2IPAB

Solution structure of trx-arsc complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
139
structure length
139
Chain Sequence
MENKIIYFLSTGNSARSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLSGDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational fluctuations coupled to the thiol-disulfide transfer between thioredoxin and arsenate reductase in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Electron transport/oxidoreductase
molecule keywords Thioredoxin
total genus 48
structure length 139
sequence length 139
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ipaB00
3JVDA 2E4WA 3KJXA 4MR7B 4RY9A 4XFKA 5DLEA 2H0AA 4N0QA 3QLUC 3EULA 1MIHA 3EQ2A 3TX6A 1T34A 1Z2DA 2FSPA 4MS1B 3FFXA 4DQDA 3F73A 2PUGA 5JS1A 3OLYA 1BDIA 4F3TA 2RJOA 4G0PA 1E6MA 1URPA 3KKEA 3HS3A 4RWEA 4OG2A 4Z4CA 4YP9A 5JNSA 1JH9A 4ZMRA 1JX6A 4RS3A 3EDCA 2FQWA 3O1HB 5FWYA 2MYUA 3TO5A 2R48A 2F8TA 1MB0A 3KCNA 1GCGA 3NHMA 1TM2A 3DGEC 1JDPA 5TE9A 1TLFA 1SD5A 5KQGA 5KQPA 4RXMA 1Z12A 3CFYA 3QLVA 1SRRA 3LMKA 4MLDA 4RZSA 2YHBA 2PE5A 3O2JA 4MAAA 3EAFA 4D74A 2A9QA 1EAYA 3CLKA 1U0SY 1VKRA 3MIZA 4W5OA 3TB6A 3NNNA 4G86A 4KQCA 4RK4A 4W5RA 3D8UA 1JYEA 3S99A 1PUXA 2YHAA 1ZN2A 3LKVA 3MM4A 1YVUA 4H60A 3OQOA 1KGSA 4MYRA 1JWLA 3NNDA 2QVCA 1RXIA 3R0JA 1QMPA 4N76A 1FFGA 3H5LA 4IILA 5B3JA 1C0EA 3CZCA 2PAFA 1ZH4A 1E6KA 3O21A 4G0YA 3IDOA 5EWJB 1OXKB 5I4CA 2CWDA 3N53A 5KQLA 1EWVA 1Z13A 5D2CA 1JBEA 1PNTA 2JRLA 4ML3A 1LK0A 4RKQA 5KC8A 5HM6A 1DJMA 4ETMA 4JB2A 1JLKA 4KRFA 3A10A 1RNLA 1LBHA 3OM1A 2A9OA 4G0OA 4KVFA 3KYJB 3G85A 4RDCA 3KLOA 5T3YA 1YMUA 2R47A 4YR7A 2B4AA 3T6KA 3A0UA 4P98A 1D5WA 2X7XA 3F7NA 2ID7A 3C6QA 5F64A 1TVMA 4OBBA 3CG4A 3RVPA 1ZHHA 2FN9A 5FWXA 5TQJA 4MQEA 4EYKA 5IUJC 3KLNA 1PHRA 1SXHA 2FN8A 2IPAB 3IP6A 1F4VA 2IOYA 3LUFA 3MF4A 1BA2A 2QV0A 3QELB 1QO0D 4D6YA 2LBPA 3KYIB 5BQ3A 1QP4A 1BAPA 3QX9A 4W5NA 4IMJB 3M9XA 3ILYA 1ZH2A 2NUBA 3LUDA 4E7PA 1LBIA 1FFWA 5JNTA 3OLXA 4MLCA 2NT3A 1YIOA 5IEJA 3SAJA 3IP9A 1UDRA 3M9WA 3OMXA 1NTRA 2JVKA 3MQ4A 3JPYA 5HKOA 2IYNA 1KRWA 5T7BA 4N41A 1OXBB 3KS9A 1QP7A 4TN5A 3RVJA 1USIA 1A0OA 3JVIA 3OO1A 3LFTA 5TQ2A 4DN6A 2E4ZA 5FWXB 4WZZA 5DGCA 4EY3A 1CYEA 2LPMA 4Y9TA 2PLNA 5CNJA 4E7OA 1GUBA 2FMKA 3H5TA 4PYRA 5EWMB 1NXXA 1Z17A 2CHEA 3QEKA 5KQMA 1FQWA 4MRMB 3EJWA 4WWHA 2L19A 5B3JC 2RDMA 8ABPA 2A9RA 2MSLA 4MR8A 3T38A 1W25A 1R8JA 1ABEA 2R4QA 2QXYA 3EGCA 3Q7SA 6CHYA 1USKA 2MYTA 3HSYA 3UK0A 3LUCA 1ZVVA 3RVQA 1P8AA 3GBVA 3FDFA 2DRIA 2IDMA 5JS2A 4MR9A 3H5VA 4NCBA 3C97A 1I3CA 4NICA 5TPZD 4Q7EA 3TMYA 1APBA 1P6QA 3E3MA 4MQEB 1ZDMA 3LKBA 1E2BA 4F12A 4LDAA 3OMWA 3VNBA 3H1EA 3UKJA 1QPZA 1TMYA 1GCAA 3BBLA 5IULC 1GLGA 4UHKA 4RK5A 4RK6A 4Q6WA 2JCGA 2VYCA 5GOTA 2IPLA 1M5TA 1M2FA 4HNSA 4LRQA 4S04A 1QP0A 4MPTA 4TMYA 3QELA 4FB4A 1EWKA 4LX8A 1M5UA 3GRCA 3C3KA 2RJNA 5ABPA 3BREA 1B00A 1NY5A 3IPAA 4YV7A 4LZLA 2FMIA 3HDVA 5CNIA 2E4XA 1W9HA 4PZ0A 2FMHA 3SNKA 3RVLA 2FEWB 4MS4A 2P4UA 3GL9A 2PUEA 2VUIB 2JVIA 3KHTA 3A0RB 4KQ9A 1DBWA 3CRNA 4N47A 2FQXA 3K4HA 4NQRA 4FE4A 1Z15A 2PL1A 4QYMA 2ID9A 3CS3A 4WT7A 2LIVA 4RXUA 4ETIA 4JASB 3URMA 2WJWA 3NNSA 3HV2A 1JFSA 3TD9A 4KK3A 3K9CA 4H3KB 2M1ZA 3F6PA 2JBAB 5ED4A 3DGFC 4KV7A 1DBPA 1EWTA 4GNRA 1ZESA 4Z99A 4YS6A 2JVJA 3CNBA 1Y1LA 2N9UA 3JTEA 3GBPA 5IEBA 1JL3A 1NXSA 1Z2EA 5TPWA 1PEAA 3QK7A 2HSGA 1ZGZA 4ZMSA 1FSPA 1D2AA 3H5WA 1MAVA 1RZRD 3M6MD 2HPHA 3O74A 4IRXA 2OQRA 3C3MA 3N0XA 3JS5A 4Z0NA 4Z4EA 1YMVA 3GT7A 2WB4A 1J56A 2RGYA 3SM9A 5IBQA 2WMYA 4L85A 5FBHA 1QNLA 1C4WA 3LUGA 3DBIA 4RV5A 2IPMA 1YTUA 3RH0A 3NHZA 1ISSA 4LE1A 4EUKA 2KYRA 2AYXA 4CBVA 2A9PA 1DC8A 4KNYA 3BRQA 3I09A 1DP4A 1A04A 2L17A 2P9HA 4H3HB 2B1JA 2VK2A 3H75A 4LE0A 1DCKA 1CEYA 5IX8A 3OLWA 1ZY2A 1JDNA 1QQAA 3BRSA 4XXHA 2H3HA 3H1GA 3Q15C 4S05A 4XARA 1DZ3A 5JNWA 3HM9A 1DBQA 5BRAA 2JBAA 3O1IC 4O1HA 1U04A 1U2QA 4PE5B 3N0RA 3O2QB 4RK1A 4TLLB 6ABPA 1YK0A 1NXPA 3P9YA 1BDHA 4M88A 4G0XA 5DTEA 5FWYB 2PUCA 2O20A 5CNKA 1NXTA 7ABPA 3GA5A 3Q7TA 2JB9A 3EODA 3FGZA 2QVGA 4MS3A 4O5AA 2PUFA 1AB5A 5KI6A 3H5IA 4YWHA 1QQBA 4DADA 3HDGA 1DC7A 4OLBA 3RVNA 4KMRA 4D6XA 3GWGA 5HSGA 5EWMA 3H6HA 4F8JA 4B09A 4YRZA 2WWVD 1PNRA 3O1JC 4QPJC 1FFSA 1JYFA 1SXGA 2WRZA 3MA0A 2GX6A 4RXTA 4P1ZA 2PUDA 3FFTA 3T8YA 2FQYA 1RXEA 5EWLB 1ZITA 4RKRA 4EVSA 3CU5A 4WXEA 4WXMA 3W9SA 1QKKA 5E3JA 4FE7A 3ROFA 2CHFA 3GV0A 2V0NA 2QSJA 1U8TA 3N75A 4EVQA 1ZAYA 2F8SA 3HJFA 2MYNA 1JHZA 5GQSA 2LP4Y 4EGSA 5IUNC 2NZUG 4KPYA 2M98A 4KFCA 4MQFA 1LJUA 2HJ9A 3HVRA 3F6CA 4JA2A 3QEMA 1IIBA 1RPJA 3Q41A 4YO7A 1P2FA 1ZGGA 3QLUA 4KZKA 2TMYA 1BDJA 4KREA 3T95A 3QX8A 1AB6A 5TQ0B 4MS3B 1NXOA 1Z18A 2FVYA 4F06A 3LUHA 1F51E 5JNUA 4ZYLA 1QO0A 4PICA 2Q5CA 4G97A 4MR7A 1SXIA 2FW0A 1NXVA 4QICA 5CNMA 3N8IA 3HK2A 1VLZA 2GBPA 2QW1A 1YK1A 3LUAA 4RK0A 5TPZA 4EYQA 4Z4FA 1H9CA 3D02A 5DCLA 5KC9A 2PMCA 2GWRA 2IPNA 2JK1A 5C5CA 4WUTA 4L4UA 3HO1A 1XHEA 1RZRA 1LJLA 2QU7A 4Z9AA 2FTKE 1P6UA 1EFAA 2E4VA 1CHNA 4YGXB 1NXWA 3KSMA 4XLTA 2W42A 3ILHA 4OATA 4NCAA 3VNAA 1JFVA 2MSKA 4MR8B 4G0MA 5TQ2B 2NT4A 3BILA 3CKMA 1DRJA 3CTPA 1XHFA 4F11A 3H1FA 5JNRA 2HQOA 1U2PA 1USGA 4HNRA 5CHYA 5DKFA 3ROTA 3LOPA 3OQNA 4G0QA 1JFTA 3O2SB 3JPWA 2AYZA 5BR1A 5TPWB 4GPAA 4JOQA 5EWLA 3N6VA 4MRMA 4YCSA 3HEBA 5IC5A 3RVMA 2VUHB 3MYYA 3OQMA 5KWSA 3HUTA 4O1IA 2BGGA 2GKGA 2PJUA 3I5AA 2MYPA 4JB0A 4W5TA 1D1PA 3SQNA 2FKAA 2FLKA 3LUJA 4LE2A 2PUAA 1D4ZA 1L5YA 3IP7A 2HQRA 3O75A 2QR3A 3HXMA 4G0ZA 2PL9A 1K66A 4Z4HA 3A3KA 1DCMA 3JY6A 5BRJA 2IKSA 2MSWA 3I45A 2FEKA 4JP1A 1S8NA 4TLMB 2R25B 4PEVA 4ZJPA 5TQ0A 4IMIB 1Z25A 3LUKA 2PUBA 5EWJA 1VPWA 2NZVG 2L2QA 3QLVC 4UHJA 3RVSA 3FFWA 4N0PA 3OO0A 3L6UA 3QEMB 4Z4GA 4EYOA 4RSMA 5PNTA 1L5ZA 1MVOA 2QZJA 2WY2D 3MMNA 3DLBA 4Z9BA 3IPCA 4JAVC 4ZPJA 4XAQA 4EVRA 1E6LA 1BVHA 3CHYA 5FBKA 4ETNA 1KRXA 3HZHA 3Q9SA 3NBMA 4MS4B 1XWWA 4XASA 3GYBA 3E61A 2FXIA 3HUUA 4OTZA 2PKXA 4Z4IA 1MB3A 3RVRA 2E4UA 2LUOA 4KK4A 4EYGA 1Z26A 2HQBA 3I42A 4RU1A 5IUKC 1DCFA 1A2OA 2ZAYA 3H5OA 3N0WA 1DG9A 4IGAA 1YS6A 3SG0A 5C5EA 3EQZA 1DRKA 2FEPA 4MS1A 4N03A 4QYWA 4OLAA 3DZDA 2FMFA 2L18A 3L49A 3RQIA 3QLTA 2GI4A 1WETA 4YLEA 1TJYA 2E4YA 3OM0A 1ISRA 1HEYA 4NV3A 4Q6BA 3FMVA 3SY8A 3LTEA 2FLWA 2CD7A 3CZ5A 3Q7RA 1KMIY 4RY8A 1K68A 2WJAA 4HNQA 3DLHA 3OLVA 4MGEA 3H6GA 3UUGA 2I6FA 3KG2A 3HCWA 1YS7A 1VRVA 3CG0A 3C3WA 4RY0A 9ABPA 2J48A 1JF8A 4MQFB 2OENG 1ABFA 1M2EA 2ZWMA 4MR9B 4RK7A 2XDYA 3KTOA 5HQJA 3G1WA 3RVKA 1PEYA 4HYEA 5JNVA 1GUDA 1NATA 1Z16A 3IP5A 1D1QA 4LDZA 3OLZA 4W5QA 3RVOA 3B2NA 1EHCA 4IF4A
chains in the Genus database with same CATH superfamily
4D3DA 2FPIB 5ALLA 5DLEA 3E9CA 4E5PA 2IUEA 3NXSA 3SQWA 1HNZB 1Q1AA 1NVVQ 2B7LA 3ISTA 5ALOA 1WPGA 4S1TA 2PQ6A 1OFIA 4IDOA 4INZA 4U02A 3UYKA 2I3DA 1G4HA 1R6BX 2NXJA 2OG2A 3N86A 3VVBA 5GONA 1C0LA 1T5LA 1C8KA 1X39A 4N54A 5JBQA 2NSJA 3G5TA 5ALFA 3IPXA 5K0EA 1H8ED 2VQ6A 2AH5A 2P27A 3EDCA 1OREA 3ASYA 5LA6F 2GJSA 4DGQA 1IDN1 2MYUA 2W5UA 4XLLA 5BSEA 2RHLA 4CKEB 3A9WA 4MWOA 4U5XA 1B6RA 3GVIA 2X2EA 1PWZA 4DIBA 1A9OA 1SULA 1TLFA 2V7BA 4GVLA 5KQGA 2Y9MB 4XSHA 5C1DA 2PU5A 4N5NA 1ADBA 2AN3A 2CXNA 1NW9B 1V2GA 3THWB 1YR3A 3DE7X 1KE2A 1GG5A 1L5MA 1W6UA 2W2QA 4YRTA 1ZMBA 2G40A 2PN1A 5LQCA 1HFKA 1LLCA 3P4YA 4R40A 4XIYA 4Y6QA 3FI9A 3O47A 3PXDA 3P0EA 4MB6A 1VYTA 1QV6A 4HEA6 5FQOA 4Y2SA 4MTLA 2ZOSA 5IM4A 1P33A 1CBUA 5CGZA 1VYHA 3I9KA 4G86A 5IHPA 1KVRA 1EJ2A 1EP9A 4W5RA 2ZJ2A 3KC2A 1SQ0A 4ZCPA 3VXKA 4AZ0B 1EG7A 1O4VA 3SFTA 4BBJA 1EPUA 1RE1A 2NO1A 2R5WA 5HOQA 1J8FA 3NNDA 1M33A 1T3LA 2GARA 2A5DA 3G8AA 4HYYA 3VUEA 3LHDA 4BU1A 4ETWA 1DPGA 1BD4A 1GT6A 2GBFA 3G6KA 1XQ1A 3H5LA 5B3JA 3QLJA 1ZH4A 2HV8A 1CEQA 2R00A 3QHAA 1G5QA 5IDXA 4HFRA 3B82A 2XR1A 4GLOA 1J5EB 5T8KC 5D2CA 4LDJA 5L3RA 1PNTA 4KYUA 4KHPB 4CF7A 3SHWA 3DXYA 2X6RA 1YR2A 3PQEA 4RF5A 5TLSA 3A4YA 5DGDA 1C9KA 5IDQA 1Y3HA 1RXSA 1W34A 3DDZX 2IYUA 4C5BA 2AXNA 1NBME 4OQLA 3F9RA 1YMUA 1V39A 3WLAA 2ODWA 3ZHZA 1C7IA 4P98A 4BFSA 2VJNA 4X95A 1KIMA 3IDZA 4KXXA 5BMVF 1NSTA 1SUCA 5LXTF 3V1LA 4PRYA 1WKBA 3EVEA 5GIOE 2ID7A 1RXWA 1LW6E 2VDJA 1ECPA 4ZALA 2ZSUA 1Z5PA 1G7CA 4PV7A 2DKOA 4XQEA 3FIJA 3I8SA 3MMPA 1CY2A 5FT9A 4O02B 2WNSA 5DN6D 1QO0D 1T8YA 4OSPA 2BGLA 5K0TA 3E27A 4J8PA 3GLFB 2FQ1A 2JLVA 4HH4A 4FLFA 1W29A 4B6EA 4O2RA 3N2KB 4UXIA 1XLUA 3CVWA 2NT3A 1R5NA 3CT6A 1UM9A 1UDRA 5JWRA 3DMTA 4BZPA 1II8A 4CLRB 2X0KA 2NU7A 4XVQA 5J1SB 1JAHA 3Q0IA 5JYCA 4J7CA 3KSZO 3JVIA 3OO1A 2DMRA 4BNFA 1ORVA 3Q7PA 1XEAA 4ZRNA 2BUBA 3JQRA 1CYEA 4F2WA 4UDNA 3NYWA 2H5LA 3PNPA 1ZUNB 1DL5A 3BWBA 5NULA 4FYIA 1U9ZA 4H9GA 4QGAA 5DBGA 4DBLC 2ZBRA 5CVDA 5AKXA 4AP5A 2WU0A 3H9GA 1E20A 3DH0A 3IS3A 4HFMA 4PZPA 1K7XB 4R3NA 4WWHA 1IPFA 5SYAA 8ABPA 2MSLA 5H8WA 3STUA 2ZJFA 5T4HA 1R8JA 1ABEA 1M6WA 2Q5HA 4PZEA 5K8TA 1CFJA 1PS9A 4COOA 4ZGGA 1IXSB 4L5AA 1JEYB 4UEWA 3RB8A 3OCYA 1JKJA 5JV5A 1V26A 3H4TA 5BQ5A 2P1RA 2X8BA 1RHMA 1R27A 3TMYA 1APBA 3IAS1 2XYGA 4EPTA 5AW3A 1OGYA 3QU2A 3OMWA 4C76A 1KYZA 2ZRHA 1J9EA 1LQTA 1K6JA 4M1WA 1NC3A 4IIVA 1EE1A 4NIMA 3ZGXA 4AQDA 4WLVA 3RARA 5FOWA 3UBTA 3RF6A 1IMOA 4EFNA 4MO2A 4YR9A 2YWFA 1U8YA 2YJNA 1XXHE 5BUQA 2YZGA 1M83A 4NZPA 3INNA 1AK9A 1QP0A 4RVHA 4H1VA 2WUGA 4TMYA 1CVRA 1NDUA 1XDUA 3ZWNA 1PT9A 1C0PA 4FB4A 3QEJA 2XNDD 1N2XA 5F23A 3N8DA 4DLRA 5DM1A 2CBXA 1H2FA 3FZGA 4HXYA 4G63A 1L7DA 3AOEA 4Q1AA 1ORWA 1EQUA 1H1TA 2IP1A 1OBFO 1NR1A 1WDKA 3KWLA 4RNDB 4YP0A 5HBRA 4EPRA 5AIAA 4CQMA 2V7XA 3HJBA 3NI2A 2H4HA 2PKQO 1O89A 4MJXA 4XTRA 3WC4A 3ACDA 3SNKA 3AESA 4GBMA 4WPGA 5IYZF 3EWNA 1RADA 1FX1A 1FTWA 2HRRA 3G8BA 3C7TA 3HB0A 4FE4A 1H1DA 1QCCA 3G89A 4PW0A 4UZEA 2DKNA 2M1XA 5I4KA 5LOVF 1ZM3A 1J7JA 5KTTA 4DIDA 4IWYA 2RGUA 1HDEA 3GVCA 1EIWA 1Q0QA 4M99A 3NNSA 1Q3HA 1FMTA 4WOJA 3HB9A 2H08A 2M1ZA 1NF8A 1I0LA 2I8CA 2J7KA 2O48X 2XCOA 3BXHA 1XPJA 1ZJ5A 4QZVA 1HZZC 1RYMA 3JWPA 3R4CA 5BNIA 4Z99A 4L27A 3AEYA 3FRIA 1PIWA 5CIWA 1DBRA 1H2WA 2DPXA 5IEBA 5KYYB 1NGSA 2OO7A 4LTNA 1Z2EA 4C29A 1HE1C 1D5CA 3ROKA 4ZMSA 3DKVA 3FA2A 1L5HA 4P7KA 2D7CA 1Z47A 5DNUA 2VTBA 1AF4A 2G5CA 4KG7A 3JQFA 4YMIA 2OHGA 2IDZA 3WQQA 3N0XA 1E99A 4BO5A 1Q0ZA 5LQAA 3NLLA 4FIZA 3FZYA 3OZTA 2GK7A 3MTQA 4I5GA 4F21A 3LL4A 4OMDA 1V48A 2O6LA 5ES4B 4L6IA 1CY8A 4NCXA 3TKYA 3ESRA 5CW1A 5CCXA 3IBTA 2XQGA 5KNCH 1OILA 3GUUA 4IQ0A 2Z4TA 4E46A 1ZICA 4Y6LA 1OQAA 3GA7A 1UAGA 3A2KA 1QONA 4ZK6A 4FZ5A 4K86A 2A1UA 2VNAA 3H6KA 1L5LA 4RYDA 1RKXA 3RV4A 4NYIQ 4RH0A 1LDEA 2GXSA 5GAJA 3SKXA 5CDFE 3GT0A 3I52A 2GASA 3V8MA 1KH3A 3I6BA 1AZWA 5K6RA 4BLQA 5ADUS 4TSKA 1E5XA 2B34A 3AQIA 3PQ3A 4MPJA 4KUGA 2JCXA 2BMDA 1K8QA 3WZ2A 1CU1A 3QPUA 2B9EA 3DFFA 4IDFA 5K3FB 4D4LA 1KSGA 4ZDIA 1EP1B 4V2UA 4N0MA 1N6PA 5B6JA 3IBYA 3INRA 3T1OA 2IZ5A 4C06A 2XDWA 5IKPA 2PSSA 4LYDA 3KZOA 4RHTA 3BIOA 3CYFA 4U2KA 2VH2A 4IW3B 2VZEA 1IBSA 4YDSA 4C3OB 2NW6A 2ROQA 4QE3A 3KOUA 3SHFA 1G18A 1MRZA 2AG5A 2HBYA 2YNMC 1C8LA 2IY8A 3EY9A 2O8CA 5C1BA 3PA6A 2O20A 3PRJA 4X1OA 5ITWA 1MH1A 1QDUA 5B4TA 4O5OA 4DYDA 2Z1DA 3KKPA 4H3SA 3Q7TA 3UMVA 3AETA 4ZKDA 4HVLA 1PUJA 1DOZA 3A2NA 3KVVA 1LPOA 2H5IA 1Z0SA 4RPHA 1AB5A 1UPXA 2I3BA 2Q0XA 3RJTA 2O5CA 1OLSA 2O7RA 5DM2A 3RC7A 4HUJA 4EA6A 2BV3A 4BNLA 3P2KA 3WNQA 2WYVA 2OGWA 2P5YA 3RS9A 1KHHA 1X9IA 2PWYA 4WX2B 5AK6A 5HSGA 3O8BA 4OD0A 4B09A 4AZWA 2GN1A 5JAMA 5K0SA 4B35A 3VX3A 2VHQA 1MAAA 5EESA 5KOHA 3C14C 1CUSA 5FX2A 1UMDA 2INGX 1UAAA 5J5AA 4CNQA 1E3DA 2UDPA 2H0QA 3W8RA 4RKEA 4OHZA 3DLTA 1CC1S 1Z4PX 4N3GA 4OHWA 4C7BA 2YUIA 2OWDA 4RZ2A 3JCZA 1KWGA 1D03A 5F51A 5IVKA 4TTTS 3OKCA 4N5LA 5ALXA 4DMGA 2CDNA 3SPXA 3DVRX 4YMGA 3RIMA 2IYRA 4BMDA 4CLEA 2VEDA 3QFCA 3LX5A 1G4UR 2R62A 3TQSA 3WWEA 1T4CA 1TXGA 1FVOA 3NUQA 5I51A 1N5RA 5FR1A 1RPAA 4UUQA 3GLGA 2QD1A 4KPYA 4UAGA 1E9AA 1U3WA 2CL5A 4OH1A 3PE3A 1YF3A 3QUQA 1CY1A 3CEMA 4TKUB 2QAGA 4YO7A 2YTZA 1UWCA 2PT6A 2YVAA 4HI0E 5HS6A 3DMGA 3BXOA 5DYTA 1Q3TA 4PBTA 3ZG6A 4ZI3A 2FSUA 2DQSA 4FMBB 3ZKWB 1OYOA 3C3YA 3P9XA 2B4YA 4UATA 5EA2A 4FWTA 3R24A 1K8YB 1TUBA 3BSYA 4H4CA 4LCEA 3C8HA 4QAJA 1MJGM 4Q5IA 4JLJA 4F6LA 2F1KA 3WIOA 4D81A 4ZVQA 2AMLA 3OIFA 4JLVA 4EJMA 3EUWA 1P4HA 1ZC3A 3EE6A 4PAMA 4RC9A 1XZGA 3KOYA 4GLLA 5FLYA 2G17A 1EH5A 3BEDA 4UREA 2Q7XA 2FVXA 1Z5VA 1N2CA 4MVJP 4A73A 4OHRA 1CRQA 1IVNA 1TB4A 2CUTA 1MAHA 2VEOA 1O54A 4MKZA 1ZUNA 4NLLA 4YFYA 1B76A 3AQ4A 1XXHA 3V1KA 4EI9A 5H59A 4LF8B 2NP7A 1TPZA 3M34A 4TKUA 1HYEA 1L0BA 1K2VN 3RROA 4DRXA 2V1UA 1ES9A 4UXJA 3WDLA 2XUZA 3O4IA 4EW3A 1UEXC 3ND7A 3D2CA 2L0XA 3TIFA 1A27A 1TO2E 4IOKA 1KO8A 1XV5A 5J9FA 3RYFA 5A7FA 4HNRA 1EKXA 1H0HA 2VG8A 1E96A 3LOPA 5BSTA 4BIMA 5KUTA 4MEJA 4OP1A 2R9VA 3PPWA 4PONA 1I5OA 2JIMA 2OAP1 3L41A 4UPDA 3KHKA 4BO2A 4DPMA 4MRMA 1X7DA 1KARA 2PPLA 1QO7A 3HUTA 1BKSB 3GCGA 4LOKA 1GG9A 3RAPR 3T3IA 4CT4B 3AX6A 4JC4A 3I58A 1KOGA 4LWZA 1LVUA 3EIQA 5K4AA 2WC1A 2C4MA 1I1NA 1W35A 1D0SA 4LNUA 3TCXB 1FDTA 5K0FA 1PUIA 1ACJA 1WLYA 3F90A 5TMEA 3L7BA 4D9MA 4RPLA 4I9HA 4JBWA 3X44A 1QR6A 4ZU1X 3VYUB 4P35A 5SV2A 4Y9SA 3L92A 1NW4A 3JY6A 5TGDA 2AJCA 5K2MA 3S40A 1R50A 3ILVA 4CMEC 3WP1B 3Q5DA 5B1IA 1Q12A 4KJZA 1L3IA 2A7QA 1JDJA 1UBMS 4I46A 4WNYA 1WSDA 3O84A 1EUQA 2FDCA 1VPWA 2XE4A 1VKNA 4NOLA 1JXMA 1V25A 2X8JB 2ZGVA 2GEUA 1YE8A 1PX0A 1RRPA 2Q2OA 3B2QA 3DVAA 4LK3A 3QVOA 2Z3VA 4N0PA 3HACA 2FFHA 3IALA 3OFJA 2A0WA 4AURA 3I62A 2ZRFA 5EIWA 2AE2A 2PS0A 5GGXA 3IUNA 3U44A 1RVV1 2H07A 4G1BA 3IPCA 2X9GA 4JX9A 3ITKA 3KBOA 4PM4A 3IP1A 4OGWA 3ZWOA 1UP4A 2GM3A 3I6IA 4DPKA 1SC6A 3Q9SA 3AM1A 1DKLA 2EC5A 1E6UA 4LBYA 5FOUA 5JD3A 4B3IA 5KB3A 7MHTA 2XUFA 3JQFC 1G5TA 3HQ4O 1G6OA 1YIAA 3C7CB 4KK4A 4UUPA 2VRCA 3V42A 4GX5A 2EGUA 4AZVA 2H92A 1T0JB 4TMVA 1A9PA 2QRUA 4UKDA 3F6RA 4CT0A 4EX6A 2WJPA 3DE1X 2TMGA 1V8PA 4J6FA 3P9SA 4V0SA 3AUTA 2B99A 2AOUB 1EJBA 3E35A 5TGZA 3U48A 2AK2A 4LOJA 3PI6A 4BQPA 3NV9A 2PVCA 2COUA 2IX3A 4KR0A 4OLAA 3OZIA 3GZJA 3ET4A 4GHWA 3U4QB 1JIQA 3ZY4A 1E1LA 1H1LB 4LN1A 5DXFA 3EF0A 1JYSA 2W0SA 3LY5A 2CZGA 1QV9A 1UBLS 4LX0A 1J0BA 1NBWB 1WXGA 3JQ8A 3OM0A 3F1KA 1ISRA 3F9IA 4WBNF 2WYWA 1S1CA 4GP6A 3CLRD 3LTEA 3SY8A 5KPDA 1SKYB 3LY8A 4O8CA 4RY8A 2RCYA 3ND5A 2IU6A 3PCRB 1P31A 2RHWA 3LD9A 4HDKA 4L2IA 4MW9A 5A4KA 4HNQA 5BNFA 3DLHA 2VTBB 1SCIA 4H1HA 2FX5A 1QUFA 1XSEA 5BW5A 1XNRB 1G9XA 3RIGA 4AD8A 1SQSA 1G7SA 4KQFA 5I8WA 4EENA 4JP5A 2JPDA 1C3LA 3ZU2A 5JTUA 3W78A 1VL5A 1KU6A 1H4QA 4OHYA 1MENA 1J8MF 4IZHA 5LKAA 2EBFX 3NIGB 5FA5A 3W04A 3C48A 2SBTA 3HGQA 1QSGA 1ZD4A 3DE0X 3RD5A 4F04A 5BYAA 5C8DA 2OILA 1EEHA 5JI2E 1KAMA 1U9IA 5EVJA 5B30A 5LWQA 1QO9A 3OLZA 2IYFA 4NABA 5CCEA 1EHCA 5L51A 2FX3A 3KJXA 3ONEA 1QE0A 3BK1A 2V97A 5CUQA 2O6HA 1MIHA 3TLXA 3ANSA 5AVJA 3GGOA 5K3OA 3P0HA 3FFXA 3THOA 5GZ3A 1CUFA 3OLYA 4MVJG 3SJCA 5JPCA 3BK2A 1JGTA 2NZWA 4YJ3A 2WNIA 5FEUA 5EYPB 1JA9A 4EB8A 4E31A 1W88A 1WCV1 1XNQB 1P9WA 3I37X 4EA8A 1M9NA 2QN1A 2WD9A 4FFSA 1Z3CA 4N5MA 3NDRA 4XX0A 3GJ0A 3CF4G 5G2OA 3DGEC 1DG3A 1JDPA 2C2HA 2DWCA 1JEEA 4YBRA 1AURA 3QPBA 5DJ5A 4QPDA 1KVQA 1AOXA 2ZW9A 4HWSA 4X91A 2WVGA 1NXQA 2HREA 2O0HA 3B36A 4TRRA 1NNEA 4JUDX 4IVNA 3BFXA 2O8CB 1SXPA 4AWBA 3UGQA 5I45A 4JI8B 4MDYA 4MGIR 2WTEA 1EAYA 4RGYA 3EZGA 1HMYA 4RMHA 3TNJA 4LAFA 3VHRA 3W4IA 4FUQA 1T13A 2FF7A 1OWNA 3N0TA 4DB4A 1L8AA 1TJ3A 2BCGY 5DMHA 2ZI3A 1DWPA 2ERYA 3LKVA 1C80A 4K46A 4LWOA 5ANRB 4I19A 3T5AA 4PWYA 3TM4A 1DKQA 1NOJA 2Q4TA 4KWIA 4EUSA 2R751 5JJ5A 3AYXB 3PBKA 1X15A 2NNLD 1IZ7A 4RMIA 1FLAA 4LGMA 4F72A 1E60A 2I2WA 5ALTA 3MWKA 3CVOA 2AOXA 5BW6B 4ENRA 1GU0A 4HLUA 4PYJA 5IN5A 1JHVA 2RFLA 3R2JA 5ALJA 1QFJA 2ZIAA 5ECDA 4LDRA 1KDOA 1NPTO 3HWSA 3QW4B 3LWZA 5TXGA 4K5QA 3DO6A 3JD1A 3MS4A 4J49A 4F1WA 2C5SA 1AKUA 4R7ZA 4XJVA 5LOVA 4LXGA 1IG3A 4QHTA 3R09A 3F1LA 4GRIA 3IBCA 4IIXA 2ZSHA 1CY6A 3GLGB 2VUUA 2VJMA 3I5MA 2B3TA 2ISQA 2ZBGA 3PYXA 4KPUB 4EYSA 1QC5B 3HC7A 4E0BA 1DAHA 3GGCA 3F7NA 4EHBA 4CETA 2JZCA 5IVHA 4JWTA 1OH6A 3M4XA 2JARA 4BFTA 1AV7A 1VG0B 1H6DA 4N0EA 4G65A 3T1NA 5CEJA 4LRYA 1JR3A 1EFDN 3KZKA 4CDRA 2UUBB 2Q3MA 4GX1A 4KFSA 2XPCA 1PKEA 5M7EA 2G1JA 3D4NA 1EUDB 1U0NA 4OLJA 2G63A 3LKDA 2AUTA 1ZWLA 2B8TA 4KLAA 1WZ2A 1QF9A 1Z6XA 3CX7A 2IIVA 3DPIA 2ZU6A 4A5SA 1HLGA 3VPBA 1JXQA 1P0QA 2G1AA 3HP4A 2X58A 4GH5A 3EXHA 3QYJA 1GILA 2FPGB 4ZYUA 1RC1A 5AMXA 5AM0A 3JPYA 2LCQA 1CERA 1RABA 2UZ3A 1OXBB 3B7GA 2ZSBA 1LW7A 2O1EA 1LSOA 2I87A 1MEJA 3OF3A 3E1SA 2Y27A 2FPPB 3K16A 4WZZA 3PEFA 5DGCA 4EAAA 1SQ6A 1VGVA 1DO8A 1E1QD 2XSZA 4MI9A 4QARA 4RLFA 1MXHA 5EWMB 5IARA 4AZSA 3ABSB 4C1NA 4M7PA 2XECA 3ZK8A 1WQ1R 1WXWA 2BGMA 5KQMA 3V7UA 1JEOA 5IXJA 2J5XA 4QVKA 2ZSEA 3OJFA 3QA3E 4HQKA 1NFQA 4IF6A 3VC7A 3BGIA 3ZE9A 4HDQB 3KD3A 1Q22A 3SX2A 1NUQA 1H2AS 3UEOA 2WZCA 1Q1BA 1T6ZA 2XGMA 2GK3A 4A27A 4UEJA 1VJCA 2OHFA 3LCUA 4N8SA 3QIVA 3AG5A 5ALYA 1V2HE 2A3RA 3W2TA 2G08A 1NIJA 5KYUA 3N58A 3LO5A 1SR8A 4LVOA 3ESQA 5FBQB 2G1KA 4NYIR 4ASUD 1PYDA 3W7AA 4ALKA 4GPZA 2OHXA 2P91A 1FQOA 1E9DA 3CF4A 3V5NA 2WJIA 1PE0A 3M5CA 4LCJA 2B36A 2RI1A 4OHPA 2BGWA 1S2NA 2IUFA 4KSYA 4M0PA 1WRBA 2ZQZA 2FEXA 5CT5A 4IXDA 5IN4A 5KU7A 1X0XA 3EEQA 4RFVA 1GTZA 3BICA 4JU9A 4GSLA 1LEHA 1BXGA 1UJ5A 1X6VA 3D54D 3NTXA 4QYXA 3UIEA 1F9AA 5JWOA 5KTNA 2VXCA 1IEQA 4XWYA 3RBXA 1V0JA 1XT6A 3FYUA 3GDFA 2MHCA 4ND5A 5CLHA 3R7WB 4RV4A 2DZDA 3B6JA 5CDFA 1NLMA 1I51A 4YFVA 1V16B 5U1PA 1SUAA 5K3BA 4EO9A 5KOJA 3CVUA 2C7OA 1IHYA 5ADHA 1E3JA 3ANMA 4N6GA 2WIDA 2RCNA 1KVTA 5B6IA 5JXGA 2C4HA 1C3XA 3O8OA 2LE0A 3AR9A 3I6MA 3L93A 3QSGA 1OPXA 3R0QA 2DY1A 2QG6A 4KRYA 2SECE 2G9RA 3WDKA 3HGMA 2QM0A 3C98A 5REQA 5J2TB 5MGNA 1N5LA 4RIHA 1XRRA 2VDLB 3RKSA 3FSEA 4B17A 5L6LB 2XRFA 2ZTUA 3H7AA 4L0DA 1GNQA 2ASVA 2AZMA 2PMBA 2FP3A 4RJKA 1Y6FA 4BC0A 1NV9A 3NR2A 5JPDA 3FYUB 1XCLA 1QJ4A 4RAOA 4JI2B 3A6JA 1Y82A 1ZD5A 5LCXA 4OP3A 4CLOB 3HWRA 4YP1A 4JN6B 4R1TA 4N6NA 3ITNA 3IQGX 1C30A 4XDHA 2JVJA 3CUVA 4O4IB 4J91A 3JQAB 1I0ZA 3OI7A 3R3VA 2GJ8A 5FI1B 2REQA 4KODA 2XTMA 1YASA 3F9CA 5ICSA 5I8ZA 3CPSA 3FJYA 1MDBA 3TRHA 3VZBA 4ZHQB 3U6BA 2FKNA 1CS0A 3PDIB 3UT5B 3WOVA 4EFLA 3KB2A 3DMNA 1FP2A 3VI4B 4E6EA 3WWPA 2DUNA 3OPYI 3QYPA 4OAOA 5JAPA 1RZRD 2OQRA 4DJAA 3T35A 5I7FA 4ZVVA 1VE7A 4Z4EA 3PA8A 2EIXA 4Q3NA 4QYTA 2J0UB 3O9VA 3F6YA 2FY8A 4ENVA 3SM9A 4RO0A 3W9YA 3E3NA 3RVDA 1S8AA 2QKYA 3NTUA 1QKJA 2HMYB 2A30A 2P6RA 1QNLA 5KYTA 2WABA 4WDQA 1PR3A 2IEIA 3IUEA 4J7UA 1WV1A 1JQBA 1SELA 2W93A 3HFGA 5E4JA 3PT5A 4J2OA 5EXPA 4AF8A 3G2QA 4QUBA 1MOQA 2C0PA 4OIFA 1SKMA 3H8WA 3E0XA 4AP6A 2CLHB 4CUJA 1X94A 1LVHA 1TU4A 4U4AA 3A28A 4S12A 1XAJA 2DETA 3WGIA 4TYYA 2E5WA 4NSNA 4P36A 2EW8A 4EYQA 4OY3A 1ONBA 1T36B 2RHTA 1YDEA 3HN7A 4G37A 4LMAA 3EMKA 3ON5A 4GICA 4MPPA 3H1GA 3ENQA 3HKDA 3NGLA 4BJ1A 5KTOA 4F97A 1QZZA 4AWAA 3RC2A 2OO5C 1ZK0A 2PGXA 1GPUA 2O0LA 3QE0A 4LISA 5KZMB 5CYPA 4YXFA 4D9CA 3LQKA 3MCAA 4OLHA 3IODA 3ZDXB 5BV0A 5JD6A 2WJYA 3WYBA 5JXHA 5CFMA 3EZYA 4M0FA 2C5HA 3VR4D 3U56A 4AN1A 5LP6B 4KXFB 1XQVA 1ARZA 4YNBA 3SQDA 4E3ZA 3G0GA 2Q5FA 3OC6A 1P4JA 1ZA1A 4PLTA 3UJ8A 4BATA 4DWWA 1L5OA 2ZWPA 3D4IA 4UMVA 3HFRA 3GRUA 1T9GR 3GAZA 2PUFA 2C3MA 1W85A 1WF6A 2VHXA 2Z04A 3HABA 2WZBA 3TNYA 4PYQA 1J8DA 3UG6A 1V8ZA 3WZLA 3QNWA 4EHKA 3I23A 3DBOB 4ZREA 2O52A 2XA2A 2HF2A 3WNBA 5JJCA 2XTNA 3EZ9A 3WNDA 3TAHA 2FZ5A 3ZDFA 4DLYA 1VHQA 5IRCD 1CVIA 4ZARA 3NT2A 3LP6A 2NYVA 5FKJA 3MXTA 2RHOA 4LYAA 4AIRA 4WV3A 1UZAA 2IODA 3ITEA 5GWXA 2BHNA 1L5NA 4A16A 4TKLA 4DQLA 4QGBA 3PFBA 1TPYA 2DFDA 2R66A 1IPEA 2YBDA 3EIOA 3GV0A 4JL5A 4AKHA 3CLUC 3NALA 9GPBA 5HF8A 3SIXA 3VDNB 1VIMA 4I4NA 3WYNA 2FK8A 3P0FA 4PLPA 4ALNA 3HVRA 4WK6A 4ZV7A 2X7JA 1R5JA 1M2VA 1ZH8A 3F3YA 3MWLA 4C0SA 3HZRA 4YMUA 3AFHA 3QRWA 4PPGA 3MD0A 3VYTB 3CB4A 1ZG3A 2E1PA 4ITVA 1LI7A 1ENOA 3V7FA 4DLVA 5TQ0B 2CDRA 1CG6A 4E94A 5LA6A 3B3JA 3FF1A 3UJ7A 3B5EA 1O8BA 2VHYA 5CNMA 1HG0A 1SXIA 3ZWPA 1N9ZA 4DEYA 5HHTA 3NHLA 3BE8A 4NMHA 2PR2A 2QW1A 1H9CA 3VDRA 4Q3AA 1IB0A 1U7OA 2D8MA 1WUYA 3GLHB 3IEXA 3K9LA 1Z7GA 3ECSA 2OQIA 3UAGA 4IX1A 3I9V6 4NYMR 1QFXA 3FE2A 1OLXB 3LSYA 2GEKA 2WAAA 3OPMA 1XHEA 2H5JA 4Q1EA 1E5VA 4LRTB 4AWXA 4DA8A 4I9UA 1EFAA 2VT2A 2WSSD 1YDWA 1YR6A 1M2VB 5D51S 5HIAA 4DQKA 1JJFA 3HY6A 5DGHA 4BNWA 3TKAA 1RYEA 5IF3A 5BP7A 4RIFA 3W6PA 2GUWA 1GJRA 1NVWQ 3UHAA 3L9XA 1UDAA 3W9UA 2JFBA 2JLUA 4WOBA 1TECE 1UT5A 1WXQA 3B3AA 4Y2JA 3UUWA 3BA6A 4G0QA 3H2JA 1QHFA 1PO7A 3H99A 4FOTA 4HAWA 3COZA 5EWLA 4C3VA 2MCFA 1XZAA 1YGYA 2QTFA 1QE5A 4CODB 1ENYA 3MYYA 2KLHA 1JBKA 1T8PA 5FNVB 2ID8A 4JB0A 4WNIA 1Z0KA 3ADKA 3R0ZA 3G8DA 1P1IA 2MSCB 1MX3A 3N74A 1VJTA 2HX1A 3FVWA 4TROA 3SNHA 5H02A 4FDTA 2IFTA 2D00A 1W8IA 4B3DA 1ML4A 3QVJA 3HVUA 4JFAA 3PQDA 1Q1EA 4FZRA 5AHWA 4WCFB 2UZ4A 3WLSA 5KAPA 3TSYA 1LQUA 3FR7A 2IKSA 3I45A 3T34A 4X5OA 5AKHA 3AINA 5FUMA 1N33B 2FWAA 3JQGA 2OHVA 3QTLA 4B81A 3AJ9A 3LHSA 2DG2A 1T35A 4J9VA 1Z5WA 1XYGA 3VZPA 1XTBA 2ODNA 2SKCA 3IVRA 4UBNA 1NMYA 1AU9A 3ZWMA 1E5LA 2VJBA 2H1HA 3MIIA 2IYVA 1TD9A 2R86A 3LHFA 5K7SA 4HH0A 3IAFA 4LYGA 5L45A 4FMCB 3U9TA 1Q0PA 2HLHA 4ROSA 1O08A 2XNJA 4WIAA 1NF9A 1YOVB 3GAMA 3CJTA 3TW4A 4DC0A 3ETGA 3AVVA 4R71A 5HUHA 1RZUA 3DDHA 3TE6A 4HY3A 4Q4HB 1FVHA 1RWVA 5HUJA 2IBMA 1NQTA 1E0DA 2VRNA 3D8HA 4H15A 3RGGA 1F20A 3JQ9C 5CIYA 3H2BA 3ME5A 4IEFB 4PS0A 3NS7A 3KUXA 4OHCA 1TYBE 2FN4A 3HYRA 2HYDA 1IHPA 3ZHXA 4DSAA 2HQBA 4GI1A 1IHDA 1MTZA 3L1HA 4RU1A 3FTQA 2C2KA 4BB5A 2ZI9A 1BWSA 3FUVA 3BBPA 3N0WA 3MS2A 4AJJA 4HTAA 4I3GA 2WFLA 3SG0A 4NL4H 2LCIA 4HB2A 1QHHB 5LMZA 3L6RA 4P3YA 3UJ6A 3D7KA 3S5UA 3EQ8A 2FW9A 4N03A 4TXHA 5L3SB 1AZSC 4RVUA 3BHIA 4ERXA 3RQIA 4DLLA 1OX4B 2PRIA 3U3JA 1UPCA 3OE7A 1JS1X 5K45A 4YLEA 1J2JA 3AG6A 1TJYA 3SF8B 1PJTA 4RHEA 3PNYA 4GPBA 2A94A 3NONA 2HT1A 5IAAA 4CDGA 1H05A 1HFEL 3LBYA 1Z88A 4OH7A 3WLIA 2FYTA 2Q5EA 3NVMB 4DGSA 3RAEC 1YZ3A 4G8CA 1VMAA 3GLIA 3DO8A 3LP8A 4DEVA 4AJ1A 4EO7A 1OZAA 1RQ7A 5BUZA 1UDXA 5JSUA 4GNKA 1Z82A 1XL0A 4I8IA 4MWEA 1FUIA 1N1DA 1A7UA 2B25A 1OLOA 3G2HA 3ZVMA 1RSZA 2J0UA 4Q18A 3VTZA 5T57A 2OENG 4QDTA 3QOWA 2QTBA 1R4MA 3HHPA 1KNQA 1GDDA 3DZCA 3AF3A 2D5LA 3GFBA 4KI0A 3LP5A 5CT4A 4GWKA 1OVMA 1PP4A 2DULA 4ZHQA 4LKRA 5BSKA 2VAPA 1HY3A 2AQKA 2PH3A 2RHDA 3EDMA 2WUWE 3IV6A 3NORA 3TQHA 3NDBB 1EAMA 5COQA 2NUPA 4JYPA 4BEVA 4MVWA 4FKMA 1PR1A 1KI3A 2YV2A 1Q20A 3I2GA 4K9OA 1TZJA 3EOBI 5AOBA 3V9PA 4OFWA 4I1PA 1Z2DA 3F73A 1P6XA 4WXPA 4L0CA 2G83A 4I2VA 4YQFA 2UYHA 1R8QA 2RJOA 4G0PA 3AHFA 2NV6A 1P7VA 2P65A 2ZIUB 3CSUA 3IQXA 1JLLA 2NO0A 1FJGB 4YLGA 4G8BA 1U7TA 2WTMA 1TYZA 3HJRA 3K70D 2MINB 2O2IA 4FP9A 3IT3A 4K9SA 3PUZA 1SXJA 5K5EA 3C5CA 4H17A 2F8TA 5DLYA 4G5YA 5IW8A 2BW0A 3KCNA 3VZSA 1CYDA 4ZYWA 3QGMA 4BE7B 1TYCA 3PQ5A 3B9QA 3F97A 2O23A 2OGUA 4UOQA 4B44A 2B4KA 2ZJ1A 4RJTA 3A1TA 3GNQA 1Y8AA 3BOSA 4OQDA 4FB5A 1YC2A 5CD9A 2YV5A 3K7EA 3O2JA 3KM0A 4RGVA 4UD2A 4TMKA 3PENA 1YRBA 5LP1A 3K72B 3A1SA 3D81A 1E1RA 3B1FA 3IVAA 3NAZA 4NNOA 5KTKA 2G36A 4LSZA 5IAOA 1VSQA 4QQRA 1GQ2A 1GAQA 2HGZA 2R4UA 2NTJA 1JYEA 2ZVJA 4G4IA 5B1DA 4D9EA 4B71A 3DE5X 4CIAA 2HCTA 1JNXX 1KPHA 3OSUA 4ZOLB 3U37A 1XQXA 1QYIA 1NAHA 2QVLA 3GIDA 1IY2A 4BASA 4BEBA 5JLAA 2JH9A 1QMPA 5TY0A 3K2EA 1KORA 1XF9A 5TT1A 1TQ4A 4R6XA 5BN5B 2XQIA 3EASA 1XTTA 4LFCB 5HYVA 1MJNA 2RGXA 2XNCA 5EIBD 4DA4A 1TJ4A 4FJ1A 5I4CA 3K6RA 3LY7A 3AHIA 4D7AA 1JLHA 4GOMD 3RRZA 4MWGA 2GZRA 2NXEA 3UENA 4C7XA 2MSEB 1IWOA 3EXFB 1DJMA 1A1SA 1VL6A 2JBHA 3RUFA 5KMGA 4AX8A 4RANA 3O03A 1I2ZA 2RH5A 3FTCA 1E1QA 2GAOA 2XSZD 2X13A 3CO0S 4KXVA 1O6CA 3CZQA 5T3YA 2G4CA 2JJYA 2JJ8A 1O03A 4Q3BA 4BKRA 1BXZA 1SFRA 2YHIB 3T6KA 4DBZA 1J8QA 3SHQA 3DT9A 4IV8A 1MT0A 1RJEA 1SUDA 2P79A 4R01A 2VT6A 4J0GA 3L8FA 2UUOA 3MBOA 4Q1FA 4R9NA 2IWRA 3IUSA 1QYXA 3E2IA 4F3NA 3HUFA 4PHCA 2P40A 5ALRA 1XDSA 1YVRA 1NNUA 1JSZA 1COWA 3HTXA 1A82A 2FPKA 1W1IA 3A9TA 4QFMA 4MP8A 4N7BA 3RRFA 5LU9A 3FFBA 4BVHA 3N7UA 2OXIA 4ZYTA 1PG2A 2FEAA 1Q0SA 3MTEA 5ECGC 1K75A 2LBPA 2WJ3A 4FNAA 5D3MB 1T6NA 2XKBA 2SNIE 3CLHA 5EE5B 5HKLA 3NETA 4HOYA 4U6NA 4XEHA 4A91A 4Q66C 1ZH2A 1WDWB 2HSZA 1P73A 3DZBA 5JNTA 2TRSB 1RT9A 3X3HA 4YT2A 1DOHA 3M2TA 2HXGA 5ERGB 2CK3A 1KJWA 2WWGA 2GM9A 3L05A 5AVQA 2GO1A 4OCZA 3I4LA 3LLUA 5IZCA 5FD8A 2PZAA 2H2AA 3MCWA 4R8KA 2OM2A 4QD3A 4GZ5A 1RLOA 5CFRA 1YQ9A 3RIHA 4L57A 5K8UA 1UUFA 4MKRA 1RM3A 1YWGO 3UOWA 4YRKA 3WHLA 5FFFA 4BNUA 4DIKA 3EPJA 2DJIA 5G53C 1NULA 1OWOA 2NV0A 1TTHA 5L7YA 1QFZA 1U2DA 2RDMA 1L7MA 2EAUA 1ZK1A 4QQFA 5CVEA 2OV2A 4RLHA 1LI5A 2P2GA 1VCHA 1NTOA 1GGMA 1DV1A 2DTDA 4MYDA 5EZYF 5HK9A 2XUGA 2XIQA 3C3PA 5J23A 3QKWA 4ALLA 5DVZA 1V5FA 1W0CA 4HGQA 3OTHA 3PXBA 1DQYA 3QJYA 4HYQA 3KEFA 2ZB2A 2DRIA 3WLQA 1YC5A 4ITRC 2C83A 2BHRA 1HTBA 3DDCA 4XB2A 1AGRA 2Q62A 3CEJA 4F8EA 5JJLA 2DHQA 1DQZA 5FDFA 3BH0A 2XJ4A 2BELA 2OO3A 1O0BA 3AY7A 3UB2A 1JU4A 2DWUA 1FFEA 2RK6A 1TCBA 2B21A 3CM0A 3E3OA 1XG5A 1NLYA 3ZZTA 1ISMA 4FFBA 4I6JA 1FZQA 1Z8NA 3AOGA 1GLGA 2VH5R 3AK4A 4I81A 2G5GX 4K8RB 1JQDA 4BMCA 3M82A 1G3UA 2Q9BA 4ZDJA 2CUNA 1LSJA 2DYKA 4JLOA 4U2DA 2AFIB 4XJTA 3Q5GA 1AK2A 1GL9B 1G5PA 3JALA 4TRJA 3Q3GE 4HBGA 2O8BB 4LX8A 3HU3A 3HR7A 5B2ZA 1SRQA 1U31A 3FMPB 4YHBA 3EK2A 1T4BA 2WHYA 3NCTA 1TYEB 2ISSD 1UWVA 3S8MA 1HZZA 3UJBA 3AB8A 3DYBA 4MZDA 4TZTA 4DJDC 1W36D 1KBZA 4LXQA 2XZPA 1DI0A 1ETHA 4Q9JA 1LXCA 1FBTA 3HB5X 2OCBA 5CYFA 3RSOA 1SVOA 1XQ9A 3LCVB 3WDMA 4F6RB 5ICMA 2IH5A 3HO6A 1YS2X 2F8LA 3QNMA 4ND1A 1M2HA 2EKZA 1SUIA 3VSBA 4HN9A 1PZHA 4EM6A 1BE1A 3ZXXA 2VUIB 4ZIRB 4I55B 4N47A 5CCDA 1XTPA 1I10A 2O7QA 5DPMA 5ALQA 4LJ5A 1M1YA 2NWQA 4BLRA 5ELMA 1P44A 1OIXA 2V5UA 3IPYA 1M1ZA 3U3ZA 4ER7A 1AHHA 4W82A 5LL6P 1WQ3A 1OLUA 4OHBA 2PXXA 3UCEA 2J5KA 3K9CA 1I4OA 2NXWA 4HGYA 1V5EA 4O0MA 4MGZR 4DJJA 4MEAA 3FPFA 4YAGA 1D6SA 2DEUA 1Z68A 2QTAA 2O2JA 4YRMA 4CIWA 1NG9A 1ZPDA 2PQMA 3AB3A 2P11A 3LWBA 2JIZA 4M0UA 2XCLA 3PXXA 4YASA 3AHJA 4NTZA 4C30A 3TINA 3X1XA 2VQEB 4ZHSA 1QRTA 3SF0A 5JROA 1HYBA 3L1KA 3IRVA 3OT4A 4D25A 4WZAA 3AT1A 3QU9A 1XCJA 4TXMA 4UARA 1G20B 4J0CA 4GKVA 4RF2A 2ECOA 2Z5GA 5IT9A 2HU2A 2OCLA 3EGVA 3H5WA 3URKA 2YZNA 4US0R 1ECLA 4TWAA 1YBFA 1E61A 1KFCB 4GOOD 4M53A 4YRLA 1ORIA 1EFVA 3L1VA 3FCSB 1AKTA 1F8FA 3EXG1 3G3EA 2JHGA 5D6NA 2IHZA 4C4RA 2WB4A 3WGMA 1YXMA 1N6KA 2B0CA 1JXOA 2QIOA 4EATA 3A6KA 1CUYA 5FBHA 4NOJA 3O4RA 3R3WA 5LOVB 3GEMA 5AFSA 2AW5A 1XRSB 3IJPA 3IQIX 4NZMA 4PGAA 4QGSA 2QL6A 5BOSB 1Z34A 2A9JA 1R0WA 5TDHA 3ZV5A 2QX8A 3EWAA 1PGJA 4O4HB 1BXRA 1LK5A 5CK4A 2RHHA 1AS2A 3BRQA 5A5EA 1ZI6A 4FGKA 3WGKA 1J2YA 4ENTA 5EXEA 3H42B 1RLIA 3WRXA 5E8RA 1K9VF 2V9CA 2XDQB 1Q7EA 1HQDA 4KHZA 1DBSA 2Q5IA 1KS2A 4ZU6X 3ZBTA 1L6RA 3THSA 3BRSA 2DLDA 4U8GA 3Q15C 1SHLA 4KQHA 4ACBA 2ATCA 2XWQA 2Z3WA 4FW9A 4GW3A 4B3MB 5F3WB 1AHPA 4EG3A 2J1LA 1OWLA 2QXTA 3FFAA 4O1HA 1YGPA 1U2QA 2JI9A 2WWXA 1V8DA 4JI3B 3SBDA 4JBNA 5EXTA 3TDKA 1E9VA 2FWJA 5BT8A 3OQIB 4TLLB 5HFNA 4ACAA 1C41A 2YZMA 3D0OA 3DZFA 4MQ5A 1G6KA 4X1YA 5CJJA 4C7JA 3PT9A 1H2XA 1MGPA 4Q9HA 3VQTA 5CM8B 1NUUA 4FN5A 4BQSA 3TUZC 2Q2VA 2J5QA 2YYSA 3DC2A 3IT2A 1GNSA 1FSFA 2HPVA 2IHVA 3IELA 3MWFA 1P0MA 2H63A 5IBRA 3UAYA 3ESBA 3X2SA 4LDQA 3GA5A 4PBRA 1P1RA 1QQTA 2Y0DA 2XUPA 3WGOA 1OASA 4LMBA 5JASA 3ZDRA 4ENSA 4QBIA 5CXSA 2QL7A 4YRCA 4FHCA 3ZWKA 4DADA 1SB8A 2X5OA 3H1BA 3PNBA 2OHJA 2Q4RA 5D3ZA 1NVEA 1X70A 4I4TF 4FDMA 5EWMA 4EW6A 3CUYA 3EH2A 2JD2A 1QG0A 4NEGA 1MU0A 1Y4UA 1MNAA 3WTCA 2BHSA 2X15A 5DYYA 1RBZA 2R8BA 3DPSA 1GQRA 1R66A 5I5EA 2VYQA 4KEAA 1G8YA 2BI7A 3ML1A 4OBXA 3HVHA 3KL2A 1IHOA 4NV1A 3ZJTA 4OU5A 1UM8A 1JG7A 2NM0A 4D3XA 1OPRA 3NHRA 5BSUA 4G6ZA 1Y8RA 4GBED 4LRSB 4Q05A 4G4SO 1XGKA 3M4YA 2GEBA 4DMMA 1TJ5A 2ZJ0A 3PXCX 2ZEJA 3MJHA 1B0PA 2IZOA 4EG0A 4JX8A 1PJ8A 2XQFA 4Y30A 1YJCA 3O9ZA 1OC4A 2N42A 4I8DA 1B8PA 2C20A 2IIQA 3FTDA 4MQFA 4LOIA 3PNLA 3UNXA 5CEEA 3C4JA 3KPWA 3X1MA 2DPYA 1SQFA 2F1OA 5DTMA 5K6TA 2W2VA 3ZQKA 4EMBA 2ERXA 4AG3A 1E2HA 1F1JA 2J8ZA 4IP0A 4J1SA 4OBWA 4XUGB 4Y2PA 4YJKA 3UANA 3UW1A 1O0CA 4ZT3A 3I4FA 4LBWA 2WD8A 5M5BA 3NDIA 1F51E 1RWWA 3AFMA 3B3QA 4Q48A 3SX4A 4ZYLA 5IKMA 5AKKA 3BZUA 4IIHA 1UCFA 3IVMA 2IV7A 3U3XA 3FOFC 1EK2A 1YACA 3SFZA 1Y8RB 1A8SA 2B69A 3BTOA 4MV9A 3DTYA 3C8ZA 3D02A 3KVYA 3AP3A 5KC9A 1QVVA 2IPNA 1P5RA 4QJIA 3PWKA 1RZRA 1E58A 4B0PA 2ZDQA 4MCHA 4FIDA 4DDHA 4DKXA 1PD1A 5DRTA 2ZXEA 5HZHA 3VHXA 3VNAA 3DBLA 4FINA 1W96A 4D4KA 6PFKA 4LY6A 3HBJA 2NT4A 3CTPA 3DSRA 2OKCA 2QWXA 3AL2A 3E7DA 5ECYA 3PX3A 1RQXA 4TLBA 3AVXA 4P9NA 2GM4A 3BWXA 2CWWA 3FGNA 2PMFA 4LQDA 4MW6A 121PA 4EPXA 2WIJA 5BWCA 2WWHA 3PSAA 1A9ZA 2DT8A 2V6IA 4QNMA 1XTKA 2PTGA 1VM6A 2FN3A 2I67A 2CJYA 4NBTA 4O4LA 2NP6A 5KWSA 2MR5A 2QMUA 1XUOA 3DMPA 3RR2A 1QYVA 1WX1A 2WZQA 1H65A 2ZU0C 3DEHA 4P5EA 4PVDA 1ZYUA 1PZXA 3IP7A 1ZNQO 4NAHA 4JIMA 4I4TB 5A4JA 2YVUA 4O59O 3TEFA 1I7QB 3NJ4A 1P5FA 4K88A 3GLTA 3PDJA 4PN7A 3OHPA 4KLCA 1N8TA 1XVUA 5LWHA 3RUHA 2NU9A 2AOWA 2REQB 2W4QA 3RYHB 2IHNA 4YK7A 2FEKA 1TYAE 2GF0A 1WHTA 1TLLA 4KMSA 4Z1MD 2VHJA 2JFZA 1IVSA 3CNEA 2PSDA 4P82A 1WL8A 4FZ3A 4XWAA 1ZK2A 1Y7HA 1Z4KA 3WJ7A 4XRRA 4KBGA 3T1TA 1JRLA 1ZHFA 4ARCA 3C8DA 4J76A 4JKOA 5F9FA 5C8ZA 3RS0A 1UC5B 1XWFA 4HX2A 1JZQA 3H2ZA 4NOKA 4ED9A 4LZZA 3OSZA 3U39A 4Y2GA 2ZPUA 3UWMA 1G60A 5LQRA 5AJYA 4YJ2F 4EVRA 2GVZC 2MR6A 1BGWA 1MP0A 1GQSA 2QEQA 1QH1B 1PQUA 3R41A 4I50A 3ONVA 3UA3A 1J06A 3GGJA 2ZI5A 1VSVA 3SX0A 2E4UA 4HD8A 1M34B 4UE2A 1VJRA 3CNOA 1BEUB 1QCYA 4KUHA 4KXYA 2ZAMA 4CFZA 1DG1G 4MWDA 1TRHA 1GITA 2ZJ6A 3KDSE 3JWHA 4J1TA 4PSKA 4U2BA 1MDFA 1OAAA 3D7MA 1HTTA 3H0CA 4H3VA 2DGDA 4B2IA 5JCPA 3CH6A 4MS1A 3H19A 3FYUC 4HAZA 2DR2A 2DSNA 2L18A 4F4CA 1FYVA 1FS4A 5IKXA 1WZUA 2C99A 1F60A 1KSJA 3F8WA 2WE8A 1AKYA 4Y1FA 1Y48E 4CHGA 10MHA 3IAS6 5L4SA 4CLDA 3QV1A 1UXOA 2Y4NA 3HKEB 1R0LA 2M32A 1FLVA 1U3DA 2ZBPA 3QXJA 1CS4C 4LHEA 4XVHA 4Z5XA 4HNTA 3K5WA 1CR2A 3E53A 3CRVA 4O4JB 3PKZA 1T8WA 2KX7A 3KHSA 4OQZA 4QELA 4RF3A 1G5FA 2F3TA 4YIHA 2ICAA 2O2XA 4IKPA 4MUHA 2HMAA 3O8RA 1E92A 3DW3X 1PNQA 3LS2A 3HCWA 1M34E 2GQ0A 4A10A 1ST2A 2HFKA 1SZJG 2VJLA 3EB9A 4R1UA 3AJ8A 4KMOA 5BSRA 5LXTB 4TYPA 4BNNA 4A36A 4HYEA 2FCAA 2V96A 2IF2A 2PKQP 1YNSA 4PYOA 4INAA 4M38A 4KVGA 1JG4A 2H2IA 3OT5A 3H9UA 3R3JA 1JILA 1FPQA 2CFSA 3HA7A 3HYLA 3DEZA 4IFEA 2GAJA 4G5SA 4WKOA 5H83A 3CEPB 4OQPA 5IZCC 4MUBA 3S2SA 6NULA 1GL6A 1MT3A 3HWX1 4RWEA 1MIOA 2I7DA 5JS8A 4NXNB 2ZJZA 3C5HA 4KOAA 1GD1O 2D3TA 5FPHA 1T9DA 3NV7A 4WK4B 5HCUA 3HB7A 2C8KA 4XH9B 1YONA 3QV2A 2YOFA 4HATA 1QTIA 2M6SA 2QLJA 3VNUA 1IN5A 2XEXA 3AERA 1RKBA 5FLXA 2BKEA 5SZHB 3WGVA 2WQZA 2MU1A 3TLCA 16PKA 4G01B 3VKHA 2CXQA 4AJIA 1XU7A 5KINB 5HTOA 4PO3X 2QV7A 4LJYA 1OBHA 4QX6A 2YVQA 1N3YA 1EDBA 4UHBA 2JCVA 2KWIA 4ENUA 4IQFA 2P5SA 1IM8A 3KLPX 1SVUA 3ZZUA 2GF9A 3ZGZA 3AILA 2PJZA 3A9VA 1BQ4A 1DAMA 1FSSA 2Q99A 4K6GA 3ZD7A 3FCAA 4TZKA 1U0SY 4KQXA 2TYSB 2QUIA 2JLSA 4YCNA 2CN1A 2ZTMA 1S8FA 2P35A 5AKYA 3IT0A 3Q2OA 2C58A 3MBKA 1OTXA 4HBZA 5A9TA 3W5VA 4OSEA 4BO3A 3KZNA 3E7PA 4DNXA 2VSOA 4DREA 4LVNA 3RODA 3LT0A 3OZXA 4B3SB 2D59A 1UK8A 2JGEA 1ISHA 4FYHA 5KEIA 3STTA 1T2EA 4FDUA 3CWQA 4O29A 5EJIA 3ZI0A 3R5FA 4EGQA 1EK6A 2C1ZA 2I1QA 2HQ1A 4G89A 4OHFA 3SKYA 4G5QA 2G28A 1EDDA 3CZCA 2J3LA 3MS7A 2IV3A 3O21A 8LDHA 2G1PA 3N53A 3OIWA 1HUQA 4AULA 1BGVA 4MO9A 3PLRA 3IUPA 4WBNB 5CA1B 2DH5A 2ZYVX 2XE7A 3IR5A 3OZSA 4RKQA 2GZSA 4MUJA 1Z5GA 1DHTA 4KBFA 4QAQA 2GESA 4B6SA 3C5VA 2J3JA 3D3NA 3D9QX 2PX2A 2NSHA 3HG7A 4Y2HA 4OI1A 1IBCA 3IMKA 1EJ0A 2C2WA 1AVTA 2HSJA 1B42A 1ZGBA 2GD1O 4OPMA 1N5OX 4CL2A 3Q88A 2JKYA 3PC8C 2DHEA 4D44A 2SCUA 1D5WA 4HS9A 4A15A 4EHFA 2UXDB 2F9LA 4ABYA 2V7EA 3OFVA 5F64A 2KM1A 1ZHHA 3ET5A 4B4VA 4C07A 2C88A 4OKSA 3QSYA 4QXRA 3QBDA 4FFDA 5IK2D 2BUCA 3K8ZA 1CDZA 3QLEA 1B2RA 3W1VA 3ZGLA 1QP4A 2AI3A 2ATIA 1B23P 1CJTC 4NYJR 5LP6F 4BNKA 8ATCA 3ICEA 3UAVA 1LBIA 3N9IA 4TM7A 2FDXA 5B57C 4DV1B 5IEJA 3SAJA 3SSAA 2VXOA 3M9WA 821PA 4PPFA 5ICGA 2HMUA 2YXNA 3TZKA 1NLUA 5KYXA 1SH7A 3VU8A 2WP0A 3ZD6A 4RZUA 3RVJA 3ZZ0A 2GD2A 3DAGA 4ZZIA 2YHSA 5KKAA 5AKIA 3UA4A 4B8WA 5K6AA 1JUDA 1E3WB 4Y1GA 4MCJA 1NSFA 5AW6A 1QVWA 1O6ZA 4Y0AA 5CNJA 1AKRA 3VH3A 2AX4A 3ZQ4A 2PYDA 3L8MA 2Y1XA 1KMHB 3DMFA 2X76A 3LQ1A 1RKQA 2XOEA 4MCAA 5AD1A 4G5RA 3AUSA 2Z98A 2ZIGA 2EF0A 3NW9A 2H6EA 4AICA 2C2MA 3VRHA 2OV1A 5CCBA 1LSSA 4X65B 2R4QA 1LFDB 1RTTA 1E3IA 4PQGA 4WI1A 3GRKA 1DKPA 4B6OA 5AI6A 3HB1A 2L82A 1XMQB 1NIPA 4J3FA 4QXAA 1J2RA 3V4RA 1VFPA 2XLBA 1N9KA 2VBFA 2CL0X 2AJBA 3D5QA 3D6HA 3D3EA 4WZAE 2IDMA 1D4AA 1Q0UA 2WFMA 3W2FA 1ENZA 1V7QA 5KNCD 1SOUA 3VH1A 1FBNA 1E3WA 2B4RO 2FDRA 2J5RA 2ZPAA 2DBZA 3G2MA 4DWVA 5J2UB 4H18A 1MOPA 2Y1EA 3EVZA 3KALA 2QROA 4X7BA 4QPZA 3EFOB 4YWJA 1YCFA 4C01A 4U7WA 3UJNA 1USUA 2HBZA 1YE5A 1NBIA 1UC9A 2A5JA 1FP4A 1FSGA 1K7CA 3T0FA 3TLZA 3RIYA 4YQEA 2GYVA 2D5AA 3WYGA 4JWKA 2QW0X 5IABA 2ETVA 2AVDA 4CKCB 3E9ZA 3AEQA 1G1MA 2V8BA 4HQNA 4CMJA 2D0DA 4P5PA 1SVKA 2Q1SA 4HADA 1FRZA 4KIGA 3TJZA 4REOA 3ZW9A 2WHQA 4HGPA 1X7GA 2F8MA 2PXHA 3I9OA 2R7NA 3M1YA 3WGHA 1R8XA 2KPOA 4LWQA 4UUMA 3BMQA 1ZD8A 2JFHA 1K6IA 5DTRA 2Q1XA 1KQ3A 2WLSA 4QPNA 4ZAXA 3UAXA 5HZKA 2GDZA 2J09A 3N8HA 2A9FA 1SD2A 1DX4A 3RTDA 2Z5VA 1KA9H 2FEWB 5IH7A 3E8MA 2HIHA 4BX9A 3DOEA 4DIUA 2OBFA 2OFXA 5AO9A 5IBPA 3BHJA 3R4VA 4TTAA 3Q3HA 3K9GA 1W75A 1T1SA 4J0FA 1XTJA 5TVKA 3UJDA 1WBJB 3SK0A 3ZLTA 4JASB 4LTDA 3ETCA 2XXAB 4H0FA 1P3JA 3F6PA 1J0XO 3KTAA 1V35A 4L5JA 2IY7A 3G7NA 1E5DA 4F2DA 2TECE 3JQ9A 3DMTC 4OMFG 3TSOA 3E9YA 3OCJA 2XGGA 4RTSA 3AIMA 4NCHA 4WFIA 1WZNA 3SDBA 2HWXA 3ZCQA 2R8OA 1YQDA 4QOGA 1TE2A 2IYOA 2I6SA 4QHYA 3IAHA 4RESA 4WNCA 5D7NA 3O4HA 4NC9A 2XW6A 1UOEA 4A92A 4BY9E 1NYLA 2DH6A 4QQNA 4D9NA 3QE9Y 2VF2A 4KX5A 2WG0A 3C15C 4PGFA 2Z09A 3BAFA 4UNRA 4WESB 4EITA 4CCWA 2PZJA 2JFNA 1Y4ZA 1NWCA 5CPFA 5IAJA 1QOQB 4QL3A 5H70A 4DWJA 5HVNA 1RI3A 2VHUA 4PQEA 1VSTA 3WSTA 4RDHA 4GSKA 4YRGA 2IPMA 4JLKA 2R5NA 2C57A 4PXAA 3U4CA 1XZJA 1K1EA 2I2DA 1G3MA 3GBSA 4G1UC 4KAXA 2B30A 5ENZA 3PGJA 4DHEA 4BUJA 4F45A 4FONA 1Z8HA 4X66B 2DFKB 3CRQA 4O2BF 5EC8A 2GBCA 1A9XB 2VAMA 4TL7A 4BKMA 2BIFA 4HGZA 4WN9A 2C04A 2RGAA 2BI8A 3L6DA 3O0TA 4YRIA 5DLPA 4RA6B 4G5OA 4MYUA 3JU3A 4J1QA 5HXAA 3B6ZA 1RP7A 4NARA 1XCGB 5EJ7A 1LRLA 4D0LB 5GJVC 4Y6RA 3V55A 2GTIA 2Q6TA 3QE4A 4UEKA 4XXHA 2H3HA 4B82A 1MOSA 3U4MA 3RC1A 2N1MA 3GVXA 1I8TA 1L8XA 3MJDA 2A5YB 3U2QA 5BRAA 4MKGA 1ONNA 5C37A 2O8NA 3LA8A 4JLSA 2JKVA 4OQMA 4NECA 5F73A 4YRFA 5BYBA 3N2GB 4BPRA 3O3CA 2HHAA 3IHLA 4ARIA 3WADA 3VZDA 2FFQA 4C4OA 3IKLA 1CUEA 1I3NA 2AX3A 1G21A 3P9YA 3ZWBA 4NJEB 4M88A 2O2GA 4JJ6A 4D8TA 4EJSC 1CJUC 2CCKA 4WJKB 4KQ2A 2FZVA 4B46A 2IVFA 4ES6A 3L6OO 3LCMA 3QHQA 1SXJC 2AGVA 5J5VA 5B4VA 3PXAA 1J22A 3EN0A 4KNWA 4OFBA 4TUYF 1JFLA 1AKWA 5FTWA 4K2AA 1ZM2A 4UTPA 2BSAA 1D09A 1E3QA 2D1SA 2I4OA 4KMRA 3GWGA 1GWNA 2FNAA 1Y8CA 2VBGA 4TQAA 2DBRA 1YRQA 1RCFA 4WBNA 3HXOA 2XCUA 2WWVD 1OFHA 5YASA 3CN7A 4C7VA 4QUKA 1VLLA 2GLUA 1BRMA 4J16C 3FRHA 1TAUA 1U28A 3A8TA 4HDKB 1QPBA 5A3SA 3ZJ5A 5F33A 3D0KA 4UDYX 2FQYA 4DQUA 3L8ZA 4EP1A 2V7QD 3QMVA 4C22A 1CRLA 1GCIA 4Z7QB 1FVFA 4GKAA 1ODIA 4B7XA 3FUTA 3Q12A 2H00A 4FE7A 3LHKA 3GRFA 2V0NA 2VOEA 1HQYE 1DU4A 3RV3A 2VQDA 3E6AA 5ALKA 4DCVA 4YAUA 4GPD1 4UNQA 4LPSA 5B55A 1GGEA 3AM5A 3N2LA 2YIVX 2V7PA 3PC2A 4OHXA 1BHQ1 1I0IA 5A6SB 5JSYA 2EZUA 3HJNA 4JA2A 3X1JA 1RJDA 2IIPA 1N8SA 1K7SN 3MERA 2Z83A 4M1SA 3UXMA 3SOPA 1ZSYA 3HSKA 2PXAA 1XRMA 3FUXA 2JJ1D 3FPGA 2QZSA 1SU7A 3DL2A 3NFRA 1Z18A 3M6XA 3MUOA 2CFRA 4X1IB 3RU9A 3ZU3A 5L3VA 3AY0A 1NXVA 4ILKA 2HJVA 1W88B 5CYGA 1JHPA 3DD5A 3H3FA 3NHAA 2P75A 2QD4A 1EBBA 3E1GA 2GBPA 3UVEA 1H42A 1E3SA 2W58A 1FYDA 1WNTA 4HJRA 3SBXA 3V2GA 2I8LA 4DUGA 3O3NB 2OCKA 2FI1A 1MG5A 3B89A 3AFOA 3KVOA 2JJ1A 4BX0A 1KI1A 1VC2A 4Z9AA 1XYYA 1VPVA 2D8AA 4HGNA 1UC4B 4YJ2B 4F6CA 4FYYA 1OXTA 4XLTA 5JT1A 4MYSA 4OO3A 4Z1OA 1JH8A 1BS2A 1HDYA 1DTWA 4R6WA 5HCIA 4CIBA 3CEAA 1J42A 3PPXA 4TUYB 4P08A 4HQOA 1Y4SA 3WI7A 5A6VA 1BWPA 2AMJA 4AS1A 2I55A 3NASA 4M9CA 5EMKA 1R74A 4CV0A 2CFOA 4X60A 1U0JA 2ZRDA 1L7QA 1M3SA 3CLRC 3CB2A 4GR4A 1MVNA 1MJ5A 1UKZA 4DQ0A 1O5OA 3IOEA 1LC0A 3C3JA 4IFBA 2JHAA 3DVAB 3TLEA 4LNUB 3UXHA 1MAUA 4QXOA 3SMQA 4ZYVA 1V41E 4MZXA 2YNMD 4EABA 5BN1A 1OLUB 4NDAA 4X44A 2NZ8A 3NRJA 4QXPA 4YQZA 3TMKA 3ZDCA 1V96A 3FPKA 4LJAA 4Q82A 4D4MA 4BFZA 1IPHA 2FLKA 2W4MA 3DJFA 4LE2A 3RVBA 4OXYA 3F8SA 2ZLBA 3KDPA 4IMPA 4JJ8A 4ND3A 5EMMA 5EUQB 3FYCA 3REQA 3T5CA 1NE2A 3H2IA 3PGVA 3TW6A 4YRRA 4OB8A 2AZ4A 1XCBA 1T2FA 1S8NA 4MVJM 4TLMB 2UZIR 4I9GA 3RS3A 1T3SA 5DI3B 5MN6A 2BGIA 3JAKA 5KHOC 5ALPA 5GIPE 5B1EA 3EDYA 3JVUA 3ZXIA 2ZTHA 4YDRA 1HYQA 2ZWAA 3ND8A 4BLUA 2OWEA 2NO7A 2OZPA 2EGGA 1O8CA 2HB6A 2HHCA 3WAKA 4LF7B 4MHOA 3OQHA 4G5HA 1TC1A 2FZKA 1L5ZA 2GHRA 4PYLA 3RWBA 1F38A 2JFVA 5JVDF 3VYSB 1SXJD 4YPOA 1GKLA 4IG9A 4EBBA 4I1UA 4UU0A 1PBTA 2OKGA 3I61A 5AHRA 5BO5A 3G2NA 2N1BA 4UNIA 1R9GA 4MS4B 5B1YA 1PR0A 1C5KA 1S3SA 2Q4OA 4XASA 4UE6A 4ANFA 1NP3A 4NZOA 3KYCA 1KH1A 3KQYA 4UUNA 2L69A 2ZRAA 3L4BC 3O4GA 5A02A 4D8UA 2ZP1A 1ULZA 1JVSA 4U2CA 1IM5A 1D4OA 2W6JD 4RZIA 3T0GA 3K70B 4EJSB 3BCSA 3ZOZA 1Q1GA 4Q03A 4E5VA 2GEJA 1GDTA 3A1WA 3S2FA 4BOYA 4I6EA 1W73A 2YV4A 2Q41A 1DADA 2WI8A 2FMFA 2PR7A 2QL5A 3OFKA 3ORRA 3MFQA 3BJMA 1G3RA 2QUAA 1NP7A 1VB5A 1VFNA 4M9XA 1CR6A 3G7UA 1L4BA 3GMDA 3OA2A 3T5DA 2WUVA 4XGQA 1XPUA 1JR3D 1I14A 3PFIA 1JE0A 2VP2A 4P3NA 5I7AA 2B2NA 2GPWA 3JQ7B 3ZY2A 1RI5A 5E6UA 1HETA 1MR3F 5ALEA 5G0VA 1K5GA 3RW9A 2I4LA 4N5DA 1U3CA 5EE9A 3N2IA 1WMEA 2EFDB 3TVDA 3ZDEA 2IOQA 1BU8A 1YS7A 4OQNA 1E0SA 3V7WA 2QX9A 3BZBA 3UJPA 1I3LA 5DLQC 2DFVA 2VHVA 4D42A 4PNHA 3OD5A 4C7KA 1AG9A 3TOVA 4CVNA 3DBRA 2VPXA 1RZ3A 3II6X 4XYEA 3PR2B 3JZMA 4HXEB 1IC6A 1NQOA 4H6VA 2ZYDA 1UDWA 2XI4A 4MUEA 3BIXA 3I0MA 1MHPA 2QMYA 5KWVA 2E85A 1FXWF 3KPVA 3SZGA 3TG2A 3E7FA 2A0YA 2D74A 1GXSB 3IOMA 2JGDB 4J7AA 1C1DA 3OIYA 4N0QA 4BO0A 2IU3A 1ULSA 1Q6ZA 1Q11A 4Q3CA 2VDQB 3D2BA 3A6LA 3QVKA 4O25A 2BH9A 4K9LA 2LWIA 3L6EA 1VMEA 2XMPA 2HMSA 2XUJA 3ANLA 4PLFA 1C8BA 5AHXA 2Y9PB 4U7JA 3TCNA 1PVVA 3W8NA 2Y92A 4F5WA 4EY4A 5F2OA 1HT2E 2P4EA 3P0JA 1SC3A 2I7VA 3P45A 1CRPA 1P5HA 4LYHA 3M3PA 2W98A 2Q3DA 3NH6A 2ZI7A 1WD7A 1XTRA 1TM2A 1PL7A 1WW3A 2AG1A 1TF2A 5DGIA 1ZN8A 5LZ5A 3R5TA 1X9GA 5CJ2A 1GQYA 2J46A 3AI3A 3GDHA 3PFWO 3OETA 1J9ZA 1A7AA 2XVYA 2VSQA 1IUKA 2GB4A 4M36A 4RGBA 2BONA 4CN9A 3FETA 3OVMA 3RYCB 2CE7A 2EWWA 4F3RA 2PE5A 1CF4A 1RWKA 4U7GA 1AC5A 1UFOA 4MAAA 2ZJYA 3EAFA 4JVMA 1V8BA 5A9SA 3CRMA 3WL4A 1G5IA 3HNRA 3NH9A 3QVMA 4U6SA 4E09A 4J3JA 1WXXA 1GAWA 1N5DA 1E64A 5IC6A 4BGIA 1ZN2A 2I3ZA 3QH4A 1YVUA 4QJ5A 4QOEA 4UFNA 4XPIA 1UJCA 2HRCA 2R6DA 1ST3A 5L53A 2P3OA 2G8LA 4PZ9A 1AM4D 3OIUA 3LQRA 3DLCA 4WOCA 1LLUA 5CTJA 4TWBA 4CKWB 4BVLA 1N3IA 2B6NA 4GO1A 4EEZA 1M5RA 5HF9A 1XLTA 2QNRA 1HT3A 1GKYA 4MP6A 4CMIA 1WPQA 3K0FA 1H4TA 5LD2B 3LVBA 4JYCA 1Z63A 4LHSA 3B1XA 1A5AB 1LS6A 1OF1A 2CKMA 4W1PA 3C6XA 1HNNA 4OA5A 4E2XA 4R81A 4R4JA 3GNTA 2H16A 1GRVA 2X7HA 1ESMA 4F4JA 5I3ZA 2CSXA 1CHDA 3NDJA 4KGVA 2KBFA 4MUXA 2QN2A 4UMFA 3AEXA 2XKAA 2OOSA 5B1SA 1GSOA 4KXLA 3ASUA 4BS9A 4EAQA 4YR7A 5BMOA 4AJOA 2QY9A 1KTVA 1ZM7A 5GJWC 5JYEA 1JT2A 3WK8A 5L7WA 1QZTA 3ADDA 4CKEA 2YDYA 4JEMA 4AROA 4DVJA 1YZUA 3DLPX 1U90A 2ES4A 4R2JA 1QAOA 2ZANA 1D04A 3BA1A 3DHEA 5E2IA 3ZBQA 4CFSA 1XZMA 2FPPA 1IONA 2EQAA 3SQLA 1FFYA 4EUFA 3R7SA 5CT6A 3THWA 2ZR8A 2C00A 4Q3DA 4IYRA 3ILXA 1RM5A 3KD2A 3ZNQA 2RBKA 1BOFA 2E87A 3VKFA 4J0QA 5KWIA 1SOWA 2WLTA 3H05A 4TXLA 2ZCJA 5KVAA 3S8EA 3P0RA 4AO6A 4CDNA 1XZQA 1DWUA 3PHHA 4H4EA 3KSAC 4KFRA 3QWIA 4Q7KA 4BQOA 1U0RA 1GQQA 3P96A 4KE7A 2QX6A 5KIAA 1YJ5A 2QYOA 1VE3A 4OL9A 3ZHOA 2WDZA 1ZCZA 1P0IA 4ITUA 2ODAA 1V9SA 5TQ2A 3MSXA 4ZAVA 2DTEA 3O26A 3WBKA 3TIGA 1W36B 1GPYA 1XAIA 4GVPA 2B1QA 3BMOA 3F46A 3E22B 4PGMA 3NCHA 4PYRA 1VBFA 3I05A 1E4EA 3V00A 2UU9B 3LQ4A 1C1HA 2EJVA 5EZQA 1KYXA 3V7NA 1M8JA 1NI5A 2BAGA 3BSSA 3RSSA 3G0IA 2GYYA 2OM6A 4F85A 1U1EA 2A9RA 3NT5A 5TT0A 1U2SA 2JD1A 1M6EX 2P2SA 6YASA 3PLAE 5JAOA 4G9GA 4IX9A 4KV9A 4ZT4A 2X5JO 4QECA 3RYFB 1ZVVA 3OZFA 1N0IA 1P8AA 2W83A 4L0QA 3WO0A 2HCFA 3MOGA 4IO0A 3TLYA 2J41A 4REMA 2XUQA 2OZLA 3ELYA 4LSMA 4MVXA 1TQ8A 2HK7A 2QUZA 3LKBA 1D07A 2RGEA 1U9JA 3SZOA 4F1JA 3JYPA 4OL0A 3B52X 1AQ6A 3C39A 2NU7B 3H3JA 4J29A 4ZD6A 4OUDB 2FJ0A 2NIPA 5EQDA 4DJEC 2O3RA 3BERA 4UHKA 3TEJA 2IOFA 3AHEA 3OOSA 4ZVSA 5TS2A 3VSAA 5IAKA 3JAMA 1PL8A 2RGNA 2YH2A 4JDPA 3ST7A 3N2KA 2JASA 1JKMA 3BM5A 4HLUC 5AOCA 3RWOA 2GH1A 4C4SA 3PD0A 3DCJA 3JQGB 4BMSA 3M33A 3ER8A 3BT7A 2NZXA 2BM8A 2PSEA 4FR2A 3D6TB 4HDSA 4Q24A 4C6SA 3JQPA 3ACCA 3GAFA 5AKZA 3DQZA 1G2QA 1WHSB 1D2CA 5JAQA 2CXOA 1MC5A 3A6ZA 3O6VA 4V0RA 3UO8B 3WBFA 4G2TA 2CLKB 3ZXYA 3TR6A 2WHXA 4R68A 1VECA 4KVZA 3WA7A 5ALZA 3BREA 5KSZA 3LYLA 4V0ME 1MXFA 1GPLA 1Z4MA 2QM8A 4F4DA 1EE9A 1XLVA 4C87A 1K2WA 2IYYA 1S2MA 3GARA 4DW8A 3BH7A 1B93A 4TTIA 3VNQA 3WIVA 1FNDA 1DBWA 4Q9DA 2SKEA 4NQRA 3UMJA 4GBJA 3WYDA 3TUIC 2HEGA 1XZNA 4A0HA 1FXWA 2DP4E 1E2LA 1TIKA 2AD5A 2Q4EA 4NQZA 1XTZA 4IWNA 1EFCA 4K9NA 1G9SA 5BQOA 3U3KA 2D3WA 3IB6A 3CS3A 4Y67A 4GI2A 1QHYA 1IULA 1TU0A 1BX0A 2G71A 2WFLB 4GM0A 3WKCA 3A37A 1JPJA 1FRVA 4N3NA 1A7JA 2UYOA 3FZNA 4DE5A 2JI6A 3R3HA 1GR1A 3D64A 4J2TA 1DBPA 1WUIS 2BEJA 2NTYC 3G23A 2VDMB 5F1KA 2X4GA 5J2UF 3B12A 1W2WB 4IJVA 2IA5A 2YDXA 4RMJA 421PA 5CDSA 1W4CA 3UATA 2VJQA 1Y1LA 2ODTX 2G67A 1NN5A 3N1UA 3EEOA 3PFFA 4X20B 2B5WA 1ZD3A 3KEMA 5IFLA 5IG2A 1JAZA 4HMOA 1OWMA 1NXSA 2BY4A 4R8SA 3AR4A 1PEAA 4U00A 3QK7A 4DM4A 2MOKA 1FDWA 3QBJA 5KYVA 5AQ1A 4EA9A 5TEWA 5KPJA 1TGVA 5DOVA 4PGHA 3EBLA 1Z37A 4WTOA 5IANA 1AA6A 2JIZD 4UVEA 4Z0NA 1ZJJA 2C1XA 1YMVA 5JHGB 1QH8B 1YBMA 2RJ3A 1W93A 3S2IA 1Y5IA 1W4AA 1EESA 4QG3A 1U6IA 1TCAA