2INGX

X-ray structure of the brca1 brct mutant m1775k
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
211
structure length
208
Chain Sequence
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNKPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pathogenicity of the BRCA1 missense variant M1775K is determined by the disruption of the BRCT phosphopeptide-binding pocket: a multi-modal approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Breast cancer type 1 susceptibility protein
total genus 52
structure length 208
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2ingX02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2ingX01
2DUNA 1JNXX 2EBWA 2D8MA 3QVGA 2NTEA 3UENA 3SQDA 2XNHA 1CDZA 2E2WA 4JLUA 2WT8A 3SHTA 3PXDA 2L42A 3EF1A 3PXCX 3L41A 1T2UA 1T29A 1IMOA 3SHVA 5ECGC 1T15A 4BU1A 3PC8C 1WF6A 3QVGB 3PC8A 2COEA 2M2IA 3COJA 3T7KA 3PD7A 2K7FA 1T2VA 3PC7A 3K15A 1N5OX 2R1ZA 3K0KA 2ADOA 2ETXA 4BMDA 2K6GA 4U4AA 4OFBA 4XQ0A 3EF0A 4N40A 3K16A 1GZHB 3HUEA 3L46A 3K0HA 3T7JA 1L7BA 2EP8A 2COKA 3L40A 4BMCA 4ID3A 2HTFA 2XNKA 3KTFA 3I0MA 3AL2A 1OQAA 3PA6A 3JVEA 3II6X 1Y98A 3UEOA 4BU0A 4Y18A 4IFIA 3HUFA 1L0BA 3AL3A 2INGX 2LE0A 3OLCX 3PC6A 3K05A 4XPZA 3T7IA 2VXCA 3PXEA 3FA2A 2JW5A 1Z56C 2COUA 1KZYC 2VXBA 3I0NA 3PXAA 4Y2GA 3SZMA 4IGKA 1IN1A 3U3ZA 2EBUA 2AZMA 3PXBA 3T1NA
chains in the Genus database with same CATH superfamily
4FMCB 1OH7A 4LXUA 5IP5A 4EY7A 2P8SA 13PKA 1YRLA 3WLFA 3T06B 4MIEA 2ATXA 4BO9A 3LUHA 3LL7A 5DULA 1ZA1A 4C0BA 1KJIA 1ZWKA 1P2VA 1TT5A 2FFBA 2PLRA 2X6QA 3DVAB 4JITA 1Z2OX 4XPIA 1SD1A 5C8YA 4RQUA 4DOMA 3HFRA 4DG5A 4D9KA 3ZWAA 4U63A 2XNHA 3H6GA 2H1FA 4N41A 1YZKA 3ZHZA 2G17A 2WMNB 3PXXA 3MWDA 2ZSFA 3L0YA 4MUYA 2PLFA 7YASA 3PGXA 4JLOA 4EELA 2DR0A 3EIOA 3BWCA 2J4CA 2NV2B 3JQ8B 4NFSA 3IMFA 4NBRA 3AK4A 5AI5A 3IH5A 2ZUFA 1H9BA 3ZX4A 3EIXA 4G8DA 3RVSA 3SHQA 1C3JA 2X2EA 2Q99A 3A6EA 2B0CA 1W34A 1D2HA 2EFEB 3GFQA 4GZMA 4LYYA 3QMVA 3TS1A 1UC8A 4A6EA 1SBTA 4I4IA 4G0XA 3TR6A 1X9HA 2O2XA 4CEJA 5DP2A 4UPVA 2HAEA 4C2TA 2G4LA 1P31A 3KZMA 3SJ7A 3E9RA 5EMMA 1E9DA 1JEQB 3DV0A 1GRQA 2H7XA 1B43A 3P0IA 2GXUA 4M7RA 5JQWA 4EARA 3G7SA 1VLHA 4TT8A 3GFTA 4HGPA 4XGKA 5DIZA 2AR9A 1Z35A 2Y1FA 3FYCA 1E9SA 1W47A 2CVHA 3WDLA 5ECDA 2IZ1A 1NMYA 1M34A 3HL0A 4DF3A 4OI2A 4YV2A 1QBGA 1IK4A 4JYCA 4L7QA 4TMWA 5JI2E 1UK6A 3AESB 1TQ6A 2MYPA 2YJTD 2JB9A 2AUTA 3PF9A 3TTYA 1U2QA 4XUDA 1GAWA 1NTRA 1UMBA 2W6ZA 4G63A 3BRCA 3LCUA 3WYDA 1GGEA 3HJBA 1E66A 2B82A 2PZFA 2W6QA 3CXUA 5CB4B 5JCOC 3AVWA 4HR7A 4JENA 1APBA 4WKGA 1DC7A 1VJGA 2QXYA 3OLXA 2XV1A 3ZX5A 1T5SA 3F67A 2EJUA 2FHSA 2WIFA 3NUGA 3PG5A 4KV7A 4Q39A 1Y7IA 4EYEA 4YACA 1GQOA 2RH9B 3OPYI 1JG1A 3PEFA 4DWWA 3GRPA 4FYXA 3WSWA 1LI5A 1FOEB 3HR4A 3MM4A 4F3RA 2Z4RA 1JXMA 3T7RA 1ZVVA 2P2DA 4UREA 1WETA 1MQ8B 2NZWA 3AB7A 1DBSA 3BORA 2ZETA 3OM9A 5FI1B 5KTKA 5GVSA 4PXAA 1OI4A 1TTPB 3NU1A 2WK1A 1XHEA 5K8LA 2C2GA 1SUEA 4PRYA 1SUSA 2P35A 1BMDA 4F1KA 2W6MA 3DQZA 5DIFA 3K94A 2WM8A 1CF9A 2H2FA 1BHJA 4HFMA 5B7PA 1WB9A 3MWLA 2BR4A 2OP0A 3SKXA 4EJ6A 1JYFA 5DNDA 2FDCA 4CEJB 4HDQB 4J4HA 4BVGA 1CUVA 1ADBA 1CUSA 3LYLA 4MP3A 2YJGA 4DA6A 2WJ4A 1EFPA 4TRMA 4B6JA 3TSWA 2QKYA 1OSNA 1Y8RA 2R7KA 4D9MA 2ZSKA 1B0UA 2H2IA 2VJKA 4KMMA 3ZWWA 3KTDA 3DYIA 5AW1A 5KYNA 4CMBA 5DHRA 3QMPA 3UK1A 3AONB 2RHLA 3T1OA 4ZO8A 1U5BB 3JVUA 3Q7TA 5FP0A 3ZW8A 2PUDA 2A7XA 2AOXA 4UHJA 3I92A 1P8JA 3WGOA 1Z6QA 1FF9A 5JBQA 1QZTA 4PY2A 4R1PA 3EA0A 5FBLB 2BSQA 1LLUA 1SY7A 3UW3A 3ZBQA 3U4IA 4FNOA 3F5QA 3KE9A 3B1XA 2WJWA 3E9ZA 4W63A 4DLVA 3HCNA 1BKYA 4X24A 2PR7A 3NBMA 3OOHA 3TQHA 1J22A 4TMFA 3TPZA 3SJUA 5DB4A 4EUEA 1ZXBA 2CVFA 1XTKA 3OCYA 3QOYA 3WRYC 5B4TA 3A4MA 2XMQA 4DUGD 2L82A 4RESA 3BSSA 1Z22A 2J85A 4LJLA 4R0NA 5TE9A 4KITB 4IIVA 1LSUA 3EQ7A 1UKYA 4FT2A 4U5QA 5G02A 4BNJA 5FUVA 1T15A 4AZ3A 3R9XB 2QP4A 3ST7A 1M3SA 3W90A 3AUTA 3RS0A 1JIJA 3H1BA 1E0KA 4X1OA 1G8AA 4XVCA 1TUBA 4A15A 3AHGA 3ZBUA 3F73A 3ONFA 4X1YA 4IG4A 2P78A 1AHHA 4PIPA 1P44A 1G55A 4ZVPA 3WRXA 1WHTA 2J0EA 2NO1A 2QRQA 2Z95A 5KKCA 4HSGA 4D3XA 3PB3A 2DWQA 3DXZA 3LGXA 4HTAA 4QSHA 1Q15A 3VO1A 4YRGA 3VXKA 1QQBA 5ES4B 3TXAA 3O7MA 2DHQA 2H2DA 3D5QA 4K2AA 5DYIA 1DJNA 2WU1A 4MPTA 4AX4A 4PGGA 1NJ5A 1R7RA 3HRKA 3B3AA 3G5AA 3LPAA 1V5FA 1Y4AE 4YH1A 5K3SA 5TV2A 1UT5A 3OM0A 4OQYA 4E70A 5HZGA 3MJCA 3F4KA 3KG2A 4PYKA 2AK2A 3DAPA 4CCAA 5JYCA 1WKBA 3VPCA 5KTRA 1I7DA 3WMWA 5FPQA 3VO8A 1P74A 4MQUA 5DXFA 2HCFA 1CR6A 4CI0B 3E03A 5HCNA 2QGZA 1GZ7A 2DR3A 2HJRA 2PH1A 3OAAD 1DAPA 4MZDA 3KEOA 3T6KA 4TLDA 2F8TA 1R12A 4QWWA 1RXYA 4F56A 1VE7A 3RYCA 1BN6A 4QTXA 1CEEA 4URWR 3TW4A 2E87A 3EXIA 1A82A 5SYAA 2NVUA 3R6WA 1OA0A 4W7IA 1PJ4A 1TMGE 1ZP6A 4RPLA 3IODA 1QH0A 1GOTA 4EZIA 3QY0A 2DLCX 4HVTA 1FBTA 2CL7X 1G98A 2PAFA 1ONPA 3CG4A 1PQPA 1QYXA 2IX3A 1QO7A 2J0VA 4G86A 2FU5C 5F9MA 3HVKA 3SNKA 4JDPA 3FE2A 4K6HA 1X8XA 4P92A 1XV5A 3N8GA 4Q1CA 2CLKB 4FYHA 3ZVRA 2ZB8A 2ZRIA 4RJKA 3B8EA 4FOSA 1E3IA 3VPFA 3JS5A 3SZMA 4ESEA 4M0FA 1FYXA 1Z0SA 3OZXA 4CEHB 3EXHB 3FCYA 4CLOB 1MBZA 3LS2A 4RMHA 2XWSA 4TLEA 2KMLA 2BDEA 2RI1A 2EQAA 3A70A 3KJZA 1QU2A 5BMVA 1X8JA 2PAAA 3MGCA 4AICA 3OIDA 1JNXX 1EP2B 2Q6TA 1O89A 1SCJA 4ISCA 1S8FA 1Z8NA 1OD6A 4RNCA 4X63A 3HK2A 5K0LA 1CJUC 1E79A 3I5MA 2AH5A 4R81A 2D2IA 4ZAWA 4E6EA 1TT7A 5KNBA 2QR5A 3N3AC 4YRPA 2VK2A 3B9RA 1W6RA 2J3LA 1DJOA 2PSJA 4R2LA 2VHUA 4LGMA 1OXKB 3I9V1 1U3WA 3P5SA 1W94A 4KIFA 1N36B 2YZGA 3ANXA 3K1TA 4OQFA 2F00A 1V48A 3F6RA 5JAOA 2WZQA 3OIFA 1QFYA 3JQ6A 2ZP1A 1KMMA 1A7UA 4QYIB 2ST1A 3NHYA 1WPGA 1A9TA 1TJNA 3T3PB 3SWWA 4JMPA 5FFFA 3MFYA 4EG5A 3AR4A 2JFGA 2X76A 3H2YA 3PPYA 5DM60 2ZUDA 3JVDA 3AIMA 4IIGA 1LSSA 3W05A 1VKJA 1NV8A 2O50A 3BF7A 3SYLA 1M2FA 3FD8A 3FKJA 3ICPA 4KYUA 3ZNQA 1ABFA 1JHVA 4BP1A 3MSCA 4UAJA 4RMGA 2PRZA 4FE3A 5F4BA 4XOIA 5DGCA 2PZMA 2H4FA 1TQ4A 3DZBA 1ACJA 3UUEA 2XYPA 1PKEA 4D3DA 2ZTVA 3H83A 4RDXA 4RE5A 1QH8A 2VUTA 1RS0A 1LF5A 4BJ6A 5KC8A 3M6FA 1EVYA 1S2NA 4DLBA 3X1ZA 1KVRA 1K8QA 2FLKA 3Q9UA 4ZJYA 3BHNA 3SU8A 5CDTA 4M53A 5IC4A 2C7PA 1FRVA 2OFWA 2QDKA 4CN9A 4H7EA 2WWXA 4LKOA 1TEVA 3RT9A 1PKXA 2YHUA 5FT9A 4DT1B 3RIYA 4PC3A 1GU7A 5LXTB 3OKPA 5DMHA 1C9NA 1NW8A 1L9KA 1Z88A 4G5FA 3U56A 2B7LA 2FW6A 3L77A 2B8WA 2QLNA 4O08A 1YOBA 4PXSA 3CNOA 4IGFA 4K6MA 2GM4A 3RV3A 1EVEA 4MYUA 2WT4A 1R0SA 3NOOA 3OQ6A 5SZIA 3ZQUA 4D80A 1TZJA 5H9WA 5LYJA 1DWOA 1AVTA 4QUEA 2J67A 3LFTA 3JYOA 1JA9A 4QARA 1J8QA 2QAJA 2HREA 1UBFA 2X2OA 4M8KA 4RVOA 2X0FA 4OXRA 4DDMA 4LN1A 2DOKA 2JGDA 4Q03A 4ZIRA 4GX2A 1OBHA 3SEAA 5KX5A 4NXNB 3KQVA 3EA5A 2UYQA 2QGNA 1N6OA 3GJ8A 1FLDA 3BPSA 4OAOA 1E2MA 1Q83A 3IT3A 1YS4A 4HBZA 4HQ6A 2VQSA 4ZT3A 3GA5A 3H5RA 3UWOA 4F84A 2XQFA 3BQ9A 1D4ZA 1U28C 2JGMA 3HJRA 4ILKA 3RLIA 2B1RA 1W5TA 3HSKA 4E2YA 2Q2OA 1ZUWA 3GJ4A 3GXBA 4XUEA 5JHGB 1G6OA 2WU4A 3EQ9A 4XB1A 3VU9B 1A7AA 2BTOA 1I6LA 1BE8A 3LBFA 3LK7A 1ECCA 1MA0A 2VWQA 3OQPA 4OGLA 3THWB 2RHRA 4OJYA 2MCFA 2H2WA 1A88A 2Q4TA 1FMCA 3UJ7A 3UUGA 2GYYA 4COOA 2A5JA 3ILHA 2IH5A 5JS8A 3NH9A 3ZOKA 5E2IA 2ZJ8A 4R05A 4RXMA 3SQDA 3OCVA 4KN5A 1RRVA 3RRYA 1H22A 2WKSA 3LPDA 1G8MA 2RAVA 3CSSA 2GM9A 3A4IA 4GQIA 4RWEA 3DXYA 4WRRA 4Z9YA 3RRNA 4BJ3A 3HLTA 2NPOA 1ZUNB 4GWGA 5FHQA 4BYMA 5T6MA 1AB5A 1Z4IA 2WHXA 3SVZA 1K3FA 5ICEA 3E7PA 2DFVA 1DRWA 5I7VA 3GCDA 5KQSA 2YY7A 1EFRA 4JEMA 4PO8A 3I64A 2UV8A 1EA5A 3WRYA 1NVKA 1AZTA 5B5SA 4P86A 2WHPB 4U9UA 5B6JA 2J5KA 2Q8NA 3ZEAA 4MPDA 5L3QA 4D81A 4UM5A 4DQ0A 3DAOA 2X5KO 1PGOA 2BEKA 2OV4A 2H5LA 4IICA 3D64A 3OPYB 3TIVA 3RIXA 4UMDA 5F7JA 4JLPA 4O4IA 2A0YA 4N49A 2HRBA 3L05A 3GJ6A 2OO3A 2IOHA 1Y5RA 2J6HA 3K8ZA 3UXHA 1BA2A 1UJ6A 3CZPA 4F4HA 1C7ZA 1NMQA 3PCXA 3KKPA 5DYYA 2DSTA 4D9CA 3CIOA 5FLXA 2B6NA 4J76A 1YA6A 4DCSA 3TECE 4JOCA 3U6KA 5E8JA 4BNUA 3DSRA 1XZEA 3OLYA 4W5QA 1BSVA 3ZZUA 1GSOA 2HMWA 2V55B 1KK3A 2JATA 4AS2A 3EULA 5JTTA 1IZZA 4GG1A 4WXHA 4MB6A 3I0ZA 4MUNA 4TWIA 4X20B 4Z1MA 1AC5A 1BHO1 4N6OA 1OAAA 3N28A 1XL1A 4NH4A 5JEDA 2WQ6A 2GI4A 4LCBA 2EW8A 1KKLA 2Y9PB 4MWCA 5EIFA 2ZE8A 3Q3EA 1SM4A 5H59A 4BO5A 2EVWX 5HXAA 3MGKA 4M49A 4FUQA 1GT6A 1L5WA 1SBYA 3QSGA 3MCUA 5FPKA 3VR4D 1JZTA 3FYTA 2VT2A 3JAWB 4GQAA 4X1KA 2QF7A 2QA5A 4BB9A 4R1UA 3DB2A 4POOA 1QLWA 9GPBA 4AK9A 1R0CA 1XRLA 1ZCJA 4LXQA 5D1NA 5EUQB 2F48A 3AY6A 1J2UA 1N2BA 3RUCA 1RC1A 1ISHA 2H18A 1W5SA 2GBLC 3HN2A 4IHKA 3I5YA 2NNWB 1ZIOA 2H4JA 4NEGA 4ICIA 2IWHA 5HIJA 4GBED 4NCHA 2HU7A 3RT7A 1RRKA 3BERA 4DLRA 1F20A 1ONBA 1E69A 1RM3A 3AHHA 3U4MA 3TOCA 4MRSA 1X19A 2KE5A 4NY1A 2P1RA 1Z39A 2FWPA 2YHSA 4H60A 4OEHA 3F7MA 5EWJB 5J4KA 4W5OA 1SIOA 3OX4A 1Q50A 5C8XA 2JW5A 3HKBA 3WSVA 2CLHB 3GHYA 3AIKA 3PQEA 1IE3A 2XMSA 4JMLA 1ZRNA 2IEYA 3QUAA 2HW8A 1HL3A 1TEZA 2HO5A 2H6EA 4DADA 3PHIA 2GR9A 4QIHA 2IKSA 3HRHA 4OATA 3EC7A 4GXTA 4AUEA 2ERYA 2IW1A 3EPPA 1L5MA 1STOA 4JXZA 4OFXA 1IHUA 4KQ6A 4UNNA 4B6QA 1NY5A 2HY7A 1IUNA 2P2YA 3MTAA 4NK4A 1Y1SA 4YRMA 4TYQA 3WQBA 3R7NA 4QZVA 4Q3BA 3L04A 1DDOA 2Q3LA 1E2GA 3THXA 3P4YA 4GWLA 2Q8PA 3KJFA 4LC0A 4M1YA 2XSZD 1L5VA 4Q4HA 4C2BA 3TRDA 3WBKA 3NHSA 1I01A 3TVDA 4CHGA 4P0PB 4E03A 1Z6GA 1UODA 5CVTA 4CM6A 2LIVA 1RWNA 5KREA 3W5VA 4B81A 1J39A 2IYUA 5IT9A 3MUOA 4WN9B 2W4QA 4B3XA 5AVVA 2A6PA 3VSEA 1T5BA 1DBVO 2BFDA 3LHKA 3WQQA 1TQ2A 4YJDA 4YCDA 4GI5A 3TI7A 3C7DB 4TTRA 4JV5B 1TYAE 4FWIB 4DMCA 1NQ5A 1AM4D 2BSXA 1G8PA 2JD0A 1FW8A 2JCGA 2WDPA 4L07A 3B8HA 2WYHA 3H5TA 2EG9A 3IBYA 4Q82A 3TVTA 5D6NA 4A5SA 2IHYA 3HBLA 1OFUX 1GUZA 1JSXA 1SNYA 2PV7A 1D6JA 2DUUA 4K81B 5KJ1A 3K9CA 1N5RA 3SY8A 3WLAA 2DECA 4LTMA 4G1CA 4NAVA 2RGNA 5IVHA 3NTVA 3QYFA 3U44A 4D46A 3WK7A 5JQGB 1FSSA 2OCXA 3F7OA 3M2TA 4HEA6 1E62A 1PJZA 3C6QA 4LJ6A 4OHOA 4TRRA 3ENKA 2NTJA 4XSHA 3Q72A 3MTJA 4S2EA 3WGVA 3EISA 1GGJA 1U6IA 2EC5A 3CRMA 3DKKA 3NR2A 4FZ3A 4KQXA 4MCHA 4DZZA 1S1CA 4ND8A 2QPAA 3E7WA 1XNHA 4JJIA 4FGKA 1L4EA 5K0CA 2YW9A 1ETUA 2EF0A 2QX7A 4HDMB 4Y98A 3C3JA 1HE3A 2YZMA 3R0VA 2M6LA 3RJTA 4D5EA 2ZIXB 3UAZA 2OSVA 5CFQA 1C3OB 1C30A 1L9XA 3LHSA 1YAJA 4JASB 1U3CA 5EJ9A 4N0QA 1A8SA 1WEKA 1DCKA 3IURA 4KXWA 2QD1A 5SZJA 1PWZA 2EWWA 2VHZA 3DE5X 4XD7A 4JI2B 4EJSC 1PUIA 1EWVA 3I4LA 1M2EA 4N7JA 2BV3A 2XNDD 4ZCSA 2EV9A 4YCLA 2HJ9A 3K5WA 2ACWA 4QUAA 1Z47A 3Q3HA 5TDHA 4YAFA 3I9NA 1NU8A 1V8BA 3IPXA 5EKXA 2FWNA 4XW2A 1VE3A 3ED5A 3KYDA 1UBNA 5HRCA 2E4XA 3WGUA 2PX3A 2I7DA 1E7QA 3P0JA 2AEMA 3HHEA 5TEWA 3FA2A 2ZAYA 4ABTA 1GXSB 2DPMA 4IZOA 1X7ZA 1R64A 4ZQCB 4ZEOA 4DIBA 4NDAA 5BN5A 5JNWA 2I3DA 4F45A 1LNQA 2UZIR 2TMDA 2ZRGA 3CZMA 3LY8A 5KNLA 1PX2A 4K3UA 2WIKA 2OGUA 3F4LA 4TYPA 3D9QX 4Z86A 3GLFA 2Q3FA 3VHXA 3ZDYB 5L7WA 4NOMA 5A7FA 3VVLA 1YSCA 1ORHA 4DV5B 4TUYF 1Z37A 4S1PA 2YH2A 3BDVA 1QS0B 4LJKA 3AEQB 2GZRA 4PS0A 1ZI9A 2B8JA 1AGXA 2FDRA 5AHKA 1N7GA 1XFDA 3FJYA 2QUAA 4MITA 1TCUA 5DLPA 2HHJA 4MRNA 4QPPA 4JN6B 5JZMA 3R8XA 2FGJA 1OZ0A 3BTVA 3JD2A 1BAPA 3DM5A 3OEHA 3QVGA 4D6XA 2WWYA 3EGOA 1QRTA 1KO8A 2I8LA 2WD7B 2WJGA 3IUMA 2HDWA 3QIVA 1EYZA 3B20A 1PJ3A 1T6ZA 1PYGA 3DXXA 1QWSA 3QVTA 5GZ1A 4QUHA 4CT4B 5BMOA 2EYUA 1RHJA 1R0BA 1X87A 2NVWA 1LSJA 3AX6A 3LT4A 3KOZA 3UCEA 3FFAA 1MH9A 3FGPA 3WK6A 1FSGA 3FG9A 4WFKA 1KKUA 1X8LA 4MPPA 3MLBA 5T41A 4LRQA 1JTFA 5FPSA 1USVA 1VBFA 3UB4A 4CETA 5EINA 2OPBA 3FIUA 1VIYA 1A2BA 3IV7A 4YR9A 3AVYA 2BHSA 3DTTA 1QJCA 3I01A 1AUXA 1KP9A 3WMEA 2CDCA 1OMOA 3QVXA 4YMWA 3SCZA 4RJLA 5BV7A 3JW8A 2F67A 3QUCA 4JVNA 4YUAA 3PWKA 3S8YA 5DK4A 3UJ6A 5F77A 2QMYA 4L2IB 1ODFA 1P0MA 3BXZA 5KVCA 3KALA 1VL1A 1THMA 2BKAA 2P6MA 1RT9A 2C5LA 3M0EA 1YOVB 1WP4A 2PXAA 2G88A 1DBRA 2XTAA 3FPCA 4EB6A 1P6UA 5B7NA 1KRWA 2OG2A 4XQ0A 4DWJA 1SZPA 2NO6A 3O4IA 1XA4A 5GGYA 4YAEA 1ORIA 5FB3A 3GLGB 3ND8A 2W0MA 3BRQA 3EQZA 1NSTA 2BEVA 4FCWA 4DNPA 4XIIA 1Y3CE 4HDNB 5BN5B 5AVZA 5ED4A 5LZ4A 4XWWA 4DEYA 1L7MA 4HUJA 1BROA 2F3PA 2N42A 3I6QA 2IBMA 1DAFA 3PYXA 4G5RA 2CXNA 3T3HA 2Z57A 3I9LA 1BCSB 2Z04A 3KQYA 3DTVD 4IIEA 4UD2A 1F0KA 2IPXA 1ZBQA 3GT3A 3AVXA 4NZZA 1OT5A 2P27A 3AF5A 4CIYA 2J5RA 3O1JC 1FFXA 2W4IA 1EM8B 2NV6A 4CTJA 1YE3A 2AFVA 3CW8X 1SOVA 1NYLA 2JBHA 2X8AA 2IELA 1RR6A 2IP1A 3C7TA 3L0CA 1PLJA 5AJVB 3I34X 3ZV4A 3RS8A 1F2UA 2WSIA 4CFSA 1QGYA 2XWPA 4UCFA 1M1YE 1ZVKA 2WC1A 5KQMA 1MC1A 2IPMA 3GDWA 3NTRA 4S1TA 2EKQA 1F8UA 2VJAA 1RMTA 2AOTA 3K9BA 1BOFA 4B4OA 2YFQA 3PFBA 3L8DA 1Q44A 2D4AA 3EDYA 5LQRA 3BXOA 1H2ZA 2VNSA 4QRDA 4UC0A 1Q0ZA 1A9OA 2BIFA 2R1TA 4MQEB 1PG0A 2F17A 2R66A 1T3LA 3DMGA 3UWKA 1OREA 2DXIA 4FMBB 3EVTA 1QYWA 2VJNA 4TRJA 1GY8A 1YI1A 2IDMA 1PG5A 1GN9A 1P9RA 3GFSA 5DNVA 3FPSA 5A05A 4EJ0A 1NP7A 2YXBA 1SVWA 5BVGA 1UBHS 1UXHA 2FMIA 2O5VA 4BO1A 4BX3A 3IDSA 4PPFA 3WWPA 2H4YA 2EFDB 5H3LA 3SIWA 2ECQA 3OF3A 2NQ2C 4JUIA 5LNK1 4WNCA 2D3TA 3E05A 1P3JA 2ZRNA 2C5AA 5FKJA 1WCV1 2E3JA 3O9MA 4UQLA 1KIAA 3EQ2A 3H9BA 1N6LA 1QGUB 2VBGA 1GKIA 4QRIA 5HJ2A 2CNNA 2PZLA 1KNQA 3EZ7A 3RVQA 4EGFA 3VPSA 4HB0A 1CHNA 3MCAA 3BTSA 3GP5A 3MG9A 3N0TA 4XM1A 5H3HA 3RK4A 3GD5A 5EMNA 4JAVC 4Z3DA 2QR3A 2PXCA 1E1CB 2BFDB 3KZVA 3CM0A 2ZDGA 1KDOA 5DTJA 2WEKA 3KEMA 1WUJS 3HU1A 3MCZA 3BWXA 4X1KB 4IDBA 1NULA 4QU0A 3A2LA 3MC1A 3H84A 1A72A 2H92A 3BGSA 3D6VA 3UAGA 3I58A 1RI1A 4RWZA 2V8OA 4N0EA 3TMKA 4JOSA 4IIJA 1XNRB 2NTYC 1AKNA 5C1OA 2BUCA 3FDIA 3ZGVA 3HJFA 1EVKA 1KE2A 4X20A 2QR2A 1COWA 1E92A 3HGMA 1UWCA 3EG9A 3DZFA 2QD4A 2YVAA 3CUTA 5CVJA 6REQA 1DEXA 3BSFA 4HL6A 3C74A 5A3SA 1I4TD 4CF5A 1F7VA 1DBWA 3KJEA 4C5CA 2ZIXA 3F9CA 3FUWA 1OX4B 3FX2A 2WAYA 2WKPA 1F4LA 2VHEA 3CVUA 4PCLA 3K2EA 1UXIA 4R8LA 3UK6A 1YL6A 1ZD3A 1V95A 1YI0A 1Y4DE 4I9NA 1G18A 1GDHA 1GZUA 1LPPA 1KQNA 1NKVA 3D4OA 5C5CA 4X8LA 3WGIA 5HIAA 4RF5A 3SBOA 1Z16A 3QZUA 1OFGA 1T3GA 4L73A 2O54A 1HTTA 3ONEA 1KRXA 1EA7A 4RPJA 1YNOA 1QS0A 4IS3A 5HUHA 1LKZA 3JASA 1ZI8A 2AN9A 4II2A 4V0KA 1AQUA 3HADA 1ULAA 4QLOA 5ELLA 3TLAA 5AVJA 1F8YA 1EBFA 2Z6QA 4G0OA 1X9IA 4HMPA 5BSFA 2Q7XA 3ESRA 3QJ5A 3NVKI 2VYNA 3LF2A 1S2MA 1B8PA 4K8RB 1ULTA 3CE6A 4QRHA 1RBMA 1QQ6A 4MWZA 1NUAA 2LDBA 2F9FA 1TVEA 2NZ2A 2VJLA 4MVJM 3RSZA 3C70A 5K4GA 2GEBA 1WZUA 2GARA 2TMGA 1RLJA 1T91A 1X77A 2IP2A 1C7IA 3W8RA 3HJUA 5KYXB 4M36A 3V5NA 2Y2VA 2CJFA 4GXNA 4EGAA 3BH0A 2W6PA 3UVEA 2J6BA 1G59A 2XT9A 3OI7A 3FUUA 2XVYA 1ZGBA 1CRLA 3OTGA 4J9UE 4TXLA 5FAXA 5IJXA 4C0WA 4E3WA 2ZUUA 3I6ZA 1N1MA 1Q22A 2Y0DA 3JQCA 4HX2A 2XVXA 2GJ9A 3JYLA 4AT1A 3W3ZB 3RS7A 3ABQB 2C58A 4CMEC 5LMNB 4DSOA 3THYA 2D0IA 1KMCA 1CJKC 4PVDA 1XI2A 2J3EA 4GLOA 5TPZA 4ZZ1A 3A3KA 4JUDX 2FSVA 2FN9A 3G8YA 2GA9A 1XG5A 3CEHA 3CRQA 4A8JC 3UOGA 2IY9A 3CZQA 2ZAGA 1DWUA 1RPJA 3GEGA 3QA3E 5L6MB 4ED9A 3EFOB 5T57A 3WL5A 1H6BA 1E1QD 1LJ8A 1XD9A 3FETA 3HKDB 3ZDEA 1XAGA 1VZ3A 2HQSA 3BDIA 4I46A 3TTVA 1E5QA 3AVVA 4JJGA 2FV8A 2HJGA 1N2HA 4IOKA 4NATA 3DL0A 4RF2A 2HL6A 1O2DA 1Z5UA 3R77A 3ME5A 3PUKA 4O63O 5D7BA 2X22A 3IHWA 1TYDE 1EH5A 3IIJA 3IPCA 3V8QA 3MUNA 3M6MD 3HA3A 2DETA 4YFYA 3GK3A 1P2TA 3H5LA 3R3ZA 1HURA 4GUAA 4NESA 4YB8A 1UC9A 2BVNA 1VHQA 2D1RA 4IP0A 3VPXA 4E5YA 2ZWVA 3PYMA 4UVIA 3PPVA 4FLEA 3TOSA 4CNBA 1SPBS 5IASA 4EA9A 1DKRA 3BBLA 3NGLA 3LT2A 4O2AA 1EWYA 4FVTA 4I1UA 3CLSC 4MLCA 4YAGA 3QKTA 2QAGC 2PSSA 4YX9A 1QIMA 4YT4A 2PLWA 3F3KA 4EHKA 4TSFD 1XQ6A 4K9OA 4ND1A 4QQFA 4K0RA 4B85A 3K4PA 4XQ9A 1HYQA 2W48A 1Q3KA 4MKRA 4X54A 5CDGA 4ARZB 1Y1TA 3L49A 4F12A 5JECA 4KACA 3EODA 2IDZA 4UPDA 2XYHA 3E35A 5J59A 1I5EA 3UFBA 1G9SA 4D0SA 3KQKA 1WB6A 5FA5A 3AF2A 2W22A 4KDFA 3DWIA 4HK4A 5JSFA 2JKYA 2I2DA 4Q1VA 4AMZA 1ZOPA 3NWOA 3SN6A 1YRYE 4HAUA 1W44A 4L8FA 1YVPA 4TQAA 5H5JA 2WMDA 4R54A 4CCYB 2PKRA 4YIHA 4Z6KA 1E2UA 1YBMA 4RVFA 1BG6A 3ESDA 2QN7A 4QTUB 4QYIA 4BX8A 4GMFA 1WZ2A 3R3WA 3E81A 3W0LB 3OQOA 2O2JA 2D74A 5LM3A 3DC2A 2B36A 3B89A 4DG8A 3R0XA 5GONB 3SVLA 4NABA 4YI3A 2FX2A 3CVYA 1QFMA 4MLPA 1E3TA 2PQ0A 1QCZA 2GF0A 3NNNA 3N2IA 2MSNA 3EXG2 5E7IA 1IY8A 1EK5A 1UMKA 1V1MB 1ZK1A 1Y5IA 3KHUA 1QAOA 3P9QA 4ALKA 4BRSA 4AF6A 5JISA 3TLMA 1JHRA 5JFGA 1EK2A 4HKTA 4HUTA 1J5XA 5J4YA 1QYDA 4FBMA 2VNJA 4KBGA 4YAKA 2N47A 4TXJA 2PWZA 3HJHA 1FX0A 2FR1A 4NJEB 1JLHA 2MSDB 1IN8A 2XBUA 4FUTA 3WO0A 2H4HA 4DA7A 4C78A 5EJ4A 3H1AA 3KUKA 1OXUA 1Y1QA 1YL5A 1C5KA 4MIKA 1BFKA 2A0FA 2V7GA 2RHGB 3ZE6A 4R6XA 4P33A 4FEAA 4O2BB 1L4KA 3AUSA 3R9KA 3VPHA 2ID7A 4GOND 4M60A 1FDOA 5IK2D 2W6IA 3ES9A 1F12A 2A0WA 3UMGA 3L0OA 5TPWB 1WQ4A 1SFRA 1XSEA 2VZEA 1SK8A 4NG5A 4X90A 4ZI5A 5ALXA 2BFMA 1DPFA 4HVAA 4RL6A 1FNSA 3GQBA 5CIQA 1M5UA 3GROA 5KDLA 4BMYA 1R8JA 3B78A 4RKEA 6CHYA 3W8DA 4CLRA 1WXQA 3OIWA 5CPBA 2B83A 4GDMA 5IARA 1W19A 4JVOA 1A69A 4R4JA 5LQJA 4U2DA 4AJ9A 3O90A 4DJDC 5HYVA 2VQ3A 1A27A 1DG3A 1PZFA 1YR3A 1NL3A 1J5PA 1CJVC 3OG9A 5C1PA 1L6IA 4FNAA 3AEUB 4ZYVA 5LBIA 4I08A 4DLAA 4Z7OB 1AQIA 3AY0A 3EVGA 1KQFA 3OZAA 5L3RA 2IPAB 1D09A 3DLBA 3MBOA 3QQ5A 1Z5OA 5A2QA 5DN6D 3TOXA 3HZZA 3K0BA 3USCS 1QGAA 2IYRA 1G5TA 1ZVQA 1FFSA 1Z0DA 1Q0PA 4HH3C 5CA0B 5HOQA 2OD7A 4WNAA 4KG7A 1P3DA 2EWVA 4F6CA 3F97A 1VTKA 1Y1PA 1E4VA 5KHOC 3RU9A 1UC5B 1U9IC 4RZUA 3VKFA 2OHXA 1QWOA 1UBRS 3HH8A 1G0OA 4P22A 3H86A 2LWIA 2CV1A 2OYRA 4I6GA 4OX9B 3QHPA 4NMMA 1Z68A 3DS8A 4MVJH 2B78A 2G80A 2HLHA 3I04A 4P3XA 5CCDA 3UHOA 3E58A 2B9VA 3VR1A 1WY5A 4PAGA 1F2UB 2REXB 5AKHA 1L8LA 3KJIA 3V6LA 4HMOA 2OCGA 3OTIA 4H4EA 2ZBFA 4X71A 3TRIA 4L4YA 2A7QA 4OB8A 1GILA 3UOWA 5BXYA 2O06A 2ACEA 4D6PA 3AM5A 2ESRA 2V7XA 4PN7A 1UKAA 2NUPA 2P75A 4HNAA 1S6YA 3KSRA 3P7MA 2HQBA 3BJRA 1BCSA 4B17A 1C7EA 2IE8A 3PGMA 1DJMA 4A36A 1NVAA 1TIKA 2C2HA 3LP5A 4PLTA 1Q7GA 2HK7A 3K1AB 1OX6A 3ED1A 4WN3A 2IC5A 4YRBA 1YR9A 3O8RA 1ZU5A 1PUJA 4RHTA 3A1SA 1WWKA 4F8YA 3F5FA 4LNHA 1MVOA 3L40A 2L0XA 3RLFA 1HRKA 1RDFA 4R98A 4ZMSA 2XBMA 1FFEA 1ZGGA 2AE1A 2NM0A 2VHYA 3BD7A 2H5IA 3C8MA 1QH1B 1C8LA 1U7TA 2VPTA 3CTPA 3EXHC 3HCEA 3HQ4O 3A6DA 1QOZA 1B3RA 4TWAA 2Q8QA 4F1WA 3EXFA 5TQ2B 2CL0X 1NVDA 2OZLA 2QTMA 3OU6A 4N8SA 4U7HA 4XJXA 3VSCA 1MVNA 1ZHFA 3H17A 3N0VA 5J43A 1YFKA 3L1IA 2VDMB 4FD3A 3DDWA 3HDYA 3VBEA 3ZY2A 2NU6A 4JK3A 1BW9A 4JR0A 1PEYA 3B2QA 4B2IA 4F11A 1RZVA 1MT3A 1X39A 1GEEA 3V2IA 4O59O 2FPPA 5DGTA 5JAQA 4FFSA 4CG3A 1JLRA 3BXFA 3DC7A 5DBOA 3FSGA 3OT4A 4MEJA 4CMAA 3G9QA 1AZSC 3NJRA 1CW2B 1Y8AA 3BRWD 3M8KA 3QBJA 3NS7A 4AULA 1SUPA 3H11B 3U5ZB 1EDEA 2PMDA 1OUMA 3KQPA 3C7KA 4UULA 7MHTA 1P8AA 1OWPA 4AMUA 2F62A 2BONA 1A9SA 1DUSA 1MG0A 2GEKA 2XZDA 2XYQA 2GGSA 3MW8A 1NNLA 5CX1B 4E0BA 1I14A 1TAGA 2H9AA 3H7AA 4F9GA 2AFIB 1I2ZA 2CNKA 2RFLA 2VT6A 1DIBA 1JMYA 1P1KA 2X8BA 2OXFA 3D2AA 3D43A 3WYFA 2Q9UA 2PZAA 3OMWA 4KWIA 4HCJA 3UC5A 1LBEA 1QOQB 3V9AA 1JI0A 2ZQYA 5BUCA 2FI1A 5KNDA 2F43A 2NUTB 3KLNA 4JSRA 4X8MA 1VXOA 2X0NA 4WECA 3L4BA 1OZAA 2QX4A 4G0UA 2FPXA 5M7EA 4G97A 5FUBA 2JAHA 2UVDA 3G23A 3LT1A 3U3MA 2JZNA 2UYGA 1NU6A 4FGWA 4S0XA 3QLUC 1MU0A 4G36A 5AW5A 3GVPA 7MDHA 2IBSA 2VK4A 3GUHA 1IOWA 1N8KA 4F46A 1YA8A 1Z2DA 3IP8A 2EGGA 2NX2A 2ECPA 4G67A 3M9LA 4KQFA 4C0AC 4LF4B 2C2XA 1PJTA 2VFAA 5J4HA 1QHHA 1T4BA 4EBBA 4ZT4A 2PKXA 2D2EA 3DAYA 3RC3A 4DFDA 1Q1ZA 6ADHA 4MR8B 1Z0ZA 2QT9A 4B2YA 1GXSA 1PJ2A 3FMPB 4MJLA 3HFGA 4PR0A 1A50B 4K28A 4DRXB 1V35A 3JQDA 3KYIB 4HUQA 5L6LB 4GPTA 4BDTA 621PA 5ALPA 4HLNA 4Q4DA 2CLOB 2JIDA 4KQWA 3NT4A 2MSKA 3UCFA 4F72A 1LQUA 4BNVA 1U3VA 3L9XA 3SS7X 1QMGA 2UZ1B 3LG2A 3ZWQA 5LP6C 2QT1A 1ZGHA 1T8UA 1LRKA 2FZVA 1YK1A 1J33A 2LPMA 3V9PA 3FPJA 421PA 2CFOA 1IZ8A 1FPMA 1IONA 1ZN2A 1UWKA 1XJCA 1RIIA 2ZFUA 3PI7A 4JI5B 3RKUA 5CXQA 2B4YA 2FEMA 4XOUA 2CL6X 3COSA 1YVUA 1XYGA 2ZRHA 3R5FA 4PWYA 1YS7A 1CUIA 4HQNA 3OOWA 4PZPA 2HUNA 3HPQA 1LY1A 1T5DX 1IRIA 4DMRA 4B09A 3V7YA 5KTOA 2CD9A 2K5UA 2HLNA 1G4HA 2GTPA 2R5WA 1DAOA 4EFNA 3IJ5A 2LVBA 4YHBA 2A9KA 3RTGA 1XU7A 3O5AA 2ZDQA 2UAGA 4M8IA 3KHSA 1W25A 2VRCD 1D1SA 4CKZA 1WXFA 2QSYA 4YTEA 4HI0E 5B3JC 1RXEA 4XX0A 4D5GA 4XPIB 1YJQA 1PLLA 3QU2A 4BX9A 3ICQB 2HJSA 1AN0A 1OROA 1PTJC 2YXPX 5GIOE 3RVMA 1G6KA 1GRRA 1V9LA 2ISQA 2W90A 3DUFB 3MWEA 1Y63A 5EIHA 4CIAA 3U16A 5AJWA 3C45A 2WM3A 3R5HA 1P29A 3PHHA 4KE7A 4OU4A 4BQPA 1LFAA 1YJ8A 3HLYA 2I2CA 4OYLA 3TGPA 3RRFA 3H2ZA 3VKWA 1M6HA 1K6EA 4CKCB 3OT5A 4B6GA 3EXIB 3MS7A 4QJBA 4YY3B 4IV8A 4P83A 2BISA 4H1VA 5CDFE 4AJJA 4ZRMA 2EXXA 2QRLA 2ABWA 1ZD2P 4LSGA 4F5EA 5IANA 3WIVA 2W0SA 4Y2GA 3ZCSA 1HNZB 3V8MA 2PIAA 1IN1A 4KR3A 3EIHA 1QVWA 1TQHA 2J9ZB 2FN8A 4W1RA 4B9AA 2VHQA 4PRZA 4EMBA 3PRJA 2D0OB 3GGJA 1CUXA 5LU9A 2OUKA 4BNGA 3OFSA 1JLLA 2BFBB 2DT8A 4IR7A 4XWOA 1Y8CA 5LBTA 1ZH0A 4L0MA 2WA1A 4X92A 1V3UA 2PUHA 4M54A 3QBEA 1HKHA 3RUFA 1RABA 1THTA 3GCZA 3IP9A 4MRPA 2C0QA 2JG3A 2XWBF 1FS6A 2FEAA 2QUZA 1QLHA 2QWXA 1FBNA 1QHFA 3BUSA 3LU1A 4KBFA 1RHKA 2JH8A 3T94A 2EW2A 5JFOA 1CQWA 3WB9A 1PV1A 1E7SA 1DIOB 5K0NA 1IZ0A 2JCXA 2IZ6A 2YYYA 3D8SA 3H6KA 4HLDA 2BMFA 2HKIA 4MKFA 4WOBA 4WZAB 3MYYA 4B44A 3AF4A 3DCJA 3EF1A 3FPBA 3P94A 1MOQA 3U1BA 3CZAA 1KEUA 2O3TA 4Q37A 2OC9A 4ALIA 1DXHA 3I9OA 3NBXX 4F4DA 5DM1A 1T3ZA 1ZM4A 4KAFA 4S1WA 2H9IA 3LLMA 4F2GA 4NQRA 1O5TA 4FBGA 1JPJA 4EHFA 4KTTE 3NEYA 5DASA 2BI7A 2QXTA 3B82A 4H0NA 1EEXB 3GDHA 4TYNA 2CFSA 4IVPA 5EWMA 1CHDA 4H4DA 2FUKA 2IYOA 5COAA 5EWMB 2LKDA 3G7NA 1EUCB 5F33A 3WRVA 2VDWA 5EAIA 3SF8A 5JW6A 3SFVA 3IMCA 4QYWA 4HGZA 3A3OA 1FCJA 3A0RB 4A1OA 1RYZA 4ND2A 1AU9A 1GA1A 3P9ZA 2OBNA 2FMXA 4L7VA 4JP2A 2F1KA 1TFUA 4ZVSA 1F6BA 2BOVA 3WHLA 1SXQA 4UCQA 5C5EA 2V6JA 3K53A 1UZLA 1K4MA 1ZQ9A 3HYCA 3K0HA 3ZI4A 4EJSB 4NMWA 2PEZA 5D01A 4D9GA 2FN3A 4L74A 2B1JA 4YRCA 1V0JA 1N25A 4PC1A 2VZ0A 4WZAA 1JAZA 4R31A 4FFNA 3P52A 1SCIA 1T4CB 2XMGA 3ZJTA 5DT2A 3QI2A 4KAAA 3RUIA 2Q3CA 4M88A 3ILYA 2WF5A 2II6A 4WSOA 2ZSEA 3RARA 1L4NA 3S1AB 3L1UA 4BJHB 2DPGA 4PBSA 1EB9A 4NQZA 4J7XA 1KEEB 1KQPA 4IYRA 3T1VA 2ID9A 4UTVA 2OBYA 1ZMBA 3BCRA 2Z98A 1VL6A 2IF2A 2Q3HA 3U7EB 5KBYA 4M83A 1E1QA 2UZ1A 3C8UA 3HL4A 3B52X 4L3OA 5BSKA 5AW8A 5FWNA 1EU1A 1F06A 1C4KA 3TH5A 1M1ZA 3AG5A 3ZHOA 2CYCA 4IO1A 2FP4B 3HRIA 2BGLA 5C8DA 3A6KA 3ER9A 1G8SA 1W29A 3DE3X 3K5HA 4NP6A 4O2LA 1D04A 4ECEA 1T8TA 3RT1A 1QE3A 3DWEX 4TWJA 1FDRA 2GX6A 2GPNA 5LYJF 4YBZA 4BV9A 2I54A 1Y37A 4FOTA 5J63A 1W581 2A78A 2ATEA 4ENQA 4N5IX 1M75A 1W87A 2DTDA 2PJRA 1XZJA 2QL9A 4YXWA 1ID8A 3P9SA 3AP1A 3QKIA 3AILA 5DSTA 4S1NA 1Z25A 2O5CA 2OKGA 4FFBA 1MZVA 1KEPA 1IULA 5TQVA 3MAAC 4QXPA 2XXBA 2RSLA 3KKEA 5IRCD 4YYEA 4F5WA 3RYIB 3JSXA 4KAXA 1B6TA 3SBEA 1DZ3A 2B99A 4QYMA 3AXTA 4PLHA 1Y42X 5KVQA 5TGDA 3VU9A 5HCIA 1Q0LA 2I7TA 3GLHE 4DCJA 4RTMA 2LCQA 4XXHA 4FCVA 3WIDA 4PINA 4TN5A 3I8OA 1P9OA 4W99A 3T3EA 3W2TA 2P5TB 4EX6A 3R2JA 4X3OA 5J23A 1T3SA 1F8FA 2YWCA 3VISA 3KCQA 1SC3A 4ZVUA 3ZVMA 1V25A 2GHIA 2HPAA 2PU5A 1TF5A 1DLJA 1W93A 3LPCA 1UK7A 3K9QO 1QX4A 2OZPA 2QEQA 4MKGA 2JJYA 2ZULA 2P6PA 4OHMA 1GKYA 4RZQA 3A11A 2QZ4A 1SCUA 2SCUA 5B2ZA 3RV4A 2VSFA 5G0UA 3X1KA 3F8WA 3H11A 5HMMA 1NI4A 4LWPA 5F2KA 2AW3A 2JIRA 3M1YA 3GF4A 3GFVA 5CA0A 5FH9A 1DBPA 4IV5A 3VRHA 1ZRMA 3T5TA 1Z6YA 4DIEA 3P2IA 3BXXA 2ZZMA 1BX1A 1RHMA 3ON5A 4P34A 1E1RA 4U0JA 1R0KA 4WXYB 1TK3A 4BLOA 4R16A 1J8DA 4C7OA 1KYQA 1V39A 1Y3DE 3A31A 3FKQA 3RIEA 1H2RS 3BDAA 1D0VA 1S4QA 1H65A 2GCPA 3G9XA 1RAEA 4PFQA 1FC0A 5ESDA 1C0KA 4NMHA 4BMDA 5T64A 1FUKA 3HDTA 5KDOA 2J0SA 1H4QA 1UIMA 1CP2A 1PT9A 3KZOA 1XTTA 4E2XA 3DZKA 1N0IA 2CDNA 3BIXA 3K16A 3Q3CA 1AKUA 1AD2A 2HRRA 4CLRB 1A4UA 1ISSA 2YV3A 1SR8A 4I4CA 2H31A 4NFLA 1DKNA 1X86B 2IX9A 4KXFB 3AMVA 3T34A 1GIAA 3KVNA 1RZUA 4IPTA 3I5UA 1X0VA 4MUXA 4CUKA 1O9HA 2NWQA 3TD6A 3PFGA 1CT9A 3OQBA 1ESMA 3Q8WA 1G0NA 4HWGA 3OUZA 2OT3B 1JTEA 1M5TA 3AJ9A 3CLUC 3BA1A 3ELYA 4GOOD 4KE6A 4NIMA 3ETDA 4RK0A 4BE9A 1COWD 1QH8B 4JYZA 2G9VA 5KSYA 5D5PA 3CLRC 4YT8A 2OC4A 5A6VA 2NUPB 1ST2A 4YT5A 2AN3A 4TV8F 5DI9A 1X1DA 4N39A 3ZXYA 3FOCA 2F3QA 2WHYA 1LPNA 3AJRA 5LDGA 3RHTA 1JWLA 3TE7A 5B55A 3D4PA 1Z5VA 1L4UA 4RW0A 3MCVA 2EZ9A 3HACA 5F7ZA 4BV2A 4B6SA 1QYIA 2XAAA 1PQYA 2YHIA 4MUJA 1T8PA 4CE6A 4CU2A 2H8GA 4EA6A 2FLVA 2BFOA 3IOYA 1W8DA 1EB8A 4YJ2F 1HF3A 1J42A 2WU0A 3CGWA 5IW8A 2QLTA 2VP5A 4D0RA 1CWUA 1T25A 1TVKB 2A35A 4HQLA 3QFCA 2R5FA 1RAAA 2AMJA 4EMTA 1SA0B 1DTEA 2OCYC 2Y66A 1WDWB 1XLVA 1N7HA 4WKNA 1HFWA 4I1VA 4D43A 4EG7A 1JZSA 5HR5A 3ETGA 5TIIA 3KQHA 2HZBA 2GCOA 2O2GA 3CMMA 4IOMA 4AKTA 1QTNA 3IDAA 2GJ4A 1R1DA 2KI5A 3EVEA 2VZ8A 3QKSA 5F21A 3LWZA 2WUDA 1XXHB 4TQUS 1RHQA 1UPCA 2YYZA 1TO1E 1IJKA 2QTVB 3DBRA 1NR7A 2PGJA 3LW8A 5CK4A 3PLAE 1GGFA 5H9VA 3JWEA 4E2FA 4IIXA 1RRMA 2DPHA 5L3ZA 4HLUC 1ECLA 5FADA 4IJWA 5LZ2A 1RPTA 1V47A 2WIDA 3DFIA 3CYFA 3L0ZA 3ZU2A 2KQUA 3QUBA 1X7YA 2E4YA 1YBHA 2NSDA 2QG6A 4YBRA 3UOAB 4HWOA 1VPLA 5EIAA 4YAJA 3V3TA 1WZNA 3IXLA 3PIRA 2G8NA 4CL8A 2P69A 1N4AA 2ZRDA 1F60A 1WMEA 2R8OA 4B48A 1J99A 5K51A 1ID1A 4TS3A 3QEOA 2N0SA 3TR5A 1IB0A 5C32A 5LQNA 1TKRA 1WDTA 4P7FA 5C1DA 4UHHA 1X7DA 3L4SO 2OXTA 3X2EA 5ALEA 4HFRA 2PVCA 2RIRA 2BCJQ 1JEYB 1KDPA 4BNDB 1SXIA 5GV8A 4CQJA 3QTBA 4DJJA 2JI9A 4YRDA 3A6HA 2PS3A 5JASA 2FE4A 4PLPA 1DPGA 5JVDA 3OEYA 4OHVA 2J9RA 3COYA 2E5LB 3QFRA 4NONA 1UBGA 2CMGA 1SHUX 3JATA 5D1HA 3UJHA 1UDWA 5BOVA 1NNEA 3IR5A 2Y1LA 3T5DA 3VOTA 3PDIA 4GM4A 3OHMA 2Z5FA 2NG1A 2I4NA 4DY6A 1U31A 2GD1O 3LXXA 3PHJA 1FUEA 4P5PA 4BLUA 1JIIA 2GKSA 1H93A 221PA 4D9JA 3RWMB 4HYQA 3AVUA 8GPBA 3PNQA 4G01B 3JTEA 5IM4A 3ZCTA 2AYYA 2OQRA 1A2QA 1GUYA 4REQA 1AQYA 3FZQA 1I7SB 2W98A 3A27A 2P3LA 2BEWA 3TTXA 4M7PA 1UKVY 1UDRA 4Q3CA 1R0WA 2XA1A 4JSYA 5ALGA 3TI9A 4XWKA 3QK7A 4GOMD 3KJHA 2WZBA 3S1AA 3B3FA 3EYWA 3GJRA 3BAFA 1O96B 2FR0A 1M8JA 3OQIA 4QEKA 4D4HA 4LF7B 4BU0A 1JMKC 1HNNA 2D54A 4C5AA 5HP4A 4O4HB 1NNUA 4D0NA 2DRIA 1PE0A 3P0FA 3WWDA 2RE8A 2WF7A 3IS3A 3DLPX 3LH5A 4O5OA 1Q77A 1L5YA 3AFIA 3E8MA 4J8PA 4PYMA 5FWDA 1KZ7B 3OO0A 4KMSA 4AUNA 3CR7A 5CLGA 3ROEA 4L51A 4N5MA 2ZJ5A 4BMVA 4DANA 5CD1A 1IIBA 3B5JA 1M6YA 3LL4A 1IXYA 3Q85A 5IJ0A 1X1SA 2AZ4A 2FJUA 2QJRA 3AR7A 4KI0A 2V0GA 5A0FA 4L9AA 2XWJI 2JFQA 1K5DA 4O4LB 5G4LA 1KORA 4JFAA 1OWMA 1B6RA 4AY6A 2C88A 3GLIE 4PCVA 5BPFA 3GAZA 3JWJA 4AN1A 4M22A 5IF9A 4ZVOA 2G40A 1EUYA 1JG4A 1K92A 2FOIA 4BDSA 4WMLA 2WJVA 1XWIA 3KFVA 4BBPA 1E9FA 1PZXA 2DH5A 1YIDA 3INGA 4MPRA 4TXNA 5EXTA 1O95D 1FFBA 5JWRA 4MAAA 3S44A 2DJIA 1NONA 3ZWOA 1Y33E 1YI8A 3EZLA 3EXG1 3KSBC 3CSUA 4GW3A 2GEUA 2PUGA 1EWTA 2OCBA 4X45A 3HWWA 5TQ0A 5A0TA 4XJTA 4ML3A 4JT9A 1ATIA 1QZ3A 3A1WA 1GPJA 1PJBA 2P3QA 2YWDA 3KXDA 3STWA 3JYPA 4HWKA 4HNVA 3A1VA 8ATCA 4PV7A 3QI7A 4AY4A 4GZLA 2VI5A 4LVOA 4O8ZA 2FTKE 4JGGA 4RV4A 2OGTA 4RNDB 4F4FA 1ZBDA 4Z7JA 1RM4A 5EXPA 4KQ1A 5CLJA 1Y9ZA 4KQMA 3CZ4A 2DH6A 3IHTA 4KWCA 5CB4F 2IS6A 1XIVA 3NHMA 4YCJA 2IIQA 1E0AA 1SQ6A 1DCFA 1Z07A 2FP3A 2WFZA 4XUGB 1BQ3A 1RHRA 3VTFA 4JLAA 4AM8A 3COJA 3GPBA 1SBHA 5A71A 4ANFA 2HPZA 1Z5GA 1J49A 2XIJA 4QYXA 2BDTA 4ZEXA 3UWPA 1XTBA 3A05A 5KTPA 2OHJA 4FYJA 2AFRA 3K0KA 2H0QA 1U6KA 2EERA 2QTCA 4W5WA 2Z3ZA 3OJLA 3RHFA 3QVJA 4AZTA 2BKUA 4BN4A 4ABYA 5A6SA 3VMFA 2I2BA 2YNMA 1ULHA 1GFSA 3NOQA 4LHSA 1IDN1 1N2CE 3Q6NA 4YJ3B 2F59A 3H8SA 5JPIA 3X43A 4KQJA 4B87A 4HH4A 1VC2A 5B64A 1Y82A 2GXSA 3ONNA 3LZCA 1R18A 5E9AA 2HLPA 4IJUA 3OD5A 3U7FB 3QKUA 3LI2A 4C07A 2C8JA 2COKA 2CHGA 4WLFA 1EDDA 1U8YA 2BI8A 1QF6A 3S4YA 4JC8A 1P4JA 2PE5A 1TUEA 1EX1A 1XQVA 4ESOA 4MYSA 4CKYA 4J91A 3LBHA 3JQRA 1Z5NA 2OFPA 1E1RD 1GLVA 3KVOA 5HKAA 1YBVA 3ONDA 4GZ3A 3QW4B 1KP2A 2P9QA 3GGCA 3HYTA 4G56A 1MC4A 4XR4A 5E1MA 1JR3A 1C7RA 2ZJOA 3CX4A 2HHAA 3RIGA 3VZCA 2K2WA 3QNUA 4BVHA 2JK1A 5CBPB 1UP7A 3R3SA 2CT8A 4KX5A 1ZJ5A 1LQ2A 4QVKA 4Y1FA 4DCNA 8OHMA 5L3SB 5HCUA 4IRXA 2BGRA 3BSYA 4GRAA 5JS2A 2O8DA 2CMDA 1OVMA 5A62A 1GU0A 1NA5A 5JLJA 3UBTA 2RHDA 3RJMA 3TN7A 3DL7A 3THYB 1C50A 1VMDA 2WHEA 4HEQA 4AKEA 3OHPA 2FPKA 1JAIA 1QGZA 3FM9A 3OFJA 2IXAA 4CV2A 4X7MA 4C06A 5I4IA 1R00A 2EZUA 3C3MA 3EZYA 4OREX 1UT8A 3JQ8A 3F96A 2JFWA 1YQWA 4HXYA 4I1SA 4S2UA 3D1LA 4YMIA 4NCJA 2ZBGA 5P8WA 3S5JA 5H4GA 1BZYA 1OWLA 6Q21A 1DKLA 4BBZA 4FW8A 1D5WA 1HZZC 2ONKA 2VP4A 4PZ0A 2O8CB 4IOJA 5C0OE 3G68A 2F1OA 3LRTA 2BEVB 1O87A 4Y6LA 4LRWA 2G1AA 1IEXA 1ZZEA 4YRSA 1BD4A 3JQFA 3L1VA 1BN7A 1F2TB 4CKCA 4EB0A 4J6FA 1EVIA 1T6XA 4GRIA 5KCMA 4D9BA 2LXNA 4BN0A 5EZYA 1Q21A 1L5GB 1EK0A 4X00A 3UT5B 4JLUA 4NOLA 3GLRA 4EY3A 1GPUA 2GAAA 4UEJA 1TMOA 2PIDA 2ZJ0A 2MINB 3DOCA 5IXJA 2C2ZA 1PL8A 3UYLA 1VM6A 2AJDA 1CQIA 3EGXB 2B61A 3FYHA 4C3ZA 5AVTA 1PSDA 2LBPA 1S1MA 1OF1A 3O8QB 2Q4DA 2YUTA 4Y9RA 3PUVA 4P58A 3O4RA 5EUBA 2L18A 3K0CA 3P9IA 1NRJB 1QQ5A 4RD4A 2SNIE 3T1QA 1N2CB 3WIBA 1V6SA 2R8RA 2J87A 4IDPA 2IGTA 5K3BA 1QX3A 3T9FA 4KP7A 4Z4GA 4US1R 2HRQA 5ILGA 2BR3A 1AHPA 3O75A 4J2OA 4E11A 1JXAA 4TZ0A 3VR6A 1DB3A 3W8FA 4WDQA 1KNXA 1ZVJA 5IAKA 2NXNA 3L7AA 3UMSA 3NV9A 3WZLA 4EVIA 2FN7A 1KR2A 1FP4A 1XZLA 3NXSA 1FNCA 4Z4HA 5EZYF 3VPBA 4C4XA 5AI4A 1Z74A 2Y67A 2P2SA 4AVYA 3WS7A 4XGIA 5FTWA 2QAIA 3V4FA 5IJWA 2PU7A 1OT3A 2ZLBA 3CH7A 3KSZO 3NBQA 4TXMA 1DX9A 1KEVA 1U28A 2BFAA 2EX1A 5KI6A 4CTNA 5A4DA 4DCGA 3KQQA 4QQ8A 3KQLA 3K0FB 3ML1A 4C6TA 2G9UA 3GRZA 4XIFA 1BRTA 5I3CA 3TW6A 4U8HA 3CT6A 1W96A 4QNRA 4TKUA 5FOUA 1X14A 3C6XA 4IKOA 3RR2A 3WDSA 4EMUA 5HRUA 2IS1A 3KQUA 4M8LA 1K7CA 4J49A 1H6AA 1GGVA 2IXTA 2X5NA 5DP1A 3D7LA 3O47A 2PX5A 5IZ4A 4RZIA 2WQ7A 4LSZA 3G6KA 1ZQ1A 1E2EA 1I13A 1TA4A 5EUMA 3SR4A 1KMHB 4OYRA 3ADOA 3DMRA 3MTDA 3KZCA 3IV6A 4GXRA 3ZZ0A 3F5SA 3ZHBA 3NDJA 4PCUA 2EQ5A 1EUDA 5AMXA 4NMLA 2XCQA 4GHWA 2HU8A 4DDKA 1Q95A 4FEEA 1VSTA 3WTBA 2I4LA 2IYSA 3K0SA 3L8CA 3TZKA 2CEKA 2VDQB 2ZGVA 5HK8A 3K5PA 2NZUG 4ZICA 3REQA 2YQZA 4WA8A 2IYWA 2OVBA 1EHCA 1IN5A 2IP4A 1JKXA 1Y6JA 3O3OB 5I48A 2VZLA 3I2FA 1KMIY 2BD0A 4FONA 4JB3A 2N9UA 2UYYA 3PHBE 4FYYA 1GNTA 4YMSA 3WLLA 5ISMA 4DLXA 1XQWA 3COVA 4FGUA 3WGQA 4J0HA 1S2OA 1B8NA 1J25A 4K87A 1HSOA 2JEOA 3OZTA 2SHKA 3QELB 4YFVA 2GETA 4QEZA 2ZT6A 1JJVA 1UWLA 3LFUA 2WPDD 3AETB 1JGTA 1IHYA 1T2CA 1WPQA 2ZWOA 1NI3A 3VR3D 4D74A 3I5XA 1OFVA 4I9FA 2C7GA 1M10A 5FFMA 2QV7A 3U7RA 1UBTS 3A0UA 3AKEA 9LDTA 3D2LA 4NNPA 1GDTA 1MV5A 2RI6A 2XDQB 4JLDA 4X85A 1FE8A 4JI3B 2F8LA 1CE8B 2JFBA 2XVMA 3CUKA 4XFDA 4X64B 3PJRA 4D3FA 4CG0A 1UT6A 4D4JA 1N2CA 2AQKA 4IXDA 4QPNA 2GJSA 2ZB4A 4D4KA 4LIPD 1B16A 1D5CA 1XRNA 4ZCPA 2DC1A 4JIGA 4UFOA 5E7QA 4MQMA 2CEAA 3W5UA 2I9KA 4ME6A 4XYEA 2O8BB 4GI3A 1FFCA 1NRIA 1NXWA 4YA6A 1MO4A 5THQA 1FPQA 2OTCA 1GYQA 1DG9A 2YN0A 1WSWA 2WSSD 1L3CA 3PEYA 3OFND 3LFHA 3O82A 4DVJA 4MHSA 3IJPA 2DVMA 2IVZA 3KUXA 4QOHA 3C3YA 3W6ZA 3SMVA 3D4IA 1ELOA 2BC9A 4FMPA 4BMZA 4DM7A 4LYEA 4UHFA 3ROQA 3CJTA 3BAZA 4ARSA 1NXXA 2GN4A 4DQVA 4CMCA 1K88A 4MKZA 1F38A 1TVCA 3MYRA 5C9ZA 5BWCA 3MB5A 3W2GA 2QW0X 1NOJA 3M1IA 5FV4A 1ISPA 4ZI7B 4N3AA 4F71A 5F98A 1VSVA 2WJJA 5LLDA 1QR2A 2PTGA 1XZBA 3RBZA 2WB2A 1TGYA 4YLEA 1J2RA 2R9VA 5B7GA 2NU7B 3L0BA 1P4HA 5AW4A 5CM9C 2ADOA 3GW8A 2DFTA 2P3SA 4Q3EA 2BCGY 5DK6A 1JT2A 1EXNA 1Z4OA 1IQUA 4BECA 2EU8A 2BGKA 2H06A 1NP3A 2I3ZA 1M76A 5A02A 2DEUA 1XTVA 1N3LA 3MZ0A 1L4HA 3ZBPA 4IH4A 1KDRA 1GNRA 1ZL0A 4M8SA 4Z2AA 4OAPA 3QPVA 2HV9A 3L9WA 3PV0A 5IZCC 3T0IA 3FPAA 5AUQA 5BWMA 3JZAA 2PUCA 2YMLA 5K1ZA 5LKAA 2ZUWA 1SGWA 4UFPA 4J4BA 5EL0A 2FA9A 1TAHA 1ZM9A 3RYFA 4CIVA 1LH0A 2WPNA 3I73A 1KK0A 5JDIC 1N34B 1R9JA 1QPGA 4YWJA 2ZATA 2HMYB 3LTNC 2RJNA 1VCOA 2V4MA 3HO1A 2NSLA 4LC9A 2PO5A 1T9BA 3MUEA 4YQEA 5BV0A 1XDGA 4FI3C 1C7QA 1G64A 1XTRA 4LJYA 4M4SA 5BSMA 2IYAA 3UV7A 4A8HA 4Q4AA 2VBCA 5YASA 4C4OA 2ZAIA 2XTNA 1Y8QA 3I62A 4RTPA 4YN3A 4RIEA 2CBXA 1VMKA 1Z4NA 2DT5A 5IEBA 4KGZA 1WMBA 2JF0A 3FCCA 3NAGA 4I4NA 3BHJA 2ZRKA 2FCRA 3C39A 3HM2A 3FTNA 1Z2AA 2HDNB 3AEKA 4EYOA 2YW2A 1LEHA 1E1KA 1GPNA 3H0CA 2Q1UA 4OGFA 4HNQA 5E6UB 1B1AA 1HE8B 4AZ3B 1XQ9A 1MKYA 2AYXA 2XOKD 2EZTA 3FF4A 4KQ9A 5F5NA 1A9XA 3PHLA 4EYSA 4IGAA 1K5HA 1QG0A 2WMOB 5CURA 4NX2A 2BWJA 3EZXA 3GL9A 3GQBB 5EZ5A 1VA4A 4F5DA 5KJCA 4D6YA 3NCTA 2P1DA 1NXTA 4DAEA 2O3SA 1YU6A 3JSAA 1LBQA 2X6RA 4XGNA 2AXNA 5E4TA 5A6SB 3ZWBA 4CF3A 3GLSA 4KDEA 1LWOA 3BREA 1DQYA 2QPOA 5ECYA 4KPFC 5BXQC 4RS4A 1T5LA 3HO6A 3ANNA 2C95A 4LQCA 3D8NA 1NQXA 3QBDA 4W1SA 3MJVA 5DHUA 1GYRA 2Z9DA 3L6EA 1V5WA 2YTZA 1RU3A 1P3Y1 1SKYE 3A32A 1LGYA 4I6EA 2NTEA 1NXSA 3KYBA 2FQQA 3N53A 4QQNA 1C4XA 1VHLA 2H51A 3IBCA 4F2HA 1QFXA 2EIXA 1C9YA 3GAAA 3ZWPA 4FHCA 3QOWA 4K9RA 2HSZA 1ORWA 3EXEA 3WKAA 4PQYA 4UBOA 5IG2A 5D86A 3H5IA 3DOUA 5E3HA 4AL4A 4C1NA 3PNYA 3JR7A 1RYEA 4TT3D 3G5MA 4URFA 3D81A 3HCCA 2P6UA 2C4KA 4JCOA 4ND3A 4JP5A 5B58T 1KZGB 1T5HX 1TFRA 5K0GA 4PZAA 1TTQB 3JYQA 2V7BA 3PT5A 4NVRA 1ZN9A 3N7UA 3KKKA 3VC3A 1YE8A 2IHZA 3HKDA 4HN2A 4ILEA 3PNBA 2QOEA 1Q0RA 1YIAA 3G8BA 4G81A 1NWHA 4DQDA 1NFRA 1U1GA 4HQRA 4ID9A 4UTOA 1BMFD 1YUMA 3ZHRA 2ZT7A 1BXRA 2ZJYA 3GRAA 4ZJPA 1N5IA 2JBAB 1VE5A 2BR5A 3ZIUA 3SEZA 4HRXA 3RSFA 1CR4A 1GGMA 1UZNA 1TQ8A 1N9ZA 2PCJA 2X7JA 3FZYA 3PNKA 2ZJ1A 4DIOA 4E5VA 2F1HA 3TJZA 1CYEA 2PR2A 2QTGA 1W2WB 5M5BA 3RO7A 2AS0A 2RK3A 1Y7LA 4WW0A 4GLBA 2WKQA 2K6GA 3ABSB 1P9WA 1E3QA 3M89A 3H2JA 3MJHA 3ZV3A 2W5UA 1ZMXA 2HRDA 3RG2A 3HUDA 3WIUA 2ERCA 2PBLA 5BQ5A 3ZGLA 1IYZA 2ANBA 1YZHA 1FX1A 1CJSA 1LCIA 3B9PA 3O26A 1KYZA 2R6GA 3HU5A 4EHLA 4PYJA 1E2QA 3A9WA 2FZWA 3JZMA 1ESNA 2VBFA 3HTXA 1KA9H 2NACA 3GC6A 2A0XA 4KO2S 1FL9A 1GTMA 3RVJA 4HZGA 4K26A 4NR0A 3JAMA 4PYQA 2WW8A 1HDGO 2BMAA 2D7JA 3W79A 4DCVA 2HA5A 4KVZA 1WDKA 4BRWA 1RD4A 4Q4LA 4KOAA 1SC4A 4G41A 1L7NA 1H3NA 1LLCA 2NO5A 1AXEA 1G3QA 2XRMA 5AXAA 5I6DA 4RGYA 3W5CA 4IW3B 2FZGA 2WF6A 4BY9E 2P9HA 3R6LA 1JYEA 2ERXA 3BD9A 2H5JA 3PUJA 4OQ4A 3VNBA 2XCOA 1KHHA 3PFWO 4MYCA 1XEXA 1AKMA 3ANYB 1QQAA 1E2FA 5E95A 1LK7A 1VKOA 2A14A 2COUA 1ZOOA 2DP4E 3EWAA 1DBQA 3QWHA 2O8EB 2Y6VA 4Q4AB 2ORWA 4FB4A 5IJ9B 3BKWA 1SIBE 3CUUA 2JLAA 1EFVB 1XZPA 4ENWA 1TYEB 1E2KA 5IKEA 4BRUA 3I9FA 1FQOA 1P73A 4Q3DA 3K0AB 1SZDA 2HWKA 2JFXA 2QD2A 3J81A 3PX7A 5G2OA 4AF7A 2MSLA 1NYRA 4MVXA 2F3RA 3NWBA 3LJKA 2MT9A 4J1TA 1U2PA 1L7QA 4HN9A 4IRUB 4WFIA 3ZWDA 2HLDA 2F1RA 3FOAA 4ZOLA 4E1BA 1C0EA 3JATB 1G8KA 1J9ZA 4OVKA 3KYCA 3GIDA 4CZ2A 5KIAA 4DNOA 1LBTA 2F3TA 2WM9B 2Y77A 3CF2A 3HV2A 3K35A 3M34A 3BG5A 1O1YA 4QDXA 4UTZA 2A30A 4UNIA 2CNWA 4Y0AA 4ZC1A 2GFHA 5KYKA 1CF4A 1JHYA 1VG1A 1Y3FE 2P9BA 3UMFA 4AB1A 2Q45A 3RVLA 5AK0A 1UEXC 1PDVA 3GT0A 3HG7A 1GDDA 2VC2B 4H6VA 1NWCA 5FTMA 2Q5FA 4YHHB 1XTQA 4RYDA 2RIPA 3SLKA 3QXHA 3LXUX 2CVOA 3MS4A 3OLVA 1XCJA 3NBZC 5FQNA 5JALA 5GIPE 3HCOA 3HXKA 2FEXA 4O33A 2X3UA 4PLFA 1V8PA 3KV1A 4FM9A 3D6NB 4D97A 2PKEA 1E2NA 3LX4A 4G3XA 3N6VA 4C3VA 1MHTA 3W2IA 4BP9A 1FSZA 4QPDA 3CX7A 2C9ZA 2E49A 2Q6OA 1JU3A 2AB0A 3C15C 3N0RA 5EFOA 2XKKA 4NBLA 4FWTA 3MELA 2E4VA 1EGAA 5AW6A 1TZMA 3DQPA 4OHXA 3SLRA 4B3BA 2DPLA 3I3SR 3MK31 2WWFA 3CNBA 3NPAA 2BHNA 2M6RA 2W11A 4FKMA 1XDZA 3Q7IA 4PHCA 5ALMA 1G42A 3AXSA 5FEMA 4YUZA 4BXOB 3WKDA 2C03A 3QEJA 4JLMA 3TIGA 1CZNA 3OZDA 1BDBA 3QU5A 4CM8B 1NLYA 4KCGA 5JD6A 4ZVQA 2HWUA 3KBBA 1IOZA 1ZM3A 1XZ8A 4KLCA 3NLLA 4PM4A 3LWDA 2XUAA 4QE3A 5AM3A 3A10A 3EOBI 2H54A 3F9IA 2Q49A 1QMPA 2CE2X 2ODWA 2VAWA 3EF0A 3ISVA 4FOLA 1MAVA 4RABA 5TJHA 3AIOA 3W3AH 1CE8A 1UR5A 4YMHA 4UHBA 1QFSA 1W4CA 1ZXXA 1HG0A 3Q7QA 2E18A 2QK4A 2XDQA 3PT9A 2RI0A 1L5KA 4EI7A 5IAEA 4H7FA 5JNSA 5KZMB 4PSAA 1DEAA 3FIJA 4QFBA 4E15A 2JD1A 1TF2A 3PGJA 1OR8A 1XF9A 4OB7A 1YZGA 3GMTA 3ZK9A 2GAOA 3FOEC 1YB4A 3PUHA 3QRWA 5AJZA 3UHFA 3EGWA 1TOAA 1V7ZA 1TKAA 3C3AA 2PG3A 3ICVA 1A2OA 3LMKA 4KJZA 4KUHA 1ECPA 3IMEA 3AJDA 4O4LF 3RFXA 4WBNB 5HK9A 3ZIDA 1VCMA 2WYVA 3ROXA 1HDRA 1KO5A 3JCZA 3KSDO 1X1TA 3SK0A 1ZONA 3JD0A 3B3JA 3EVAA 2VDLB 1GKKA 4DCPA 5IUJC 3TNYA 5LCXA 4JBWA 3U7QB 4BLQA 1FU4A 3WJAA 1OI7A 4BWVA 5FUMA 1R9GA 1FS4A 1XRJA 3EUFA 3OZEA 4Q00A 5IBQA 1DX6A 2JI8A 4MOWA 4YRIA 2QUHA 1A9XB 5DGIA 5B3AA 5B3JA 4AFNA 2XCLA 2ZI5A 3R4VA 5DCUA 2ZBEA 1UJMA 3CPJB 4KR0A 3TNJA 1N2SA 3ACDA 3OT1A 4M0EA 3ITEA 4Q5IA 1JQBA 4R3WA 2AN1A 2YQ5A 4PNZA 3KL4A 5CNMA 3T7EA 4C2AA 4DZRA 2I6UA 1WVIA 4XFJA 3QUTA 1Z8HA 2BAGA 5JWHA 1C1DB 4U2KA 1YQDA 3SIRA 4RCVA 2C4UA 1Y48E 1USKA 2Y0PA 3DEJA 4NZ9A 5FO0A 2UYCA 2J08A 1VI6A 4YQYA 1HT3A 3VR3A 1E98A 1MV8A 4J75A 1XT6A 1ML3A 1RCTE 3KOMA 4MQEA 3QLVC 2I78A 1C3LA 1JKJB 6LDHA 5GJVC 1MRNA 1MJGM 3G9ZA 4QG7A 5BURA 1F0NA 1GQSA 1NI4B 1X13A 3GP3A 3PKZA 4D26A 2PLAA 5FA8A 1JJIA 3IQWA 5EJEA 1JEDA 4QO7A 2PMEA 4YMLA 1QF9A 3V4LA 2RB5A 3GGOA 1XZKA 1Z34A 3N2NA 5KC9A 3TEFA 3SEFA 3R7WB 1YASA 3EJWA 3IEIA 1YKGA 4OGGA 2QHXA 1YS9A 3VUFA 1MIOA 1JXOA 3R7AA 3EAFA 2R8YA 2DBYA 3L6RA 4HATA 4DJEC 4HNUA 8ABPA 2D5AA 3VKVA 3FCSB 1O4VA 5FNVA 4Y2QA 1CB7A 2E4WA 1H9CA 2XGGA 3SYNA 4KREA 1X7GA 1MB3A 2LZ0A 2ZU0C 3GZNA 2QAGB 4NBNA 3W34A 4EZBA 2QTZA 1T9HA 2AN4A 4C6SA 4M7OA 4XH9B 5T4BA 3RUAA 5KVSA 3VDQA 3S28A 1UPAA 3IPAA 2YXEA 2YY5A 2C9OA 2CD7A 3MPUA 3OIYA 2H7CA 4ZD6A 2DBZA 4GGOA 1PTKA 1QAQA 2WUVA 3M6AA 1XCLA 3PFCA 2RAFA 1L5HA 3ZZMA 1LJUA 1NP6A 2G6BA 2SKEA 1JHAA 4PFKA 4TSFA 3UTDA 1XRSB 1YQGA 1XEWY 4I1RA 4AY3A 2JCYA 3LHIA 4DWVA 2JFUA 1FRZA 2EZ4A 4URYR 2NZVG 4HY3A 2CN1A 4J1QA 3F98A 4YPFA 1N1EA 1ZA2A 1OA1A 4G5QA 2Q5CA 1GSAA 1XCBA 9ABPA 5G3YA 1IEWA 1WXIA 4BWFB 1M6NA 1L7VC 3DZ8A 2TSYB 1J1ZA 2EKZA 3OCUA 1FRNA 2DTXA 3OIVA 1Q7EA 1ND6A 3T9DA 2B1GA 1W1UA 2B4AA 3CR8A 5H02A 4FR2A 5T3UA 4CM9D 5K3OA 3IB6A 2CSUA 1H2EA 2QQEA 5DZSA 5AKJA 1JHUA 1WE2A 2IU3A 3KWMA 5I01A 1MW8X 3MA0A 4BTEA 2AKAB 4EY5A 1XZIA 4JH0A 1SOAA 5FDFA 4MA5A 1Z0AA 2H1SA 4GO1A 3U5TA 2C94A 2QBYA 4QJ3A 1SCUB 1EFPB 4N0DA 2I7CA 2O0MA 2Q4RA 2ZYAA 2O14A 5CLFA 3P4UA 1U65A 5JBIA 2KWIA 2NT4A 2A67A 2Y9MB 3AL3A 1U0SY 3OLCX 4GE0A 4HX5A 4NJMB 5DF1A 5SY4A 5LDHA 3G88A 3VDNB 5HKOA 5LQUA 1PHPA 2BTQB 1IM8A 4FFPA 1L4MA 3PNOA 3WTCA 3KU4A 1LVHA 2H08A 3N39C 3QELA 3T54A 2JH9A 3A9RA 5JPDA 1KF0A 3I39X 4A0HA 4EFLA 2WD7A 3RSLA 1P1IA 4CODB 1DAKA 4E07A 2ZCVA 5A0VA 1HT2E 5AP9A 1YB1A 2K4MA 5SYNA 3BBPA 6YASA 2PVPA 3I0NA 4WKPA 3CONA 5DT9A 1Q7CA 2XGJA 2H16A 3L82B 3P2YA 4MV5A 3REQB 5JJCA 2ZI6A 3CZRA 3RB8A 3BWMA 4DB4A 3B6MA 3JD3A 1RFGE 3LF1A 1EFAA 1L8OA 2IHJA 3BL6A 4R01A 1HLPA 1OIXA 2DY1A 3PWTA 5HQ3A 5IVIA 4LDZA 1DAGA 1M8KA 3B3GA 4MH0R 5IVKA 2VJBA 1JIVA 1ZPDA 3OD1A 3ORFA 1KYXA 1LTQA 4UM7A 4CDGA 4B76A 4CT5A 2IXDA 2FPGA 2NPFA 2DFKB 4RQTA 4BFVA 4DSUA 3FBTA 4CKEA 2A9JA 1P7ZA 2V3CC 1VIMA 1LRJA 3H8JA 2OMKA 4N01A 4BKQA 2ZB3A 3DEIA 3EASA 2C1EA 2XUGA 3GMIA 3I53A 3DD1A 2JLBA 1O5IA 3HVHA 3O9VA 3N05A 2G6TA 4M9XA 4MQ6A 2WWHA 5A3QA 2VP2A 2P68A 5E6RB 2I8CA 4BFXA 2P7IA 4Q05A 4HDSA 1VBNA 3C1UA 2I87A 2SBTA 1NXQA 2FXVA 1UJNA 2X41A 1FUIA 4DUYB 1TJ5A 1IVYA 3LQ4A 5JD5A 4JKYA 4B3DA 4CLHA 1PEKE 4MWDA 1LPBB 4DSZA 3OO1A 4U02A 4L4ZA 3T5AA 3OE5A 5EOVA 4B73A 1JEQA 1C14A 2R1UA 4EPVA 3VU8A 1Q6YA 4QDKA 2GK7A 4MRMA 1LC3A 3H4IA 3ZD9A 4RLHA 2YWGA 2VSQA 4B6FA 3RYHB 1EK6A 5KMGA 4ZVVA 1SB8A 2X0RA 3NWEA 3R09A 1COZA 5LMCA 4MPJA 5CBPA 2A0KA 1KC1A 1T6NA 1UPTA 2C78A 3O94A 4WLUA 4HDMA 2CUTA 3WYGA 3A58B 3ZDFA 3ZLTA 4BNNA 3K15A 1EBBA 4HNSA 3EXAA 3M6XA 3VGPA 2W4MA 2R0QC 3NHKA 2ZQ5A 3JQFC 1QO9A 3NANA 1LDNA 1X1QA 2AJCA 2CXTA 2F7SA 3I9V6 5D84A 4EB6B 2Q07A 4G0YA 2ZYTX 4ZDIA 2G09A 2R79A 1T26A 1ZK3A 3IYLW 1E6CA 2LGJA 3QKRB 5AKZA 3CB2A 5M3BA 3E7FA 4BNYA 1AJEA 1VJ0A 4Q7EA 4NECA 2ZE5A 5I7OA 1OH8A 2E7ZA 1WRBA 1GNPA 3QE3A 2TMYA 5CMLA 4DLZA 5INTA 4LY3A 5AVUA 5I7RA 2JEYA 1MDFA 1X15A 4YJ3A 2OD2A 4RV5A 4YO7A 4Z9XA 4D9NA 4S3MA 3C16C 3FWPA 4DBLC 3HA7A 1CJCA 1L7PA 3AERB 3NO4A 4RQBA 5ALNA 1NT4A 3W2HA 5HJ7A 1JSCA 3ZE7A 2F1IA 2IT1A 2DB3A 3BMOB 4KHPB 5AFSA 1YXMA 3OMXA 5CHYA 4AKGA 2FZCA 1YQXA 1WB4A 1XJ0A 1YO6A 2UZ0A 1F6WA 2HA0A 4DC0A 1QGED 1ENZA 3K9GA 1MXHA 1TW2A 3WDMA 3X2SA 1G8YA 3ZG6A 3E1SA 3O4GA 1TM4E 1Q16A 3B2EA 3JRXA 1U9IA 1Y81A 1BGWA 3E9QA 3I2HA 3MIZA 3BIOA 3OIUA 4RY8A 3VGJA 3ZXSA 4WJLA 5LQDA 2W2VA 3TIIA 3W6OA 1OYWA 1TYBE 5DCWA 4MW2A 3KQOA 1ZU4A 2HA7A 3IELA 5LZ5A 3UV6A 1MD9A 3CISA 3W7BA 2JLZA 1VJRA 1RXIA 4CQMB 4J0GA 4AUMA 3U4GA 2BP7A 2XRZA 1YE5A 2F64A 3WYAA 1Y1LA 1L4LA 5K6TA 1CUHA 3ADDA 4H35A 3OZRA 5JO9A 4E14A 1UQRA 3TIXB 1QYVA 1JLLB 2BFBA 4WZ6A 5LPNA 1THZA 1V1RA 2CJPA 4XJVA 2VEDA 3HI4A 5GMOA 2GRAA 5KAPA 3VV3A 3CH4B 5A9RA 1WZEA 3DZIA 4JI8B 1XKQA 2M6KA 5LZ8A 5HFJA 2Z9BA 2ZVQX 3P19A 5IAGA 3ZWYA 2AW5A 5JXIA 2C77A 1IOVA 1EFTA 5B3KA 2R7AA 1DFHA 3RI3A 1ZD4A 2EG5A 1XVVA 3IKMB 2Z5GA 2CDAA 3Q9LA 4LXTA 4R2JA 4XQCA 3L07A 4TSKA 5AKXA 4OMDA 1U8AA 2BDUA 2QE7D 4FGJA 4JA2A 5LU8A 2EFCB 1VRVA 1NAHA 3JQQA 4OXYA 3HVJA 4JQYA 4BVLA 4D42A 1I9GA 5CUQA 4Q1DA 4HXGA 5FUQA 1ARZA 2O4UX 4CKBB 2IV7A 5G40A 1RC0A 1PL6A 4NDZA 1ADJA 2DBVO 1NW9B 1OBCA 2GT1A 3GUYA 4J94A 5ERYA 5CB4A 5I7UA 5LQKA 2XD9A 3EB9A 3SM3A 2RJ3A 5ECGC 1EEHA 2IUYA 4IIUA 3C7AA 2Y6UA 2EL7A 3KBOA 1KE1A 1F3LA 4Q4JA 3TSZA 1M9NA 4D41A 4RK6A 4DYDA 2NYRA 2MR6A 5J1TB 3AESA 1QQTA 4MP8A 2ZSAA 5CLLA 2CK3D 4WTOA 3ZDRA 3CRVA 3VJLA 4ZHQB 2FX5A 5JS7A 1KAQA 2KSQA 3E0QA 4I9UA 4KLRA 1G4UR 3CLUD 1EGHA 4C4PA 1JKMA 4JELA 4D02A 2I34A 3B9BA 3DZDA 1J7JA 1RKQA 1KJQA 3B1FA 3NC0C 3GPLA 3C3XA 4UVHA 1T0UA 1EDOA 1U3TA 4RVSA 4INZA 3FTCA 2P90A 4O29A 3WWOA 3BMQA 2F9MA 3EARA 4PZDA 3AUKA 1SUAA 3NDBB 1NQTA 4MMYB 1FB5A 5IH3A 2UZ4A 5ALZA 2D5LA 4S12A 3T4XA 5BR1A 2QVCA 2XJ9A 3Q7SA 2QTVA 4LHYA 4US2R 4FSHA 2C9YA 1U8EA 3KXKA 1DT5A 5DTIA 4P0QB 2A1UA 2FX3A 5EI5A 2VSYA 4GDFA 2EEPA 3PEEA 5JR3A 3RAPR 2W2TA 3I61A 5CA1A 1E2DA 3G2KA 2H7YA 4OL0A 4GKAA 4QXOA 4Y6RA 4EENA 4YQZA 1V71A 2P4HX 3PZRA 1NN3A 1A4XA 4WKCA 5ALOA 4ZTZB 4LV6A 3OE7A 3VI3B 1FYVA 2W2LA 1AS2A 4MV9A 4RC9A 1VYVA 3TUZC 3HN7A 1FP1D 1VLVA 4OM8A 2IOFK 4O2BF 3R20A 1KFBB 1PU2A 1HZJA 3CY6A 4KIUA 2YDYA 4GLLA 3OHSX 5JNLA 5MN6A 3HNPA 4PFSA 1J24A 1I2CA 5EJMA 2OE2A 2IV2X 4NNOA 1YKFA 5ALVA 1NKTA 4O1MA 5EP1A 2V5UA 5DSZA 3PDUA 1WUTA 5JCZA 3R9WA 1LSOA 1NIPA 2CHEA 2FQYA 3QUQA 1JEYA 3ZJUA 2FW8A 4RENA 3ROMA 3B3QA 2L69A 3HS3A 1AT1A 5JG7A 2JAWA 3SKYA 1L5HB 4IDFA 2PANA 4YDQA 1E6UA 3QFHA 2IWRA 3TNFA 2V97A 3BK1A 3JQ7B 5E0OA 1YRBA 1NHWA 1RXSA 4DR7B 3TCXB 1XEWX 4Q3OA 4C04A 2G5GX 3KVRA 3F3MA 1JDBB 2R6AA 1JDTA 3NV7A 4MV6A 3U37A 3NFYA