2INGX

X-ray structure of the brca1 brct mutant m1775k
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
211
structure length
208
Chain Sequence
b'RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNKPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Breast cancer type 1 susceptibility protein
publication title Pathogenicity of the BRCA1 missense variant M1775K is determined by the disruption of the BRCT phosphopeptide-binding pocket: a multi-modal approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 52
structure length 208
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2ingX02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2ingX01
3I0NA 2XNHA 1T2VA 3COJA 1KZYC 2HTFA 2K6GA 2NTEA 2M2IA 3JVEA 1T29A 4IGKA 3PXEA 1CDZA 3T7KA 3PXDA 3QVGA 3T7IA 2INGX 4U4AA 2COKA 2LE0A 3AL2A 2WT8A 2DUNA 2XNKA 4ID3A 3II6X 1T2UA 3L41A 2EBWA 2JW5A 3UEOA 4Y18A 1L7BA 1JNXX 3EF1A 1IN1A 2EP8A 3AL3A 3HUFA 4XPZA 2COEA 3HUEA 3PXAA 4BU0A 3K05A 3K0KA 3K15A 4N40A 3L40A 1WF6A 4Y2GA 3U3ZA 2L42A 3PXCX 3QVGB 2ETXA 4OFBA 3KTFA 3SHTA 1Y98A 4BMCA 3T1NA 3FA2A 3SQDA 4JLUA 3K16A 4IFIA 3I0MA 2D8MA 3L46A 3PC8A 4XQ0A 3PD7A 3SHVA 1T15A 2ADOA 4BMDA 2AZMA 3EF0A 1N5OX 2R1ZA 2VXBA 2K7FA 3PXBA 3PC8C 2E2WA 1L0BA 2EBUA 3PA6A 3UENA 3PC6A 5ECGC 3PC7A 4BU1A 1OQAA 2VXCA 1Z56C 1IMOA 2COUA 3T7JA 3SZMA 3K0HA 1GZHB 3OLCX
chains in the Genus database with same CATH superfamily
2O8DA 2J3IA 2R8YA 5EYPA 2J48A 1EM8B 1P1HA 2GSDA 1VIVA 1JIKA 2HTEA 2I2FA 4N82A 3UKJA 2FVXA 3NKVA 1WM1A 1XZ8A 3OZGA 5F5XA 3R76A 3WGOA 1NBEA 4ENWA 3MN1A 4LFBB 1EJ0A 1BMDA 1MG0A 3NASA 3NNSA 3OT4A 4YP6A 1Z6PA 1OLOA 5D7BA 3VX3A 1JHPA 1TYBE 4EGQA 4XM2A 1CEXA 1QOPB 3QPWA 3T7KA 5HKOA 3BWBA 3FOEC 3MK31 1N2ZA 4A0FA 2IZ1A 4JOBA 1OMOA 4BC0A 3Q2OA 5AJVB 1S3SA 3MUEA 3SEFA 3RT9A 3KXDA 3N05A 4M0KA 1HFEL 2QX6A 4MP8A 2BISA 3IX7A 4EX6A 4LF9B 1C0KA 2GUWA 2Z57A 5LZ4A 1Z2AA 4RD0A 4G5FA 1Y3BE 5KSOA 2VFAA 1IZ0A 4ENSA 1PL0A 3GMIA 4D3FA 2FETA 5EMKA 3PK0A 4NFLA 4Y1EA 1CVRA 1QP4A 3AXSA 2HCBA 4Q03A 4AF6A 4C7OB 1WRBA 1SXJB 2IDZA 3CCFA 1UXGA 3AR3A 2J5KA 4BN0A 3V4PB 2J4CA 1UAGA 3DHVA 4K9PA 4FD2A 4BBZA 4PYKA 2PRYA 3GXOA 3MS2A 3INGA 1KEWA 2J5QA 3DLTA 3VI4B 2M6RA 4YCSA 3TQRA 2Y67A 4G0MA 3KQMA 3R77A 4FOOA 4Z8XA 2FN8A 1QTNA 4PSKA 2QN2A 2J5XA 1J2YA 1Z88A 1RI3A 1W46A 3AERA 4YO7A 5D86A 4EMUA 4URVR 9ATCA 1R5JA 4DIKA 4BO0A 3JRWA 3QVUA 1KAOA 1BD3A 3PXCX 3QUQA 2A67A 3O4VA 4ZK2A 1PG5A 5ICSA 4BY9E 1I5OA 4ZRNA 3MAJA 4KFRA 3ZWNA 4ESOA 5LZ5A 1FRQA 1Z36A 2Q6VA 3E0QA 5JI2E 3TXAA 4DLLA 3S99A 4HDMB 3WO1A 5LJIA 2R8ZA 8AT1A 1M66A 2LTAA 4HDSA 3OTHA 4IMIB 1H6AA 3BMNB 3NBZC 3ZI0A 1C9KA 3VNUA 4JJFA 4KPGA 1TVCA 2QNRA 1BCRB 2OOSA 4A8JB 2DMRA 1UR5A 2OFXA 2AF3C 4FKMA 1QSGA 2IIBA 4WD3A 1L6IA 1YMUA 1D4FA 1RI4A 3H0CA 3NATA 4JB2A 4I9FA 3T6KA 4AZTA 3DAPA 1L5FA 1WDWB 4HQFA 3RRZA 3ZCUA 1TK2A 2I9PA 4H31A 1NR5A 1U3VA 4ARUA 3RQSA 2NSJA 1PD0A 3K8YA 3U6BA 2WFLB 3M49A 4PBRA 4Q1EA 4TXNA 4JUCA 3O4JA 4ZTBA 5CEEA 3GVHA 3UVEA 3SIWA 1IDN1 2OCYC 3R3XA 4PC3A 2DSTA 4EYOA 3AYXB 2FWJA 4U9HS 4UCFA 4YGYA 1W30A 2VDPB 4PRLA 5J4LA 4HYQA 2AG8A 1Q83A 4JBXA 2EIXA 3VOTA 4RF4A 4YXWD 1M6VB 1E1NA 2R79A 2YCBA 5I3CA 4DDTA 2BHNA 3UJ3X 4KLZA 4KV7A 2HSZA 2B34A 4HAOA 5TB5A 3FPAA 4B3MB 3W90A 2D1RA 2FN7A 3TLJA 2W2LD 3ZTYA 5C35A 1ZAYA 3J81k 3EQ6A 2ZAIA 4H1TA 3W7AA 1VGVA 3D2LA 4R05A 5A06A 5A2QA 2H4WA 3LVFO 3K1AA 1H0HA 3CNQS 4X8MA 1SZDA 3BREA 3DUFA 1Z2EA 1CQPA 2PD4A 4IDGA 4QXMA 5P8WA 4EG4A 5LXTB 2CXRA 2W90A 5H9WA 1KSJA 3WQRA 1JQ5A 2BI4A 3P9RA 4C7BA 2SICE 4YRNA 2VSFA 3PGXA 3H4MA 3WZMA 2HH9A 5JBIA 1ZGZA 1NP6A 5FV7A 2RG7A 1NUSA 4H35A 2BFDA 1EUQA 2B6HA 2QI9F 3B6MA 4Q3LA 1WPQA 3PJEA 4D9FA 2HHJA 4GLFA 4X91A 5K03A 3T1HB 1YCFA 5IJ9B 2IYXA 5AI9A 4DCVA 4J4HA 2A9RA 2UKDA 1SCKA 3HN6A 3Q5DA 5A4JA 5JO0A 3DHWC 1KH3A 5KWVA 3WJ7A 1KJZA 3JS5A 4OQZA 4G81A 4AM8A 3N8GA 1R6BX 2C2YA 2SCUA 3OX4A 2VOJA 4AZ0A 5ENDA 2ZTVA 2BGGA 1EBBA 1TJ5A 3PE3A 5HDBB 5KQPA 3CF4A 1PZNA 4B8ZA 3C3AA 3Q88A 1PS0A 1GU0A 2DUWA 4X6UA 3W6UA 4BNHA 1A96A 4US0R 1MFZA 2DVMA 3QENA 1L8LA 5DNEA 3TN7A 2C5AA 1P81A 1RLOA 5FI3A 3K8QA 4JYCA 1YRAA 1TQ2A 4TYQA 3J80A 3OTOB 4MVYA 2CL6X 3A05A 4HRXA 2C4MA 3FF4A 3FKSA 5JISA 1A8IA 1C9EA 4HQLA 2GZ3A 4MKXA 4ZI3A 3I9JA 1P2VA 1QYIA 1G21E 1CUZA 3PWSA 3LHSA 3F7NA 1O97C 2M6SA 2IU3A 5CCXA 4MR8B 4RTRA 3D5EA 1R10A 2IHZA 5K8CA 2QN8A 1CHDA 4V0QA 2F4VB 4DUPA 1IG0A 3GPLA 3IHTA 1DC7A 1M34A 2H0RA 6YASA 1GNPA 4JLMA 3H2HA 4JBWA 1R64A 2XWPA 4ZMBA 4CIYA 3AJAA 4K6CA 3R6TA 4FWTA 4G8CA 3EH2A 3T1VA 2JL1A 1A7UA 1E2UA 4DY6A 2V6BA 5SY6A 1WMAA 3VFDA 1JB9A 3I6IA 3V2IA 1YHYA 4RKRA 5ALIA 1PLLA 2PEYA 5JZ9A 3KOUA 4XB1A 1I7NA 1RXVA 2XUAA 1POWA 1YNSA 2QX7A 2WMOB 2X7JA 3AM3A 3GELA 4B34A 2ZVJA 5IN5A 1V0JA 3S4YA 1CNFA 1D4OA 2QX4A 1JWBB 2R6ZA 3I12A 2UZ4A 1S2IA 1ZFNA 2HA0A 3DM9B 3NDPA 4KYVA 2Z5VA 4REQB 4QDOA 1XKXA 3SJZA 3UUGA 3WLRA 2AWNA 3JQ6A 4E4YA 5CPFA 1VBMA 1KE2A 3WA6A 1DXOA 4N5LA 4BWGA 5JALA 1MH1A 5CT8A 3A1DA 4MUFA 3ESBA 1ZL0A 3AQ4A 1P1CA 4RVHA 1Z56C 1OX6A 3QVSA 5C7YA 1HDRA 3AHCA 1F1BA 3OIDA 3WQHA 3CISA 5IJXA 1Q7TA 1T1EA 2AOUA 4CTJA 1SELA 1C2TA 2X19A 4RC9A 3IPCA 4TM7A 5FWXB 2O52A 3RAJA 4IQFA 4BLTA 1TT5A 4LVOA 1GN9A 2JFZA 2ADMA 2O4UX 2Q5QA 1Z0UA 2GXSA 3EJ6A 3JQBA 3T3GA 3H2JA 1MBZA 1PHRA 1U28A 1XRMA 2FY8A 3ABIA 3GJRA 1UPTA 3DO5A 2FZ5A 1GG9A 4RZUA 5F3DA 4HWTA 1RCFA 4R5MA 9LDTA 1I1QB 1P0IA 4UTNA 1W85A 2W0MA 3A06A 4RVUA 2E7ZA 3QRWA 1F4VA 4AY2A 4GDMA 3ELBA 3DOCA 2GTHA 4Y1RA 3M9XA 1H8ED 3PXGA 1RR6A 1YL6A 1K4YA 1R5NA 1YRLA 7GPBA 2HF2A 1E4YA 3H2GA 1WTAA 2WYOA 3U80A 1ZK4A 5LDHA 1JQBA 3P97A 5D87A 4LCJA 4EFDA 1E18A 1UPCA 2A3RA 4B17A 2H3HA 4RA6B 4DDMA 1A69A 4ID3A 5AW8A 5GJBA 1ZNZA 5HW0A 3ZJTA 4P36A 4YWHA 4E6PA 2Z5FA 4GXTA 5FAXA 4QGBA 3MCZA 1IN6A 4JU8A 4Z3OA 1LI7A 3THYB 2AZTA 4MUEA 4AK9A 4MYSA 3BWCA 3FBWA 3IHLA 3IQHX 1B7GO 4MQ4A 4ASUA 4RK0A 5ESDA 4RK1A 1XTTA 4O0MA 1FNMA 2JGJA 3AEKB 4WEOA 1PR0A 3ZH9B 3K70D 3GHYA 2OKCA 4WBNA 1M7BA 4X8HA 1AMNA 1Q0ZA 1DMSA 2BBTA 3BTUA 4CGYA 3NKFA 2HWWA 1G8HA 3C8MA 3BK7A 4Z4CA 4O59O 1LV8A 1SCUA 1H4VB 3E3LA 3KLPX 3EUEA 4FMCB 4IVRA 3D8UA 5JTTA 1ZVJA 5G1OA 1GFSA 3CF4G 5CVVA 2CXOA 3PXXA 3SYNA 1U1DA 1ETHA 1I2BA 3QLVA 2HO4A 4XJXA 5G02A 1IRIA 4M7WA 4H18A 5EXDA 1U8AA 2Z1NA 1P9WA 1VOTA 4QL3A 4BO7A 3HJGA 1X7HA 4FT2A 4AKGA 1PR3A 1YBHA 1UKEA 1CR6A 3BE4A 3REQB 4BFSA 2C1ZA 4MP6A 1FDSA 1DIHA 2G9VA 3FJOA 1UOPA 3N5KA 4ISCA 5IC6A 4Y2UA 3JASB 2A0WA 1ZM4A 3DS8A 4WE3A 4DRXB 4DIMA 3M82A 4YCAA 4BTLA 1KJWA 1TW2A 1S7GA 3K6JA 4U7FA 3R74A 5B7QA 3LVRE 3JWHA 1QX4A 4R2KA 2BH9A 2IZ0A 5CVCA 2R1VB 1SVLA 4HRYA 4YQYA 2C5SA 2IF2A 3SSOA 2I54A 3I30X 1EGAA 3A7DA 3ZWDA 4XVCA 2ST1A 2VBFA 3H83A 5JUWA 2B1GA 2ZSEA 1L4MA 1OZAA 3C85A 4HXGA 4KGXA 4ND3A 5AK0A 4BGUA 2Y0BA 3JATA 4TTPA 2NVBA 5JPCA 4GD3Q 5CM8B 4R9UC 4D81A 1H2EA 4C2UA 4MDEA 4FGUA 3ZU2A 5CLHA 2XRYA 3CH5A 4F38A 1L1EA 5JNTA 5ARCA 4PICA 1RLUA 4OB6A 2ZWVA 3VPHA 2GJ8A 3C70A 1Z39A 2DWPA 2ZE6A 4YCBA 3QY0A 3KELA 3GPDG 3FPBA 4ZEOA 1K3TA 5TMEA 3VKUA 2B8NA 2XQKA 3E9NA 3RG2A 1ZRMA 3FR7A 3K72B 4Y2PA 4CNQA 2OBNA 3LBIA 3UHAA 1ILWA 3ZNOA 4EO9A 3B12A 1U0BB 5D2CA 2PH7A 4H3VA 5HRCA 3F9CA 5BSHA 1TYEB 3JR7A 4GI7A 3HB5X 4CQMD 2WQZA 1QH8A 2Y9MB 4UM9B 3E53A 2JCYA 3CVJA 1GOTA 2EEPA 1DG3A 4NE7A 2DFDA 1PT9A 1BOOA 1CB0A 2YYAA 3HB1A 2M32A 4AJPA 4NE2A 3EDCA 3N0TA 5BW6B 1L8OA 1ZS9A 2F3PA 1JZQA 3VU3A 3L1JA 5KUTA 3T61A 3EWNA 4KDEA 5FWYA 4OREX 1WQ4A 2G71A 1FTWA 2I3DA 1WZCA 2ORYA 5EHIA 1E62A 2B21A 3SCZA 3AY7A 1Q6ZA 1JKMA 3IUEA 4MV9A 5DISB 3Q10A 1G42A 4N0EA 1TX4B 3VYWA 3LRXA 3WWPA 4DPLA 5GADl 2QKYA 4LF8B 1CRPA 4QYSA 2INGX 1N0UA 2H31A 4FIZA 4N5MA 1E2PA 5JCJA 4X7PA 3OT1A 1T2FA 1B73A 1HNXB 1DUSA 1ZMBA 2QVCA 3KR1A 1RKUA 4IKEA 4ZI7A 2E4WA 2GYUA 2PJDA 4JHLA 3VSEA 2BGLA 5BP7A 1M76A 3IRUA 1G21A 4M99A 4TLEA 2H1VA 5KNBH 1MEOA 3MYRA 4KSBA 3OJLA 1JP7A 1E1RD 1DGQA 1JU3A 3VOBA 1EWYA 3JAKB 1P7VA 1CQXA 3FSRA 1U1EA 5HQ3A 4ZVPA 2FLVA 3GLKA 1LD3A 1VL6A 4G09A 3FI9A 3HKBB 3G02A 4KPYA 1LLFA 1RYMA 4LTDA 3WBKA 4QLBA 2IHNA 1C30A 3NV7A 5K0BA 1XTSA 5DLDA 2YOGA 3E9ZA 4URWR 1D6JA 5KSPA 2IDKA 3SK0A 3CSDA 1PJ2A 4DLAA 1YS7A 4J1QA 2VLBA 4M49A 3IAUA 3WAKA 1T9CA 2FRDA 3VH3A 3VU1A 4FHDA 2EZ8A 1DC8A 3LP6A 1NVEA 2BE9A 2CD7A 4HNGA 4J91A 4QRIA 5LD2C 3HB7A 3C87A 1JW9B 1CZLA 3CLRC 1L4LA 3PC8A 4F2DA 1JSZA 3ZW9A 4FE3A 1ZD1A 2VHZA 3LZCA 1HOXA 3PCTA 3P0IA 4DCSA 2DULA 3N0WA 1D5WA 2BRUC 2OK8A 3ZE9A 4JJ8A 4Q7QA 4PG8A 4NBKA 4K81B 1EA5A 1KDTA 2PDAA 4B6EA 1OB2A 2GBLC 4ZOQI 3N2GB 4PRZA 2F7SA 2PX6A 5DIZA 1RVDA 4TTVA 1UH5A 1WZNA 3G0IA 4KXWA 2BMFA 3S2IA 1WSDA 4AS2A 2QXYA 1Y1QA 1IUNA 4ILKA 2HMAA 2NT4A 1U0JA 5AP9A 3QFRA 4J7AA 1AKRA 1YV9A 5HBGA 3VDQA 3FUWA 1JI0A 2UXCB 1DT3A 1SBZA 4NZZA 4YP5A 2G77B 2YDXA 2GZHA 3QBDA 3V3TA 3W78A 1LQUA 3FUVA 3BMQB 3KRTA 3L9WA 3HI6A 2X0JA 3QV1A 5HK8A 1VPDA 3PD1A 3UUEA 2FAXA 2WTXA 3IP8A 3EIQA 3BPSA 1NU6A 3NUGA 2E55A 4FLEA 1AXEA 4HB2A 5HE9A 5L3SA 3LCJA 1OXUA 3I0ZA 2IEBA 2NU7A 3TIIA 1A1VA 1U6JA 5JATA 2COUA 4KCGA 4B2IA 4E3ZA 3L4KA 2ZSDA 1G66A 2G76A 2ZRDA 4LZAA 1ZVKA 2V9ZA 4EATA 2BSQA 3O26A 4EECA 2EVWX 1NRWA 2PBLA 3O1JC 1TPZA 3I9FA 3GVCA 3AESB 5CDFE 1HDCA 1AGPA 1U2DA 2ZT6A 3QW4B 3H2KA 4RJ2A 4JR0A 4OYHA 2XSZD 1JJ7A 3COJA 4F04A 3DF9A 3R75A 2BGWA 5JBQA 1P0PA 2J45A 4IFTA 4WECA 5CLLA 1SGWA 2D5LA 1L4YA 1J21A 1U90A 2ZI5A 1MOQA 4IDOA 3KQKA 4P34A 1OROA 4Z7JA 3ENNA 1YUNA 4GMGA 4TSFD 1E7WA 1Y9JA 3A26A 3THXB 4IXWA 1TYCA 4RK6A 2HFJA 3ZCSA 4BX8A 2NXJA 4UAVA 3OLYA 3QPDA 1SOUA 5CYFA 4C0KA 3SKYA 1I3KA 3PFFA 2DJIA 4IZOA 5GVSA 1R1DA 3TD9A 4KREA 1I3CA 3BCRA 3F8TA 3NP7A 2VNAA 3H9EO 2OE2A 1UBUS 1F4LA 2GYWA 1S2LA 1EVEA 3D6FA 4E33A 1E6EA 2H29A 5FF9A 4JXXA 2H07A 2JFPA 4OFXA 4HCJA 4KFCA 1JEOA 3LT0A 4ZEVA 1SXHA 1U2PA 3GLHB 3H9GA 2BFAA 2GARA 2KE5A 3L8DA 3OH8A 5BQFA 4I1SA 5BQXA 4NR0A 5DNYB 1GRVA 1W6RA 1V5FA 2WW8A 3D7NA 3DXZA 4B31A 4C22A 1IEWA 4R8MA 5AVWA 1B2RA 1XKLA 4EI7A 3O8NA 1UPXA 1MGOA 2YY7A 1Q1AA 4XYBA 4D0SA 2R8EA 3A2KA 5G3ZA 4YCJA 2DQKA 3LAWA 4F6RA 4C6RA 3WNVA 1Q84A 1ZD2P 1V26A 3WLAA 4MV5A 4B7AA 4NG4A 5BYJA 2PQ0A 1ULSA 1AZLA 3KQPA 3EDQA 3KZCA 4BRSA 1OOEA 1SVKA 4MQEB 2F8MA 4NHOA 3WVNA 4C0XA 3LT5A 4EUEA 1BWPA 2GJ9A 4LCBA 2PL9A 3N8IA 1PK7A 3FNGA 3TDMA 2F8SA 3HVHA 3I5AA 5F1YA 2OFFA 3VSCA 3VZBA 1YA8A 1DDIA 3URMA 4HNAB 4JFAA 1Z26A 2ZTSA 1EFUA 1C1XB 1XCOA 4LOKA 5D6NA 1B0PA 1JYFA 1O3YA 2QX9A 3RI3A 5KX5B 2BSAA 2I9KA 4F5YA 4V38A 4OXXA 4HZGA 4W1RA 5G4KA 3HRKA 3L7DA 5C3UA 1XEAA 3VPGA 1REQB 1RM4A 3MNFA 3ZI4A 4DCMA 2I6UA 3PLRA 3FGNA 1CZKA 5SYMA 4NOJA 3K3PA 4FIDA 3RVJA 5LXTF 3ZHVA 3SP1A 1DL5A 3EWIA 4W9NA 1J5PA 4KFUA 2ODQA 2HJVA 4UU1A 4DS3A 1RYNA 3EEOA 1AUXA 1C8BA 3OEHA 3QEMB 4YB8A 4D92A 1K8QA 1ZO8A 4JBYA 4MWOA 1CJTC 2GO1A 4IJKA 1IFXA 3G2LA 3OJEA 5KQGA 1HDYA 1GYPA 3NRBA 2BJWA 4KQJA 4NJEB 2QDXA 4B7ZA 4OQFA 1X1CA 4RPJA 1Z5UA 4HDRA 1CG6A 2FPIA 4RXTA 1THMA 5GOTA 5KWSA 1U3TA 1ZITA 1DX4A 4N54A 1IEQA 1UBKS 5CJPA 4M0EA 3DDOA 3IAS1 4OLAA 2G5CA 2SKDA 1RZUA 5REQB 4INPA 4OEHA 5CFPA 3WGQA 5K3AA 1M6NA 4MDYA 5G0SA 2I4IA 1AKEA 2P6UA 4D25A 3TMKA 2ATCA 5J5CA 1EGQA 5I7WA 5ICCA 3JYQA 2Q3JA 5DIFA 3I0NA 5E7JA 4BMPB 5ICMA 1HDGO 2AZXA 1QZ3A 3R3VA 1E6WA 5TGTA 4RZXA 2QYTA 1GQOA 1RI5A 2C54A 2JJ1D 2I3ZA 2RGEA 2YW9A 4TX1A 5FLKA 5M3BA 3ZVMA 4CFYA 4D46A 2C2WA 3KSAC 1I6LA 3M33A 2EOAA 2P6NA 3ISVA 2IYAA 1WMDA 2VG8A 3H9CA 4L9RA 2GZSA 4B6FA 2W2TA 3PFBA 4UHKA 3VNQA 1CDZA 1K6XA 4EG7A 4LF7B 1TZJA 3KYDA 5BNFA 2FZGA 4TQAA 1BNCA 4FJ0A 1IUPA 1O87A 2RHLA 3GCXA 3H3JA 2ZYAA 3BXHA 4MQLA 4PLHA 3GGPA 3EZGA 3H42B 4M36A 4RO0A 5AKIA 1ETUA 1UJBA 3C6YA 4AD8A 4PNHA 3GJ3A 4CVNA 5KREA 3MOIA 4QOFA 4G0XA 3M5CA 1I7SB 4OI1A 4JI0B 1NA5A 1RYZA 1WNFA 2IF0A 3WYAA 3IPAA 1GTSA 2JLBA 2XECA 2ICAA 1FXSA 4FWIB 2GRAA 4GMKA 1I6KA 1OPRA 4L8WB 1TF5A 4CTMA 4WNCA 1ZNQO 2O8FA 2Y1DA 3SF8B 2O19A 3KFXA 1CB7A 3ZK7A 1U65A 3BGDA 1Q21A 4KK4A 3SXJA 1QONA 3Q8WA 2HQBA 4Q7KA 3BZUA 3IOMA 2B99A 1U7PA 4IGAA 4TSKA 1FDUA 1LRLA 3N74A 6REQA 1YGYA 1Z2DA 2VP0A 3U1TA 4GU5A 3UWPA 3VKFA 2R00C 3OHPA 4QDTA 4EMTA 2AR7A 3SBOA 5IABA 4OLBA 2ODPA 4FOSA 2HPHA 2VUTA 4BYMA 5C8DA 1E2HA 5K4GA 4X90A 1J23A 1G2PA 2AOTB 3OJ0A 4OHPA 5EE5B 3U37A 1ABBA 2ODNA 4MA5A 4URYR 2H6EA 1O7JA 3MUFA 3WLJA 5I7OA 4YA6A 4A23A 1X8LA 1DAFA 3PC4A 5L4LA 4E13A 5C1OA 1CJMA 2DKFA 4MW9A 5A5GA 1DIRA 3Q7TA 3VH4A 2ZUUA 2GCEA 4JOQA 4R9SA 3C3KA 5BYAA 3NB0A 3L8FA 2WYHA 2Z6QA 2WJHA 2ZVDA 3DBHB 3H2YA 4QU0A 1R6VA 1EWTA 1BU8A 3RM3A 1JE0A 2YWCA 1GUDA 1ZXLA 2AG0A 1BS9A 3EF0A 3NT5A 4NESA 2J0QA 3FLMA 3ZXXA 3AM5A 3ZV3A 2ZBPA 2W22A 1YVPA 4MVXA 2Z6AA 3RSHA 1IK4A 1VHLA 2V0GA 1A04A 4KV9A 4TRMA 4JK3A 5JDIC 1M1YB 4BO6A 2WZDA 3L7IA 2Y3IA 4IWNA 1C7JA 5LSAA 4H7FA 2JA1A 3GUVA 2QP3A 4BE4A 2PMDA 3ICWA 4JI3B 2N46A 3WDKA 3H3XA 4AL4A 1U8TA 3H8JA 2W2KB 3P19A 3VYUB 4TL6A 2JLSA 2VNJA 4HP8A 4DIEA 2ZE5A 4ARIA 1GZ7A 1SVMA 5KBYA 1ECGA 1IDOA 1QYXA 2V6JA 4OQEA 2C20A 5C1DA 4A6PA 3GT3A 3SHQA 3E05A 3FMGA 2XUHA 3BWEA 3L93A 3CN7A 4FFBA 2XUDA 1HGXA 1H2WA 1YZHA 3ZY5A 4ZAYA 2PH3A 4FINA 2ZUFA 5DMHA 1NM5A 1J2EA 1E3TA 4ENVA 2VUIB 2ZBGA 1E2NA 2WHEA 3NW9A 2PX2A 3RAPR 4LMAA 1L8AA 1VCOA 4A82A 3AF5A 4K6MA 4DBLC 1QHHB 2R1UA 3I2KA 3BFXA 1RWVA 4G1BA 4FONA 4MS3A 2C98A 2EJTA 2JGEA 3FLBA 2RH9B 3EDRA 4KQXA 1A9TA 1UT6A 2VWPA 2WP0A 4K9DA 4LDPA 4Y2QA 5BNIA 1FMFA 1LBSA 1RNLA 2V5AA 1ACLA 1TAHA 4JP5A 4H15A 4RKQA 3WL7A 4YLYA 4FMCF 4IG9A 5JAUA 1XNHA 2WUGA 2XB8A 3U4DA 5LLSA 4F9TA 3FCEA 4PQEA 3E5RA 4DDKA 1UBMS 2WSSA 2Y1OA 3PFKA 4EW2A 1C3VA 2HHAA 3FRHA 2H51A 2D5CA 2LXNA 3D4BA 3MT9A 2ZUBA 2IPAB 4CMAA 2QLFA 1ST3A 3UICA 2JKZA 3FPKA 1YJQA 4QUDA 4K3UA 4YDRA 1T6YA 2NV6A 3OE1A 2BDEA 1DFGA 1ZMTA 2C2BA 4W5JA 4HRAA 2ONJA 1NJ1A 4DJEC 3ICPA 4B4UA 5BMVB 2XZOA 3ROZA 2DWUA 2HLHA 1Q3HA 4F5ZA 4C29A 8ATCA 5HX7A 1GUAA 4AS1A 2D7JA 1ISHA 1G2QA 2AN3A 3OU7A 3VR4D 5F7XA 1KRHA 4CWAA 1PLJA 3L6RA 3UQYS 4XWTA 2CNNA 4K2HA 5IKXA 4YJHA 1DCKA 1EXMA 1I0LA 5HIMA 1LDNA 3I8OA 4GR9A 4EBFA 1DJNA 4KIFA 4DABA 3IE1A 1CUGA 3DLCA 2AQHA 1BX0A 4AJ1A 1PR1A 5L6LB 4BZWA 4FFOA 2FZCA 3RVDA 1KI1A 2GZDA 1VFNA 1KQ3A 2DY1A 1CJSA 2LKDA 2PZMA 4GI1A 4LJ5A 1Q20A 4M7RA 4AJ2A 5I7HA 3FHTA 2R97A 4YREA 1Q14A 1CE8A 1TUBA 4XUGB 1AF7A 3S7TA 4GMXA 3IJ5A 3UK6A 3VX4A 3ZK9A 3HCRA 4OFBA 1QFXA 4ZAFA 2O8BB 3OURA 1G16A 4Q47A 3L1HA 4U8GA 3VR3D 4OK6A 2D2VA 2BEKA 4XWYA 3GCWA 4KXNA 5AESA 1IBLB 2PVSA 1GN8A 2WUVA 5KYYB 3VZDA 1RWWA 3QU7A 4QXAA 1IBCA 4DNXA 4L9AA 4ZIRA 3U16A 1X7XA 3OEYA 3VSBA 3G2NA 3FN4A 4HUQB 3Q2KA 5BPFA 4UEOA 3S2ZA 1L1QA 1SKYE 1R0SA 1AZWA 1CUHA 3FYUA 3UC9A 2Q62A 1M2GA 2OB1A 3TRJA 4N18A 2BWJA 4NF2A 1Y1LA 4L6CA 1ZR4A 4IP0A 4MVJG 4P1ZA 221PA 4DG5A 3GLIE 4Q3AA 5DM70 4G5YA 3H4IA 4KQCA 4UM5A 4I8XA 4BCCA 1U3GA 3D8TA 2EGHA 3OX2A 1CY0A 4Q9LA 3IESA 3C3DA 1NQWA 2HU8A 3L7NA 4JKYA 4LZNA 1KMHA 1NR1A 1PF7E 3TMYA 2HBQA 3WB2A 4AMVA 3IP6A 2XWJI 3MTJA 4MV7A 1QP8A 3G0HA 4GI2A 1JLLB 4ZANA 4F6LA 1ONBA 3NEYA 1FLAA 1EM6A 2FPOA 2YN2A 2JVKA 3A2NA 1GQRA 3DEKA 3M6XA 3OQHA 2R11A 3KWJA 3QU5A 3K6SB 5JTUA 3DXYA 4K2AA 3TEFA 4G67A 1ST2A 2J7KA 3KQSA 5IC5A 5ILGA 2P2YA 2VAMA 1IPHA 1JDTA 1OBFO 3DB1A 3KTDA 4B4WA 2HR1A 1ORIA 2XDQA 2GTPA 3ZTTA 4B4OA 1R4NA 2CV0A 1ZSNA 3ETCA 3LDGA 5EKSA 2GO7A 3J7AC 1GKUB 1V43A 3QELA 4OBWA 4MCAA 5BOSB 2VQ6A 4AJKA 1RRKA 2EJUA 3CURA 3HKEA 3M3HA 5U1PA 2D1YA 1VJ5A 2ZG6A 3O8OB 5JOQA 2O20A 3DFZA 2AK2A 2XE6A 4URHA 3TE7A 4EY8A 3MAGA 3GGJA 2AN1A 5IUNC 4NABA 3KZKA 5JQGF 1MABB 4GR5A 5FBZA 4E11A 1H85A 3QX3A 1JA0A 1JDBC 3LS2A 4CRWB 3E84A 3PDUA 3WISA 2CNKA 3DZHA 3CH4B 3EISA 3IUYA 3OM9A 4R9RA 4WY8A 1FX1A 3WY9A 2CEAA 2PY6A 1SBCA 3DO8A 1ZCJA 1BHO1 3B70A 4HFRA 5F77A 5C1IA 1MOPA 3DOHA 1TIPA 5C8YF 3AVYA 5FB3A 1AKMA 2GB4A 5H82A 4BX2A 2D59A 4DF3A 4Z3DA 2MHCA 1ZCFA 2ADFA 4PX9A 4X1KB 1M6YA 1H66A 3LGSA 2AX3A 4K87A 4UC0A 1CUYA 2DHEA 2JJQA 1TJYA 1ZIPA 4XGQA 3A9SA 1JB1A 4YXWA 3AILA 1ISIA 2Y93A 4I4LA 4EELA 4ES6A 4F85A 4N7BA 4RMIA 3TTYA 1II9A 2P5SA 2W2LA 4JWKA 3BIOA 3T5PA 3D81A 5LQCA 2GN6A 4Q9DA 5DCLA 3VGPA 4BKUA 2V7WA 5GQSA 4ZDJA 5JZSA 4D99A 5EJ8A 3BHMA 1RFLA 3KM0A 4QUIA 2PKQO 1YK0A 3PRHA 1PCXA 5CNIA 3ORFA 1OVGA 3AEQA 1PLKA 2PZLA 4AVYA 3IMCA 3HYNA 4JLAA 2GCGA 4J94A 3SX2A 3HDYA 1FQOA 3IQIX 3A4IA 4W7HA 5KMGA 1DKOA 1GYRA 2ZUVA 4TT3D 2C4HA 4RLQA 4CCWA 4TVKA 2C8JA 3CONA 4Q9AA 5FWAA 3DKPA 1DXHA 4XWKA 3SQDA 4ACBA 1T9BA 2CK3D 4I08A 1DKUA 4MKZA 1PJZA 4KX5A 3NORA 4DJAA 1T5DX 2GK3A 2IHJA 1RWMA 3A6ZA 3BA6A 4W7SA 5H3CA 4C7MA 1D0SA 1ZR2A 2WV7A 3NS7A 3CZRA 3PF9A 5ELLA 5JMTA 2JVIA 1DC5A 4EHFA 2QUAA 4TS9A 3SX0A 1P9NA 1Z8NA 2WTMA 3ENVA 2Z43A 4S35A 1S6YA 2FOIA 3HCDA 2AOXA 2CZGA 3QLVC 1PWYE 2BR5A 3DZJA 4XSVA 4CEIB 4RTJA 4TS1A 5K45A 3LPLA 2G83A 2GCPA 3GAMA 4Q01A 4WCVA 4ATNA 3UH1A 4JOCA 4DB2A 3JYHA 3RU9A 5DBEX 5MDHA 2RK3A 4G5QA 1QZTA 2E4UA 1VTKA 1PU2A 1YNOA 2I7DA 3CEMA 4KJXA 4QDZA 2RDMA 4MW5A 3C5EA 4PZUA 3S1LA 4ARCA 2EG5A 3MWYW 2UZ1A 1YIAA 3UXYA 4EPRA 3LC0A 5CIYA 4QVGA 4YV7A 1Z68A 5KWJA 2KWIA 4DHEA 1A7JA 5FBVB 4UMEA 5KHLB 2GFQA 3WGMA 3IR7A 3UGJA 2NUPA 1CZNA 1Y34E 4M9RA 4ZO8A 2E4YA 3OHMA 3D7KA 1KYQA 5I7FA 4FU0A 4LC9A 4D74A 3O3OB 1QO9A 1YL7A 2PBRA 1MVLA 1XP8A 4QUHA 2ZR9A 2L19A 1YS6A 4FFRA 2G9ZA 4ID9A 1J49A 1MJNA 1CS0A 4M4SA 3EWAA 5JWHA 3M6WA 1XMSA 1DG1G 3AVUA 1ITZA 5CLQA 4CIDA 3SEZA 3LP5A 1DBIA 4ZVVA 1PZFA 3IURA 3LYAA 4MUGA 4D1YA 2EL7A 4M8IA 1Y3FE 2AE2A 4UUQA 4M9QA 3HBNA 4HDNA 5ADUS 1Q1ZA 2IS4A 3BK1A 4ZYXA 2CJPA 5A9SA 5KB3A 2DETA 4QUGA 1QJ4A 4W99A 4R0VA 4BWVA 4DCPA 4HZIA 3PQCA 4B44A 5JSZB 1IQUA 3N8HA 4K9NA 1Y5IA 3TQQA 1SMKA 2BCGY 4ZEXA 4IMJB 1J5XA 1KVSA 4UUNA 1Y5MA 4IDFA 1TEVA 3HU1A 4QBFA 4QPDA 3FX2A 3WAGA 2VHUA 4AKIA 1RM3A 1R0YA 1GZVA 3EIHA 3M34A 1JEAA 1OA0A 4HSGA 4RFSB 4Y9SA 5A3RA 4F5WA 4AROA 5L4SA 3W1WA 4FJ2A 2PWZA 4M89A 3KOMA 3VR5H 4D57A 5KX5F 3RADC 1VG1A 3G13A 4GRIA 1I94B 1X1BA 3H5LA 2KBEA 5BY2A 2H54A 3JVDA 1WUJS 4LY3A 1JHUA 3PU6A 2VZ9A 1K9SA 2JAXA 2IYZA 4UM8B 4ZJZA 4DA6A 4DSNA 1EFAA 2GHTA 1V4VA 2A5YB 4PNPA 1BVYF 3HY3A 5ER6A 3T12A 3SVLA 4L07A 1QYVA 3UQZA 4DEYA 1UQUA 4CM3A 2JK0A 1MDBA 5EWLB 5KNCH 1E94E 4CL8A 1XLUA 2CMGA 3WIOA 1MAHA 2EFCB 3GHHA 4L4YA 5E9AA 3HO8A 1U1FA 3CLKA 1NN0A 4OTZA 2XNDD 5KYUA 4ARSA 2Q2NA 1BEEA 2NO6A 3HKDA 1ENYA 5F35A 2C88A 4XH9B 4AJJA 5HRUA 4OYRA 4XW2A 2Z1MA 3TTVA 5J4YA 3O5AA 1SZCA 1FNBA 4BP9A 1V1RB 3FCUB 4Y2TA 5FBKA 2CYCA 3HDGA 1EX1A 1H8EA 2R1TA 3S1AA 2XVZA 4INOA 3V33A 4XYLA 2BFEA 1A2OA 3WKCA 1CZOA 4R9NA 1OXBB 4Y2JA 1OZ0A 1QRAA 1OX5A 1TW3A 4KMRA 4IM7A 4W6ZA 2WHYA 1Z6TA 4LA4A 4PX2A 4X1IA 2GPTA 3FDXA 3LLUA 1XZJA 3BBLA 5DW0A 4P3NA 3SZLA 1UFRA 2ODBA 4QOIA 4YO8A 3EYAA 3ZZNA 4NLLA 3T7CA 3VH2A 4BZZA 1Z4QA 1BE8A 4L28A 4UCQA 3IUQA 7YASA 1GAJA 2C9ZA 2Q1TA 3CBQA 3MBIA 3PC8C 3UATA 2C7GA 2WTBA 4UTXA 4A2PA 1VIAA 3DBVO 3OFSA 2RHOA 4X41A 1U0EA 4MGZR 3AM1A 1LUAA 1R0BA 2LDBA 3DR5A 3FFXA 5BW8A 5JY6A 4D4GA 4WADA 1KEPA 1DBWA 1XK6A 2FFRA 1JLHA 2H1WA 2ZBFA 3DM5A 1L5ZA 2I87A 4O4JA 2B7BA 3EGOA 2QRQA 4XM0A 3STUA 2ACWA 4GGMX 4BLSA 1YF3A 7AT1A 5FBRB 2VXCA 1XALA 4EGCB 3KCQA 4U7GA 3X2SA 2GBCA 3BD8A 1PJAA 3A32A 4LISA 4O5AA 5THQA 4B33A 2BEWA 3H7AA 4ETNA 3VPXA 2X22A 1P3DA 2WQ6A 2GEDA 2QOEA 1O08A 3AFOA 3OMXA 3U0VA 3BQ9A 1JDBB 3FVQA 3TW8B 1L4UA 3GD7A 4ZU1X 1M5UA 3T8YA 2IU4A 1E3WB 1SBQA 4OA5A 1CUSA 5BVHB 1NVTA 1OLXA 1R8QA 4ND6A 4DOMA 2AV6A 3GJ5A 4FTWA 1J8QA 4QTXA 2OBYA 3B1VA 4Q21A 4M9ZA 3NBMA 1BVRA 2W2NA 2ZM6B 1KJQA 4JDPA 1HPLA 2ATIA 1V45E 2YHUA 4HAIA 1QBKC 1XVUA 5C8VA 4YC7A 4KN9S 3UT5B 2XH8A 3WTCA 3I3SR 3IR5A 1PT7A 1RLIA 1GDTA 1U2DC 2W8ZA 4UTZA 4IIGA 4UBMA 1QU2A 3F2IA 1V8DA 3DBOB 2XXAA 3GRUA 1FF9A 4IJMA 4ENPA 1A7KA 2V55B 1YC5A 1YCGA 3LX6A 3LX4A 2BZSA 5T8KC 3GR6A 1T0BA 1I0ZA 1WKCA 3WRYC 2HRDA 1R9NA 3TD2A 1MB0A 3SSNA 4JBIA 2XF8A 1ENOA 3NT2A 2ZYWX 2VP6A 4DYDA 3NJ8A 2C5GA 2FVYA 3ONDA 3K9LA 1VIDA 5FYDA 3IEIA 3JRXA 3ABRB 4WZAE 3GFTA 2DR3A 4OSEA 5H7XA 4DIUA 1A4XA 1MNQA 2OCPA 5J63A 2IS1A 4UHDA 5J2TF 3GFPA 3TKLA 2ZS7A 3F3SA 1C3EA 4CQMA 1VMEA 1RWPA 1VIMA 3R3HA 5JNWA 1XZFA 3UB2A 4CIBA 1F51E 2Z95A 3WK6A 3DV9A 4CU2A 2AEMA 4W5NA 1AO3A 2YZ2A 2ZBRA 4MCHA 2GHQA 3WIVA 2NU9A 2PXAA 2RAUA 1COZA 2CWWA 4BB9A 5CA0B 3IOBA 3GNTA 5DOZA 4BMCA 4EGAA 4EVSA 2I78A 1WMBA 4UNPA 3VC7A 1P19A 4HWOA 4DT1B 1UFVA 3LHFA 5B3KA 5F98A 3UAWA 4DC1A 1O96B 2QB5A 2P9HA 3HBFA 3KAPA 4QBIA 5D1HA 3ZGYA 5CJ2A 4CL3A 3ZDBA 3GLGB 2RI0A 3GQVA 3KL2A 4E5DA 1NBMD 3KZOA 4B3BA 2DQYA 4J16A 4W4TA 4FNOA 3V8VA 1F2TA 2D74A 3CRZA 3IIMA 2FK8A 1IZZA 2QF7A 3QYJA 3QWHA 4H7KA 1TQ8A 2QV7A 1HDIA 1H2AS 1HXHA 1XIVA 4ZAGA 4N8EA 3OKPA 2ZB4A 3PRJA 4IH9A 4OSPA 4XDHA 4XKJA 1LVUA 4IZIA 4Q1CA 1N5OX 4QAJA 4C3ZA 5EP4A 1T3TA 3C24A 1IHOA 5BR7A 2CXHA 2EKQA 1ZESA 5D85A 3RE1A 3UA3A 3VNSA 4EG1A 3Q8MA 3TQHA 1U0SY 3SQLA 4XPIB 4RM3A 2RHMA 2ZB2A 1E1RA 4BNIA 4DSTA 2N1BA 4Y6RA 4A2WA 3ED1A 5MGBA 2FZKA 1D4AA 3ZD7A 1C2YA 2VYVD 2NNWB 2WWTA 5FOTA 3TGWA 3P2KA 4UMDA 5K0SA 5F5LA 4HX5A 3LVQE 4C4XA 3M6FA 1RPAA 3GRYA 1DZIA 4KGDA 3U7JA 3TLAA 3F5FA 2YYYA 1KMCA 3USES 4WNAA 5CD9A 5KJCA 5FO0A 4EL0A 4RMGA 4W9NC 2WM3A 2P9QA 2XE8A 3HJHA 3G1TA 3EAQA 4I4IA 4EITA 6Q21A 1HMYA 5BMVF 2IGTA 4FOTA 4MRVA 1IUOA 1MUUA 5CXSA 2Z2ZA 4NCKA 1YBVA 1HK7A 5B7GA 3T5MA 3T1YB 5GONF 2FF5A 2IEAA 1GPKA 1W0KA 1PL7A 3E7XA 2IYSA 4WFKA 2QZZA 1NDUA 3I2FA 4GEGA 2P9EA 4EPTA 2VQFB 3KSMA 1H1LA 2X9GA 3HFJA 2R25B 3MINA 3HXOA 3ETJA 2GEJA 1MOZA 3CLHA 3QI2A 3AF3A 4WFQA 4C7VA 4E5MA 1XWFA 1TGYA 3BTOA 4TS4A 4BQQA 1M8JA 1X2EA 2JFWA 3FPSA 1EFCA 1FRFS 4UU7A 4TMKA 4XI9A 5ELXA 1NMSA 2Z4RA 1ADGA 1D07A 4PFJA 4ARZB 2VPYA 1ZY2A 3IGFA 5L3QA 3AOGA 1PGJA 3G8BA 5IH3A 2VPQA 4ZT3A 2IEZA 5IAJA 3DZBA 3ZE7A 5LN1A 1C1HA 1DUIA 1N6IA 2IUTA 1DV1A 3HN7A 3HV0A 4YAGA 4YPVA 5B5SA 1PZGA 1E89A 2AXEA 1QO0A 1NU8A 4ER6A 3W9BA 4RGQA 5ILOA 2QEQA 5ECWA 3IBGA 3AK4A 3UWSA 2LDXA 1DAEA 5EERA 4DLXA 1B26A 1LS6A 2FWBA 4TUYA 2WMYA 1R0RE 1OWPA 4U6QA 3PE6A 3RW9A 1EDOA 3GRVA 1G21B 3JWIA 3O1LA 2C4UA 2FE1A 4HYYA 4TOIA 5DXJA 2PPLA 3S29A 4E70A 4CYMA 3OOWA 2BR4A 3PV0A 1MMFB 4Q4AB 1ZK1A 2FTKE 4EJ6A 1ML3A 4EHBA 4F3KA 4O4LA 5FORA 1II8A 1QTQA 3UKOA 2Y8EA 3NT4A 1D7OA 2V7XA 4R69A 1L4HA 3NX4A 2XSZA 3CNOA 3NIDB 5EESA 1VXRA 4ZAVA 3VSDA 1TQHA 2WMNB 3P52A 3GFGA 3H13A 3QTTA 4FSDA 5H9VA 3AR8A 4BVKA 2IY7A 1X7YB 2ACVA 3L77A 4JU9A 1MO5A 3EXFB 3LCMA 4NENB 2B2XA 2CDAA 4TSFA 1GCIA 1LWOA 2FZWA 3EFOA 1Z12A 3VU8A 1E6CA 3PFHA 2DT8A 1D04A 4K0RA 4UM7A 3V1LA 1ZVQA 2O9JA 4OH1A 4IAOA 3KYBA 3W3ZB 1KVQA 2YVKA 2YFYA 2JCXA 5FNZA 3AXTA 2GVZC 4FDMA 4OYYA 4EY5A 2OENG 4AIIA 3ZKWA 4UVEA 4BEVA 1TKBA 1VMAA 4UUMA 2IKQA 5FOUA 3DD5A 1NMEA 4WK2B 1L7RA 2R1ZA 4PHTA 1OR8A 5DM2A 3BWXA 2LIPA 1PL6A 3IEUA 4FVTA 2GCOA 2VTKA 2ZT8A 3WLMA 1FYDA 4EEXA 4EYEA 1WP9A 5A3VA 3F4KA 4MV6A 3DTYA 3HUTA 2R6HA 3I1YA 4IHKA 4KODA 1R4AA 5K99A 5AI4A 2ILTA 4FILA 4MYHA 2Q07A 4G01B 2BMDA 3U09A 2WG0A 3HL4A 4E3WA 4L8GA 4G6ZA 1B0AA 4YI5A 3KZMA 5EZYA 2J6HA 2XUKA 3F9IA 4CKCB 1IB6A 4AYXA 4DV2B 3G5UA 4XASA 2A92A 1LB1B 1L7NA 2V74B 4HEQA 3DEJA 2RI6A 4EX7A 3M4NA 2JARA 1GNRA 3KYIB 3KPJA 4UZSA 2ZTUA 3JQ8A 4NMWA 1QMGA 2CCJA 2PXXA 3B1XA 1IMOA 1FDOA 2RGBA 1G291 3C8ZA 4C20A 1DKQA 2PV7A 4WA7A 2OORC 4WJZA 2I4TA 5GVRA 3C3BA 3KTAA 5B3LA 3TOSA 1TEXA 4JBNA 4MYRA 3PGA1 2VHXA 1JHRA 2PLAA 4KKXB 3VUEA 4D8WA 4MXDA 4H16A 1RPZA 1U0TA 2XNHA 4P53A 1F60A 1PN3A 1K89A 1B8OA 4X95A 3WKAA 1Q1BA 5B1EA 5IX8A 2CB9A 5AM3A 1VL0A 2F59A 1KGDA 1G5PA 1T8RA 3OJCA 4XUDA 4C4SA 4HC4A 1JFFB 5BV2P 2O8CB 1Y80A 1IY9A 2H4JA 1V96A 4GNRA 3WIBA 3HBAA 3ZZ0A 1G8MA 2BBWA 2V7GA 4QFBA 2QLMA 1KI6A 1HLDA 2H11A 2R7MA 1IPEA 2ZJFA 3G8CA 4BMSA 4DIBA 4Q3NA 3OPMA 4OXIA 3BKWA 3O84A 2Q1WA 1EIWA 5CX1B 3Q5EA 3UAGA 4AJLA 2VEOA 1DP4A 2P9BA 2VQEB 3D3NA 4WZAA 4IXNA 4JJ4A 4BWFB 4FT4A 1RRCA 4FEYA 4YLGA 2PX0A 3GJTA 1YMQA 3V8NA 3RYHA 4X8LA 3L5OA 1I3LA 1ZU5A 1KETA 1JTVA 4LK3A 4BGIA 4DIDA 1W36D 4ICIA 4Q3CA 1ZUD1 4BEBA 2IUFA 4M1TA 4ECAA 3I58A 2VPZA 3K09C 4NOMA 1T5SA 2W6NA 4XX0A 3V34A 4NONA 3NNNA 4DY4A 4MWCA 1KO1A 4BLWA 1OH6A 3WLKX 3LCUA 4I8DA 2XNCA 5AVVA 3KJNA 3VM6A 4D4KA 1T91A 4KAAA 2GHIA 2X41A 3SQXA 5K09A 4B6JA 1GSOA 1KR5A 3PUVA 1RC8A 4KE6A 1GQ2A 3KLOA 3MMSA 1AF4A 5C1PA 3P5SA 2B2CA 4GWKA 4II2A 2E4VA 4U2BA 1IQRA 3WGKA 4YQFA 3E9QA 5DP2A 1YQQA 3RSCA 1B42A 2Q1XA 3FDIA 4DIOA 2QMOA 4A5OA 4WK0B 4ENQA 3UUFA 4XR4A 2JJ1A 4G63A 4BJHB 1IL0A 3KU1A 3OOSA 2O2CA 1RKQA 2YUTA 1GLNA 1SU4A 4OU4A 2UVPA 3TXXA 1EX7A 2M1XA 4I50A 1HH4A 3I9V6 1K98A 5B6PA 2VLIA 4U0JA 3LW7A 1N34B 4E1VA 1QRTA 2PCJA 2X2PA 3GRAA 1TYDE 1UDBA 4M2LA 4XQGA 4NNOA 1ESNA 4UBJA 1E64A 5FO1A 4NV1A 3M4ZA 4JYZA 2X23A 3K9NA 4H59A 2HT1A 5LQNA 5BURA 1DTWB 1BXRA 4ZQHA 1Z15A 1BMQA 2D1SA 3OIWA 5LZ7A 2IHYA 2CDNA 1VCHA 1NBAA 2WF7A 5HKAA 3NWBA 4O2LA 4XIIA 4UZEA 3E22A 4KDFA 4GKBA 2EARA 4F86A 4HN2A 4RBNA 1YZ3A 4AF7A 2N1MA 1WZEA 2EU8A 3R1IA 4L0DA 4YROA 3FYUC 3P71T 5EWJB 1Y81A 2IWHA 4YHBA 5B2ZA 3TFQA 4DC0A 4TKVA 2A4KA 3FOZA 3KOWA 3JPWA 4ZI2A 2JFVA 2XQFA 1RT9A 4HFNA 5HUQA 4PZCA 2VHYA 5AJZA 2BI7A 3PT9A 2XZDA 4HDRB 3MQFA 3IDOA 2VAXA 3AHEA 3PGVA 3V4SA 4ZEWA 1X86B 3E9YA 2CWDA 1NQUA 3L79A 3IILA 3LE8A 1PT8A 3OTQA 2XGOA 3I2HA 2PLFA 1I2DA 3I09A 1RQ7A 3N39C 4HGQA 3D2CA 4OCZA 3PA8A 4O5OA 3OLCX 3DDUA 3SSAA 2AYYA 3BGVA 5IJZA 3KFLA 5BWCA 2QDKA 2IYEA 4HGOA 2ZAYA 2ZJ2A 3PUWA 1B6GA 1PGQA 5J1TB 3QYFA 4IEIA 1TM7E 4ZMSA 1LNQA 5H16A 2HMTA 4A8TA 1YQ9A 4J2HA 2YRFA 2HF9A 3JVEA 1FS4A 1GL9B 1MTOA 3NVAA 4FYHA 2FW7A 2WKSA 2ZE8A 2FQWA 1QVZA 2DWOA 2QTCA 4IGKA 3GPCA 3NM6B 4AY4A 4LE0A 5TR9A 1MN6A 1PS9A 2B5OA 4MLZA 1YU9A 2R4TA 2ZRNA 4YP7A 3WLFA 3QE0A 3QVGA 4D8YA 4ND5A 4ETMA 2BGUA 3QFFA 1OLUB 1GHTA 4LZWA 3NHBA 1QH1A 2CJFA 2YS7A 4G9BA 4DMGA 5C1BA 5J3JA 3K32A 1YKGA 2YY6A 3ANLA 2FJUA 3LFHA 3COPA 5FYQA 4WK4B 3TTTA 1LFDB 1VA5A 1W4LA 5GV7A 2JI9A 2HLDD 4RX1A 2ZZNA 1TQDA 3TOZA 2R2AA 2XRFA 4AI6A 5DCYA 2WABA 2VTBA 1P5HA 4AZWA 2WT9A 1DIBA 2W6CX 3PEWA 1UWKA 1AIPA 2CVHA 2O6HA 2PJUA 2W2XA 4P3YA 5B3JA 5BSKA 2OZPA 5FLXA 1JKJA 5LB4A 3ADCA 1V95A 1S4QA 5GMOA 3HXQA 1YE5A 4FN5A 3PXAA 4MGYR 5CVDA 5K0CA 4X64B 1AKQA 2Q2VA 2HIAA 3DULA 5CLIA 2V45A 4AN0A 3CGGA 1MAAA 1XZCA 3HDHA 4C76A 1OT5A 1NYQA 3F6SA 3VZSA 5LUBA 2Y1LA 2NU8A 3VR2A 4QT4A 3KHSA 3NCHA 2ZQZA 4IDPA 4YUYA 5HKKA 3DKKA 2J1LA 2BKVA 4X97A 1PVDA 4L4SA 4E08A 5JNSA 1MW8X 2PR2A 2IA5A 4NATA 4DARA 1PNTA 2HDHA 2MYNA 3EVEA 3K9QO 4DHWA 1NJ8A 3IP5A 1PZEA 1Z7GA 1Z6YA 5CBPA 1HZZC 5KAPA 4KXYA 3IEMA 2PJRA 1T2EA 1W88A 2GCIA 2MTBA 2NSHA 1FIUA 3BDVA 3NHYA 2AI2A 1EGHA 2OO5A 5F52A 2BSXA 1QHNA 3JALA 3OQIB 4AJOA 1K7XB 5KYWA 1J25A 5HTOA 1TUIA 3MGAA 2ZIEA 5E3IA 2UUOA 2IQIA 5CK4A 1L5YA 3NDRA 5IW8A 1LTHR 1HRKA 1TEZA 3RVPA 2W83A 3ABSB 4S04A 1E2LA 3VR4A 3F6PA 1NY6A 3EFEA 4U5XA 1Q50A 4JY7A 5ALEA 5LWHA 5TE9A 4FZRA 1BHSA 3L05A 3LQKA 4X6XA 2WTEA 3G7UA 5I48A 5IM5A 3FPGA 4NAVA 5E38A 3B2QA 2XUIA 3VPAA 3L18A 1OGJA 2XMQA 1VYTA 4U3JA 1XXHE 1SHZA 4GPAA 4NY1A 1ZP6A 4OJNA 5AXDA 4EW1A 1JHQA 2I4OA 5KO2A 1UBHS 4CL0A 3HY6A 1V3VA 2QN1A 3TPCA 3NHFA 4LOLA 3TECE 1HNWB 2PRJA 4B79A 1GPMA 2WJAA 1BOFA 1MRZA 2OM6A 3OF5A 4JL8A 3ZCQA 1DS6A 4ZD6A 5AVQA 5L7YA 3MD0A 3B1ZA 3LQRA 1SHKA 4KXMA 1OKKD 1PNVA 5JXGA 1V41E 2Z09A 4NS1A 2YJTD 2XGMA 3VR3A 1CUXA 3BJRA 3QVJA 4YIHA 3UEOA 1DQSA 3DL7A 1G18A 1YT5A 4AJHA 2XBLA 3T9CA 3D8BA 3PYXA 2A9PA 1N33B 2IUEA 1SBYA 3E2MA 5J23A 3IIJA 4BNTA 1KGSA 2GN8A 2MR6A 3KZVA 3A9TA 2F1JA 1PK8A 2VH2A 5ICFA 1CETA 1R0KA 5E4JA 1ZHFA 2XT9A 3EGWA 3SJBA 3T1QA 2JAOA 3EEBA 3GFQA 4DV1B 5FBQB 3AJEA 2JI6A 3H4TA 1S8AA 2R48A 4LJLA 1XTPA 1VHWA 2YXDA 4EBBA 4EHDA 1FB5A 5INTA 3PLNA 4LOAA 4M55A 4MGKR 3I04M 3VTKA 1P4SA 5CA0F 4WCDA 3GNSA 4N48A 3CW8X 3GRPA 1ZN7A 2QMQA 4UBOA 5F1KA 1HNNA 4U7HA 4GFDA 1CC1S 3UC5A 4DDVA 4BVJA 1KY4A 1AS2A 5JXHA 5JWRA 2HJHA 1WOMA 1ULHA 2X15A 4MWEA 4PYLA 5AKLA 1NW5A 2CMFA 2GZ1A 4MHSA 5DGTA 4DJFC 3RPEA 4BMNA 2OZLA 2WD9A 2J67A 4H6WA 4BL5A 1JVNA 4K9RA 3GL9A 5BRAA 1GGMA 3OPNA 1P8JA 1F4PA 1LC3A 5EA2A 1R15A 4O2RA 1TYAE 1GPAA 3E2IA 1VMDA 1E2GA 4M53A 1OFIA 1T35A 2VP3A 3TRIA 4DANA 1RYYA 1YSCA 3CPSA 1AHNA 2QGFA 4D6XA 1M6HA 1JZSA 2LRHA 2W93A 3D4LA 5JQGA 1Z37A 2OHJA 1K5HA 5EN4A 2ZIVB 2E6KA 1L7DA 1NULA 3BTSA 3SN6A 5HM6A 3EGXA 3JXEA 4NZOA 1UKZA 2F48A 2Y1GA 2KLBA 3JQAD 4H4EA 3TSWA 1K1EA 4LSGA 4RGYA 1RXUA 1O95D 3N70A 3QUTA 1KZ9A 1NPDA 4RIHA 3WK4A 4E31A 1TCVA 4G5XA 4B6SA 2D8MA 1SKQA 4LF5B 1G4AE 1YWGO 2ORED 5IWAB 3MRSA 3WICA 2CLIB 1SXJD 2A0UA 1SIUA 1HX7A 4UKDA 1XMJA 4LNAA 4JBLA 4QA9A 3U7EB 4RZ2A 4WW0A 3D3WB 3QITA 1HT0A 3RF7A 3OU2A 4HNRA 3G8YA 4H7PA 4K05A 1S2OA 3PR1A 3RRJA 3U4AA 5BXQC 3AVWA 2HV9A 4YIKA 2UXDB 2P9ZA 3JZDA 2FCAA 3IJPA 4I8IA 4LJ8A 1Y0BA 3G49A 4E2XA 1IVNA 1Z5NA 2RBKA 4OHBA 5TPWA 5DI3A 5JEDA 4NJMB 2D0PB 1R4ZA 1T9GS 3MTIA 2UUCB 3AHDA 2Q4OA 4XIFA 4EW3A 1ZC4A 1WTCA 4GOKA 1XZHA 2W4QA 4MARA 4ZHQB 5CTJA 4B3XA 3QFSA 2F43B 3TXYA 3DZKA 2X5KO 3AUAA 3Q6IA 4FW9A 4WESB 3K96A 4KH1A 3S2FA 2EKBA 2W4IA 5JI3E 5IDYA 2V0CA 4EJSA 2PSHA 1UADA 4H6VA 4DCJA 5AUOB 3Q0IA 1MW9X 1JMKC 2QQ0A 2HDNB 2AQKA 2F17A 4PVCA 1Z5GA 2BFCA 3RABA 1UCFA 4XOUA 1KZ6A 3GLFB 1XL0A 2BV3A 2E21A 4ZT2A 1PUJA 1X70A 4JASB 3LNTA 4LXQA 1OAOC 3WNQA 3ZY6A 1ODIA 3O93A 1KMQA 1TCAA 2BLLA 2QTVB 4R71A 1WNTA 1N5RA 3F2VA 5AW0A 3K70C 3RC8A 2IHKA 1R4NB 2LNDA 3QP9A 1VJDA 1VKJA 2VJCA 1E2BA 4DXHA 1EDBA 4XGIA 4CCYA 3DJFA 3QELB 1GZDA 1UQRA 4UASA 5AVJA 1U2RA 2EBFX 2BP7B 3AZOA 1TEHA 1T2DA 3GN1A 3IXQA 5E6RB 4MV4A 3UUWA 3KV3O 4URXR 3QE2A 1OBVA 2O3SA 5CVUA 5CDGA 4ARAA 2E9SA 4UBNA 4AJEA 3UMGA 1XPUA 3IXMA 4Z0NA 1VMKA 1PDWA 5GJVC 4V1CB 3I76A 4R8RA 1NBME 4J0EA 3PQEA 4N9QA 2BEUB 3U7QB 1QLWA 1RWNA 2VAWA 3TX6A 4JJEA 5IJ0A 2G9QA 2BKXA 4ETIA 2AQ8A 4YMSA 3PPIA 2J9FB 3COZA 3SZRA 3EG9A 1SKBA 1DKNA 2D2FA 2X5JO 3GJZA 5DCWA 3UMCA 4XTRA 1KS2A 5ELMA 3MZ0A 5CFQA 3NAQA 5LKAA 2P1ZA 3O2NA 4M1MA 4BP8A 1FCJA 3OFKA 5G0UA 2Y1KA 4MPJA 3HXMA 2E5FA 4NU6A 5FEUA 4Y2HA 4G1CA 4DV4B 4QBHA 4CMIA 1PI3A 3U17A 3GYBA 1OAAA 2HM7A 4N5IX 3D2AA 4PZAA 5DHPA 4ZGGA 5I9BA 4ALJA 4Z7NB 4EUKA 3EGIA 1D0IA 5HMMA 3OCUA 1R0XA 4KPUA 3U5TA 2PUGA 1G8KA 2I3AA 5H3HA 2X7XA 5EFOA 2VVTA 1Q19A 4BCBA 5I3ZA 2O0MA 2Q1SA 1NJ6A 3JQ9A 4OQMA 1IXSB 4X6YA 1KWGA 1J2JA 5BUCA 2XWQA 1LWNA 2CMHA 4G4SP 1G98A 4U7WA 3IHKA 2OV3A 1RHJA 2Q8PA 4A73A 3N2NA 4LFAB 1UKYA 4FDVA 1Y7IA 1CEYA 4QQRA 3EXG1 5FRDA 2GVDC 3WHLA 1RWOA 2WWYA 2C59A 2X8LA 2ZJ4A 5F76A 4D3YA 1JBKA 3KZ1E 5AJWA 2O3UA 1RLJA 2P79A 2X9LA 5JR3A 3LCVB 4M9UA 3S55A 3A9VA 4G84A 4CV0A 2PWYA 3H1BA 3P2IA 5K8JB 2NU6A 1D2MA 3UJDA 4TXJA 4EY4A 4MGHA 2IZ7A 3GRCA 4TXHA 5BQ3A 3FFBA 3G8AA 3QKTA 5CYGA 2O0KA 3L6BA 5CDSA 1P44A 3HA2A 5A0FA 5JNRA 3ADOA 1FFXA 1XXHA 3ND7A 4OI2A 1NMZA 1QYCA 4FE7A 2HO5A 5D00A 1LPSA 2HWYA 5CB4B 2IYVA 4M8SA 1S2DA 1SU7A 4HJXA 4LIPD 4RQTA 4TT8A 4U2KA 1VLQA 2WNSA 3HKCA 4IV8A 5E4TA 4DB4A 1TF7A 3DKRA 4YMWA 1XVLA 5EIWA 1Y4DE 5KTKA 3D7MA 2WSBA 2UUBB 3SXUB 1NVMB 2DZDA 2YMQA 3BSFA 1EU1A 3CUEF 3HFSA 4ZZ0A 3N58A 4PZEA 5DX0A 1Z73A 3EDMA 2FWPA 3OOYA 2X7HA 1MXHA 2YJ3A 1WHTB 1B8VA 3EXEB 1Z63A 4FHEA 2DLDA 4CF4A 5CUQA 4MUYA 1QYDA 1ZWKA 2D0OB 2WPNA 3LF2A 2G36A 4BO3A 4UMFA 3BHIA 1OH7A 2GKOA 2DC1A 1N6KA 4RCYA 2XNDA 1MTZA 4RH1A 5HZKA 1AH2A 1E7RA 4WHMA 3WB1A 3KB6A 2ISQA 3DLBA 1XL1A 2EX0A 3V2HA 1WXHA 5I8PA 2ZYSA 4NQRA 2X76A 4Q3DA 2NIPA 4G0QA 2EFJA 3DEYX 4A1FA 1N5DA 1QF9A 3KOXA 3M6UA 4JCOA 3PHJA 5FOWA 1PJ8A 2RGWA 1YJCA 2C0PA 1Q7RA 3A6KA 2OB2A 4HWSA 1J39A 2PUWA 1SOWA 2X3YA 4W1QA 5TV2A 3GJYA 5K6AA 3NKLA 2NUAB 1IEVA 2I55A 2AYXA 4FYPA 5C2JB 3HGTA 3G2QA 2OD2A 1P7CA 2OG2A 2ENWA 2YFQA 3KS9A 3UK2A 1BA3A 2QM8A 2QSZA 3E58A 5T4HA 3JU3A 1GTMA 4LY6A 1O6BA 2QXTA 4MKHA 3VJLA 5EG5A 4DWWA 1FTSA 3H16A 2J85A 1HT2E 3VKGA 3DDSA 4R2LA 2P3LA 1XROA 5JCPA 5LVAA 3NCTA 4U4AA 1UKVY 5DF1A 5KVCA 5LOVB 1G19A 3D0OA 4XCXA 3PNKA 1F2UA 3U1VA 2V5VA 3BERA 5C4IA 4HZUA 4I0WB 1SPXA 3AHJA 3DEAA 5JCOA 3DE0X 5BRNA 3HYLA 2IE0A 3RUPA 4C4TA 4V2UA 4EFLA 4GS5A 3Q7IA 4CKZA 4UNRA 3GLQA 4KQ2A 1GV1A 2WZBA 1YR9A 5FUVA 2JW5A 5ALSA 2CBGA 3V2UA 5F2OA 4BQRA 4RACA 1JILA 3I05A 3PDIB 4KO8A 4YJFB 1RRFA 2B4KA 3AONB 3AUTA 3Q3EA 3ZNQA 4EWLA 3BHNA 3FTQA 1V9LA 3CIOA 3BOSA 1UDAA 3AP2A 3NTVA 4REOA 4IHJA 4GBGA 3R7SA 2A6PA 1J24A 2XTMA 4ZVLA 1O89A 3CXRA 1X1QA 1JXOA 2BT4A 3OFND 2YV1A 1Y1SA 2CNLA 4KFTA 5GWXA 4MRNA 1SK8A 2YMPA 4TRRA 3R9IA 4ZYUA 2DTXA 1E2FA 3QXGA 1SKYB 5ALRA 2OV2A 2CXPA 4EI8A 2P9FA 4JJZA 3HDJA 2XCIA 3Q1LA 1KO4A 2GHRA 3ANMA 1JV2B 5FTKA 5EWMA 3GLIB 3NBFA 1SHLA 4H0NA 4C6SA 2L69A 3IIKA 2VJKA 3P9IA 4BQPA 1NUAA 3ER8A 1TCCA 1LW7A 5HA5A 1T15A 4UNNA 2KYRA 3P7MA 1Y4ZA 3H2IA 2FR8C 1HFJA 3I23A 3L01A 4CLOB 2NSLA 4PGFA 4MS4A 3WV5A 2W4MA 4OHXA 4D9EA 2IS2A 1B00A 3UJ8A 5FA6A 3RVOA 1E4EB 4EQ6B 2SKCA 2MDTA 2QN3A 3CZ5A 4IH1A 5ESWA 4DR6B 5EP3A 2WHPB 2ZBUA 2ZKIA 3JZFA 1LLQA 3PA6A 1I4EB 4DCTA 4X54A 5KDLA 2XUZA 5HBRA 1PNRA 2V6MA 1JKXA 1T1RA 1TXGA 1ZIYA 4E4TA 3IBFA 3EPLA 2JHAA 2X5XA 1ZLXA 4AXBA 2GD6A 1NP3A 4N76A 3DMYA 2YVUA 1KMMA 4DFDA 2AJDA 4HAWA 2IHUA 2B4RO 3T3HA 1RAHA 1L7VC 5TMBA 2EJBA 1V5WA 1U8YA 1XPOA 3L8GA 1WHSA 4P58A 5T7BA 2AFRA 3X1YA 3CKLA 4EW6A 3PR2B 1UWVA 3SS8A 3T9AA 1B0UA 3BFKA 4ZU3A 2X4DA 4CQLA 1NBMA 3FYTA 4EVRA 3JQDA 1VKOA 4JT8A 4RA9A 1K6JA 3D8RA 4B5KA 1DEKA 4GM4A 3IBYA 2VP9A 5M29A 2IPLA 3BF7A 1EDDA 3JWPA 3H5VA 4PNZA 3HA3A 2CV2A 1OLXB 2DLNA 4AX4A 4PZPA 1KVRA 1FNDA 1NW7A 3RAGA 4EA9A 2P6RA 1FXWA 3ZJVA 4LQCA 3UFXB 1N9GB 4IDQA 1HT3A 3HL0A 1WY7A 2Q41A 3P9NA 4J0HA 2LVBA 2WM2A 3CG4A 1NQOA 3H17A 2AWOA 1WCYA 2NYVA 3FHCB 4MVJP 1XUOA 2VYVA 1UP4A 2P4UA 3EOAI 4ZGBA 1ISMA 3LO5A 3FLAA 4IL5A 2CJWB 2NP6A 1Y9DA 4TZ0A 1O5OA 2NPOA 1UMKA 1JH8A 3AU9A 1MX1A 4FBLA 4FDUA 4GP7A 3RT7A 4D79A 5C8ZA 3FHOA 3HXTA 3PHGA 2EX4A 4EYQA 5EHZA 4GOJA 3UJ7A 3IFSA 1G55A 2ODWA 4D6YA 1FE8A 1ACMA 2CLEB 3E4DA 1KSGA 1XLTC 2QMYA 1GVHA 2VDWB 1APBA 2ZITA 1KBOA 4ZO6A 1QIHA 2E82A 4L8FA 4ZN6A 1D1TA 3QPBA 1GCGA 2G70A 3L49A 4AQYB 4C0QC 4YAFA 4R3WA 1NVFA 3VHXB 3H9QA 1GFWA 1U0OC 1YVUA 1U3FA 3KJQA 3ILXA 3PC3A 1TJ4A 1U31A 3N2EA 4TMVA 3UAXA 2OHVA 5E8JA 3D5TA 4LGMA 3NXKA 1IOLA 1F8UA 1M2FA 3KQTA 3P9XA 1N2CE 3WZ2A 5F4BA 5J2UA 2XQJA 5BORA 1U2TA 1EE2A 3R3WA 3FPFA 4G4IA 5EQDA 3IB3A 4I5DA 2CF5A 4FJ1A 1OXXK 3UYLA 3DTVB 3RWBA 1JDPA 3UV6A 2PMEA 1K66A 3EXHC 3ADPA 5JAQA 4DLZA 4OI4A 3JV7A 2Y1WA 2ZIWB 3FLEA 1DCMA 4JEUA 4TWZA 5CG1A 5AVYA 1TA4A 2PFKA 4LS3A 2NYAA 2VJMA 1N6RA 2Y27A 1B8UA 3CRVA 3HEBA 2J0UB 2Y4NA 1K6MA 4PRKA 3MD9A 5L53A 1B3RA 3EVBA 1E9FA 2NO1A 2VN8A 2G9UA 3SY8A 3T4PA 3ID6C 1WLYA 4ZC1A 5AT1A 1QC5A 3EVDA 3DE3X 3GARA 1QX3A 2AG6A 1GT6A 3MRVA 1Q0QA 1GVNB 2FN9A 1OAKA 3LUFA 4P7JA 5U4QA 4YRSA 1AZTA 1DRVA 1EP2B 3IBTA 1CKEA 1YR1A 4G0UA 4ZRDA 1MJFA 2VT7A 3PC7A 4DKXA 2VF8A 3LPNA 4Q1FA 2OZVA 1JHAA 3WQQA 2MSLA 5IBRA 2IOHA 2TMYA 4UUOA 3B5EA 3U49A 4GLOA 4MQFB 3IKLA 3O82A 5JAMA 1QCCA 4O6VA 4A6XA 1IU9A 5GJCA 1ECFA 5LIRA 4P7FA 5K0JA 3R3JA 1FFCA 3D1JA 1ZEMA 2CD9A 1PWHA 2WOOA 3VOSA 5JNVA 1CCWA 4IG4A 3KAQA 1ZJ4A 2ZJ0A 4WAUA 2PMFA 4KXUA 1KQFA 1XG5A 1F20A 2C3UA 4RY2A 4O2BB 5HSGA 1F14A 1V1MA 3HU5A 4PAWA 5BW4A 4RD6A 4G8BA 2QSJA 2I4RA 3EGCA 2B4QA 2QR3A 3AVVA 1QLJA 3LIIA 3JD1A 3OO1A 3E70C 4I99A 1H5QA 1O0SA 4MB2A 3RS8A 4XEHA 2H52A 4OHYA 3M1YA 3A9CA 3DMRA 2HT6A 2OCLA 1JIIA 4HWKA 4HAYA 4V1CI 4W5OA 1SXGA 4JLSA 4F4IA 1XZQA 4UVHA 1BXGA 2EL9A 1XDUA 421PA 5K3EA 4KR2A 2R4UA 1ZH2A 2BLNA 4OL0A 4EB3A 1RJFA 1X0XA 4JAVC 1Z45A 2IXGA 1JQJC 3C0KA 4R7ZA 4JLJA 4DLKA 2IS6A 2FWAA 1NXXA 1QQTA 1LI4A 3OJWA 4MUKA 1I3OA 2MYPA 3CTPA 1PQYA 1CFZA 3AR6A 3CZPA 4PAOA 4N5DA 5HF5A 4LXGA 2BM0A 2JHCA 2RHWA 5CH3A 4BBAA 1LX7A 5KKNB 2D8AA 1L5KA 3D9QX 2AJTA 1NXVA 3QKRA 4Y6OA 1IY1A 3ISTA 1X19A 1L3CA 3VC2A 2IE8A 3SIRA 1T2AA 3O94A 1VHQA 3HZZA 3M6AA 1C5KA 3CVUA 1RYBA 1O5TA 4KKVA 2GRJA 1JLKA 4MAFA 4ZHQF 2G3YA 3RS3A 2W6ZA 4CM7A 3H9UA 1D1QA 2ZWMA 3A37A 2YCLA 3MTEA 2R47A 4CN9A 5FI1B 3O8QA 5DLQC 3UHFA 1IH8A 1XQWA 3HJAA 5JLJA 3UAZA 4Y6GB 1JFVA 1SUBA 4JLUA 5B7PA 3OE5A 1P1KA 3HFRA 3S44A 3R4VA 5BV1A 2GZRA 1FUIA 1UMBA 1JTFA 4HXFB 3M8KA 2QP9X 1X3SA 3H11A 4JIGA 4CKBB 621PA 1Z5PA 5TY0A 4WMLA 3EUFA 4DBVO 3S2YA 5I9NA 3GEDA 3QPAA 4HB4A 3STVA 3G5MA 4IIJB 4ZO9A 2RC6A 5I5GA 1T9DA 4LQ4A 2UYOA 3P4YA 1NMXA 1VB3A 3CB4A 3LKVA 3IL2A 3ORHA 3ZD9A 3N07A 2J3QA 1QE5A 4AMGA 4V3CA 5IZCA 2QN9A 3H18A 1KQGA 3PWTA 3U3MA 1HQDA 2WKWA 2G67A 3WYEA 5EPOA 1DZ3A 3ELUA 1ZM7A 2QTMA 5PNTA 4EARA 4UVIA 1NG9A 3AFMA 3UCEA 3DDZX 3PQFA 3FM9A 3LOUA 5H83A 5SY4A 1RXIA 2YL2A 2OO5C 2JBAA 3NVKI 3PWZA 4ZT6A 1TGVA 1YQWA 2V54A 4YAJA 2O54A 3LBAA 5JSHA 1AX9A 4M6WB 1OTYA 4JLWA 4PIVA 1S8OA 2J08A 4V0NA 4H7IA 4EHLA 3U44B 4MWDA 4KQWA 3H5AA 1XZMA 1Z2OX 1SG6A 2FMKA 2WYWA 2XODA 2Y71A 1DAGA 4Y9RA 2X86A 4FGSA 3WGVA 2Q3LA 2RGNC 5IG2A 3FTDA 4HJRA 5T3YA 2XT0A 3OLVA 4P92A 2YZKA 3H5WA 3UPUA 2HADA 3RQIA 4MRRA 3IAFA 1OXMA 2IXBA 1D2RA 2NUBA 4B40A 3AM4A 4DLTA 1A8QA 4LDRA 3D3KA 1U9IC 3OHSX 2Q49A 3TQFA 2EHJA 2R6JA 5E6UB 3GEEA 4QJ3A 3X2EA 2FDXA 1B16A 2VSNA 4OB7A 1KZGB 5KQSA 3KZNA 3MT8A 4KI0A 5A6SB 1KR2A 2NUTB 2Q6KA 3IS3A 1YR3A 2BFWA 2WJPA 4G1MB 2AIRA 5EZQA 2HW8A 1EFLA 2C2ZA 1JHYA 1G6OA 1DAHA 2O2EA 2DPMA 4TVOA 1BGWA 3DZFA 3LK6A 4ZVSA 3TLMA 2HA5A 3KB8A 2ZANA 1SXJE 2XEXA 3EZLA 5ITWA 1YBFA 4J3FA 1Z47A 2JGDA 4RK5A 4ZZ1A 3FVRA 1E9BA 1YZNA 4MDFA 2NZJA 3AQIA 1FPMA 4IDHA 1J20A 4HDKB 4Q7LA 1MO6A 1D1SA 2OSVA 2JZCA 1RKBA 1Y6QA 4TL7A 4CMEA 4MEJA 1MQ8B 1SQ0A 1WBBA 2A7XA 4W82A 1TA0A 1C0EA 6CHYA 5JD6A 1K27A 4Q1DA 4RY9A 4OK5A 4YAOA 2QRLA 5ECDA 2ZRIA 2QRZA 1AV6A 5EIAA 2O4CA 4FD3A 4P4GA 2A5LA 4D4HA 3LXXA 4TM8A 3WG9A 2FWNA 4WFIA 5HFAA 2UAGA 3A4TA 3EXHB 4IMPA 1XRLA 3FOBA 4NP6A 2RKOA 2FWMX 4I7EA 4MWZA 3L43A 4E5YA 2JLWA 1RP7A 4M8KA 1FP4B 2XB6A 3TLYA 3W2GA 2VDRB 5DRTA 3ZHYA 5AVSA 3C6MA 2C7BA 4G4GA 1T5LA 1ANKA 4EOGA 4XGNA 4UEJA 1OI7A 4LVUA 4CMKA 3ZIUA 2AFIB 3L46A 4ZQIA 1GEGA 3M9WA 5ANRB 2P9CA 3CT6A 3BL6A 3WSTA 2WUEA 3A4LA 1USVA 2K2QB 3ZIDA 2IP1A 3V97A 3GLTA 4GQAA 1YTLA 1Z0FA 2PG3A 3PIRA 3ZV7A 3EFHA 3E9EA 3OCZA 1A2KC 3A14A 4MNTA 3D4IA 4PN7A 2UXBB 3B3AA 2QVGA 3JSAA 2XITA 1NSYA 3MUOA 4G0ZA 1CLEA 2HLDA 3SVTA 1P2DA 1SVIA 2YBEA 3AGPA 3GUZA 4BS9A 2K7FA 2PUFA 2HA2A 3NIBA 4U2DA 5KTOA 3FE2A 3IYLW 2NNLD 2GWRA 1ZBQA 2WWFA 3FCYA 4M1ZA 3GWZA 2QA5A 3LI2A 4OQ4A 2AJLI 2P1RA 3OA2A 4RSRA 5AWFC 5E1MA 1K5GA 1E7QA 4P4NA 1FXUA 2YWFA 1THGA 3N2LA 4QT0A 4RQBA 4TWIA 2XUQA 3SZGA 5DNUA 3Q5GA 4FX5A 2C3MA 4JUBA 1OASA 1EK2A 2HZBA 4PIPA 1E7SA 1OFVA 3FYHA 4QUEA 3KSRA 3ED5A 4JGGA 5DRYA 5LOVF 1J0EA 1EUCB 1BDJA 2CUTA 4LWQA 4B73A 5KPJA 1P45A 1H4SA 3DR3A 1PAUA 1QHYA 3BZWA 4BXOA 1GTZA 5AM4A 3VO9A 1SVWA 1K68A 1I2CA 3PHIA 4P5PA 3HZOA 2GEUA 4M0PA 4KVGA 1XEWX 2XIQA 3DQZA 4OX9B 3K5IA 1THTA 3D6JA 2PGNA 3GXBA 4MV0A 2BF7A 3UJBA 2WWGA 3V1KA 1IULA 2NTVA 3CUUA 5K8LA 4DNPA 5ALVA 1N9ZA 4AG3A 5AM0A 2PSJA 1DC3A 3E6AA 2NYUA 3MPOA 1PJLA 1YUBA 5A04A 4X20B 2Z8XA 1NF8A 2WKRA 1U94A 3VZQA 3EUWA 1USWA 3Q3JB 1ZVVA 3OKFA 4LK2A 3GK3A 2DBVO 3LQ2A 5DOVA 3CO5A 3MJ4A 4XVRA 4ILEA 2ROQA 4E5SA 3V1UA 3HR7A 1P18A 3EASA 2CYAA 3Q3GE 1KBQA 4U7DA 1W76A 2JAPA 4HWRA 4NIMA 3R4CA 4D96A 1JAZA 5I45A 1VPWA 3IT1A 3TCNA 5IANA 4L8YA 4N47A 3S3TA 3T7IA 1M1XB 3HMKA 1NIJA 2PR7A 3QK7A 2CVFA 2HUPA 1CDOA 3BD9A 3TFWA 2VYQA 1S02A 3BA1A 3N8DA 1EBUA 2GAJA 1DQZA 3RTDA 4FCCA 3ZR4B 5C5DA 3BN3A 5KNDA 3F71A 1P2BA 3G9QA 4J43A 4BDTA 1V7ZA 4FB4A 1C9JA 4INZA 3BRCA 5GM2A 4EFNA 4PCAA 1RCTE 4QYWA 4ZQCB 5KNLA 3R7DA 1OKKA 3TCXB 1KBZA 2HDWA 1OB5A 3QSGA 4PLCA 3ZU3A 1I36A 5KJ6A 3A1EA 2QZSA 4BU0A 3MCUA 5JU6A 2QRVA 5GP1A 2RAFA 3PC2A 3CN9A 3P9KA 3K0KA 1H93A 1C7EA 3GPIA 1LQ2A 4K40A 4G5SA 4KR9A 2RE8A 1GA4A 3WJAA 4OMUA 1M75A 3GG9A 5HJ7A 3PE4A 2H5EA 1HYQA 4D41A 4F60A 3SHTA 2UUAB 1NI4B 2FFJA 2H2GA 3NBKA 1QLHA 2CZQA 3K2QA 3WK9A 5IH7A 3B53X 2G5TA 3BYZA 4OH7A 5SZJA 4Z1MD 1AD2A 1QBGA 4Q4HB 1JG4A 1U2GA 2QBYA 4QASA 5J47A 1DKPA 4O2AB 2BMWA 3LKDA 1I14A 2MJLA 3WLNA 4FZJA 3OEWA 4E0BA 3DCNA 3RVRA 4YRLA 3IE0A 3JQ9C 2IEGA 2FMUA 2QAGB 3G89A 1NVKA 3UWKA 3ADBA 1E1QD 1BAPA 4L08A 2ZIAA 3ZY4A 4HNTA 3L7YA 3DDHA 2X9QA 1RZRA 1EM8A 2IYLD 1KZ4A 2YMMA 2FNAA 3DFMA 1TO6A 1X1SA 3VYRB 4DLBA 1ZK3A 1T8WA 2WFZA 5FXMA 3ZIAA 5A62A 5TT0A 2AVNA 2WNHA 1I7QB 1JEDA 5JMOA 1VE6A 3QKWA 2ORIA 3EBLA 4MK4A 4LRUA 1SUEA 4ZALA 1YFJA 2TYSB 5H80A 2X2OA 1MG5A 4NDNE 1I2AA 4KLRA 5HMLA 1ISPA 2W58A 3ENZA 4FUQA 3ZVRA 3SICE 3LBHA 1SD1A 4FMDB 2HAEA 4GC9A 4N3CA 1Y63A 3L8YA 5D8DA 1ZZEA 2GLUA 3CX8A 5DBHX 3HVJA 2C5FA 4HLNA 3E1SA 1O6ZA 4ZOLB 4QLAA 4RTSA 2GT1A 3JQAA 3U4CA 2G9RA 1O95A 4RTPA 1ZSVA 3B85A 5M5BA 4AU1A 4D3XA 2EW8A 1E5TA 1WLSA 4OY3A 3DHEA 4B9EA 1E9SA 1UZAA 2WA1A 3NOQA 1J1UA 1QPBA 4QIHA 4C7OA 1SXJA 2ID7A 2YQ5A 5CITA 2FMIA 4FEEA 1SAYA 3QWIA 3A36A 4B45A 1J2RA 1K5PA 1T8YA 2JDID 2VA8A 2ZS9A 1D7AA 3RF6A 2XQIA 5ITVA 3PHHA 3I6YA 3LSTA 2J33A 1T2CA 4UDXX 4F4UA 1PIWA 1ZJJA 2QNIA 3FWPA 4GXNA 3QX8A 3EW9A 5EMMA 3C97A 1Z4LA 3PQDA 4IHAA 4NDAA 4X3PA 5EEGA 1E8DA 5T4EA 1G38A 1M2KA 1TB4A 2FHPA 3BL8A 5AKYA 2Q9AA 3PDHA 1Z7BA 4ZKDA 1RJEA 3K92A 1KJYA 3CSUA 4FW8A 1HA3A 1YFKA 1AT1A 3GFOA 5K6AC 5AHKA 3WYBA 1PYDA 1QIGA 2DUNA 2GXUA 4HDMA 4CW7A 1QM5A 1U1GA 3HDQA 4Q16A 1Q1NA 2Q3EA 3T5BA 1H2RS 3BMNA 3MJTA 1NBIA 1TDJA 1RAIA 1JDJA 3HNRA 1V11B 2FN3A 2FUCA 3JYPA 3QG1A 4JJKA 1BCRA 2IOFK 3NHUA 1GU7A 2DQ4A 3WGZA 4A8JA 5GTDA 1SOAA 1UKCA 3CBGA 5MFPA 1C8KA 3I2YX 2QAIA 2RGXA 3DOOA 821PA 2WK1A 5AKHA 1KERA 5G41A 5MFZA 1OH8A 1ONOA 3WBJA 1ZWLA 2FSIA 2CSXA 2HDOA 1KJIA 2CE2X 2Z98A 4G24A 2WFLA 1AMUA 4HGRA 2IQ5A 4FNMA 3U3ZA 1IBKB 4V0KA 1VPLA 4JUIA 4OSOA 3A4MA 3L3BA 4QLOA 5AVUA 1UZNA 4RL6A 4AY5A 1FU8A 4XOIA 4NK5A 4YXFA 1TMGE 4G36A 2V98A 4BNLA 1L5MA 4H77A 3HO1A 1FU7A 1M6VA 1XTQA 1UDWA 3L7OA 4K28A 5SYNA 3MXTA 5CXXA 3V7YA 2G72A 1U7ZA 2WRZA 2BUCA 4JZKA 2ONKA 1HMPA 5TEVA 1X14A 2D5AA 4UARA 5DKFA 3ZN2A 5IJ0B 1PG2A 1ZA1A 1J8VA 5T6MA 5LXTA 3OESA 3QLUA 3JYLA 3ZI7A 1PBTA