD 4DXFA 4JPSA 3FILA 2NMQA 2LGIA 3UI3A 3RUIB 4DXAB 3R3MA 1J7AA 2L7RA 1K50A 4J6IA 3NS1A 5AZGA 3N32A 3W1YA 4ZRPA 4RGMA 3VH3B 4FXCA 3GOEA 1ZGUB 2CHWA 1QKZA 2QHOA 5JZEB 1HEZE 4BBNF 4GLSC 4X57B 5TR5A 3P4QB 3H1UA 2BYVE 1KTKA 1I4HA 3D32A 2KO3A 2FE8A 2LHDA 3MTNB 1PUTA 2GI9A 2Y5BB 1HZ6A 3BINA 3OWEB 2IGGA 2NVUI 4MJSB 1UGJA 3E56A 2W3SA 3HVZA 2GB1A 5BYSA 4RCOA 3R8BA 2CHZA 2OEDA 1XLOA 3QJZA 1KM7A 3APFA 1HA5A 2Y5CA 1JWBD 4WQMA 3U7DA 3ZJVA 2N7DA 3BWUD 3VTWA 3VHTC 3AEEB 4LNFA 4LDTB 2N9LA 3T8MA 2NPTA 2WXRA 2ACZB 1YQ3B 1TS4A 4DQOC 2VZKD 4A3PA 5KHOA 3B1LX 4LJOB 4LNNA 4TSSA 2RPQA 3EECA 1XLNA 3APCA 2KC2A 2RDGA 5DCNA 4I6NB 3RD2A 2KFKA 3ZXVA 4B0MA 2WNMA 1JW9D 4F7ZA 3TJPA 4WH4A 2FBWB 2YEPB 4IWQA 4JGHB 2KQSA 3OLMD 2OJWA 1XEEA 3AV8A 2BBCA 1JWUD 3CIRB 1V5TA 2SAKA 1PGAA 2K8HA 1WMHA 3ZTCA 2NR2A 2WXGA 1RFAA 2IGDA 3IT4B 2Y3AA 4LNKA 2C7MB 2KWUB 4N59A 1LM8B 2DHZA 1KLGD 3SD5A 4YWGG 1CQVA 1MG4A 4GXBA 2INNE 4TQ1A 1OFFA 2O2VB 3VR9B 4WQOB 2A4ZA 5JH5C 3ZLZA 5JXVA 2AQ2B 1CJEA 3T3OA 2DZKA 2KJ6A 2WLBA 4RGTA 3IVFA 4DHZB 1ESFA 3SHQA 1C3TA 3FAHA 2WDQB 2FIDA 1N5WA 4FHKA 4MH8A 2L76A 1K8RB 1ZE3D 3FILB 4EZLA 1WX8A 2C7HA 2JVCA 4K7SA 4E74A 4GB9A 3IT6B 2AL3A 2R2OA 4XZ4A 2NTTA 2KDMA 1YX5B 1I35A 3DCGA 3VFKA 1WR1A 3VUXA 3T9LA 2MRPA 1WRIA 4TV3A 1T3QA 3AN1A 4M00A 1I4GA 1PGXA 5CHVC 4C56C 1E8YA 1UF0A 4F8CB 4JE3B 5JHBA 3Q69A 3L17A 1L4ZB 3H8HA 5GMVA 4ZRQA 1ZXHA 1YQBA 4ARIA 3HM3A 2DWQA 2ZJDA 4AS1A 1WYGA 3AE7B 1PQSA 3DVGX 1PGBA 3URYA 1P1AA 4BKSD 4HPPA 1WR6E 3R7QA 3SEBA 4A6QA 2YVCA 2NPTB 3MHZA 2IO2B 4HKZE 4XE0A 1D5ZC 1XCQL 1T0SC 3H6NA 3BZDB 2D3AA 1N5XA 5DPSA 1JWSD 2BYFA 1GPXA 4XYCA 1FCLA 4LCDE 4MM3A 3LJ3A 4XX5A 2KTRA 2KN4A 3NVVA 1N60A 2NBWB 2KT7A 5EE3A 2M19A 2SEBD 2L8JA 2N9PC 1FEHA 4W9LA 4GN1A 3QIJA 4YTPB 1WMHB 2OOBB 1XQQA 3PRMB 1R4NB 2C9WB 2WXHA 3LXFA 1RFKA 1WGGA 2MBHA 4CQNA 3L10B 3EUB2 5E6JA 2N0SB 1V8CA 3C0RB 3AMZA 4HEA1 3KWVA 3ZGZA 2QSDA 3V05A 1HQRD 3DWGC 4BKSA 2IO3B 3E9SA 5T8IA 1NVID 5HI1A 4MT5A 4AQ7A 2BQQA 2JXXA 3Q3FA 2WX0A 2VZKB 2MP2A 3RNGC 4AOFA 4HDOA 3BYYB 4PS7A 2BW2A 4ZYNA 5I4DA 1NEKB 4JL9A 1MHXA 2KVZA 3BYTB 3JSVA 1IGCA 1BMLC 1KH0A 1RLFA 1I42A 2LI5A 4N9F4 2D5GA 4OVVA 2PE6B 3AU5A 1V1PB 1BXTA 2INCC 2M17A 3TMPB 3FKYA 1E6EB 3I5JC 3TEXA 2DAJA 3TL5A 4ZRIA 3VTUA 3L13A 2ZNVB 4WWMA 1L6VA 4US8A 1XLPA 2D3GA 4YXDB 5D6JB 4P1CC 3NZSA 4WAAA 1P7FA 5D7GA 3CF6E 4W9DA 3Q14C 1I4QA 3ZIMA 3U2SC 2DYOA 4PT5A 5E6PA 3BVZA 2PVGC 3KLSX 1S3SG 3V3XA 2LGXA 4GU2A 5AEKB 2HDEA 1JROA 3PTFC 2VH2A 2FUHB 3CSFA 1XXGA 4MSQB 4S0RA 4L1BA 3NG0A 3PVLA 1DGJA 2WXOA 1P9DU 4XDDA 3AE9B 3AEDB 4MM3B 2K9XA 4QAYA 1WIAA 2KTRB 2FUG1 1Q5WB 4FHJA 3QC8B 1ZDXA 3KQ4A 2KZRA 1C76A 2MW5A 2JU6X 1DYQA 1WX7A 3WA0A 2DZJA 4IWPA 3Q8CA 3QQ8B 3VAWA 2E3TA 1QZEA 3ZRCA 1N6ZA 3AE1B 4YSZB 3KWLA 2CJNA 2B3AA 3PLUA 1SE4A 1XO3A 4G0NB 1YMHE 3B9JA 2M56B 4MGIE 1B9RA 4KZ0A 1H8CA 3KH0A 1KLUD 2L1AA 2BT6A 1FCCC 2GOWA 3PGEA 1EU4A 2LJIA 3MC8A 5HG2A 2L00B 4KGRA 3AULA 2AWTA 3DBSA 3L16A 2ZW1A 1FNVA 2WXNA 4ACFA 1TTNA 4HLEA 5BYQA 2WQYB 3NZUA 2WXJA 2MP2B 2QJLA 1ROEA 3U52E 1NENB 4URKA 2KXJA 1HTQA 3AE2B 1ET9A 3RT3B 1MJDA 4RF0A 3QHTA 2DYBA 3JSVB 1RM6C 1WX9A 1N62A 1L7YA 3ZNGC 2H89B 1J8CA 2PJHA 1YOVB 3T3NA 4KZCA 1C4CA 2MSED 3Q3MC 4XWWA 3RNAC 4DBGA 2LUEA 1E90A 4HJGE 1V9JA 2ASQA 3UIPB 4KKJA 5TSSA 2C7NB 2CHXA 4MSMB 3SFEB 4IOIE 2LXCA 3RPFC 3NOBA 3EFCA 2G3QB 3QAQA 2WXMA 2BF8B 3BVGA 3QCAA 3P63A 3WIMA 2BTEA 2K3UA 4JX1C 1GOZA 1SEBD 4WURA 1UWMA 1OTRB 1JALA 3JVZX 1C78A 1I4XA 1Q10A 2JF5A 3DHIC 1UBQA 5IA7A 2DZMA 2FCMA 1EF1A 2D10A 2K25A 5EE9A 3HIZA 5LXIB 4NNJB 2K39A 2OJRA 4EZKA 2EKIA 2Q5WD 4OZBA 5C2TB 2REXA 2GBNA 2IGHA 2R61A 4WIPA 3ML8A 4HWIB 2BWES 3DQVA 4K7UA 2WX1A 3QWZB 1L0YB 4GDKA 2KTFA 4REZA 4OHJA 1UGMA 3Q8FA 3AEAB 1J19A 1EWCA 1LGRA 1FPYA 4US9A 3IHPC 1VZ8A 4HROA 2KANA 2FAZA 1NI3A 2I2YA 5G5GA 2NS5A 1TY2A 1YJ1A 1WGDA 1NYRA 4PS8A 3DDCB 3VH4B 2WDRB 2WP9B 4NAWA 4FLHA 5AZHA 5DPRA 3GB1A 1E7UA 1OEYA 3IBEA 1C77A 4K3CA 3AU4A 1WJ4A 1P3QU 4W9IA 4AP4C 1E8XA 2D3CA 1XT9B 5EE0A 2K1FA 1HZ5A 1VZ6A 1GJZA 4EUTA 3N3KB 4OVZA 2V4IB 2PMVA 5E6NA 4DHZE 1LFDA 1WGKA 2BKFA 2UWQA 5CHFA 3PPAA 1T0YA 2JXTA 1FM0D 2DYMA 1E7VA 2JWUA 3UINB 4W9FA 5IO9A 5HFYA 2MJDA 2Z0DB 2DENB 1TS3A 3IAS1 2LMCA 2ZPNA 2NTSA 4ZHPA 3ZYYX 2L3ZA 3WCQA 5J18A 4IKGA 4BBNC 4ANWA 2PVOD 1YX6B 5IN7A 4AJYB 1WJNA 2WXLA 3NUHB 3K9OB 2G4DB 2KAJA 4CHKA 1UWXA 4P16A 2PIAA 1ENFA 1VD2A 3ZQ4A 2KC1A 3AEBB 3DHGC 3V6CB 2HD5B 2VRRB 4PYUA 3ZO5B 2LWPA 4G3XB 3AE4B 2GBJA 4W9JA 1TKGA 2ZNVC 4NAMA 1FNWA 3SU8X 2GRIA 2KACA 4S17A 5D3DA 1R4MI 2MA9B 1TS2A 1TKEA 2C60A 4BKTA 2N9XA 1LO5D 2X38A 2JT4B 2QDFA 1TKYA 1VLBA 2D2QA 2L0FA 2JRHA 4RM8A 1N63A 1WRDB 3JYUA 1KFYB 1HE8A 2WXIA 4TUUA 4RGNA 1T0RC 4K7WA 2K6QA 1HTOA 4A8XC 2KLGA 4M01A 2KMCA 3H7PA 5AZFA 2RPVA 1NI2A 4HK2A 4FJZA 2KWCA 4GDKB 3PO0A 5D94A 3IFWB 2WHIA 2V0GA 3BK1A 3N1YC 1V1OA 2JY6A 1ACCA 2K5PA 1ZXIA 2LEKA 3PZ7A 3ZVVA 3ZTDA 5D3IB 1ZKHA 1Z2MA 2BS4B 3AE8B 3Q8BA 2AQ3B 2KQ7A 1RWSA 1WXVA 4E3CA 3W5UB 4NAWB 4ZOHC 1JMLA 1QILA 3ALBA 1F2RC 3RFZB 3P1MA 4II3B 3NY5A 3IXSA 5FKAC 4YSYB 1MFWA 3K9PB 4NPNA 1L6UA 2HTHA 4HRSA 4BFRA 3O65B 1WSPA 2KQ4X 1YJIA 4LNIA 1UELA 3OJ3A 1D6EC 2WDVB 5HKHA 1S1QB 3Q3JA 3B2FA 1FD6A 1FXIA 1PFDA 1TGZB 3KYCD 1L0VB 5CTRC 4HCPB 1IPGA 1DOYA 4HXDA 2KJRA 2MH7A 2MX2A 2UU7A 1F52A 2KFKB 3DVNV 1EF5A 1Z5SB 1ZW7A 4C00A 2FIFA 3U30A 2BYEA 3R7RA 2I1KA 2G1EA 3TUOA 1F2RI 3HUIA 2WXFA 3WANA 5JHAA 2LRUA 1VCBA 3NVZA 4PS3A 4NQLB 3QARA 4WJPA 4KKIA 1WJUA 5EE1A 2FCNA 3VRBB 2ZVOA 4YTNB 4YL8A 2BB6A 3TIXA 3Q8EA 4P1BC 1FRRA 4JWSC 4TQ0A 3B0AA 4W9EA 2BYTA 3ZXRA 1C9FA 1QT9A 2VH1A 4CO7A 2ZVNA 3H9DA 4ANUA 2DBYA 1YQ4B 4NJ7A 2JPHA 2ZCBA 4D2KA 1SF0A 2WWZA 3NRZA 1FXTB 3DBLI 1AARA 5EDSA 5H8YE 1DOXA 4KIKA 1D5XC 2L05A 2KYWA 2N7EA 3OAWA 1R4MB 4EZJA 3A9KA 1F1HA 1WI0A 1QOBA 3R2IA 3BK2A 3RYTA 2KX0A 3ML9A 1FNUA 2IY0B 1XD3B 3MJ5A 3NVWA 2DLBA 2GLSA 1AW7A 1OGWA 5FR3A 4WWOA 3R66C 3KUCB 2IO1B 4ASWC 2J4XA 1QOGA 3U8ZA 1JRPA 3GE8C 4EOYA 2CS4A 4G50A 3A1QA 4ZYSA 3EFUA 1WYWB 3ZDMC 1RRBA 5J2RA 5CHWA 4WJQA 2WXPA 5LLIA 3PT2B 5BMHA 3M95A 2ZEQA 4IWOA 4OW0A 3KUZA 1IBXA 1EUVB 1B1ZA 1T5XD 3RNBC 2J42A 4TKNA 1WGYA 3W5VB 4W9HA 2WXKA 4N6EB 3GE3C 2BS2B 1V2YA 5G55A 3RNCC 3N9YC 3RMKC 2HJ1A 2JQRB 4EEWA 2PEAA 4FJVB 1MPEA 1VJKA 2A5UA 4RNAA 5C3JB 4KX6B 5CX3A 4RF1A 2PKOA 2MBBB 2KD0A 4MGYE 2H88B 2WGSA 2MQJA 1ZPSA 3PHWB 3PREA 3L4PA 3PS6A 2KJHB 4ANVA 4DK5A 4B95A 2LD9A 3VVWB 2AEHA 5DPWA 4LJPB 1VRAB 1VZ7A 3VR8B 1C4AA 3PRZA 2LRWA 3TEYA 3UF8A 2Z0EB 4MDKE 4K81A 1F0ZA 4NY0A 5H92C 5BYRA 4KV2A 3EHVA 1SE2A 2LGYA 3VTVA 2N9EB 2JYTA 4MEMA 2D3BA 4FA6A 5E6OA 1SIFA 1LQBA 2W9NA 1SGHA 1MG8A 2EMSA 4XGAB 2BWFA 1RYJA 4ANXA 4N58A 3KVFB 4KIKB 1UD7A 4ZHOA 1SSNA 2WU5B 3DBLB 4GSWA 3VXWA 1HXYD 3A9KB 2LGDA 4B0EA 2QEJC 2KWVB 2KHWB 2HTME 4E71A 2CR5A 3C19A 1TBEA 2MJ3A 2ICIA 1V80A 2HJ8A 1QLBB 2JZ3B 4FJYA 4NJCA 1IYFA 1UZXB 2KMMA 2V4LA 4XDCA 1D5MC 1TT5B 2YLMA 1ET6A 1R7SA 5FR6A 4BZAA 2EELA 4P7IA 2JRIB 3EC8A 1V81A 2PW9A 4M02A 4ARCA 2Z59B 1YNTE 2KK8A 3C8YA 2JUOA 1AYFA 1V49A 1FXAA 1GC6A 3HVDA 3AB5A 3PZ8A 2J53A 3AI5A 4GGQA 2CKHB 3NJTA 4EKUA 1IBXB 2ZPYA 1WM2A 2N4FA 5AUKA 1WXMA 2QC8A 3W1SA 2JSVX 3V60A 1KF6B 2AQ1B 1SE3A 2N1VA 2IZVB 2BKRB 1PDXA 1CK1A 3QX1A 4BKGA 5BMIA 2AYOB 4HDQA 1T6BX 2KDBA 2KVRA 2DNFA 1N61A 1M94A 4K1RB 3CMMB 5G5HA 2L83A 3QA8A 1K53A 1UH6A 1E8WA 3NS8A 2FCSA 2JZPA 2DZIA 1KLVA 3HRDD 1U4AA 2L32A 3GS2A 1WE6A 4KVGB 1GB4A 3WAPA 1X1MA 4Q2JA 1FRDA 2Z8LA 4K3BA 1YIWA 2BB5A 1PYWD 1OEYJ 4I6LB 1WZ3A 2PE9A 2EMTA 3PV1A 4B6WA 4KGTA 2KDFB 4GDLA 5BMGA 1V5OA 4EFOA 3I3TB 2ON8A 2J0KA 3X0WA 3HM6X 3I9V1 1P7EA 2M0XA 3A4RA 3ZJUA 1SBBB 1V6EA 2L0TA 1JQ4A 3A33B 4JLCA 3RNFC 2LVPA 2AL6A 1V86A 2V3PA 2W54A 1I4RA 2LUMA 2LXAA 4C80A 1WWTA 1Q0WB 3M63B 1L0XB 2G45B 4CYEA 3AECB 1KOTA 2MHJA 3IAM1 2XN9C 1UBIA 1VR9A 2B76B 2TSSA 1ZP0B 2N9KA 4A3OA 2RDHA 4XWTA 4TMAB 2J0MA 3Q3OC 4YTMB 3M62B 4A20A 3DBHI 4FADA 1FMAD 1YN3A 4DWFA 3Q3NC 2DX5B 4MGKE 3U7ZA 2KLCA 3BY4B 1LXDA 4ICUA 3DWMA 4II2B 2KFJA 4DHJD 3ECIA 2W82A 4A90A 1WXSA 2UYZB 3GZNI 4KSKC 1JWMD 4LLGM 3N1ZC 2K22A 4H2AA 5IAAC 3WAMA 1F9JA 2KDIA 2CJOA 2Y5PA 4IDIA 2X8XX 3S2AA 1AN8A 4C7YA 3AEFB 1P0RA 3MC0B 2PLPA 4F1SA 5IKCM 4L23A 2LVQA 4HKQA 3ONSA 4DXGA 1JRUA 2BPSA 3ENEA 1BT0A 1R4NI 1MVKA 2PPHA 2W3RA 3V6EB 4WJNA 2FNJB 1K52A 3PSEB 3ZW3A 3HHMA 2V3NA 4P6VF 1MHHE 3Q6BA 1KJTA 2INPE 5LNK1 1QQRA 1MI0A 1L5PA 3LDZE 2XEWA 1E8ZA 4MGZE 4PYZA 5C1ZA 2MCNB 5FK9C 4BVUC 2C5LC 3DBRI 3AM9A 2K8CA 2MBEA 2CU3A 2KDEB 4GMVA 2MEKA 1E9MA 3IG3A 2QIEB 4WWPA 3VRAB 4FULA 2N1WA 3FC4A 2RDBC 3TBLD 2KNBA 2AX5A 3MHSD 4KGSA 4GDLB 1WH3A 1OQQA 1GNUA 4AWJA 2CU1A 4M8MA 4NQKE 4C7ZA 1TZ1A 2WXQA 4NZLB 2ZZPB 2GBKA 2MJEA 3A4SC 1SIJA 2KMAA 3JW0X 3WALA 1WZ0A 1XF5L 1M4VA 3TSSA 3RN9C 4LTUA 4A9AA 2M8SA 1V1PA 1H4RA 4XC2A 3UGBB 4YT0B 4LNOA 3P4SB 4BOSC 1QOFA 3L0WB 2O6VD 5GXGB 3H7SA 3P2BA 2RD0A 4DDID 1E5WA 4W9GA 1WM3A 3OJ4B 2J7QB 3RZFA 3DHHC 1TIFA 3B2GA 3AE5B 4ZDVA 4NJ6A 2ONQA 1YJJA 1E10A 1WF9A 3LB8C 5DPTA 1P98A 3KW5B 1IGDA 3V61A 3B08A 4M0WA 2XK5A
chains in the Genus database with same CATH topology
4P1CC 3DHGC 4P1BC 3RNCC 3RN9C 3RMKC 3Q2AC 3RNBC 3GE8C 3Q14C 3RNFC 2INCC 3Q3MC 3N1YC 2RDBC 3DHHC 1T0RC 1T0SC 3RNAC 3I5JC 3RNGC 3N1ZC 2INDC 3DHIC 3Q3OC 1T0QC 3RNEC 3GE3C 3N20C 3I63C 3N1XC 3Q3NC 3RI7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1C C;  3DHG C;  4P1B C;  3RNC C;  3RN9 C;  3RMK C;  3Q2A C;  3RNB C;  3GE8 C;  3Q14 C;  3RNF C;  2INC C;  3Q3M C;  3N1Y C;  2RDB C;  3DHH C;  1T0R C;  1T0S C;  3RNA C;  3I5J C;  3RNG C;  3N1Z C;  2IND C;  3DHI C;  3Q3O C;  1T0Q C;  3RNE C;  3GE3 C;  3N20 C;  3I63 C;  3N1X C;  3Q3N C;  3RI7 C; 
#chains in the Genus database with same CATH topology
 2HE7 A;  1NYQ A;  1GUA B;  3DBH B;  4RM9 A;  4HJK A;  1VDV A;  2ZW0 A;  3GP7 A;  2JZZ A;  2M4N A;  2JX5 A;  3EA6 A;  3MJW A;  2NBV B;  2NBU A;  1I7H A;  4IUM B;  3GZN B;  2OHF A;  1E7P B;  3TCA A;  1SJH D;  5HHD G;  1EM7 A;  1A5R A;  4RFB A;  3U4E G;  5BO4 B;  2IPK D;  2LHE A;  4UDU C;  1TS5 A;  3AE3 B;  1F77 A;  2N7J A;  4C4V A;  2DAF A;  2IYD B;  4RMA A;  1L2N A;  2M1M A;  1G6J A;  3MFG A;  3Q8A A;  3W2D A;  4IM0 A;  2O6V A;  1J0G A;  4L2Y A;  1KRH A;  3AEG B;  3L08 A;  1EO6 A;  3O13 A;  1SJE D;  2RSU A;  2WS3 B;  3Q2A C;  3QK0 A;  4WJO A;  3RZW C;  3A9J A;  5L95 C;  3DVG Y;  4KDI C;  3ABV B;  2K0P A;  3H7P B;  3N1X C;  1Y8R C;  2IDY A;  3UIO B;  3BII D;  3MC9 A;  3P42 A;  3DBR B;  1OQR A;  5D2M B;  4DHJ B;  2I1J A;  2LFI A;  1WJ6 A;  4ITK A;  2RR9 A;  3TEW A;  2BS3 B;  2I38 A;  3AXC A;  3VUW A;  2G4S A;  1CMX B;  3RCZ A;  4OZA A;  2IND C;  1Y56 A;  4MAC A;  2J52 A;  1E0Z A;  3NHE B;  4GOC A;  4WAF A;  3UQB A;  3HK0 A;  1WGH A;  2LVO A;  1WFY A;  4A55 A;  3PRP B;  1STE A;  2WDT B;  4BOZ B;  1AWD A;  3ZDT A;  3R2T A;  2LZ6 A;  1OQY A;  1L4D B;  2G9H D;  4RH6 A;  3ZNH B;  3SDL C;  3ZRF A;  5C23 A;  2MLB A;  3W9C B;  2YEP F;  4M8N A;  2IJ0 A;  4KSL C;  2QIL A;  2QMT A;  3KUD B;  2ZCC A;  3ZNI D;  3PHX B;  1WXA A;  4OZC A;  2JWZ A;  4I6P A;  1UNS A;  2EKE C;  3WAO A;  3MP9 A;  3I63 C;  4PK1 A;  4M0W B;  2XK5 B;  2D11 A;  1GG3 A;  1RAX A;  1TY0 A;  2JYE A;  3AE6 B;  4YSX B;  1ZUD 2;  2KX3 A;  4O1N A;  4W9K A;  1FFU A;  1K51 A;  4LDT D;  1QOA A;  1TZO A;  4EE2 A;  4OVU A;  2E6X A;  3X23 A;  2GBM A;  4USA A;  3VUY A;  2R2Q A;  3P4R B;  1NBF C;  4JWU C;  3N20 C;  4AUQ C;  1YD8 U;  3BVM A;  4IM3 A;  2D07 B;  3RI7 C;  3DVN U;  4HVB A;  5LXH A;  4IM2 A;  4JQW C;  3EGR A;  3SR6 A;  2K6D B;  2KOX A;  1V97 A;  4JIO U;  4B9K A;  1SE9 A;  4MH0 E;  4C4V B;  2V9H A;  2J0J A;  3DOW A;  1T0Q C;  1J7B A;  1XCT L;  3NVY A;  1GB1 A;  2O6V B;  2GMI C;  1ZDV A;  4HPM B;  3PZD A;  1J7C A;  4BAX A;  1TYG B;  3W1S C;  2LJ5 A;  4LK0 M;  4MJS A;  3A9J B;  2MBO A;  2LAS A;  4HPL B;  1C79 A;  3ZNZ B;  1WY8 A;  2FCQ A;  1SB3 C;  2LGS A;  3CWI A;  3LYY A;  4ZRJ A;  3SFD B;  3N30 A;  1JWA D;  3DPD A;  3APD A;  2W55 A;  3KYD D;  3VQI A;  4IG7 B;  1WXQ A;  2V1Y A;  1D3Z A;  2QCZ A;  1ZOY B;  2IBI B;  1Q1O A;  3A1Q B;  3I57 A;  3OG5 A;  3PLV A;  2WU2 B;  2RGF A;  5IP4 D;  2IO0 B;  1A70 A;  4R3D A;  3RNE C;  2NCN A;  2BGF A;  2M0A A;  4MEL A;  2WYQ A;  2MWS B;  2IY1 B;  1IUE A;  1UUP A;  4W9C A;  5KHQ A;  1SXT A;  2MBQ A;  1NDD A;  2RMM A;  1EU3 A;  1FIQ A;  4GIV A;  1IP9 A;  3ZKJ C;  5J17 A;  1C4P A;  1CZP A;  2KWD A;  3P4P B;  4KDL B;  3ZJT A;  1EWY C;  3V62 A;  1YN4 A;  4HCN B;  2KKC A;  1XLQ A;  1GAQ B;  4DDG D;  1I4P A;  4FBJ B;  4G11 A;  3ZUN A;  1YN5 A;  1DOI A;  2XBB C;  1WE7 A;  2K8B A;  2KN5 A;  5IOI A;  4RGO S;  3UQA A;  1C1Y B;  2PTL A;  1WGR A;  4WWN A;  5MPO A;  1FFV A;  1GC7 A;  2L52 A;  5AUI A;  2O2V A;  2V3S A;  3ETR A;  3AH7 A;  2BVC A;  3CST A;  3J9C A;  4AJW A;  3M3J A;  4IC7 B;  1TJE A;  3L54 A;  1D4B A;  1ISN A;  4ICV A;  3RUL A;  2GBR A;  1FO4 A;  4ZRK A;  4IW0 A;  2XNA C;  3TEZ A;  5L83 A;  3VDZ A;  5G2N A;  1BUI C;  3NZ3 A;  1QF6 A;  1JCK B;  4FN2 A;  4J3O D;  4DXF A;  4JPS A;  3FIL A;  2NMQ A;  2LGI A;  3UI3 A;  3RUI B;  4DXA B;  3R3M A;  1J7A A;  2L7R A;  1K50 A;  4J6I A;  3NS1 A;  5AZG A;  3N32 A;  3W1Y A;  4ZRP A;  4RGM A;  3VH3 B;  4FXC A;  3GOE A;  1ZGU B;  2CHW A;  1QKZ A;  2QHO A;  5JZE B;  1HEZ E;  4BBN F;  4GLS C;  4X57 B;  5TR5 A;  3P4Q B;  3H1U A;  2BYV E;  1KTK A;  1I4H A;  3D32 A;  2KO3 A;  2FE8 A;  2LHD A;  3MTN B;  1PUT A;  2GI9 A;  2Y5B B;  1HZ6 A;  3BIN A;  3OWE B;  2IGG A;  2NVU I;  4MJS B;  1UGJ A;  3E56 A;  2W3S A;  3HVZ A;  2GB1 A;  5BYS A;  4RCO A;  3R8B A;  2CHZ A;  2OED A;  1XLO A;  3QJZ A;  1KM7 A;  3APF A;  1HA5 A;  2Y5C A;  1JWB D;  4WQM A;  3U7D A;  3ZJV A;  2N7D A;  3BWU D;  3VTW A;  3VHT C;  3AEE B;  4LNF A;  4LDT B;  2N9L A;  3T8M A;  2NPT A;  2WXR A;  2ACZ B;  1YQ3 B;  1TS4 A;  4DQO C;  2VZK D;  4A3P A;  5KHO A;  3B1L X;  4LJO B;  4LNN A;  4TSS A;  2RPQ A;  3EEC A;  1XLN A;  3APC A;  2KC2 A;  2RDG A;  5DCN A;  4I6N B;  3RD2 A;  2KFK A;  3ZXV A;  4B0M A;  2WNM A;  1JW9 D;  4F7Z A;  3TJP A;  4WH4 A;  2FBW B;  2YEP B;  4IWQ A;  4JGH B;  2KQS A;  3OLM D;  2OJW A;  1XEE A;  3AV8 A;  2BBC A;  1JWU D;  3CIR B;  1V5T A;  2SAK A;  1PGA A;  2K8H A;  1WMH A;  3ZTC A;  2NR2 A;  2WXG A;  1RFA A;  2IGD A;  3IT4 B;  2Y3A A;  4LNK A;  2C7M B;  2KWU B;  4N59 A;  1LM8 B;  2DHZ A;  1KLG D;  3SD5 A;  4YWG G;  1CQV A;  1MG4 A;  4GXB A;  2INN E;  4TQ1 A;  1OFF A;  2O2V B;  3VR9 B;  4WQO B;  2A4Z A;  5JH5 C;  3ZLZ A;  5JXV A;  2AQ2 B;  1CJE A;  3T3O A;  2DZK A;  2KJ6 A;  2WLB A;  4RGT A;  3IVF A;  4DHZ B;  1ESF A;  3SHQ A;  1C3T A;  3FAH A;  2WDQ B;  2FID A;  1N5W A;  4FHK A;  4MH8 A;  2L76 A;  1K8R B;  1ZE3 D;  3FIL B;  4EZL A;  1WX8 A;  2C7H A;  2JVC A;  4K7S A;  4E74 A;  4GB9 A;  3IT6 B;  2AL3 A;  2R2O A;  4XZ4 A;  2NTT A;  2KDM A;  1YX5 B;  1I35 A;  3DCG A;  3VFK A;  1WR1 A;  3VUX A;  3T9L A;  2MRP A;  1WRI A;  4TV3 A;  1T3Q A;  3AN1 A;  4M00 A;  1I4G A;  1PGX A;  5CHV C;  4C56 C;  1E8Y A;  1UF0 A;  4F8C B;  4JE3 B;  5JHB A;  3Q69 A;  3L17 A;  1L4Z B;  3H8H A;  5GMV A;  4ZRQ A;  1ZXH A;  1YQB A;  4ARI A;  3HM3 A;  2DWQ A;  2ZJD A;  4AS1 A;  1WYG A;  3AE7 B;  1PQS A;  3DVG X;  1PGB A;  3URY A;  1P1A A;  4BKS D;  4HPP A;  1WR6 E;  3R7Q A;  3SEB A;  4A6Q A;  2YVC A;  2NPT B;  3MHZ A;  2IO2 B;  4HKZ E;  4XE0 A;  1D5Z C;  1XCQ L;  1T0S C;  3H6N A;  3BZD B;  2D3A A;  1N5X A;  5DPS A;  1JWS D;  2BYF A;  1GPX A;  4XYC A;  1FCL A;  4LCD E;  4MM3 A;  3LJ3 A;  4XX5 A;  2KTR A;  2KN4 A;  3NVV A;  1N60 A;  2NBW B;  2KT7 A;  5EE3 A;  2M19 A;  2SEB D;  2L8J A;  2N9P C;  1FEH A;  4W9L A;  4GN1 A;  3QIJ A;  4YTP B;  1WMH B;  2OOB B;  1XQQ A;  3PRM B;  1R4N B;  2C9W B;  2WXH A;  3LXF A;  1RFK A;  1WGG A;  2MBH A;  4CQN A;  3L10 B;  3EUB 2;  5E6J A;  2N0S B;  1V8C A;  3C0R B;  3AMZ A;  4HEA 1;  3KWV A;  3ZGZ A;  2QSD A;  3V05 A;  1HQR D;  3DWG C;  4BKS A;  2IO3 B;  3E9S A;  5T8I A;  1NVI D;  5HI1 A;  4MT5 A;  4AQ7 A;  2BQQ A;  2JXX A;  3Q3F A;  2WX0 A;  2VZK B;  2MP2 A;  3RNG C;  4AOF A;  4HDO A;  3BYY B;  4PS7 A;  2BW2 A;  4ZYN A;  5I4D A;  1NEK B;  4JL9 A;  1MHX A;  2KVZ A;  3BYT B;  3JSV A;  1IGC A;  1BML C;  1KH0 A;  1RLF A;  1I42 A;  2LI5 A;  4N9F 4;  2D5G A;  4OVV A;  2PE6 B;  3AU5 A;  1V1P B;  1BXT A;  2INC C;  2M17 A;  3TMP B;  3FKY A;  1E6E B;  3I5J C;  3TEX A;  2DAJ A;  3TL5 A;  4ZRI A;  3VTU A;  3L13 A;  2ZNV B;  4WWM A;  1L6V A;  4US8 A;  1XLP A;  2D3G A;  4YXD B;  5D6J B;  4P1C C;  3NZS A;  4WAA A;  1P7F A;  5D7G A;  3CF6 E;  4W9D A;  3Q14 C;  1I4Q A;  3ZIM A;  3U2S C;  2DYO A;  4PT5 A;  5E6P A;  3BVZ A;  2PVG C;  3KLS X;  1S3S G;  3V3X A;  2LGX A;  4GU2 A;  5AEK B;  2HDE A;  1JRO A;  3PTF C;  2VH2 A;  2FUH B;  3CSF A;  1XXG A;  4MSQ B;  4S0R A;  4L1B A;  3NG0 A;  3PVL A;  1DGJ A;  2WXO A;  1P9D U;  4XDD A;  3AE9 B;  3AED B;  4MM3 B;  2K9X A;  4QAY A;  1WIA A;  2KTR B;  2FUG 1;  1Q5W B;  4FHJ A;  3QC8 B;  1ZDX A;  3KQ4 A;  2KZR A;  1C76 A;  2MW5 A;  2JU6 X;  1DYQ A;  1WX7 A;  3WA0 A;  2DZJ A;  4IWP A;  3Q8C A;  3QQ8 B;  3VAW A;  2E3T A;  1QZE A;  3ZRC A;  1N6Z A;  3AE1 B;  4YSZ B;  3KWL A;  2CJN A;  2B3A A;  3PLU A;  1SE4 A;  1XO3 A;  4G0N B;  1YMH E;  3B9J A;  2M56 B;  4MGI E;  1B9R A;  4KZ0 A;  1H8C A;  3KH0 A;  1KLU D;  2L1A A;  2BT6 A;  1FCC C;  2GOW A;  3PGE A;  1EU4 A;  2LJI A;  3MC8 A;  5HG2 A;  2L00 B;  4KGR A;  3AUL A;  2AWT A;  3DBS A;  3L16 A;  2ZW1 A;  1FNV A;  2WXN A;  4ACF A;  1TTN A;  4HLE A;  5BYQ A;  2WQY B;  3NZU A;  2WXJ A;  2MP2 B;  2QJL A;  1ROE A;  3U52 E;  1NEN B;  4URK A;  2KXJ A;  1HTQ A;  3AE2 B;  1ET9 A;  3RT3 B;  1MJD A;  4RF0 A;  3QHT A;  2DYB A;  3JSV B;  1RM6 C;  1WX9 A;  1N62 A;  1L7Y A;  3ZNG C;  2H89 B;  1J8C A;  2PJH A;  1YOV B;  3T3N A;  4KZC A;  1C4C A;  2MSE D;  3Q3M C;  4XWW A;  3RNA C;  4DBG A;  2LUE A;  1E90 A;  4HJG E;  1V9J A;  2ASQ A;  3UIP B;  4KKJ A;  5TSS A;  2C7N B;  2CHX A;  4MSM B;  3SFE B;  4IOI E;  2LXC A;  3RPF C;  3NOB A;  3EFC A;  2G3Q B;  3QAQ A;  2WXM A;  2BF8 B;  3BVG A;  3QCA A;  3P63 A;  3WIM A;  2BTE A;  2K3U A;  4JX1 C;  1GOZ A;  1SEB D;  4WUR A;  1UWM A;  1OTR B;  1JAL A;  3JVZ X;  1C78 A;  1I4X A;  1Q10 A;  2JF5 A;  3DHI C;  1UBQ A;  5IA7 A;  2DZM A;  2FCM A;  1EF1 A;  2D10 A;  2K25 A;  5EE9 A;  3HIZ A;  5LXI B;  4NNJ B;  2K39 A;  2OJR A;  4EZK A;  2EKI A;  2Q5W D;  4OZB A;  5C2T B;  2REX A;  2GBN A;  2IGH A;  2R61 A;  4WIP A;  3ML8 A;  4HWI B;  2BWE S;  3DQV A;  4K7U A;  2WX1 A;  3QWZ B;  1L0Y B;  4GDK A;  2KTF A;  4REZ A;  4OHJ A;  1UGM A;  3Q8F A;  3AEA B;  1J19 A;  1EWC A;  1LGR A;  1FPY A;  4US9 A;  3IHP C;  1VZ8 A;  4HRO A;  2KAN A;  2FAZ A;  1NI3 A;  2I2Y A;  5G5G A;  2NS5 A;  1TY2 A;  1YJ1 A;  1WGD A;  1NYR A;  4PS8 A;  3DDC B;  3VH4 B;  2WDR B;  2WP9 B;  4NAW A;  4FLH A;  5AZH A;  5DPR A;  3GB1 A;  1E7U A;  1OEY A;  3IBE A;  1C77 A;  4K3C A;  3AU4 A;  1WJ4 A;  1P3Q U;  4W9I A;  4AP4 C;  1E8X A;  2D3C A;  1XT9 B;  5EE0 A;  2K1F A;  1HZ5 A;  1VZ6 A;  1GJZ A;  4EUT A;  3N3K B;  4OVZ A;  2V4I B;  2PMV A;  5E6N A;  4DHZ E;  1LFD A;  1WGK A;  2BKF A;  2UWQ A;  5CHF A;  3PPA A;  1T0Y A;  2JXT A;  1FM0 D;  2DYM A;  1E7V A;  2JWU A;  3UIN B;  4W9F A;  5IO9 A;  5HFY A;  2MJD A;  2Z0D B;  2DEN B;  1TS3 A;  3IAS 1;  2LMC A;  2ZPN A;  2NTS A;  4ZHP A;  3ZYY X;  2L3Z A;  3WCQ A;  5J18 A;  4IKG A;  4BBN C;  4ANW A;  2PVO D;  1YX6 B;  5IN7 A;  4AJY B;  1WJN A;  2WXL A;  3NUH B;  3K9O B;  2G4D B;  2KAJ A;  4CHK A;  1UWX A;  4P16 A;  2PIA A;  1ENF A;  1VD2 A;  3ZQ4 A;  2KC1 A;  3AEB B;  3DHG C;  3V6C B;  2HD5 B;  2VRR B;  4PYU A;  3ZO5 B;  2LWP A;  4G3X B;  3AE4 B;  2GBJ A;  4W9J A;  1TKG A;  2ZNV C;  4NAM A;  1FNW A;  3SU8 X;  2GRI A;  2KAC A;  4S17 A;  5D3D A;  1R4M I;  2MA9 B;  1TS2 A;  1TKE A;  2C60 A;  4BKT A;  2N9X A;  1LO5 D;  2X38 A;  2JT4 B;  2QDF A;  1TKY A;  1VLB A;  2D2Q A;  2L0F A;  2JRH A;  4RM8 A;  1N63 A;  1WRD B;  3JYU A;  1KFY B;  1HE8 A;  2WXI A;  4TUU A;  4RGN A;  1T0R C;  4K7W A;  2K6Q A;  1HTO A;  4A8X C;  2KLG A;  4M01 A;  2KMC A;  3H7P A;  5AZF A;  2RPV A;  1NI2 A;  4HK2 A;  4FJZ A;  2KWC A;  4GDK B;  3PO0 A;  5D94 A;  3IFW B;  2WHI A;  2V0G A;  3BK1 A;  3N1Y C;  1V1O A;  2JY6 A;  1ACC A;  2K5P A;  1ZXI A;  2LEK A;  3PZ7 A;  3ZVV A;  3ZTD A;  5D3I B;  1ZKH A;  1Z2M A;  2BS4 B;  3AE8 B;  3Q8B A;  2AQ3 B;  2KQ7 A;  1RWS A;  1WXV A;  4E3C A;  3W5U B;  4NAW B;  4ZOH C;  1JML A;  1QIL A;  3ALB A;  1F2R C;  3RFZ B;  3P1M A;  4II3 B;  3NY5 A;  3IXS A;  5FKA C;  4YSY B;  1MFW A;  3K9P B;  4NPN A;  1L6U A;  2HTH A;  4HRS A;  4BFR A;  3O65 B;  1WSP A;  2KQ4 X;  1YJI A;  4LNI A;  1UEL A;  3OJ3 A;  1D6E C;  2WDV B;  5HKH A;  1S1Q B;  3Q3J A;  3B2F A;  1FD6 A;  1FXI A;  1PFD A;  1TGZ B;  3KYC D;  1L0V B;  5CTR C;  4HCP B;  1IPG A;  1DOY A;  4HXD A;  2KJR A;  2MH7 A;  2MX2 A;  2UU7 A;  1F52 A;  2KFK B;  3DVN V;  1EF5 A;  1Z5S B;  1ZW7 A;  4C00 A;  2FIF A;  3U30 A;  2BYE A;  3R7R A;  2I1K A;  2G1E A;  3TUO A;  1F2R I;  3HUI A;  2WXF A;  3WAN A;  5JHA A;  2LRU A;  1VCB A;  3NVZ A;  4PS3 A;  4NQL B;  3QAR A;  4WJP A;  4KKI A;  1WJU A;  5EE1 A;  2FCN A;  3VRB B;  2ZVO A;  4YTN B;  4YL8 A;  2BB6 A;  3TIX A;  3Q8E A;  4P1B C;  1FRR A;  4JWS C;  4TQ0 A;  3B0A A;  4W9E A;  2BYT A;  3ZXR A;  1C9F A;  1QT9 A;  2VH1 A;  4CO7 A;  2ZVN A;  3H9D A;  4ANU A;  2DBY A;  1YQ4 B;  4NJ7 A;  2JPH A;  2ZCB A;  4D2K A;  1SF0 A;  2WWZ A;  3NRZ A;  1FXT B;  3DBL I;  1AAR A;  5EDS A;  5H8Y E;  1DOX A;  4KIK A;  1D5X C;  2L05 A;  2KYW A;  2N7E A;  3OAW A;  1R4M B;  4EZJ A;  3A9K A;  1F1H A;  1WI0 A;  1QOB A;  3R2I A;  3BK2 A;  3RYT A;  2KX0 A;  3ML9 A;  1FNU A;  2IY0 B;  1XD3 B;  3MJ5 A;  3NVW A;  2DLB A;  2GLS A;  1AW7 A;  1OGW A;  5FR3 A;  4WWO A;  3R66 C;  3KUC B;  2IO1 B;  4ASW C;  2J4X A;  1QOG A;  3U8Z A;  1JRP A;  3GE8 C;  4EOY A;  2CS4 A;  4G50 A;  3A1Q A;  4ZYS A;  3EFU A;  1WYW B;  3ZDM C;  1RRB A;  5J2R A;  5CHW A;  4WJQ A;  2WXP A;  5LLI A;  3PT2 B;  5BMH A;  3M95 A;  2ZEQ A;  4IWO A;  4OW0 A;  3KUZ A;  1IBX A;  1EUV B;  1B1Z A;  1T5X D;  3RNB C;  2J42 A;  4TKN A;  1WGY A;  3W5V B;  4W9H A;  2WXK A;  4N6E B;  3GE3 C;  2BS2 B;  1V2Y A;  5G55 A;  3RNC C;  3N9Y C;  3RMK C;  2HJ1 A;  2JQR B;  4EEW A;  2PEA A;  4FJV B;  1MPE A;  1VJK A;  2A5U A;  4RNA A;  5C3J B;  4KX6 B;  5CX3 A;  4RF1 A;  2PKO A;  2MBB B;  2KD0 A;  4MGY E;  2H88 B;  2WGS A;  2MQJ A;  1ZPS A;  3PHW B;  3PRE A;  3L4P A;  3PS6 A;  2KJH B;  4ANV A;  4DK5 A;  4B95 A;  2LD9 A;  3VVW B;  2AEH A;  5DPW A;  4LJP B;  1VRA B;  1VZ7 A;  3VR8 B;  1C4A A;  3PRZ A;  2LRW A;  3TEY A;  3UF8 A;  2Z0E B;  4MDK E;  4K81 A;  1F0Z A;  4NY0 A;  5H92 C;  5BYR A;  4KV2 A;  3EHV A;  1SE2 A;  2LGY A;  3VTV A;  2N9E B;  2JYT A;  4MEM A;  2D3B A;  4FA6 A;  5E6O A;  1SIF A;  1LQB A;  2W9N A;  1SGH A;  1MG8 A;  2EMS A;  4XGA B;  2BWF A;  1RYJ A;  4ANX A;  4N58 A;  3KVF B;  4KIK B;  1UD7 A;  4ZHO A;  1SSN A;  2WU5 B;  3DBL B;  4GSW A;  3VXW A;  1HXY D;  3A9K B;  2LGD A;  4B0E A;  2QEJ C;  2KWV B;  2KHW B;  2HTM E;  4E71 A;  2CR5 A;  3C19 A;  1TBE A;  2MJ3 A;  2ICI A;  1V80 A;  2HJ8 A;  1QLB B;  2JZ3 B;  4FJY A;  4NJC A;  1IYF A;  1UZX B;  2KMM A;  2V4L A;  4XDC A;  1D5M C;  1TT5 B;  2YLM A;  1ET6 A;  1R7S A;  5FR6 A;  4BZA A;  2EEL A;  4P7I A;  2JRI B;  3EC8 A;  1V81 A;  2PW9 A;  4M02 A;  4ARC A;  2Z59 B;  1YNT E;  2KK8 A;  3C8Y A;  2JUO A;  1AYF A;  1V49 A;  1FXA A;  1GC6 A;  3HVD A;  3AB5 A;  3PZ8 A;  2J53 A;  3AI5 A;  4GGQ A;  2CKH B;  3NJT A;  4EKU A;  1IBX B;  2ZPY A;  1WM2 A;  2N4F A;  5AUK A;  1WXM A;  2QC8 A;  3W1S A;  2JSV X;  3V60 A;  1KF6 B;  2AQ1 B;  1SE3 A;  2N1V A;  2IZV B;  2BKR B;  1PDX A;  1CK1 A;  3QX1 A;  4BKG A;  5BMI A;  2AYO B;  4HDQ A;  1T6B X;  2KDB A;  2KVR A;  2DNF A;  1N61 A;  1M94 A;  4K1R B;  3CMM B;  5G5H A;  2L83 A;  3QA8 A;  1K53 A;  1UH6 A;  1E8W A;  3NS8 A;  2FCS A;  2JZP A;  2DZI A;  1KLV A;  3HRD D;  1U4A A;  2L32 A;  3GS2 A;  1WE6 A;  4KVG B;  1GB4 A;  3WAP A;  1X1M A;  4Q2J A;  1FRD A;  2Z8L A;  4K3B A;  1YIW A;  2BB5 A;  1PYW D;  1OEY J;  4I6L B;  1WZ3 A;  2PE9 A;  2EMT A;  3PV1 A;  4B6W A;  4KGT A;  2KDF B;  4GDL A;  5BMG A;  1V5O A;  4EFO A;  3I3T B;  2ON8 A;  2J0K A;  3X0W A;  3HM6 X;  3I9V 1;  1P7E A;  2M0X A;  3A4R A;  3ZJU A;  1SBB B;  1V6E A;  2L0T A;  1JQ4 A;  3A33 B;  4JLC A;  3RNF C;  2LVP A;  2AL6 A;  1V86 A;  2V3P A;  2W54 A;  1I4R A;  2LUM A;  2LXA A;  4C80 A;  1WWT A;  1Q0W B;  3M63 B;  1L0X B;  2G45 B;  4CYE A;  3AEC B;  1KOT A;  2MHJ A;  3IAM 1;  2XN9 C;  1UBI A;  1VR9 A;  2B76 B;  2TSS A;  1ZP0 B;  2N9K A;  4A3O A;  2RDH A;  4XWT A;  4TMA B;  2J0M A;  3Q3O C;  4YTM B;  3M62 B;  4A20 A;  3DBH I;  4FAD A;  1FMA D;  1YN3 A;  4DWF A;  3Q3N C;  2DX5 B;  4MGK E;  3U7Z A;  2KLC A;  3BY4 B;  1LXD A;  4ICU A;  3DWM A;  4II2 B;  2KFJ A;  4DHJ D;  3ECI A;  2W82 A;  4A90 A;  1WXS A;  2UYZ B;  3GZN I;  4KSK C;  1JWM D;  4LLG M;  3N1Z C;  2K22 A;  4H2A A;  5IAA C;  3WAM A;  1F9J A;  2KDI A;  2CJO A;  2Y5P A;  4IDI A;  2X8X X;  3S2A A;  1AN8 A;  4C7Y A;  3AEF B;  1P0R A;  3MC0 B;  2PLP A;  4F1S A;  5IKC M;  4L23 A;  2LVQ A;  4HKQ A;  3ONS A;  4DXG A;  1JRU A;  2BPS A;  3ENE A;  1BT0 A;  1R4N I;  1MVK A;  2PPH A;  2W3R A;  3V6E B;  4WJN A;  2FNJ B;  1K52 A;  3PSE B;  3ZW3 A;  3HHM A;  2V3N A;  4P6V F;  1MHH E;  3Q6B A;  1KJT A;  2INP E;  5LNK 1;  1QQR A;  1MI0 A;  1L5P A;  3LDZ E;  2XEW A;  1E8Z A;  4MGZ E;  4PYZ A;  5C1Z A;  2MCN B;  5FK9 C;  4BVU C;  2C5L C;  3DBR I;  3AM9 A;  2K8C A;  2MBE A;  2CU3 A;  2KDE B;  4GMV A;  2MEK A;  1E9M A;  3IG3 A;  2QIE B;  4WWP A;  3VRA B;  4FUL A;  2N1W A;  3FC4 A;  2RDB C;  3TBL D;  2KNB A;  2AX5 A;  3MHS D;  4KGS A;  4GDL B;  1WH3 A;  1OQQ A;  1GNU A;  4AWJ A;  2CU1 A;  4M8M A;  4NQK E;  4C7Z A;  1TZ1 A;  2WXQ A;  4NZL B;  2ZZP B;  2GBK A;  2MJE A;  3A4S C;  1SIJ A;  2KMA A;  3JW0 X;  3WAL A;  1WZ0 A;  1XF5 L;  1M4V A;  3TSS A;  3RN9 C;  4LTU A;  4A9A A;  2M8S A;  1V1P A;  1H4R A;  4XC2 A;  3UGB B;  4YT0 B;  4LNO A;  3P4S B;  4BOS C;  1QOF A;  3L0W B;  2O6V D;  5GXG B;  3H7S A;  3P2B A;  2RD0 A;  4DDI D;  1E5W A;  4W9G A;  1WM3 A;  3OJ4 B;  2J7Q B;  3RZF A;  3DHH C;  1TIF A;  3B2G A;  3AE5 B;  4ZDV A;  4NJ6 A;  2ONQ A;  1YJJ A;  1E10 A;  1WF9 A;  3LB8 C;  5DPT A;  1P98 A;  3KW5 B;  1IGD A;  3V61 A;  3B08 A;  4M0W A;  2XK5 A; 
#chains in the Genus database with same CATH homology
 4P1C C;  3DHG C;  4P1B C;  3RNC C;  3RN9 C;  3RMK C;  3Q2A C;  3RNB C;  3GE8 C;  3Q14 C;  3RNF C;  2INC C;  3Q3M C;  3N1Y C;  2RDB C;  3DHH C;  1T0R C;  1T0S C;  3RNA C;  3I5J C;  3RNG C;  3N1Z C;  2IND C;  3DHI C;  3Q3O C;  1T0Q C;  3RNE C;  3GE3 C;  3N20 C;  3I63 C;  3N1X C;  3Q3N C;  3RI7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...