2INGX

X-ray structure of the brca1 brct mutant m1775k
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
211
structure length
208
Chain Sequence
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNKPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Breast cancer type 1 susceptibility protein
publication title Pathogenicity of the BRCA1 missense variant M1775K is determined by the disruption of the BRCT phosphopeptide-binding pocket: a multi-modal approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 52
structure length 208
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2ingX02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2ingX01
4BMCA 4XQ0A 3PC8A 3SZMA 1GZHB 3PC6A 1IN1A 1L7BA 2COEA 3KTFA 1OQAA 4BU1A 3AL3A 3PA6A 3PXDA 1KZYC 3PD7A 2JW5A 2R1ZA 3I0MA 3K0HA 1IMOA 3L41A 3PXBA 4XPZA 4BMDA 4N40A 3PXCX 4IGKA 1Y98A 1L0BA 2EP8A 3K15A 3L40A 3PXAA 2E2WA 4U4AA 3HUFA 1WF6A 2AZMA 2VXCA 2XNHA 3PXEA 3UENA 4JLUA 3T7IA 2HTFA 5ECGC 2D8MA 3I0NA 2K6GA 2XNKA 3EF0A 3EF1A 3L46A 2ADOA 2NTEA 3AL2A 3K05A 3II6X 2COKA 3SHVA 3PC8C 1T2UA 1T15A 4BU0A 2ETXA 3FA2A 2LE0A 4OFBA 3HUEA 1CDZA 1N5OX 2DUNA 3SQDA 3OLCX 4ID3A 3U3ZA 1Z56C 4Y2GA 3PC7A 3QVGB 3JVEA 3T1NA 3SHTA 2VXBA 2K7FA 3T7JA 1JNXX 1T2VA 3COJA 2WT8A 3T7KA 2EBWA 2M2IA 3K0KA 2EBUA 4Y18A 2COUA 1T29A 2L42A 3UEOA 3QVGA 4IFIA 2INGX 3K16A
chains in the Genus database with same CATH superfamily
1ECFA 1F9AA 1BS2A 2CFIA 5TB5A 3VXKA 1KYYA 1E9CA 4GEGA 1LPMA 4N7JA 5FXMA 4Q4AB 2XWJI 2FPGB 1GWNA 4GOMD 4HZUA 3EWIA 1Y7TA 1J0EA 4KUGA 3TFWA 2CUKA 2NNWB 4O2BB 1VKHA 2BR5A 3P0FA 4MLPA 4DLWA 1NNEA 5EE5B 1U63A 4R2MA 4EB3A 1WBJB 4N7MA 3WMGA 2F55A 2FMXA 3LKDA 3VAZA 3KTFA 4JH0A 5DNEA 1FTQA 1UKEA 2ORWA 5I7SA 3G2JA 1RWOA 4GPTA 4PLHA 4MWDA 5EKTA 1F14A 2JA1A 1W88A 4A8JB 4P7BA 2GBIA 2XJ9A 2Z3WA 3BERA 4REQA 4BASA 3BCUA 4BVLA 3A6FA 1O89A 2ATCA 2WSMA 1H5QA 3G2KA 1FDUA 3R5KA 4LQ4A 1U81A 1SCQA 2OECA 2P6PA 2GJAA 2WDZA 3R5XA 4RH1A 4WEOA 1Z18A 3I1IA 5LVAA 1Z6ZA 3IKTA 1L7EA 1KO1A 3CMCO 3KZOA 5KYUB 2CLDX 2I87A 5K2MA 2J07A 1SPXA 3I5XA 1ZN9A 1T6NA 1ISFA 2EJBA 4C08A 5B3LA 3FPGA 1W49A 3D6JA 3D6AA 1JR2A 1CERA 3B53X 1Z4OA 3PXAA 1UZNA 3CTPA 3N05A 1WZ2A 3AERB 2RH4A 2GJ8A 3U4IA 4QPNA 5DT2A 4E5DA 1ESDA 3EVCA 5FI5A 2C0PA 3MSCA 4C0HA 1P45A 2VNKA 3T3EA 2Q41A 3CRZA 4EYSA 4DV5B 2C2HA 1UDBA 3DEFA 1KP2A 3KNZA 4I8IA 2OBYA 4Q82A 4CR6A 2WHEA 3BGVA 2IELA 4G1VA 2AQHA 1G8PA 1P31A 5JBQA 4M55A 1XEXA 3TK1A 4G4SP 1HDIA 1NURA 5TE9A 2IS1A 2V9CA 4BS9A 1AMUA 2H06A 5DNVA 3IOEA 2HX1A 1T15A 4HQFA 1YHZA 3OIVA 3CNLA 4QYXA 5AXAA 2PZBA 3JU3A 3DVRX 3MLEA 4KIUA 3PBKA 4L5IA 3X1YA 1N2EA 4TMXA 5JZSA 5LFAA 5ELMA 3TZEA 1FFDA 3TVYA 3ZVMA 2ZJFA 3QA3E 4FGZA 1W4BA 1YL5A 4F92B 4GMKA 3RRNA 5FWYA 5JJCA 3FOEC 1ESZA 4CKZA 2P6OA 1JMKC 3PRKE 4FN4A 1XZQA 5I4CA 1GQ2A 5CFNA 3R7DA 3MRXA 5K0ZA 2HSGA 1Y6QA 3ZIUA 1A8IA 1ORHA 3H6HA 1NSYA 5IKEA 1JECA 4PHCA 4GPEA 4PQEA 3UVEA 3ZY4A 3N3BC 2Y4NA 3PHCA 4M0EA 1U0BB 4AY5A 4O4LF 3DW3X 4E5VA 3MTJA 2I7XA 5FOUA 1IDN1 3KKPA 1CF9A 1J8QA 5BVHB 3G8YA 1X2BA 1H0RA 1YZ3A 3VNAA 4A4DA 3JCZA 3E5MA 2A9JA 2HN9A 3C6QA 1Q3TA 2PL9A 1WLSA 1R74A 2WAYA 5F51A 1QRSA 1JDJA 4TS1A 1XSEA 4UUNA 2EBUA 1KFEB 3QXGA 5KWJA 3MHPA 3T1TA 2VAWA 1KZ1A 1XAIA 4H60A 3VDNB 4YRRA 4DLPA 2YWXA 4FMPA 1RHQA 4J75A 1DIRA 1T1IA 2I2XB 4YB8A 5AJVB 1YFLA 2AFHA 1YHYA 3CWQA 4HRAA 3STUA 3FH0A 1E77A 4KVZA 4MYCA 1Z4QA 3FY4A 3THYB 3ZV3A 4A92A 1GGEA 4WZBE 4V38A 1SHUX 2ZJOA 4J2TA 3JQ7B 3DE7X 1SKBA 4ZZ0A 1VA5A 4MIOA 2POCA 1QOZA 4MPJA 3LO5A 4GI1A 4GHWA 1DAFA 3B60A 4IDHA 4DC1A 1ZGBA 3IAM1 3NR2A 3ZX5A 2AUMA 4Z3KA 3N2KA 9LDTA 5KOIA 1B2RA 1CJVC 3SF0A 4EFDA 3FWYA 1SXPA 3ICEA 3SHWA 1PYDA 1UPTA 2OWEA 4S05A 2HMTA 3PD7A 4K28A 4DDKA 1L6IA 3R23A 2IYFA 1YZTA 3VI4B 3T12A 4B82A 4GT1A 1QGUB 2QN3A 1E5XA 2DUUA 3QOWA 4NCHA 3PZBA 5IRCD 3RS0A 4MQMA 1ZIOA 3B9QA 4OBWA 2IXAA 2HCBA 5HKKA 3H9EO 3CJRA 3CUEF 2B8NA 3TOZA 1XLWA 4FJ1A 1TKCA 4PW0A 2BTQA 4GRIA 4WNAB 2ZTUA 3DMHA 3PDWA 4PGMA 1F60A 2CBZA 2UYYA 1N6NA 3HYTA 3L7YA 5K4AA 3RROA 4FJ2A 3SXUA 4UAVA 5B1DA 3L7NA 3C3YA 2OHHA 4OQDA 1T2FA 3ZOKA 4TX1A 3DONA 4WY8A 5I5GA 1I7QB 4CM6A 2X76A 1HM5A 3UJBA 4US2R 1NOJA 2V5VA 4L07A 4LYEA 1QQBA 2FFJA 4XKJA 2QRZA 4U0KA 1D2GA 1HOXA 3FFTA 3I12A 4QJBA 3SNKA 4UM9D 3UV6A 1P0MA 3NWJA 3GGCA 4MVJE 4GD3Q 2I5PO 2W6QA 1IK4A 4DLBA 2NU8A 3SHVA 1DELA 1QF7A 4KKVA 4RPJA 1QGDA 4E22A 3KQKA 1U7TA 5F3DA 2B92A 4B6EA 1SZCA 4YDRA 4DMCA 3GEEA 3AKYA 1ELOA 4FB5A 2W7TA 3FDIA 3KVNA 4GRAA 4BU0A 4OB8A 5DMHA 4LHXA 4G3XA 5DXFA 3A7DA 3M4JA 4I3GA 2EQ5A 4PRZA 3V8BA 1J0DA 1QH9A 2V65A 3IVAA 5B1IA 3OA2A 3KAQA 5JJBA 2NXNA 4YBZA 4Q34A 2HJWA 1MNAA 2A1TR 3DBRA 2RJNA 3FVTA 1JLHA 3MMSA 3S81A 1D1QA 1BGWA 1B1CA 1NX6A 1Z6AA 1JEYB 5JALA 3PR2B 4DNOA 2Q6KA 4NSNA 2RJ3A 1EE2A 2HM7A 1U8FO 4Z7NB 3KR1A 5FWDA 3VDRA 2REQA 3W5HA 4KU4A 5THXA 1EDDA 1ACMA 1J8FA 3OZGA 3C0KA 3OX1A 2HJVA 3TQFA 5BR1A 3AFOA 1Z0JA 1QIKA 2O7SA 3IEPA 3A1EA 4OLBA 1G7SA 1MFZA 1VSUA 4XASA 4ZEWA 4UBOA 1OI2A 1ISHA 2FX2A 2ZETA 2W2OA 2LZ0A 3A7EA 3CLRD 3K70D 3TAUA 5ERXA 3M3PA 1XU7A 4C6TA 3SSAA 1VM6A 1IJEA 2HC9A 3O3CA 4B8WA 3T1HB 1NW7A 1KGDA 4Y1EA 1VPLA 2X4IA 3X1JA 3L7KA 1F51E 3SR0A 3HPQA 5C31A 1IQ0A 2JHCA 1N33B 1H94A 4P4SA 2JI8A 5HF5A 2ZM5A 2R96A 3AR5A 2QN7A 2VCEA 2JGNA 1OH5A 2FMHA 2AK3A 2W71A 3WL4A 1IUNA 3DHVA 5F3RA 5F7ZA 1J5EB 2OUKA 3F78A 1ID1A 5KTMA 3DMPA 3EARA 3AB8A 4U2BA 4DXHA 3PC8A 3M4ZA 4HNGA 3S40A 4RSGA 4DQDA 2J9YB 1V1MA 2W6MA 2G8LA 4OHRA 4ZJUA 1RLMA 1TPZA 3LWZA 4B45A 5ALPA 1OAOC 2C1XA 4J6FA 3L04A 1Y1SA 5GJVC 2FWBA 5T41A 4AKEA 3VZRA 4GVLA 2CLIB 2IIPA 2O2YA 3MVEA 2IGBA 3MTBA 4MNTA 521PA 2ZI5A 1DBQA 2RKBA 3J7TA 1DG1G 1TJPB 3KX2A 5JSYA 3LUCA 1DEKA 5JZMA 3RT9A 2X0RA 3RNLA 1XF1A 2PA3A 3CBGA 2X0NA 1WMAA 2H8KA 1IULA 2ATVA 1X1RA 2XNDD 1ZUNB 3DJYA 4DWOA 3GY0A 1JWAB 4BJHB 4EG5A 1QIMA 3GJ0A 5SICE 3OEHA 1M1YA 1BH2A 1ZWLA 2RB5A 5GQSA 4B9EA 4JOQA 4V3CA 5AJTA 3V1UA 2BP7B 3DE5X 3GEGA 5ALYA 4EHNA 3DBHB 4B44A 1UMDB 3NHUA 1YULA 4IDNA 1IJBA 3V2UA 4OB7A 5FUXA 2YN0A 2CB9A 4DR2B 3HUTA 3FSGD 1GZ3A 2OB1A 3QOFA 2XXBA 3ZXIA 5CGQB 1FP4A 3Q41A 4YXWA 1XEAA 3P71T 1L4UA 2HGSA 3SYMA 2WWYA 3DC7A 3M6XA 1AA6A 4P0QB 3W4JA 1U3TA 4Q1CA 5KS2A 1JT9A 2FPIB 3E3OA 1TJNA 1V1JA 3JARA 4Y6LA 1GAJA 4FSHA 3VO1A 1Z2CA 2IIBA 2F1KA 4BZPA 3ESYA 1CQPA 2I2WA 4AG5A 1RACA 1KI3A 3IQEA 1E59A 3UJDA 3Q0EA 1X87A 2GAJA 4F8YA 3AF0A 3JYPA 4IL5A 3U1TA 1TUBB 3WK4A 2ZBFA 2XUDA 4IHJB 2FU5C 4PX5A 3WJ2A 3O93A 1XJ0A 1HYEA 1MVOA 2YZKA 3IEKA 1N57A 3JQAB 4PINA 1PR3A 3BK1A 3GLFE 4F4UA 3UK0A 1U8EA 4KXWA 2C5HA 5AJYA 1F2DA 3DOUA 3A4IA 2PGOA 2ZTVA 2O14A 3FLAA 4PM4A 3WVNA 4X7RA 1KOFA 1UBCA 3BXGA 4PPGA 1RYMA 3T3MB 5JRZA 1YD7A 4KB5A 1P4AA 4X6XA 4KDFA 5K3CA 4BP1A 3KFXA 2EBWA 4G5HA 4EA8A 3KJIA 5TT1A 3DMGA 4MYUA 4DJEC 2GZ3A 5ICMA 1ZXBA 3AUUA 5LLTA 1PTJC 4BCBA 1U28A 3IODA 4E2FA 5K0TA 4A91A 3VR4A 5EEGA 5KOJA 3E58A 4BUZA 1UMBB 2MHCA 4OQFA 1YF3A 1SCUB 3SF8B 1EPUA 4JR0A 3K9WA 4ZI7F 4WFKA 2O2DA 3V33A 1VKJA 1PF7E 3W78A 4WLFA 2X9QA 4DUGD 3DNFA 4JQZA 5G53C 2XE4A 1CEYA 1QG2A 2FG6C 2QJOA 4YJGA 3SBDA 4DCGA 1VIDA 4YUWA 1IEXA 1LPNA 2JLBA 3F6SA 3FIJA 4NK5A 3RSQA 4C4RA 5C8YA 4Z53A 4HZIA 1AF4A 4QRHA 2XB6A 4WGFA 4AUEA 1DBVO 4MMXB 3TZKA 2GN8A 4RBNA 3IE0A 3DO6A 1IN1A 1N36B 1QGED 2ZSFA 2BISA 4LHYA 1KHTA 2DETA 1JDBB 1DO2A 1JLMA 4YPVA 4BMZA 3WICA 4BU1A 3G49A 2O3RA 4TOIA 4RTQA 4A26A 5DM2A 5G2OA 4XRGA 5CLGA 2EFDB 4NONA 3NDRA 2X2PA 1BXKA 4P5PA 5L95A 1EB8A 4JJ6A 3GJZA 2XCQA 1E9AA 1NVVR 4RD0A 3P2MA 3H8VA 2HQSA 1FYDA 2ZJ3A 5AVKA 2H51A 3A27A 1L5KA 1U5BB 3WGGA 3BE4A 3N2ZB 1WETA 4QXOA 1U98A 4B6GA 1XR3A 3H3FA 4TN5A 3MUEA 1AS0A 4FEEA 4RELA 3DQPA 5L7YA 4K8RB 3OE5A 1XPUA 3TB6A 4BNMA 2V3VA 3IR5A 3ZK7A 3UK2A 2OZKA 3HV2A 3LXRA 4EG0A 5B7GA 2G06A 3NI2A 4G85A 3VC1A 5IABA 5A4IS 2QDKA 4OREX 1I4DD 2CHVA 2PY6A 3FTPA 3KJXA 4KQCA 1J49A 4UXHA 3CX4A 2BGNA 3U17A 1BN7A 4UBMA 1RZVA 2NM0A 5EERA 4BVKA 4KO4S 1PZXA 3F90A 1KSHA 3KLOA 4JAVC 1ZD1A 4NE9A 4OD0A 4E5PA 2UYOA 2DKOA 3D3WA 2KM1A 2EGHA 2EX4A 2GUWA 2OCAA 2AMJA 2YZ2A 4KODA 4U00A 4XARA 5EGSA 4G8JA 2ZAGA 5K0LA 5WRFA 4AJ2A 3IIKA 3K53A 3DMFA 5KJFA 3RRXA 1MABB 1XVAA 2CD9A 5KVSA 1EUDA 2WWFA 4FYPA 3KVVA 3WLLA 3MFYA 3NM4A 2JCBA 1JXAA 1H5UA 4FP9A 3U81A 5L4NA 2IBTA 4KBGA 5IDWA 2IQIA 5CX1A 2ODAA 4UVIA 2VEDA 3AWDA 1L8AA 4WLVA 4F5WA 3HK2A 2J0UA 4QICA 3IP3A 5C52B 3E7FA 1H0HA 2CHQA 5T6BA 3LVBA 1S3SA 3MT7A 3NS7A 4NZ9A 4RVDA 4ZXPA 3TOXA 2FX5A 4E7OA 4TYYA 3IOBA 1E5DA 3E7WA 1V11B 3TTXA 3V7WA 2BKXA 4BFUA 5DI3B 1AQNA 2WC1A 2QG9A 3C6YA 1EHIA 3S2FA 1USWA 3LA8A 3PX7A 1E7RA 2BGGA 4Q7JB 1QXSA 7GPBA 1UL1X 2MU1A 2WDPA 5AXBA 4ZXFA 2WE8A 3UM9A 5BURA 1KBZA 2JZOA 2QM0A 2VN8A 3LUGA 3WYGA 5PNTA 4I81A 1T5DX 1Z0DA 2DPLA 2XNJA 1Y34E 2ZFUA 1G8AA 3C3EA 5E3JA 3SM9A 4B3HA 2AMYA 4JXKA 3S27A 1N5LA 3R24A 4Z4IA 5F12A 4BRSA 4EEKA 3PKZA 2GFHA 3A32A 1U4SA 3CC8A 4ZCQA 4W5OA 5B1SA 4RVOA 3PPXA 1R8JA 1O6ZA 1E9EA 3FVQA 1ECCA 2F1IA 2JVIA 2Z5GA 3MCWA 4AYTA 4BAZA 5JNLA 4QBHA 2HPHA 1Z4KA 1XMVA 1BG6A 1Z0AA 4KTVE 4Y9RA 4AY4A 3I6MA 3LSYA 1D7AA 3HU5A 3KEOA 4OATA 1QR6A 4P7JA 3PYXA 4Q7EA 5KWSA 4ZOAA 1U1CA 1J20A 2HHJA 1JZQA 4LX0A 1KDZA 4RD2A 2I3GA 2FF5A 1HT1E 2JCGA 5CUQA 2DE0X 1GRQA 3HVIA 5L3RA 2W4QA 4BEJA 1KORA 5CB6A 3PQ2A 4UEQA 2YVUA 3VO9A 3FKQA 1U2DA 3F7NA 4A8JC 2I4MA 4IIGA 5BV0A 1OI7A 3C41J 3EQ6A 3FPHA 3QEMB 1KC1A 4R81A 2XITA 4V39A 1A9QA 3LT4A 3N7AA 1PJQA 4NV1A 2WJJA 5KTSA 3OY7A 4EL5A 2W0MA 1JHZA 2FSUA 4ZCMA 5KBYA 4BUCA 4G0OA 2R87A 3AYXB 4G26A 3SI7A 4KO1S 5LC1A 1NTOA 1QIFA 3DLIA 3P9XA 3PFWO 4KLZA 4LDRA 4NJMB 5ECYA 3ON5A 4MUAA 3R9IA 4HQ0A 3W5CA 1MAVA 2HCTA 4HZGA 4M9SA 4N47A 5DBHX 2C2KA 3C7TA 1GAWA 4L8LA 2QTFA 3UB4A 4BE9A 3N28A 2IE0A 2OM2A 2RGDA 3FHCB 4KQKA 5LMNB 3WQBA 3KV1A 4QULA 1FOEB 1Z88A 2DF8A 1PT6A 4K03A 4Y2PA 3IUPA 4NNPA 4REOA 3RS3A 2D5CA 1UF9A 4KMSA 4EEZA 1PJRA 3KJZA 4RPIA 1O95D 2NGRA 4U7HA 1I6MA 5FI0B 2SKCA 3AG5A 3JVVA 1U0NA 2B7CA 4MCJA 2ZWVA 4PZPA 5DHQA 4WH0A 4YP7A 2NU6B 3TW4A 4GGPA 2A78A 5KDOA 1B8OA 3AF4A 4X84A 5DGTA 5DTMA 5G3YA 1OW3B 4KK4A 2A59A 3BHMA 4PWZA 2A1IA 3AILA 4JCCA 4C0QC 3ORFA 3UT0A 1FS5A 2MSNA 3F97A 2B83A 2X23A 2JLZA 4AZSA 2Q4RA 2ERXA 2HJGA 2QZSA 1SBCA 2XD4A 3OZ7A 5AQ1A 4HQLA 5IC4A 1PW5A 2IUTA 4OB6A 1FUKA 1T4BA 4G0VA 1NP3A 2DFLA 4A6XA 4XPIA 2Y1KA 2HSWA 3CURA 3KQOA 4HN9A 2OXRA 4G6ZA 1JEOA 1YWGO 1QDLB 2A84A 2JFQA 3P2IA 1SXGA 2MYNA 3PFBA 3WYDA 5CG1A 3G5MA 1NN1A 3D0QA 5IM4A 2H29A 4TT8A 3UGJA 2JAQA 4ZGGA 2RJOA 2Q6LA 4IIHA 1L7MA 1N6KA 2VPIA 3GVPA 2AG5A 1RWMA 2WM8A 1NF9A 2DHDA 4ZVNA 4CM8A 4MCAA 1QAOA 2NMVA 4IICA 2Z57A 1S9DA 2JLCA 1PZFA 4OXXA 3BH0A 3UUEA 2QQGA 3FE2A 2P9EA 5EOVA 1DXQA 1JP7A 3D81A 4ZANA 3KVRA 1OC4A 4NFLA 3GRVA 1O2DA 1Z8FA 3F5SA 2O5EA 2PGNA 3D8BA 3E3AA 3SQWA 1G1MA 2ZWMA 3DV9A 5EWJA 4ZHSA 2BD0A 1CQIB 3GDOA 1M5UA 4MVJP 4PC6A 1YQ9A 1C0EA 1MC4A 3CYFA 1WA5A 3OSUA 4F0JA 3WWZA 2R8RA 2NZUG 4XGQA 5EE9A 2IU6A 3F6PA 2XF2A 4NDZA 3DVAB 5LBUA 4JNCA 4YECA 2HHHB 1YRAA 3SYRA 2XMDA 2G9VA 3OAAA 3WK8A 5CCBA 3K4PA 4I4IA 4EQZA 5JR3A 3HCFA 3RRZA 4HLUC 2E4VA 2YFYA 1H9BA 3PEEA 3L06A 1K88A 1J25A 1QG6A 4Z4FA 2PUHA 1JZSA 3DXXA 5AW7A 3AL0C 4PGGA 2WA1A 1YNOA 4RIIA 1P7PA 4XJSA 5LDGA 5IASA 1EQUA 2AG8A 1KMCA 1IWOA 1E3SA 1T3TA 2DFNA 1YVDA 3FMPB 4LQDA 1TT5B 3EZYA 3OJ0A 3AR4A 1D09A 1ZG3A 2CMHA 5JS8A 4EG3A 3AZOA 1FU4A 3K0HA 3RS5A 4KSCA 2ZIUB 2Z56A 4QTXA 4DSOA 2P41A 1ZGZA 3NEAA 3IUBA 1A9YA 1F3OA 2NT4A 3ANLA 4HR7A 1N6RA 2O50A 4QEKA 1E1YA 3QYPA 4MGHA 5F21A 3VPFA 3RSOA 3UMYA 4UHHA 3BWYA 1A8SA 2HQRA 1KU0A 3DOEA 2ET6A 4JJEA 3AW9A 5LOVB 2WHQA 2Q4BA 2YINC 3SHQA 4GRDA 4MQ4A 4L8VA 4XIFA 2UVQA 3ADDA 2N3ZA 2C1ZA 3EEYA 3CLKA 1T36B 1NQXA 4K2HA 4AL4A 5B2EA 1HLDA 3V32A 2ADMA 5JW6A 5FNVB 3HVHA 1AGNA 2MSCB 2O9JA 3NTVA 2GZ1A 1NJ8A 3JQPA 3X2EA 2ZJ1A 5CBPB 2DMRA 1I7NA 3T3HA 4DCJA 4WK6A 1C30A 1OX5A 2ZZKA 4WKGA 3S1AA 3AESA 4BTVA 4AKIA 3QE0A 2HWYA 3G9TA 4JU9A 4WD3A 1GN8A 4JL6A 4WBXC 3AEUA 1JVBA 5E4FA 3CMMA 4HLCA 4FZ3A 3VISA 2YWFA 1GGHA 3VC2A 4GG1A 3R6GA 3L02A 3CLTC 2BFNA 3HYCA 3KUKA 7REQA 1C3XA 1G64A 4BMSA 3Q8LA 1DRJA 1EXMA 1ISIA 1ZU5A 2YV3A 3HVJA 4X65B 3DMTC 3TZCA 3N8HA 1WCV1 2GNOA 3OLYA 4P84A 3M0EA 1OBFO 3MAGA 1M67A 2XD9A 5EHQA 4BKQA 4CLXA 3TQRA 2R25B 4TQGA 4F8EA 1AS2A 3OZUA 5BV8A 1R6TA 3GC6A 1TIBA 3I83A 3JALB 1Z4LA 4WXMA 5FLKA 1Z6PA 3VU3A 2EERA 1U1GA 2QRPA 3TDKA 3A25A 2DERA 2XWSA 3W04A 4P08A 3RD5A 4B4DA 4O2AF 4O1IA 3EGXA 4KFSA 4FE4A 4LJRA 1DAGA 4ZARA 2ZB8A 4DQXA 2FP4A 2M9MA 3BMQA 2L17A 3GLGA 3KUDA 1G8SA 5IVHA 4Z9FA 1FP1D 5CT9A 2VHYA 4J1SA 4D6XA 3EQ2A 5J2UA 2FMFA 1O9HA 2Y27A 1XZLA 2ZVPX 3QX9A 5LDDC 2VJCA 4RHEA 1ZI9A 3NPAA 1HMPA 3LKBA 1I5OA 5A4DA 3KTOA 3G0OA 2QT1A 5L45A 3G2OA 3OSZA 1NY5A 1DI0A 2IIVA 4S35A 3TIFA 3MAAC 4C30A 3DLAA 1DFIA 3BK7A 4MVCA 4P4LA 2JRCA 3H4MA 1GL9B 1UEIA 4XYGA 4R7GA 3KZKA 1AQLA 4JP8A 1SWVA 2V7TA 2JI6A 1TM2A 2V55B 3AJ9A 3K1ZA 3E9CA 5D3MB 3K2QA 3ZWYA 3SZMA 4AQDA 3CXUA 2CV0A 2K7ZA 1A9XB 1XN1A 2YX1A 1U7OA 2BZSA 2GN1A 1L1RA 2VKQA 4XIYA 3RRJA 4YDHB 4L3WA 1FCJA 1W4LA 2X1VA 2BKAA 3PNBA 1RZRA 3Q11A 4NE2A 4BCCA 4KGVA 4V0MA 1KS9A 4Y1RA 1QORA 1JAZA 2KHZA 4XX0A 2NPIA 2QNIA 2F1HA 3IXMA 1PLLA 4GM4A 1JG3A 2FEAA 2WUGA 3AUKA 4NJEB 3UFBA 4AF7A 2OV1A 3CUYA 3ZU4A 5L3QB 2XZOA 2SCUA 4WTOA 4EX6A 4L9RA 3O03A 3DBOB 4TLCA 4JYAB 3U5TA 1CY6A 3DLTA 3HCEA 4TZ6A 5KTOA 3RSFA 1IXRC 2PQ2A 2V7QA 4WK0B 2FMUA 4YRCA 5IEJA 4PC1A 4UNNA 1Y5RA 5KWEA 4RMNA 2PUDA 4N6NA 4UCFA 3FROA 4ZHQF 2QWXA 4YAWA 1T10A 2VYND 1LQTA 3OKCA 3QF4B 1AURA 1DC3A 1GRVA 1LVHA 1OAOA 4Q3NA 5AVOA 1CUFA 3AETB 2HA7A 3HCDA 2C3UA 2WYWA 4Q4CA 4WZAA 2GA8A 2VI5A 2LBPA 5DX8A 1G5RA 5TQ0A 1UT8A 1JSXA 1QLWA 3L8ZA 4I6JA 3UHFA 3VR6A 4AN1A 3IBYA 4BYGA 1TKAA 3KC2A 4C0BA 1TK9A 3H2YA 1OTXA 3MJHA 3SZ3A 5JJ5A 3R0JA 3CCCA 4CL8A 2ES4A 3IBGA 4URWR 5HXAA 3EVTA 5H4GA 5D01A 3K9FC 2YH2A 1OWLA 3WXMA 4X91A 3OKAA 1QCCA 1W4ZA 5GINE 3CKKA 1I4OA 1MKYA 5C5IA 3ENVA 4U7GA 4H0FA 4GWGA 1MEEA 4QG3A 2Q9CA 3NDIA 3EASA 2XTNA 1R2QA 3W7AA 1Z8DA 3ORRA 1AB6A 1M6HA 4ZDWA 2DEUA 1Y1PA 3A4YA 4MUXA 1V5GA 1N7HA 2H08A 1WMBA 3IRVA 1ISSA 4ZI2A 2UZ4A 5AKHA 4JR1A 3Q10A 2HNBA 2YJ3A 3ZHVA 6ADHA 4W5QA 1GCUA 1NG1A 3U7GA 3ZE6A 1S2NA 1YR2A 3OZEA 1N2JA 1PN3A 3D54D 4G8DA 4V1CB 4OGWA 5EESA 4KPYA 1NJFA 2DHQA 3A1FA 3EMVA 4RJIA 4MB2A 3I2YX 1C3VA 4UUPA 1W5EA 1TGVA 4QL3A 3I9LA 3DEKA 1X0VA 5GZ3A 3Q7IA 1E3JA 2Q3JA 1C5KA 4D0SA 2Z1MA 3NUGA 4RANA 4K2AA 1VJRA 421PA 2ZS7A 1DWUA 1E9DA 2DWOA 1TKBA 5L51A 3W06A 3LG2A 1JBQA 3AFIA 4MUNA 4BBZA 3R6DA 1V1RA 3TW6A 4R8LA 3RI3A 5CFPA 1AXRA 1WB9A 4RE6A 3DHEA 4PQYA 1XDSA 3MINB 5BSVA 1XA0A 2ORIA 1WPRA 4RSRA 4X3OA 3DG9A 4GDFA 2PKRA 1AUVA 3IPAA 3NPMA 3WMFA 3EIWA 3QW4B 1VFNA 2OD2A 1MJHA 2UXCB 2WBLC 3N5CA 4AZ3A 4EG6A 4ZICA 5C5CA 2XVZA 3UWMA 1Y42X 1RTKA 1TL7C 2PX5A 1SVNA 1ZGAA 3CH4B 3NHAA 4KX5A 1R00A 3B2NA 4MTLA 1AXEA 3ETNA 4LMPA 1KYWA 3HKDA 4NTZA 1K2WA 5TARA 5JHHB 1IAQA 1M73E 4F3YA 1A2OA 1NVKA 1EVZA 2RMKA 3K1JA 3PIRA 3URKA 2DFDA 5K3OA 1EUCB 1I4EB 4NBWA 4JYMA 1XOIA 2BIFA 4ND3A 3DAFA 4F86A 1TTTA 5DM1A 2QLJA 3E5RA 3H17A 5C7IO 4EYOA 9ATCA 4PFQA 1PTJA 1E66A 4YLGA 2UYCA 1JDBC 2B0JA 1W19A 3B5JA 3LDGA 4JBGA 8ATCA 4FI3F 3VGJA 3B2QA 2PS0A 1FFWA 3THRA 5FPPA 3CNBA 4FZJA 4Y3UA 1PAUA 1ZM4A 3O38A 4FT2A 4MQFA 4CHGA 3VU0A 4AYXA 3BRSA 2X3FA 3GLKA 2Z2ZA 1EBUA 3F6BX 4RQBA 4DNPA 1GT6A 2ODNA 3AJ8A 1QHXA 3NO4A 2FB9A 3JAMA 1YZYA 1KYVA 2EFJA 2R60A 2VH5R 4AZ0B 1Q21A 3AVWA 3VA7A 4KHPB 4KUHA 2BGKA 4MUYA 5EPUA 4WCDA 1U2EA 3ZBTA 5F98A 5BWLA 2VOEA 1DIOB 2FUCA 2IPMA 1C41A 3MELA 4MR7B 2GB4A 2H4YA 2WWGA 3AR3A 3DKVA 3KBBA 4I50B 4CQLA 2A0KA 1GZSA 2MSKA 4DLNA 3T94A 4O5OA 4P35A 4YR9A 3LY9A 5H59A 2FN4A 5E8RA 1M5TA 2XY4A 3CRNA 1Q0PA 4GR4A 5IBRA 5JSHA 3HFSA 3F6CA 4YRLA 5CCXA 1T3HA 5THQA 1PFKA 1Q0RA 5EAIA 1P72A 2WA2A 1NR1A 4H16A 3P2JA 4Q1BA 3WHIA 4JCOA 2O7QA 3QTBA 9ABPA 3MTIA 1QC5A 1SPBS 4F2WA 5EXPA 1OX4A 1RMTA 5EMMA 2AXQA 2BTOA 4FZVA 1COWA 3M9LA 2A9RA 4GPD1 3BJRA 2NO6A 3UGKA 1Z8NA 2BELA 1I10A 3EDRA 2DXIA 5C5EA 1Q3HA 2CHEA 2EIXA 3DMYA 1KK1A 3AOEA 3VVBA 4GEKA 2NQTA 3A1SA 4QBKA 3GP8A 3SPXA 4LG1A 1ZMOA 3DTVD 1H2EA 2P4EA 3ZXUB 4EW2A 2GSDA 3P9NA 3QVWA 4HDNA 4KH0A 2YHUA 5CVVA 3TTUA 3AO0B 3BSSA 5CNJA 4ZVUA 2P2ZA 4R1OA 2XECA 1KY3A 2CDCA 1ZXLA 2ZU0C 3SZRA 2CL7X 3V2GA 2AX3A 5F7XA 2JPDA 5HYVA 5EWMB 1YVUA 1ZD2P 4NOMA 3AHGA 1NUHA 3QWIA 4NYMQ 2UV8A 1SQGA 1XWIA 2QX4A 3GJ3A 3B51X 1PP4A 4JJ7A 3TQSA 3BFVA 5BSKA 2ZZNA 1JAYA 2H07A 2I2CA 2C96A 1GCAA 1XAHA 4R31A 4UHEA 1KBOA 3V8EA 3R6TA 4C76A 5L53A 3QX3A 1E2DA 4R7ZA 1FTNA 5IAJA 1RKVA 3LQFA 5KSZA 1DV2A 4ZO6A 2YHIB 4OBEA 4IO0A 3CZQA 2QV7A 2VP5A 4ZEVA 3REGA 4PLTA 4ZZ1A 1SC4A 3LW7A 3D4OA 1IY8A 2A9FA 1RAIA 3WGOA 3DL2A 4A8TA 1GUFA 3VX3A 1NMQA 5TMEA 1UPBA 1K8QA 1KMQA 1OSNA 4D57A 2RHGB 3O7WA 1BOFA 1HO3A 2OCLA 3D5TA 1JTVA 1RHMA 1CNMA 1RHUA 3W5IA 9MHTA 3GHYA 3OJFA 1WPQA 4BO7A 5DWQA 2A35A 3P5SA 3AKEA 1FYVA 4JLOA 4HNVA 4V2UA 1MB0A 3G9UA 4F5ZA 2YOFA 4OAPA 3IDZA 3R6WA 3U60B 2B9EA 1VL1A 3K9LA 2H59A 3PC3A 3PI7A 5E1MA 4DQUA 1F5SA 4AZWA 3KL2A 5B2ZA 1XK6A 1QFJA 3JQGA 1GPH1 5EJIA 1EWVA 3QWBA 4EVQA 1R0XA 2O6HA 1WP4A 4TMFA 1TCUA 3P4XA 3EODA 2Z09A 1YCGA 1GTG1 2JA2A 1J07A 4NRDA 4EHLA 5BOSB 3AX6A 2WU4A 1KVSA 1UK7A 2JIDA 2PGJA 3D3NA 4CWAA 1RFLA 3MJFA 4DR3B 1AK9A 4MYHA 1BDBA 3RFFA 3KEQA 4W9NA 3ZK9A 2OV2A 1B15A 4NZZA 1FW8A 4Q4AA 3I4FA 4AURA 2DWPA 3H1AA 2FPGA 2VNHA 4TYPA 3T6KA 3FOFC 5IBPA 1PVOA 4MIEA 4HS9A 3BWDD 1Y98A 2IP4A 3JSAA 4PPFA 4P34A 2ZCJA 2RHJA 4YBRA 1HE4A 3ACBA 1Y9ZA 2HMSA 1THGA 1IFXA 1R3UA 2IVFA 5BYBA 3LBYA 1EFCA 5LBIA 5GONF 1ZM2A 1P62B 3IEVA 1LBTA 2RH5A 3H2HA 3KEFA 4LUCA 2YWBA 5KX5F 1VI5A 2HHCA 1WVMA 2ANCA 4NENB 4EY3A 1BXGA 1S7CA 2VHQA 1XU9A 3L93A 1BHJA 4PC3A 4A8JA 4JB2A 1JFSA 1OBOA 5LU8A 3UG7A 1UXIA 4ESOA 1DCKA 4QECA 5CFQA 3D1LA 4LOLA 4Q6WA 4UXIA 4BBAA 4KQEA 4XWTA 3Q6NA 1VGVA 4HYQA 2PL5A 2XX3A 1LTHR 3ETHA 5KYUA 3OZSA 1IVSA 2NU9B 1XTBA 3COWA 5HQTA 4RVCA 1STOA 5CA0F 4K87A 1MW8X 5BNWA 1EEXB 2D5LA 4WNIA 5TMDA 1Z07A 3AERA 2JB9A 3O3NB 1Z34A 3EBPA 1W34A 2VZ9A 1D0SA 3LWBA 3MSXA 3R3HA 5LXTA 3DE1X 4BX9A 4B7UA 1TA9A 4ODIA 3FAZA 4Y2UA 5JWRA 1K8XB 1XU4A 2P27A 1JDTA 1XJCA 3DO8A 4P98A 1DRUA 4KSBA 4PYOA 5JEDA 4LNHA 1M3SA 1Z5VA 1B6RA 2WIAA 2ZYTX 1XPOA 1PGOA 4GMHA 3F9IA 4O4IB 3ZDEA 5J4VA 5KYNA 1G20B 1XYVA 4RKEA 3STHA 4NCAA 3Q1LA 2OV4A 5KTYA 4AKGA 3BKXA 1JNXX 1WUHS 4JA0A 3ZVLA 4ADSG 1OROA 1ICIA 3KKZA 3JASB 1G4HA 2VHWA 2IXGA 4MV3A 4JI2B 4EJ6A 1OBCA 2BSAA 2CNBA 3ZDQA 4Q3BA 3U39A 1PL7A 4OGLA 4I36A 3E48A 3Q5GA 2C9ZA 3OZIA 1M72A 4J43A 4TTPA 1NUPA 1RVV1 4LBYA 3H18A 4L1KA 1KI1A 4G37A 1QFZA 4OUKX 3LOPA 4NFYA 3HI4A 4OTZA 3GEIA 3K09C 5IUNC 4DV2B 1JIIA 3L7LA 3P2EA 3PK0A 4IFIA 1C2YA 3L0DA 4PO9A 2QMHA 4JJAA 3GLRA 3V5NA 3S4YA 8MHTA 5D8DA 4D97A 1PK9A 4UAGA 3WGIA 1ESEA 4G9EA 2FRXA 3L6EA 4JSRA 5D6NA 4E2YA 1MEJA 5I7AA 1Z5NA 1TM5E 4JJZA 2ZBQA 5MN5A 1GKIA 5COBA 3D6UA 9GPBA 4C5BA 1K6EA 3EGWA 4YRSA 3AVTA 4UREA 4EAAA 2BH9A 5EFZA 1SHTX 2Q3BA 1DKMA 2FK8A 4Z4GA 3ZKAA 4YUVA 3WLQA 4EB6B 3AVQA 3LHFA 3E2MA 2H4JA 3TG2A 1V39A 2FJ0A 4I5IA 3KSZO 4RL4A 3PDIB 5C8YF 2CLFB 1Q15A 3R40A 2YQ5A 4IXWA 4XW2A 3VJMA 4DTIA 1JEJA 1KMMA 3M9WA 3S8MA 3W2TA 2BTEA 4AWXA 3CEJA 5H81A 3DGEC 4UDNA 3UUFA 4DE5A 5B6PA 3HJRA 5GVRA 5FUMA 5AXDA 4HK4A 5NLLA 2UUPA 3THYA 5T64A 2EP5A 3GT3A 4PGAA 1N5RA 3IP7A 1QRTA 2WG2A 3H8JA 3PPVA 5EIXA 3JQ7A 3FYUC 4IUYA 4MJ3A 2VYCA 3ND9A 1BCRB 2PBFA 2JJQA 5DW3A 3GRFA 4FHCA 5ERGB 3N9IA 3OUUA 3GFVA 3PUVA 4UTXA 4CG2A 4DTCA 3GPLA 1FQWA 2M32A 1MQSA 1T25A 3RV3A 3B3AA 1HNXB 3BXZA 1V3UA 3OZTA 1DJOA 3CJQA 5A71A 4GP6A 2VHTA 1K97A 3HABA 4FR2A 5ALIA 1L4EA 1Y6JA 2DLNA 1E6CA 3DE4X 3UA3A 1H3EA 2YICA 2AJ8A 1RPTA 4P4UA 2GERA 5CVTA 3JWJA 1SKQA 1CR6A 1HZJA 4M1EA 2W2VA 2ESRA 4CEHB 3H0EA 1VDMA 4DZRA 2NU7B 4QGSA 1WHSA 3ILVA 3BIWA 4FMCB 5CLJA 1W6RA 1JJ7A 1KEPA 1GSAA 1FDSA 4WNAA 5DK4A 3S68A 2I33A 3EOBI 3WRXC 3OLWA 1JX6A 1RRMA 1T0JB 1J2EA 1C0LA 2XOKA 4FFNA 4ZPJA 2UZIR 5G4KB 5HFNA 5JG7A 3AHIA 1VBKA 3BL6A 4QBFA 4HVCA 1BEUB 3R09A 3GU3A 2JFYA 4P5DA 1OLXB 1KK3A 4EUEA 5GV8A 4NG4A 5ALTA 4AWBA 2FSGA 2BFCB 2PS9A 1Y3CE 2QN1A 1QJCA 3C3CA 4IUBS 1FNSA 4M60A 5DLPA 1R18A 2GEFA 4CFSA 1T4CB 2V3CC 2BRUC 4BEWA 3MK31 1R66A 4TKLA 4CHTA 3L6UA 4IXNA 4WVLA 1T0BA 2Z58A 3G17A 2CNLA 1YB2A 1VHQA 1QQ5A 3NHJA 1Z4IA 3S2YA 1XDBA 3DMTA 3RHSA 2IW1A 5D87A 4XTRA 3QSGA 4D82A 1C9NA 4V0KA 1CVRA 1P1HA 5J5CA 3KFLA 1I14A 1XKXA 1U99A 2QRGA 1IAVA 5CD9A 2DSNA 2WAAA 4R71A 3GFSA 2BH2A 2Y1LA 1O3YA 1UEJA 1UJ5A 4X71A 2VP0A 4YP0A 1YS1X 2B1GA 2TMGA 5I4BA 1MORA 4J0GA 1JEYA 3F0TA 3OIWA 1LDMA 4ZTBA 1LBEA 5LZ8A 1ZRNA 3HJNA 1F8UA 3M9XA 3O2JA 3WGYA 1CNFA 3FCYA 3M1LA 2C7BA 3PGJA 2FNAA 4WRRA 4Q3OA 2X5KO 2VKTA 4CZ2A 1TF7A 2E4UA 3TW0A 3ICWA 4MYSA 4YQFA 1JDZA 4JJIA 5HKKD 3FTFA 4LOKA 3BXFA 4BNFA 1BN6A 5EUCA 4QTUB 4CM3A 1I2DA 3EMDA 1G8FA 3TLKA 1EWTA 3O8RA 2J9RA 1CRQA 5FFFA 1FUUA 1MJNA 1E89A 3F46A 3VR6H 4FR0A 3X1WA 1USUA 4DANA 1OYVA 4Y0VA 1GARA 5HMLA 5LCXA 4HEJA 3T9AA 5KJCA 2Q5QA 2QPOA 1Z0KA 1OXKB 4YCLA 3AY3A 1CJMA 1T4DA 4LOJA 1QOPB 5JQGB 5E6SB 3N87A 4CW7A 2UXDB 3VH3A 1V5EA 3GEPA 4GOOD 3RTBA 2F3TA 2KS6A 2R6AA 1R3DA 4FFMA 2XDQA 3ZIAD 4Y2YA 2OR3A 3MMNA 2MSWA 2VLBA 3BXHA 1KZGB 3DXFA 5E3IA 3K31A 5MN4A 4Z4CA 4A8HA 3W3ZB 2DFTA 1AHIA 4DNQA 1L7NA 3EZNA 4X66B 3OU6A 4X3CA 4YLEA 3OBIA 1FZTA 2ACVA 5IDQA 4ENWA 5ECGC 1W8IA 2X8JB 4FDVA 3Q98A 10MHA 2HA5A 1LQ2A 1MW9X 2BMFA 1CDEA 1JPJA 2JGLA 2K6GA 1G8YA 2W6IA 3R3WA 4PSAA 4U5QA 5IBQA 2VQ3A 1EXDA 4RE5A 1R6DA 2H2WA 5HZMA 1A9OA 3ETEA 1GZVA 3OE7A 4G1EB 2ENWA 4QDOA 5B3AA 5HKLA 4FWBA 5KNBA 4H27A 1EIZA 5A1JA 3FX2A 1ZUNA 1PW7A 5HK9A 1KH3A 2A33A 2FE1A 5EL0A 2BWJA 1QHGA 4MJXA 3ZQ4A 3NM6B 1BYUA 3EK2A 3O1JC 1R4NB 1GFWA 3ZDAA 2OFWA 2BP7A 3WYFA 3LQ4A 5I3CA 3DCJA 1UMDA 4KZPA 5A6SB 1IBCA 1X9IA 3WGZA 4GI3A 2FQXA 3Q0TA 1DZ3A 1GQFA 5SYAA 1IY2A 4I8DA 1N8SA 5CR9A 2NV6A 2CN1A 3U31A 1GNVA 3IQIX 4ESEA 3R44A 1ZR2A 2H2HA 1UDAA 5EMHA 4FKBA 1IZYA 1NAHA 4DCUA 2FR8C 1R5OA 3ZR4B 4BN0A 2PD3A 4MWCA 2NQ8A 4ZFNA 4F45A 5IX8A 3AMVA 3L07A 2PSDA 1N9KA 1TOAA 1Y3IA 3I1YA 3LIIA 3PP8A 1A2BA 2FPIA 4FVTA 3UOWA 5C3MA 3GI1A 4KX3A 5BW6B 1B3RA 4K9QA 3DOOA 4YUZA 2LVBA 3DDCA 1FNNA 4URFA 5D51S 1GD1O 3OPVA 4M38A 3WLIA 5F9HA 1TUBA 2QR2A 2PNJA 2Z5VA 5A3RA 4IHJA 3MOIA 4J3NA 2BFDB 4YRMA 5KNCA 2DBYA 3GFGA 1AKUA 1NYQA 4HDKA 4TTVA 4H6VA 3VZBA 4URUR 2GCEA 3ELWA 3DLPX 3A37A 5FBHA 1ZW1A 3ABRB 3JQAA 3BE8A 4XM2A 4WLNA 3TZBA 2ZRPA 4C4XA 1G0OA 2GAFA 1F38A 1EWRA 2PJDA 5AVXA 1OREA 3ZGXA 5KYYB 4JLPA 4YCDA 3BFPA 2HBQA 4M4SA 4AMYA 1VIVA 5DP1A 3T7CA 2Q2NA 2VFAA 1XZHA 3WGMA 5C8VA 2OZEA 1MENA 3U6BA 1M83A 3L1HA 4OJQA 4RHYA 5ECWA 4HC4A 3W5SA 1PUJA 1BZYA 4E31A 4I9HA 1NPTO 2OPHA 2K2WA 3ZDDA 5B6IA 3OEHD 3T5MA 2X0KA 3HB1A 5MGBA 4PZYA 3B1VA 4OFZA 3VZQA 5LZ2A 4FGJA 1PQ4A 3DT6A 2EL9A 1L4GA 2GDJA 5J58A 5EKXA 2Q0SA 1UMBA 1KEEB 3H1BA 3WO1A 4HN2A 4BNJA 2MYPA 1SCUA 3SF8A 5K0SA 2C78A 2J3KA 2VWHA 2H4HA 3I0MA 1UBMS 4PC7A 2APJA 1G9SA 4BE7B 3QV1A 3NTOA 2A5LA 1W94A 2XVYA 2WJ3A 1UK6A 4QGGA 4UJ5A 1PL6A 4YJ2B 1ZJ4A 4ZO9A 4D9BA 1P73A 3N3AC 5DHRA 2ZQZA 4PSDA 4YXWD 2R84A 3F2VA 3MCZA 1GAQA 4CU5A 5H3LA 5BRJA 3L0SA 1KBQA 2OGWA 3EH1A 4AKHA 4F5EA 1NP7A 3K6JA 2G17A 2KBEA 2JASA 2YV2A 3DYIA 1ODKA 2PO5A 2JBAB 1AGYA 2XTAA 4G8BA 2R6ZA 1TMYA 3WL6A 1U9IA 2RAPA 1QE0A 2IY9A 2BMVA 3E8MA 1MX3A 3EEBA 4ENSA 1JG6A 4YN3A 3H6GA 3KE8A 3SVTA 3NRJA 4TRRA 3MFQA 2IYQA 4OLJA 1U5BA 3WLFA 4B3RB 4D43A 1SXJC 2H54A 2GBFA 1GFIA 4J7XA 1ZC3A 3Q7QA 3A9TA 3V8PA 4B3SB 2H1FA 4MXDA 2OEPA 3E82A 4PYNA 4TTIA 3AEYA 7ADHA 4LF4B 4CM9A 1EJ6A 2PAAA 3KYJB 3LKZA 4DFDA 1JLRA 3V3KA 4YRNA 4EUHA 1ZCBA 2FKAA 2YBEA 3DW1X 3FNQA 3MT0A 1VKNA 5E1OA 5GADl 2Q4OA 5DM0A 3SBXA 2CK3A 1GYPA 4EFMA 2VP9A 1WUTA 1NRXA 4NCNA 4F9GA 1CUHA 4ZN6A 4DCMA 3GFOA 5GY7A 1D2CA 1UFVA 1G7TA 1EHCA 2SHKA 5KHLB 2J33A 3OTGA 3TNJA 4EHHA 2H2FA 5DWVA 2J3MA 4BV2A 4ZZIA 1RWVA 3FNGA 3B1KA 4Q12A 4M9UA 5E8JA 5CB4B 1TW2A 1ENZA 1N7IA 4G0UA 2Q5IA 2ODWA 5HJEA 3T7KA 1HT0A 2ACKA 1NW6A 2JVJA 2VAXA 4C0LA 1T9GR 2C00A 3C8DA 1V8PA 1WHTA 4P0PB 2WICA 3TQTA 4PPYA 1MABA 3UPUA 3P32A 3MLBA 4QTTB 3PI6A 4B71A 1N78A 1SUSA 3NTRA 3SC4A 1N5IA 4OQ4A 3D4PA 3VJKA 1ZWKA 4OHKA 3RUHA 4BFZA 4IHQA 1WQ4A 4M83A 5HTOA 5ARDA 1GTJ1 3EGVA 1Z45A 4L9AA 5LKRA 3ILXA 1CQWA 4R1PA 2O59A 2ZJBA 1MT0A 2EWMA 4TXLA 4RYDA 1DKOA 2PWBA 1V11A 1W76A 2IP2A 1U4OA 1VG9B 2PX8A 4WZZA 5DI3A 4DEVA 3O91A 2FSHA 1DWPA 1JLSA 3GVCA 3SFZA 1F8YA 1FBNA 1EFLA 4GM1A 1KERA 3C1OA 4LC1A 4M9RA 3RVSA 5JROA 1SA0B 3IUMA 1JTEA 3B7GA 5BSUA 4YREA 2QUJA 2E1RA 2W8ZA 4TM7A 2CFOA 3RNOA 5TV2A 4PLYA 3W6OA 3MTDA 1JFRA 3EISA 4OH1A 1KMNA 4MVJG 5CP8A 4I2NA 2F3QA 1RTTA 1EEHA 4R51A 1DEAA 1T2AA 3A3OA 3A6DA 3BDVA 4YVFA 5DW0A 2HV8A 3CW9A 3E27A 1YR3A 3KQQA 4BO5A 4WL0A 5KNDA 3TRIA 4JB8A 4YUXA 2HHLA 1NP6A 5DT9A 3WB2A 3ZNNA 5LQDA 2FFRA 1YE5A 2PYDA 2D7DA 1HF3A 4QXAA 4AS3A 4KSYA 3AUYA 4B3XA 1J2RA 1NUSA 1ZHFA 1RI4A 2F64A 1TQDA 2XIJA 2GBCA 3VPCA 1PJ4A 3LT5A 4GKJB 1DAOA 2I4OA 2WKPA 3KLNA 2NO1A 4G97A 3RF7A 1EFRA 1J2JA 2XNHA 4IDBA 3QXHA 1LH0A 4PFKA 1MN6A 4MGKR 3RYIB 4JROA 3OECA 3NOXA 5DNCA 2WTUA 3H1EA 1YA6A 4J03A 2DJIA 4RZIA 5T3UA 4I5DA 1ZMRA 3UYLA 5HKBA 4KQXA 4AQYB 1GQRA 5JCZA 1R15A 1PSDA 1IU9A 3QEMA 2WV9A 1UKYA 1RT9A 3EQ8A 3PEVA 5JPCA 3QBJA 1MNQA 3DEIA 3NCTA 3RUDA 3WTBA 4I6GA 1X1QA 3U13A 1CWUA 3BRWD 5TGDA 1SZDA 4TSFA 3W0LB 3OX3A 4HNHA 5CYFA 3F3SA 1Q1NA 2B6HA 3GW8A 5CNIA 4NJMA 2RGAA 1OY1A 2QW0X 2IPNA 1ESMA 5TEVA 2JCYA 2WF7A 3OPMA 2QTCA 1NMEA 4OFBA 3LQYA 1SG6A 4K8OA 5ADHA 1BDHA 5I7RA 2PUVA 4L5AA 2ONKA 5HIKA 4EH1A 1JGTA 5C1OA 1RM4A 4BBPA 1XTJA 2QY6A 2G5GX 3SK0A 1W0JD 2PD4A 1RJFA 3LUKA 1I1NA 2F48A 2NUBA 3G1WA 4MP6A 2PH7A 1NVWQ 2QD5A 3DB1A 3JVEA 4U1RA 3VHQA 3F49S 4BQOA 1U7DA 5JRDS 3KQHA 1X1DA 4LYGA 3CVOA 1LCIA 3GAAA 4MRAA 1S1MA 5LUBA 2QMQA 3FNBA 4LECA 1QRDA 3UPDA 1RD4A 1PS0A 2I6GA 1PYGA 4N4AA 1YS2X 2YZ7A 3ICQB 1H4TA 3SGLA 4IYJA 2WP0A 1J56A 3AFMA 3JAWB 2ZBUA 4I55F 3WV5A 2JLSA 3M5PA 3S5UA 2IEZA 3AY0A 2IUFA 3CHYA 2FEMA 4TLDA 2QZJA 3CO0S 1FDOA 2DQKA 1MJGA 1HDCA 3OPYB 3ONDA 1N1GA 3BA6A 1CUVA 3FF4A 1MOSA 5SZJA 2I6UA 2J0EA 5K45A 2QTHA 5FTNA 3B12A 1U3GA 3AFNA 3ZH9B 1NVTA 1BX0A 1D2NA 3EGDB 2DFPA 3JQQA 2PMFA 1JMYA 3OPNA 1EH5A 4IH9A 4MRMB 4OHCA 4UEJA 2PUGA 4CL2A 1B6GA 2CXTA 2EJTA 2N75A 5JAOA 3GT0A 4F7WA 3THOA 4CEJB 3DFUA 4BIMA 4LZPA 1XMQB 1QO0D 2NW6A 2WVJA 2C5SA 1VJGA 3KZCA 1JYFA 1C1HA 3O2SB 4UHKA 3A2MA 1QHYA 4B81A 3TGLA 2BLLA 4Q9JA 4CKCB 5AVQA 1UBKS 5BN5A 4XWKA 4GZ6A 4JIMA 4EYGA 3LRPA 2Z2YA 1ZONA 3W9BA 1FNBA 4BJ1A 1I3LA 4URVR 2R1UA 3B6IA 2F90A 3U9TA 2O19A 4W7SA 4RHXA 1YVEI 3HU2A 5JZVA 4EKNB 3NBKA 2F9FA 3K09A 5H68A 4B4UA 1VE6A 1JIVA 3TBKA 1BXRB 1O5OA 1M76A 1OUMA 4S1NA 2EYUA 3RBXA 3ODPA 3DVAA 4TQAA 4WLOA 1NLMA 1WNFA 3DKIA 3LXMA 5DM4A 1WUKS 1FP2A 4C3ZA 1VHDA 5SZKB 2I7CA 3BRCA 2IW3A 4MA5A 1C4XA 4B31A 2X19A 4KO3S 1I01A 3QY0A 5F73A 4XB6B 1QHFA 2A6PA 4E2WA 5KMGB 4DJAA 2GZSA 4A2CA 3TJRA 3ZGNA 2IYWA 4OY3A 3W5UA 2GASA 1MH1A 3FNRA 1GPWB 3WIDA 4CG3A 4XUGB 4UXJA 2GM3A 1HWYA 3GGSA 3RJTA 4BXOA 3CBQA 1KK0A 1OVMA 4RWEA 1TT5A 4IWYA 3QFHA 1ACJA 2I29A 1VZ2A 1T1GA 2DBVO 3P96A 1BVUA 3Q8WA 1N77A 4OHUA 2PDAA 1V16B 3DM9B 4CTJA 3L7JA 1QYXA 1QX3A 3QPBA 3TOSA 3I62A 1NGSA 3G0IA 1B0ZA 2HXSA 3PRYA 4X85A 3WZ2A 1C2TA 3CB4A 5K09A 2B4QA 2G08A 3TYXA 5LOVA 2PBRA 4NXNB 4INPA 4LWOA 1YR6A 4XEUA 3RIGA 1P0QA 3PQCA 2OBBA 3QVTA 5A3JA 4C0JA 1KS2A 5CA1B 4LS3A 2R00C 4PAWA 4Y2SA 1LZKA 1T36A 4H3SA 2A0XA 2XSZA 5FNVA 3ZJUA 1KTVA 1JU9A 3ZE2B 3ZGLA 3ZI4A 4HX5A 2YC4C 3PJEA 1HE3A 3AEXA 3DULA 1B14A 4Q7MB 4DDMA 5CBPA 2XGOA 1Y7IA 3NHRA 3BB3A 3X1XA 4BLSA 3EXG2 4DIBA 5ICSA 3AVXA 1VCOA 4YQZA 3BJEA 4FGSA 4PVCA 1ABEA 5CVJA 5GOZA 2HUPA 4Z6KA 4BKRA 3PNVA 3S7ZA 1DCTA 3L82B 4EELA 2JLWA 4QFMA 1GUDA 3TX6A 5LQAA 1GL3A 5A4AA 1FUEA 3P2YA 4OQMA 3AF1A 1W48A 2A9KA 3L4EA 2HDWA 3WRXA 2AN4A 5JXHA 1YB4A 1DEXA 1OWOA 1X1SA 3GJTA 4DB4A 4DA4A 2Y6VA 1CIVA 1G5HA 4G5GA 4D74A 4CODB 3WLKX 4H1HA 2YMQA 5EZSA 1H6BA 1MTZA 1HETA 4ILKA 3EDMA 1ZUIA 2OC9A 3GLVA 2X14A 1TQ6A 2VXYA 3JALA 4OFXA 3H04A 1P77A 4UVEA 3H7AA 1B41A 4R41A 4KMMA 1DRWA 1O08A 4RKFA 3H97A 3OIUA 2D4HA 3ZLBA 4BKOA 5JANA 2BRUA 1SXJE 2HRCA 4H7PA 3U4QB 3DTNA 1P9RA 1XAJA 1TFRA 5ALHA 1E2EA 1KYQA 4YMUA 4R9VA 5JSQA 3DCYA 2PWPA 3EHDA 1RYHA 2C9CA 1BHO1 3LP5A 1TADA 1WEKA 4XUDA 2Y76A 3C7CB 1ML3A 5FTWA 1CJBA 3FBGA 2UYHA 2HXGA 3QY9A 1DFHA 1GL7A 4CTKA 1R64A 2QR3A 4XH9B 4DMKA 3ZDYB 5C46F 4GC5A 2YXEA 3M2TA 4CNBA 3NKFA 2E0IA 3JVUA 4HWSA 1IMOA 2FPRA 1ZX1A 1S3FA 3E23A 3L41A 2AMFA 4G41A 3CIOA 5J2TF 2XYVA 3NHZA 4ARZB 1TCCA 2UAGA 2BDEA 2A5YB 1DVRA 1RLTA 5BWBA 3VNUA 3OU7A 1W4CA 4ZJYA 1JR3A 4KIWA 3KXKA 3P94A 5D3MA 3BXPA 5CDHA 5KNBH 2Z8ZA 1SJ9A 3IQWA 3G5AA 2HEGA 2NV2B 4TTSA 1A9XA 4LVOA 5FX2A 5F2OA 1T8PA 2J5XA 3HUFA 3Q3VA 4ZVPA 3HL0A 3T7AA 2X6RA 3HWWA 4Q18A 1Z5PA 1UQUA 1VKRA 2C03A 2OFOA 2OAEA 1NBHA 2Y0CA 2YWCA 4V02A 1AHPA 2FZGA 2JHAA 1JU4A 3L84A 5HVNA 3D3QA 2XGJA 2HCRA 4GMXA 1MX9A 4H18A 4R3NA 2ZUTA 4NJEA 1NUTA 5E3HA 1M2FA 2FUG6 3JYQA 1A9PA 1J6UA 2D74A 1HYBA 2A3NA 3OQBA 3CH7A 5D86A 3GRKA 2OV8A 1WB6A 4O2BF 5HJ7A 3LKVA 5JMTA 1QQAA 4ZEOA 3DO5A 1XJ5A 5G0SA 1QV7A 1UXJA 2H6EA 2PRKA 1VLMA 2QTRA 3TTSA 4AO6A 2PUBA 3GUUA 1XZDA 2P90A 4F2HA 2C9BA 1XCLA 2O4UX 2XQJA 3PNMA 3TM4A 3FRIA 5LYJA 3EY4A 3L7BA 3QF4A 1GDDA 3OQ1A 3T5BA 4LFAB 4FBMA 5IMSA 3V9AA 2QORA 3AETA 3IPRA 3Q5EA 3QVJA 4WK2B 2VPQA 4K9LA 5TR9A 4PS1A 5AVYA 3PGVA 5KNCH 3EZXA 1H1TA 1Q6YA 4H1UA 4X90A 3VPDA 4BE4A 4DA6A 5BUCA 3P9ZA 1EZ1A 2WQ7A 4EM6A 1ZCZA 4K6OA 1R0LA 2IYRA 5LP6B 4BATA 1P7VA 4MYRA 4PCLA 4RFLA 5DU2A 5CEFA 3IO5A 2IH2A 5K5EA 2F00A 1FA9A 5CBKA 5FHQA 2J3JA 2P91A 1WSWA 1EG7A 3OOWA 4HDAA 4B4KA 1EDZA 1KL7A 1NIPA 2V6JA 1BXZA 2BPOA 2V6MA 3GJRA 4G5XA 4RKRA 3ZWOA 4RPHA 1UKAA 1XKQA 4QUEA 1E4YA 2QTWB 2XA9A 5FB3A 4K9PA 4QLAA 3EVBA 3NHKA 4AUMA 1MVLA 2WIDA 1K98A 1P9OA 1F0KA 1US8B 5EMNA 3V6LA 4ENTA 3HXOA 1RBYA 2ZB3A 4XDYA 4B84A 1ZD4A 5IW8A 4WLUA 3HSYA 1RZRD 2J0SA 1LLCA 3G7UA 1A2KC 2NXWA 4V1CA 1DC7A 5K4HA 1QIHA 1RP1A 1U2RA 2EF0A 4MWBA 2RK3A 1CUJA 2VL7A 4WOPA 3ROGA 1AUOA 4MDYA 2H4WA 2PRSA 1NXSA 2ASEA 4M36A 1JYSA 2FR8A 4I8XA 4TROA 1DO0A 2IZ7A 2JI7A 4KV9A 5I51A 5DB4A 5P8WA 4E09A 1D6MA 1PWEA 2XUKA 3LHDA 4PRYA 4XR4A 3R4CA 5A4MS 3L3BA 1T24A 1BD3A 2R97A 2ZANA 3PE3A 4JDUA 4MGEA 2Q1TA 4OHVA 4RK5A 5HE9A 2PT5A 4DR1B 1GTSA 2Q9UA 1IN6A 2V7QD 4IKEA 3B3FA 2VWGA 1TE2A 4M6WA 2M98A 1KARA 3MINA 1RSZA 1XD2B 3VPBA 3NGMA 1Z0ZA 2FZ4A 4HKTA 4JU8A 4FQ5A 1XNHA 4MKHA 4ZU3A 5FFNA 2BEUB 1M2HA 5HIJA 5AUPB 2HPAA 4UVDA 1DT5A 2J9ZB 5TXGA 3WDMA 1T13A 2FUKA 1QK4A 2OQVA 4D9GA 4EITA 1OOEA 1YJ8A 2AC4A 1F12A 2ZB4A 4AECA 3WY9A 1ZY2A 4DZTA 4TYMA 3QNMA 5AK5A 4EZEA 3ZJ5A 1JDVA 2VP6A 3U7RA 1UAAA 3DLHA 2CLMB 1NL3A 1A69A 1NLZA 4MKZA 3V4ZA 1EUCA 1E1DA 4FCCA 1B3BA 3WSWA 2HDNB 3EPPA 2RB4A 1NOIA 4FHGA 3KHTA 5JNRA 2LDBA 3WMEA 1XFAA 1S96A 1YVRA 5DBOA 4YO8A 3ZG6A 1YRHA 3KPWA 4EBBA 4F2PA 1RHJA 3MWYW 1ZCJA 3UT5B 3QG5A 5LQUA 1V9SA 1VIYA 3GLHE 4TRNA 4WI1A 4S04A 1RYYA 5A4KA 2HFJA 3O73A 3KSRA 1M8KA 4J29A 1OIVA 1SH7A 3CLVA 4MIKA 1W46A 2IYYA 2KB0A 3IUEA 2DBRA 4X3PA 2J48A 3LUAA 5ANRB 5ESRA 3SHFA 1FPQA 1TMOA 3O9ZA 1HLFA 1AKYA 1TU4A 5BQPA 5HZGA 1U2GA 3TL6A 4AZ0A 3HP4A 4EJFA 2B7BA 5JY1A 2VNAA 1SAYA 1MPXA 3CLRC 3M6VA 3QI7A 3PDJA 1Z6GA 2O06A 3NVAA 5IJ0B 3K70C 1R4MA 4E2XA 1JHRA 1IOLA 3DHYA 3NIDB 2A2ZA 2J5KA 4MR7A 3U3XA 4I50A 2XHZA 1CJCA 3KUCA 1MA0A 1UKVY 1V6SA 2IU3A 3I1FA 3Q1KA 4I3FA 5EMJA 4CV0A 3RE1A 4E6PA 1SELA 1RXEA 1Z29A 1HFEL 1S5PA 4KQ9A 1V47A 1IWBB 1USVA 5C35A 5KU1A 5HF6A 3AIKA 3OCYA 4EW1A 1XPRA 1J9GA 4C04A 4M0FA 1CJUC 1G66A 4EMUA 2XBMA 1RM5A 3ZLJA 3BCHA 1GAXA 1T5TA 2ILVA 4J8PA 2Y66A 3E6AA 4JOCA 5FTMA 1CIPA 2XE8A 3PQ3A 5DGXA 3ZJYA 2QVYX 4YAUA 3HKEB 3UAWA 2C4UA 3MTGA 4MTCA 2GKGA 2QUIA 3QEJA 1TCAA 5I9NA 1QUEA 2P2SA 3Q3CA 4L51A 4WUVA 5T4BA 1VYVA 1UPFA 3O31A 2NLOA 3W6PA 1T8TA 1NVEA 2GXAA 2P9TA 2NIPA 3HM9A 5G0VA 3W05A 3NUQA 4Q9IA 2ZRDA 2P0EA 1ODCA 2O3SA 1E5LA 2O5VA 3G0CA 4PQGA 3ADBA 2CHFA 4C22A 1PVDA 4JUAA 1D2HA 2N1MA 1CY7A 4XCQA 2DAPA 2BI8A 4FGKA 1VJCA 2L42A 2YWJA 1J42A 3L18A 3SJAA 2V4UA 1G291 1I30A 1EVEA 1H4VB 2Q5HA 4XGKA 3CZ4A 1TZ2A 5IFKA 1KWKA 4PGFA 5EWMA 4HXFB 3WGUA 3N59A 4DAOA 5F2NA 2RAUA 3RYHB 5MF6A 4NPAA 3MWGA 1ODIA 1Y1QA 2GPNA 1PZMA 4ERXA 2E4ZA 2GD6A 4LKOA 2J7PD 4MDEA 3KQMA 3COZA 3QPAA 1ZRSA 2VH2A 3OCXA 3WMRA 3GFFA 3I39X 3SMQA 1SCKA 1K4YA 2P3QA 2YJ5A 2YXNA 1M0TA 4CIDA 2YHIA 3DOCA 1HDXA 4HH3C 1QYVA 3UHPA 5DZSA 1W36D 2G83A 3L05A 2VRNA 2AUTA 4ZI5A 1NYTA 4R9SA 1AX9A 1CF4A 4EW6A 2N9UA 4BWGA 5D5QA 3NVMB 5B55A 3OM8A 2GAIA 3K96A 1YZNA 5FBKA 4B3FX 1P1CA 2BBSA 1C0PA 2A94A 1CSEE 2E4AA 3UH0A 2V7XA 1K27A 1PZGA 1E2PA 1DAEA 4D44A 1O94A 2HOQA 4CMIB 4UCQA 1AC5A 4NKRA 2XXAB 2WD7B 2E18A 3WG9A 4ZHQA 1COWD 2WU3A 1IY0A 3CGGA 5LIRA 3TSYA 4I5GA 1NW9B 1OF1A 2ZAIA 4KAXA 3RGGA 1T5OA 1EFDN 2NUPB 2X2OA 4QA9A 3UJPA 3ZBUA 4OQYA 4DLSA 4F12A 2JDIA 1JR6A 1J33A 1GRRA 3AZQA 5C4MA 3Q88A 4ZTZB 1BE6A 1VMAA 3H9JA 1UH5A 1YL6A 2GH1A 2CZGA 3ZCXA 2WTBA 4R68A 4AM8A 5BOSA 4LY3A 1KJNA 1WY5A 3R3SA 4CF3A 8AT1A 1MFPA 1KETA 2EGGA 2VSYA 2W37A 2ZRLA 3D0RA 4G24A 4WINA 3HWSA 3UCEA 2PIAA 2CLKB 5FLXA 1MX1A 2G1AA 5JI2E 1M1UA 3QBTA 2EFYA 4LKRA 4AJHA 1F1JA 3TGPA 1Z37A 2G80A 1FLAA 3FN4A 4FYKA 2W2MA 5E7MA 3OUTA 2WKQA 4Y9SA 1RLIA 3EH2A 4J3JA 1UM8A 3PFCA 1EK2A 1ENPA 1JKMA 3C5CA 1Q0HA 3HA7A 4P3NA 2PGLA 4Q3AA 1FUYB 4G65A 4TWIA 2ZYGA 1II8B 3JWIA 5LB2A 1V3TA 1D2EA 2GUGA 2NV0A 2P5YA 3O8LA 4ID3A 1HE1C 4IR7A 1B0UA 4U5XA 3P8ZA 2JK1A 4JBIA 5BW5A 4NENA 1A50B 3ESQA 1CETA 4M2LA 5HBGA 5EC8A 1DZIA 4W99A 2JS7A 3EW7A 3LCRA 3TD6A 1V26A 5FWAA 4S3MA 1Q77A 3PR3A 3GGPA 2CZCA 2JRLA 3AF5A 4NOLA 1WUJS 4NF2A 3WRVA 4DUYB 2NU9A 5AQEA 1P39A 1MAAA 1RVDA 2QTBA 2NYVA 3DV0B 3TSWA 1ICEA 3PX2A 3AP3A 3RHTA 4FDLA 1FYWA 4NULA 4EYEA 2C88A 3EUAA 1DLIA 2IZZA 3KL4A 1CUZA 1EM6A 2EZTA 5LL6P 2YFHA 3NB0A 4OXIA 2IH4A 2PGDA 5HDBB 2CBGA 3GDHA 4O8CA 3TEFA 3ZD7A 1VRCA 1LGYA 3KUUA 1ZD8A 4LRQA 4JVSB 5CJJA 4N49A 4D0RA 4O4IA 1G20A 1P5FA 4R6WA 4IHJF 3WS7A 4BB9A 3IV9A 4HADA 4B9AA 2WVAA 3CCFA 4DA8A 4YJ3B 1NVBA 1VG1A 2M6KA 2E48A 4B3MB 1I4WA 1HDRA 1R0RE 3JASA 1R9JA 4HAOA 4PANA 7AT1A 5JY6A 1LS1A 3ABQB 3EXIA 4ANFA 3VU8A 4AX4A 1DQPA 5AVVA 4DR4B 1T9HA 2IS4A 4J16C 3MJCA 1PFGA 1FRQA 1VLHA 1F0PA 2C94A 1EA5A 2O57A 5ENDA 4ZCSA 3G0HA 2YKGA 3M4NA 3AEQB 1J5XA 4RZ2A 4QU0A 4UM5A 4AJNA 4HSGA 2YRFA 4OKNA 2DKFA 1SVLA 3EBOA 3HJHA 4FBGA 2EYQA 1TUIA 1Y1RA 3DWGA 2V7WA 2PKYX 5H9WA 5CTJA 2C59A 2J30A 5EVCA 3H87A 3H86A 5EJMA 3TFOA 2JKZA 4KR3A 4YC7A 3KD3A 1V71A 3OCWA 4IIEA 3Q9UA 3EZ9A 3ML1A 3LFTA 2IEYA 2W6CX 3C14C 3KJNA 2QUAA 1ZKMA 3MS7A 3H99A 4QU9A 4OX9B 1ILEA 3EAGA 4Y7DA 1L0BA 1RIFA 2P1DA 3D7NA 2WWRA 3JYLA 3OIDA 1HT3A 3EOAI 1ZJ6A 3GOHA 4TUYB 1QV9A 3B6ZA 3GR6A 3K8YA 1IRIA 3L1VA 2P9QA 4JLSA 4DAEA 1AKMA 2Z04A 1BWSA 1Z28A 4EB6A 3FGZA 4R54A 1YNSA 1U9ZA 4U2KA 4BTLA 5CLFA 3T1VA 3TW8B 3GRAA 3BULA 5DN6D 2FSVC 2GJ9A 3PDIA 2FEOA 2GPAA 3A70A 1W9MA 2FR0A 5J5VA 2HF9A 1F48A 4G0YA 4UHDA 3X1DA 2PMEA 2QL9A 4WN9B 1R9MA 2F8LA 3FETA 3HEBA 4QGFA 3TL2A 4PLCA 2BFFB 4B6PA 3BMCB 3P5BA 1KDTA 2Q4TA 2DG2A 4MVJH 5CDUA 4M9QA 1FSPA 3HXLA 4DHWA 1QCDA 1BCRA 1PSWA 3FHJA 4S1TA 1TQHA 1OT5A 4ZAGA 1K92A 1ES9A 1G8MA 4D3FA 2E3JA 2QRUA 4DBZA 1O57A 3H84A 4C20A 3ZJTA 1ODSA 1G41A 1N32B 5KB3A 4J0DA 3SKYA 2VJKA 3DHWC 3HDTA 1KDYA 2YOGA 1EBBA 3ZGZA 2WF9A 4GBED 4AZVA 1LB1B 1YR1A 1K6MA 3EZFA 4N6GA 1VB3A 1KZHA 4YUAA 2Y0DA 4XQ9A 3M6MD 1MB4A 1BKDR 1I36A 1NVGA 2AW3A 4JQSA 1E7YA 2GLTA 3BXXA 5ENVA 4AMUA 3U16A 2JJ1A 4RTSA 3S2IA 2RFLA 4CEHA 1YS9A 2C57A 1TO1E 1ZNWA 4OM8A 4II2A 4YK7A 1QONA 2NU7A 1AGXA 4PNPA 3L01A 2Q3LA 3AH8A 4IIBA 4PSUA 2EW1A 1BIFA 1OC2A 1GPMA 2JEZA 1VGQA 2SKEA 2YUIA 3SG0A 2WB2A 1RWKA 1NC1A 1QGAA 2M1XA 2WIBA 1A88A 5G4KA 5LWHA 4TWRA 4BFYA 4X97A 1SFRA 1U0RA 3L7OA 1ZXXA 1E1QA 1R4ZA 3MWFA 3P26A 5A9RA 5IC6A 4I66A 1HI9A 2BFCA 3K30A 1Q1AA 3U09A 3MOGA 1RQNA 2GCPA 1JE0A 1Y7LA 4MA4A 3WADA 2H1LA 4KR6A 1AZLA 1SVWA 1T4CA 2E4XA 1A4RA 3C3JA 1H5NA 2HBZA 3ETJA 3QJYA 5A2GA 1YFJA 2P4QA 2WTNA 3P0JA 5BSEA 3B6JA 1TLFA 2BKEA 4GE0A 3SIRA 1NOKA 2QW1A 1VG8A 5KYTA 1OT3A 3OEWA 1CBUA 1VKZA 3MF4A 2JJ2A 4ND4A 2AOVA 3WOVA 4ZK6A 5BY2A 1WXHA 1P7YA 1ORVA 1AHNA 2QMEA 3UWSA 3KYBA 3MWJA 2FUG1 2Q1XA 1BE1A 4U8HA 2HJHA 1YTUA 3E70C 1O95C 3BH6A 4LGYA 1XD9A 2QPAA 2ISQA 2I6QA 4LRWA 5AIAA 3C7DB 1K86A 3GFQA 5CW2A 1U0FA 4U2EA 1MJ5A 1V4BA 1W75A 3I04A 2O2HA 1EFKA 2XDYA 4QTZA 4F3TA 3DD1A 3UENA 3KHSA 5FOQA 3VUFA 2ZYWX 5BRAA 1UP7A 3HDHA 3CLUD 4GXRA 1L4LA 5AUOB 3E8SA 1ZBQA 3OPXA 5JXJA 4ZGBA 4R8VA 5JXWA 5DLQC 3WIUA 2YCLA 2H4ZA 5LYYA 3TECE 4QQKA 4AROA 3ITDA 4M21A 2C2MA 3QFSA 2CVOA 3TLMA 4YAJA 4DIEA 2XOKD 4RZUA 2QYTA 4F4IA 4HB2A 4IJKA 7MDHA 1D8TA 1BE8A 2A5JA 4XYEA 4KWIA 2V5UA 4CLOB 3VU1A 3FD8A 2IJGX 2QRVB 2MT9A 3OZVA 3MPUA 2C04A 2QTZA 4IQFA 5E6SA 5JQGA 2GKOA 1CUSA 4BEVA 3W8DA 2HB6A 2XMBA 2DKNA 2ZSHA 5BR7A 3GMDA 1Y8ZA 1ZW6A 1WSBA 3L0ZA 4HRVA 3I64A 4IILA 4G4SO 3HWRA 1L6RA 4LY6A 5CVUA 2C5LA 4M7PA 4QRDA 4IIDA 4H1WA 5C1BA 2R5WA 1UIMA 4LN1A 2PIDA 1DAIA 5JDCC 4JBXA 1Z82A 3JTEA 3TB4A 1EP9A 1SOVA 1RCUA 2X8JA 1JQBA 5G4LA 1V4VA 2Q5JA 2P9JA 1TD1A 5LP6C 4ER3A 3EPKA 2GXSA 5AIBA 1YONA 4OU4A 4RK1A 4YAFA 4PVDA 5K0EA 1POWA 3L77A 4TWBA 3IHWA 3DBIA 3EIFA 3K2EA 3R7NA 2EKZA 1E2BA 3OCVA 5DCLA 3G3EA 3NKLA 3PXXA 4X62B 4ZCLA 3COJA 4BRZA 2OAGA 5I9IA 3O4IA 1R4NA 4ZC8A 1X7GA 1ZUD1 4EGSA 3DP9A 3L0IB 2HRRA 3NX4A 4KOAA 5F35A 2RCNA 1YZVA 1H2HA 5A6SA 1YZUA 4LWQA 3A6PC 1SQ6A 3HGMA 1D4FA 3ND6A 3QLVC 3CF2A 2G0TA 4H1VA 4X8MA 2NSLA 5AUQA 3NYRA 3VYWA 5K0BA 2GYYA 3J81k 4KH1A 1QKIA 3WFJA 3GRUA 4O3MA 5H7XA 4L6IA 3VRHA 4PYJA 3QNUA 3GFBA 4K86A 4XYMA 1BNCA 1JQ3A 3CG0A 2JBWA 2QD1A 3I8OA 1P91A 3LDUA 4Q05A 3K6KA 1UEXC 3NHYA 4Q3LA 5K8UA 2B3TA 3R41A 4M9XA 1JSZA 4H4DA 3MRVA 4FZ5A 1W44A 1QB7A 4GF5A 1FIUA 3WBKA 3PQDA 5BSTA 2BFDA 2LCIA 2YCBA 1HXHA 1E0AA 1GA4A 1Z4JA 4A9AA 2V74B 2V6BA 4K88A 4HDQB 4QAJA 5FH9A 4ATNA 1WXDA 1NNUA 3K8ZA 1HK7A 2Z4TA 3OWOA 4KYIB 2VJYA 3NUZA 3E4CA 4S0XA 1IZ0A 5KYYA 1O03A 5DIFA 1PL0A 1QFMA 2G1KA 2W6ID 2OD7A 4LZZA 2DP4E 2MMGA 1QZ3A 2GAOA 2PJUA 1PLKA 1YDWA 3NV7A 2B99A 2E49A 4FXOA 3M1AA 4ZOBA 2X2EA 5FPSA 2MOKA 1OTYA 2PRIA 5KNBD 3U3MA 5LXTB 3HHPA 2FSFA 4KQ2A 5BMVB 3LBIA 5HRAA 1SCIA 1SM4A 3ITNA 1CS0B 1Q7TA 2WUVA 4LK2A 4WKBA 4HCJA 4P4NA 4RJLA 4ZJPA 2G77B 2C2ZA 5DEOA 1DSSG 5ITZB 2HTFA 1EA7A 1V8FA 1KEEA 3R3JA 4Y2VA 1SCAA 1G8KA 3MTEA 5F33A 3SE7A 1CZNA 1CZUA 3OOHA 4IOLA 4BRUA 1X42A 2WUEA 1AGPA 1DX4A 3ZHSA 3KO8A 1KEKA 3ESXA 1PHPA 2CKMA 5E1BA 1IHOA 2VBCA 2OQIA 5DCUA 5LA6B 3T5DA 3T38A 1H65A 2A0UA 4YJ2A 5ISMA 3K32A 1Y6ZA 2CJPA 2LP4Y 3D8TA 5KQGA 3R3UA 4ZYXA 2Q8PA 1Z7GA 1GNLA 4JEHA 4W8GA 5CYGA 3THWA 2QNRA 3UNXA 2WPNA 2R9VA 3NAZA 1V25A 5EJGA 3DZGA 1JPNA 1FX1A 1R5JA 1YZKA 2RG7A 1U7UA 2F7SA 2XQVA 3BTOA 4NY1A 3T4PA 3WP1B 2JF0A 4UHCA 1I3OA 4Q9DA 3WSVA 2NO0A 3ZPXA 3LO8A 2JBAA 1RJWA 3Q87B 5EN4A 1C7RA 3D0KA 3QRWA 5JAZA 4JMPA 3SQDA 1K7SN 3AI7A 3LDAA 2HZBA 4D9IA 5KVAA 3Q0IA 1LLQA 4LSMA 3AKZA 2EATA 5IJ9B 1N8NA 3UAZA 5JCJA 4RHFA 5CIQA 1KA9H 1GZ6A 1NMYA 1RI3A 2NPOA 2IEBA 3DOFA 2R5FA 4BLUA 1XT6A 4FPXA 3DQQA 1OWNA 3USES 1ARZA 4PZ9A 1Q74A 3CM0A 1JH9A 3ELBA 5FNVF 5BNIA 4FDTA 4B09A 3QTTA 4KQWA 3QEKA 4EX7A 4AG6A 2JHPA 3SXUB 1YMQA 3FNFA 1LRKA 1EWQA 1UBEA 2O48X 3MLAA 3KCQA 4QDTA 4C03A 4MP3A 1AA9A 3VC7A 1OZAA 3RC9A 2X9VA 2B25A 3TBFA 2XCIA 4I1OA 2C4KA 4ND6A 3WQSB 6ABPA 3NDPA 1N2CB 4PAQA 3X1MA 3QG1A 4JHLA 4W82A 2AE1A 5LZ5A 5KKCA 2Q1YA 1OI3A 3FLBA 4JZYA 5JVDB 1P5RA 1OGYA 1H85A 4D42A 3UGQA 3HLTA 3H2JA 3QUAA 2WUDA 4BWFB 4KFTA 1T3LA 4II3A 4YGYA 4C7KA 5BWCA 5CB4A 2ZATA 3A1TA 4GL4A 4ISCA 5EHGA 1GPKA 3S2EA 2A92A 2QW8A 4UBLA 4W1PA 2J5QA 6LDHA 1CDDA 4MV5A 4DA7A 3NNSA 1PFWA 1ZRHA 3OQHA 2JGKA 2B8TA 5AYVA 4YLYA 1OD6A 2XF8A 3FDJA 3UV3A 3TNDA 4OQZA 5C5DA 1XZMA 2W22A 3UN1A 2BBWA 3V7FA 1Z33A 4G5RA 3EZGA 5J40A 3DNPA 3EA0A 1W29A 3TAHA 3VR2D 2R1ZA 1NUQA 4UARA 4HDRB 1O8CA 2XNDA 3SFVA 3RUAA 1TA0A 1AS3A 3N0XA 4XVCA 4MPPA 1P0IA 2MSLA 1KJJA 2FTKE 3I2FA 5EQFA 1OLOA 3VVMA 4QDXA 2H1IA 1UXHA 1UM9B 4X41A 3EDCA 4E5MA 3RM3A 1GKUB 3PJGA 4M99A 2AH5A 2N42A 2LR0A 4HFJA 4NABA 1RQXA 1ZUWA 2KMLA 2R8OA 1BOOA 2VF4X 1EHYA 2WIJA 3O0DA 3TCXB 2D0PB 3C6KA 3KWFA 4UMVA 3RAFC 4DOMA 2V6GA 2QVBA 2SKDA 1NBOA 4Y2JA 5CJPA 1SKYB 2D2IA 3ONFA 1EDBA 1KAGA 2AG0A 3FSGA 4CM9D 2BFEB 4HAVA 3OZWA 4O2RA 3BWEA 1W6UA 1HURA 1YJCA 1YB6A 4GECA 1NQUA 2OHOA 1Z68A 4WXYB 4RMJA 2YNMD 5H80A 4NPCA 2CK3D 1PIWA 1NI4B 1AQJA 5AI4A 1AOXA 3FUVA 4TWZA 4BWVA 3O21A 2BGWA 4R2WA 1RDFA 4LI3X 2V58A 3A1NA 4IM7A 3M5WA 3O5AA 1P7ZA 1MAUA 1C4KA 3GN2A 5HKOA 2BMDA 4N1AA 4C6RA 3L49A 1UBJS 4Q66C 4F9TA 3FMVA 3O8OB 3WLJA 4DDVA 2VLIA 5JAPA 3OFVA 2FZLA 4Z0NA 3FWZA 5T7BA 3RG8A 2IEIA 4BFVA 5FF9A 2R48A 4HJRA 2W2KB 3MCUA 4MQUA 4NMWA 2GHRA 4TXMA 1E0JA 4URHA 3VR3D 3HXPA 1IPFA 2RAFA 13PKA 1WP9A 1RCTE 4POAA 4YT8A 5TIIA 3ZCVA 4F3NA 1TVKB 1A5ZA 3RYIA 3GV0A 4FFWA 3MUOA 1KEZA 2Z2KA 4X8LA 1YGPA 2GNPA 3HXTA 3T5CA 2QUKA 1TD9A 4PN7A 5LYJF 4M0MA 1JG7A 4JR2A 4ZAWA 5B58C 2OLEA 3AKDA 5C1PA 1HBJA 3RVBA 1B23P 3W3AH 4DQLA 2WU8A 2J4CA 4I7EA 1IG0A 1X2EA 2EJUA 4TS9A 2IYUA 4FBLA 1Y1LA 4XB1A 4OF4A 8ABPA 2ZBRA 1Q83A 4ARUA 1IHYA 2I67A 3CNNA 4XD7D 2XI4A 3OZFA 4LXQA 1OFVA 5J23A 1Q12A 2NN3C 3FWPA 1Q50A 3M8KA 3AUAA 4BEBA 1NBME 1JVNA 5JTTA 1Y4DE 5C1IA 5B3JC 4NBUA 3VYSB 1XJWA 1TZCA 2IYAA 2X1LA 1BTOA 1YK0A 5J3JA 1T91A 4RVFA 4DSAA 3C5HA 3TE6A 1FP4B 2CL5A 3D5QA 2VDPB 3KM0A 3U4DA 3GARA 3KB2A 2VDUE 3IDFA 5CTAA 2C3PA 3N8DA 5K0GA 1CUEA 4ESHA 2Q9BA 4L15A 4NAVA 4GDMA 2NG1A 2ZIAA 4LCBA 3RKUA 2NTYC 2GTIA 4OU5A 5AM3A 4BMYA 2GYVA 4IJQA 5H0IA