2IQ9L

Pfa2 fab fragment, triclinic apo form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
molecule keywords IgG2a Fab fragment PFA2 Kappa light chain
molecule tags Immune system
total genus 52
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iq9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iq9L01
1KTLA 1FFQA 1QKZH 1GOHA 2BSED 3SY0A 3BH8A 1HXMA 2AJ3B 3DOSA 4JB9L 5I8OL 3TGXA 2GJJA 3O0RH 3QWRD 3AREC 5E0QA 1EO5A 3Q6FB 4YHPA 3MBEB 3P4NB 5CSBA 3WS6A 2DICA 3CDGA 3GGWB 3ULVH 3C09C 3RFZC 3GJEA 4P4RB 4O00A 3RWHB 2R0WH 5GRYA 5ACLA 3B9KD 4YZFF 5BMFH 3IDGA 3SGDI 3CLFH 3FO9B 1CFTB 1II4E 3D48R 4QNPF 1AGDA 4LK4A 4NO5B 4MXWH 2D31B 4FFZH 4YH6A 4Z0BL 2NY6B 4C58B 5C0IA 2YD2A 4YHYB 1YC8A 3P3YA 1HYRC 5CGTA 2KDGA 4UTAL 1I1YA 2X89A 4PJDA 3RZWA 2GFBB 4LCCC 4PRPA 3QG6B 3QIBC 1FNSL 1HHJA 2Z35B 3GHEL 5DRWA 3REVA 4RCAA 2O26U 3LQAC 4K23H 2YRLA 2YSSA 3LAFA 4MSWA 2PXYC 4XBGA 1A9BB 2NLJB 3FOMA 2AXJA 1FNGA 1JPFB 3PWLA 2CDEA 3TO4C 3RL2B 1M1SA 1QRND 3UO1L 3GBLA 3QG7L 4B0MM 5L7XH 2QKIB 5FA4B 3IDNB 3BXNB 4KMTH 5J1SC 2GITA 1JWMA 1RUQH 4JQVC 3BESR 2L0DA 4FRWA 5DJ6B 3OKKA 3ULSA 3RDTC 4H5SB 4M93C 3MUGA 4NZTL 4ZFZB 4OZHF 1DVFC 2PR4H 3K74B 4CJ0A 4NO3A 2OL3H 1N59B 4ZAKB 2BVUA 3OR6B 3UCRA 1EZVX 4YQXL 2X4UA 4LCWB 4QTHA 5T1DL 1IC7H 5D70L 4R3SA 1NQBA 2BOCB 1QRNB 2ED9A 3MV01 4KH2A 2F58L 3KJ6H 4OFYD 2H2PC 4YK4B 3T1WA 1WC7A 3TPUB 2X09A 5H2BB 1JNNH 5EZOL 5C86A 3DIFA 2HKFH 3FZUC 4OZ4B 2ADIA 3S7GA 4DUVA 1UB5A 4KI5F 5D96B 1WWAX 5DJXB 2D7PA 4DKEL 4WI3A 5CEZD 2BP3A 5D2NA 3D39E 1C5BH 3OR7B 1IZKA 1MH5A 3FQXA 1B4JL 1OT2A 5C0AE 4JPIA 2HP4A 4LQFH 2HN7A 1GGBH 2D4DA 4IM8A 4NRZA 1Q9KA 1M7XA 3FN9A 4PB9L 4YC2C 4D9RE 3V5DA 2F15A 1OL0A 4MJ5A 3L5XL 4Y88A 5HYJD 2HYMA 4EN3B 5HHME 3L3GB 1FO0A 1U8PB 3WIIL 3I02A 3KS0H 1WWBX 3MCLH 3SBWA 1FYTE 2H41A 4FABL 5DTFB 2VL5B 4KXZH 2DJSA 4GKZB 4F7CB 4MD4B 3LPFA 4X6EB 5K9QI 5JQHC 3P2TA 1ZS8A 2PTVA 2R4RH 3HRZA 5GS1B 2NMSA 5FO7B 1KLGA 4JPVL 5ILTL 1HH6A 3VXRE 4L3ED 5FB8A 1N6QL 3IDJA 1LO4L 5C9KA 5EO0B 3TJEH 1MLBA 3VXSE 4W6XB 2CQVA 5T5NF 3ARTA 5C08A 1NC4A 2ADFH 1MCJA 4GS7B 4ISVA 4PRNA 4PJHE 5HYJB 2BSTA 2XNAB 3P30L 5DD3L 3TM6A 5CD3B 4Y5VA 3VI4E 4Q7DA 2VDPH 2J3SA 3WFHB 5TFSL 4NRYA 3IXTB 4ZOCA 3HTLX 4N5UA 2DAVA 4Q9QH 5CJ5A 4J23A 3TYFB 4I5BA 1G7JA 3H3BC 4IOIB 5KSUA 1EGJL 3MLVH 2P5WB 2IG2L 2FEDC 4L3EB 3IDIA 5EU3A 3RJQB 3UPCA 2E9IA 4KZDH 3P0VH 4GRLA 2XXCB 4LRIC 4PB0L 1SBSH 3G5XA 5T1KD 1OF2B 5HHOB 1Z3GH 1ETZA 3HNVH 1IKNA 2OTUA 1QLRA 5HDLA 1JNJA 3R0NA 4WDIA 2IPTH 2V2WB 2FGWL 5A2IH 2V7HB 1DN0A 1V3JA 2AKRB 3KPLA 2I5YL 1VKXA 1HOCA 1Y0LB 4Q97A 4F8TA 4NT6B 4P2OA 3WLWC 2GUOB 4LPYA 1ZOXA 3Q0HA 3MA9H 3CFBA 1MWAB 2UZIH 3QHZL 1SVZA 3PE9A 4JFOB 1A0QH 1XT5A 5KS9F 1L0YA 1FP5A 3D9AL 3OB8A 3SKMB 4OI7A 3UDWA 1FQ9C 4L9DA 4JRYE 1IGMH 1D9KB 4RISL 4H26A 1TJIL 4UUJA 1EAJA 3GSXB 5T1KB 1IKFL 2ZKHL 3HNSL 3KXFA 1V3KA 1PKOA 4LCUB 2XY2A 2QQLL 3BN9D 3FRUB 4HJ0C 3LEXB 3KVQA 1EHXA 4ZS7H 1JMXA 2FJHA 3CPLB 4AEHH 4M7JH 3H3PL 2I24N 2DOCA 5T1LB 3RUGB 2DQCL 1HHHB 2PW1B 2G5BB 2Q7YA 5M94B 3QI9D 1FLTX 3JWOC 5IROC 1MJJA 4KKBC 4S1QH 2HFFB 3FQWB 3HA0A 5JW5B 1MFNA 2AGJH 3TO2A 4JY6A 1FVDB 3OAZK 3L3OA 3L1OH 2QJDA 1OW0C 2O93L 3ARGD 2V7NB 1X7QB 3MBEC 2Q76B 4P2RD 4Z7UE 2HRPL 4P23A 4ELMF 2BVEA 1RUPL 4UILH 4IOSD 3ARVA 4KY1H 4XAWL 3EO0B 1WTGT 2HG5B 5I76A 3L3JB 1YNTB 5CSZA 4XCNA 3O11B 1F4YH 3U7YH 4ZD3H 3C8KB 1E0OB 2Y25A 3NCBB 5F96H 5JW3H 3E3QE 3FFCE 3IDUA 3EGSA 1PGRB 3CMGA 2YMXH 2NY6C 1FAIH 1HHKB 1EFXA 3O3DA 3QULB 5F9JB 4YHYC 1UWXK 5GS0C 4PJ8D 2CLZA 1RJYA 4TUOA 5LWYL 4IMKC 3ARGB 3PIQA 2PTUA 1FN4A 1U6AH 4LRNH 1VGEH 3A67L 1MCDA 3E0GA 1QPXA 4H25A 5J12B 2V9TA 4KQ4L 1P4BH 5DS8A 4Z78B 1EJOL 1RZKL 4WV1B 5JDSB 4MVBC 3UYRL 3SPVB 3CFJA 3RL1A 3O9WD 1MCSA 3T2NL 4JHWH 1KB9J 2Z31A 1LDSA 1HKFA 4JKKA 4ZFOA 1YQVH 2L7UA 2ZSWB 4I4WA 2QADB 4PY8I 1F4WL 1I1FB 5DFTA 4DVRL 2GY7B 5EH1A 5ESVA 4XAKE 4F2MA 1MHPH 4PJ8B 5FCUH 4ZXBA 5HI5C 4FTVA 4HQQH 4CGTA 3JV0A 4KUZL 3VXQB 4JJ5A 4ZAKC 3V52L 3BP4A 2J4WH 2UWEB 5KOMC 5EDXA 3HI6H 3LMJL 3I50L 4IRSA 4M6NL 1KELH 1JVKA 4FQ2L 2FEEI 4OBSA 1DBKL 1RQ5A 4N9GA 5I1HL 5EU6D 1HH9A 4WO4A 1LP9A 1MFAL 3MLXL 4YK4C 3MRPB 1HEZB 4RX4A 3ULUF 1RK0A 4PJIF 3HLAA 1U8JB 4HD9A 4F33B 2UYLA 2V5MA 4M62L 3RHWK 1AD9B 3PQYA 4OZGB 5D96C 5JIHA 2AK4B 1Q0YL 3MJ6A 3MOAL 3BGFB 3ZE0E 3X17A 3T0XA 3IGAA 4D0DA 3ARFA 4M6ML 4DCQA 2FB4H 1S78C 1U8IA 2ESVB 2H3NB 1T5XB 3GKWL 3Q5YA 2APXA 3MRGA 2BFVH 5IEHA 1T1ZA 5IVXE 1MCPL 3VXME 4EN3C 3S36H 4OFKA 4F8QA 1XGTB 2WWKT 4HFWA 4HXBH 3C5ZD 3SE8L 3Q5OA 5D5ME 5E94B 1SM3L 5FF6A 3P0YL 1L9MA 3KPOB 3RVWC 3VDAA 4LVHB 1FZKB 5I30L 2EDRA 3BW9A 4N0UB 1NSNL 5GS1C 1GC1H 3ILQD 3TA3B 3ELAT 5CP3H 5JTWA 3CSYB 5D6CA 3HE6D 2DKUA 4G6FD 3EO1B 3VWKD 1F97A 3PGCB 1FE8H 1IT9L 4QHKJ 4AIZB 3MJ8A 5DEGA 4Z5RA 5EU7E 3C08H 4KTYA 5B3JE 4NNYA 4GS7C 35C8H 5CGMA 4UU9B 3MRFB 2HT3C 3MYJB 3QWRA 4PB9H 1GHFH 4XC1L 1CYGA 5KAQF 1KIPB 3C5ZB 4G43A 5E7FA 4KVNL 5HHQA 3X13A 5D7IB 4NC2B 3BKYH 3BSZL 2FSEB 5E6YA 1YPZE 2OSLA 2NZ9D 1C08A 2EDXA 3B9KA 1G84A 3H9HA 1DBBL 1WEJH 1U8HA 3HZKB 1I7UA 3FT2B 1H15B 4J6RL 5EUKB 4PJAA 3VWKB 4PJCF 1YEJL 1A7BA 4H1LA 1UWEH 4TRPH 5T33L 5ILTH 3HUJE 5DRXA 3IDNA 1I7TA 1JNLH 4QF1B 1LMKA 2W1NA 5C8JB 4PJBE 4G80B 4NCC1 4OGAD 4MXQC 4MJ4A 3CSPA 3LKPA 3VFOA 1JMZA 4BQ6A 1NCUA 1OGAE 1F4XL 2ZCLL 2OLDA 1G6RA 4LSPL 3RWGB 2Y5TB 4FZ8L 1QA9B 1WUNT 3RTQD 4ZUTB 4Y4HD 4WU7A 4HZLB 5E95B 3GSOA 4OFPA 3QDMA 1RY7B 5F3BB 4GG6F 2JK5B 1JZ5A 1D9KC 4UIKH 1HZHL 1BD2D 3VE0B 4TNVK 2IEPA 4WFHE 4O2CB 4OCMC 4HLZH 4KDTA 1TCMA 1G0DA 3F7VA 3MRHA 3UTTE 4PRBA 3VD7A 4JM2F 3SOBL 2DQFA 1WBYA 2DI8A 4X6DA 4JN2B 4DFIA 4LVNB 3CVHB 3PP3K 4M1CD 3TJHD 1BX2B 1EEQA 1DQLL 5K9OB 1UA6L 1OTSD 2I5YH 4BFIA 3WLBA 3ESVF 5ITBL 2CK2A 4LLDA 3ULVC 4IOFD 1EBPA 4Y4HB 5DJ0B 4PJ9B 4PRAA 1Z6JT 3QHZH 2PYEE 1CE1L 1G9ML 4FP8H 4QGTA 3OHXB 3CFIC 2AJXL 3HR5B 1H8NA 1TJIH 2E27L 1WZKA 4EQ2A 4NKDB 1ZLVH 4XPHL 5T3XH 4O58H 2CUIA 1I85C 4LPCA 5MENE 3DX9B 1Z0NA 4U1SA 1MFEL 1RZ8A 2WUCH 4M7KL 4TTGA 1LO3L 5I15L 1YNLH 4BSWB 1DTUA 4U1LA 3T3PE 4WGVB 2DM7A 3EOBA 5IMOA 2OJEB 2JCCE 1T6VN 1R3LA 3GMRA 3BKCL 3NFNA 2AERT 4UDTB 4RBPK 5ANMA 3QIUB 3TYGL 4QXTA 4HJGB 1WVZA 2IADB 1VDGA 5DJCA 1YJDH 2K9UA 3ARGC 4HIXL 1JNHB 3RY6C 2W60B 4NGHL 4KK8D 1PG7X 4N0FB 5CD5D 1F8TL 2EH7L 4D9RD 3KR3L 4WW2F 2VLLB 5J12C 3TESA 5HHMD 1A64A 2DRUA 4WV1C 3PV7A 3HI1A 3VRIB 1FYTD 5F88B 4D9QD 3D0LB 1KULA 1WITA 2QADC 3VGHA 4DKAA 2ZUQB 2R0LH 5CGYD 4QHNA 3D39B 3U48A 1HWHB 2ZG2A 4YHIB 1BM3L 3MV9E 3GFUA 2YXFA 1LO0H 4PJ8C 3H0TB 3OF6D 5C0AB 2FBJL 4PJXB 1MHCB 3VXRD 4U3XA 3B3IB 4BQ9A 2EH8H 1PY9A 4FQJH 1QSFE 4GBXD 4KHXH 4APQD 1OARL 2E6QA 4ERSL 4S0SD 5FYKL 3AAZA 3VXSD 4LSTL 3KPPA 3QCTH 4I48A 4IDLA 3GSNL 2ZNXA 1QFUL 4J1UA 5IMMB 5DZNA 3SE9L 3A67H 5HHMB 4LBEB 4G8IB 5HYQB 5EC1B 4KAQH 5EUOE 1E4XL 4Z7WA 4OIAA 1RZKH 5MEPA 1FYTB 2JJSA 3HCVB 1YQ2A 2J6EA 5FOBA 4GLRI 3PABB 2VR9A 5E9DE 3RGVB 1E6JL 2A9NL 1JWUA 2YA1A 1F4WH 1ZANL 2CH8A 3DYOA 1C16A 5HVHB 1WK0A 1OLLA 1S8DB 1XF5B 4R90H 5BO1L 4APQB 4P48A 4K7PL 3VXSB 1G7MA 4LSRL 3X14A 3EFFB 1ZSDB 4PJHB 5D7SH 4HKZA 3OKYA 4YFLI 3BGFC 3LRSA 4YX2L 1HHHA 2JELL 1Q1JL 4J3XA 3ZYJA 1JRHI 1LK2A 4UT6L 4RMWA 4Q0XL 3IJHA 5ESQA 5DO2C 4I2XE 3SJVE 1H3UA 2LE9A 2X70B 3CK0H 5F1IA 1DBJH 5F7MC 4IEFB 4JE4B 5I1HH 4PGEB 1ZGLM 3MMEA 5IK3B 1NBZB 4U2YA 3THML 1BZ7B 4RFOL 4JM4L 1SEBA 3CGTA 3MRMA 4M9OA 4TSBL 1X7QA 1VERA 3N1MC 4KTDL 1ND0B 3IU4H 2BERA 1AY1L 5FYKE 1RIUL 1NCDH 4GSDH 1PX3A 3DVGB 1I3VA 2XTJE 5JOFA 4RGNE 4LVHC 4KK5C 2PKDA 2EE3A 3ZTNH 3RUGF 4J3UA 3ULVF 3AU1B 2PCPB 4OGXL 2CIKB 3QEUB 4ETQA 5EOQL 4OM1H 1Q0YH 3M1BA 3QI9A 1QSZA 3TA3C 3UP1A 3FB8A 1DEDA 4CRPA 4JR9H 5CWSB 3QNXA 4Z7NE 2EXYD 2IALB 3JWNC 1FBIH 4XPFH 2K7QA 4WFGE 5DR5H 2C7UB 5CZKA 5HGAA 4P2RA 2W0FA 1CXKA 3C5ZC 1BOYA 4JRYB 4YWGL 2MPAL 2C1PA 4OZFA 4KKCD 1JHLH 1BGXH 2JKXA 1AXSA 4EI6A 2L7JA 4D8PB 2GAZA 2OJZL 3OKDA 5EFIA 4FQLH 1U8QB 4KXZI 4NQSB 5AG8A 4OLXL 3T8XB 4QTIH 1MJUL 3ILQC 1HIML 4U1JA 1S9WA 4JFYA 3VWKC 4WHTA 3U2SA 3JVGC 3MLYH 1BAFL 3EDDA 1OAUL 4XZUA 3RJDA 3VRLF 4HDIB 1AGEA 1NGYA 3R06B 4MLIA 5B21A 2VJXA 1CBVL 3FFCD 1UXSB 2DQHH 2QSCH 4QLRA 3VXTA 3DI3B 5J7CC 5E8OA 5HBBA 4YPGB 4HIHB 1NGWB 1UM4H 3W5MA 2UY6A 3ARSA 4OTXH 1D5MB 5I0ZA 1U8LA 2FX8L 4WJ5A 4EI5D 2NZ9C 1ORQA 1MJ8H 3PGDA 3FQUB 3O9WA 3HHRB 4NJ9L 1A4KA 4NM8L 3G6JF 2VAAA 4ODVH 4AG4L 2ZCKL 3I3DA 3UTOA 2DF3A 5EOCJ 3QEHA 1ZTXH 3CXDH 1ZVSB 5IB3A 5MEOA 2J7LA 2VIRB 1OWWA 2QLVB 4JAMB 4Y1AE 4GAJH 2B20A 4OGAC 4UB0H 3FFCB 5DEFB 4LVNC 4PGCB 1AD9A 2DQIL 4H88H 4OCNC 4XXDB 4MJIB 5KVFL 4X0KA 4A6YL 4LGPB 2R56H 1F58L 1AGFB 3BWAA 3HZMB 4M5ZL 4PIRF 5JO5B 5ADOH 2Q8BH 4HHAB 5I8EB 1YEKL 4EI5B 3DBXB 5DA0B 1KIRA 5CEXB 5F7UA 4Y4HC 4NJAL 5ERWA 4PJ9C 4F58H 4LHUD 5D1XA 4X6BB 5EU6A 2D7TL 4MJ2A 3WSQL 2DDQH 4LVEA 1KLFA 5DMIL 2DYPD 1H8SA 3QXVA 4X4YA 1HZHH 1S7UB 2LVCA 4IDJH 4OF8A 3WFCL 1E27B 4PJFB 1HCFX 2NQCA 1HKLL 2OP4L 1DQQA 4M1CC 3UAJD 1NPUA 2CJUL 4L8CA 3S96B 1FZKA 3D2UD 2WQRA 5CMAB 5GRWA 4K2UL 1V3LA 4POZD 4RMUA 3NIFE 3N1PC 3TH4T 1RK1A 3PG2A 4GKNB 5MP6H 1GAFL 5EZIH 5JUEL 5C7XL 1A5FL 4K3GA 1ZGLB 2P42B 2CMRH 2DYPB 2A0LD 3QXTA 1CD8A 1CE1H 4P5TB 4UIMA 4PLJC 5GGRA 4DVBB 3QIUC 1A6PA 3SKNB 1KPRA 4MNGE 1NC2D 1DZBA 1NFIB 2UZXB 1R3JA 4CU6A 1KIPA 1X5IA 1LE5B 3G04B 4GRWF 4PV9A 2VXQL 4Y2DD 3D2UB 3FT4B 2GK0A 1LEIB 4ZTPL 3VXMD 1JPST 5EO1B 2V5RA 4AL8H 1MFEH 4JHZA 1F2XK 2ARJQ 2RR3A 2E9BA 1MRCH 3BIKA 4YBLB 5EUKA 2DLHA 3HE6A 4G3YL 2VABB 1RU9H 1RIVH 5D1ZD 4CVZB 4CVWA 4O4YL 5ALCH 5F70A 1CGVA 1MVFA 3C5SB 2QBWA 2ZUQC 5C2BH 1GIGH 1K4DB 1RUML 5D8JL 1ZHBB 3VG0L 2A83B 3P4LA 3TNNB 3WKML 1NC2B 3ZE1F 1AP2B 4X5XB 4U05A 4KK8C 1YMMB 4H20L 1OAQL 2CD0A 4QXUH 5CD5C 3HAEA 4NKOB 1AKJD 4NGHH 5ACZB 4Y2DB 3LZFL 5CIPH 4L3CB 2WBJB 3MJGX 2Y5TA 3VXMB 1F8TH 4WU5A 4MQXD 1T66D 5DHVH 2VERN 3MLWL 2Z8SA 3RNQB 3UPAA 1MAML 3TBWB 3VFSA 2B2XL 2X05A 2QQQA 1IAOB 3QUKA 5CGYC 4KZEL 3BVNB 4CNIA 4LLMB 3RGVC 4O2CA 4TPRL 1UQSA 4OLYH 1JF1B 3PWNA 4ZPVB 4P2YA 5B8CB 2NX5B 5HVHC 1INEH 1MELA 3ET9F 3IJYB 1IGTA 2FX9H 2OMNA 4HKBB 5E8NB 4APQC 3QUMH 2A73B 3W0WB 5F3HA 3GIZL 1I8MB 3UYOD 1AKJB 1OARH 4LSUH 2BVOB 1S3KL 3BDBA 4O02H 5EZLA 1QFUH 3RTQA 2O61B 1GZPA 2WIMA 3N85L 2CR3A 4L5FH 4JQIL 1OGAD 4J12A 4GQ9H 4HWUA 1GC1C 1BD2A 2BVYA 2G9HA 3VCLA 2CK0L 4XHQA 4BH8B 1JJUA 3G6DH 3RWFB 3TV3H 2NTFA 4OQTA 1E6JH 5GHWL 2G2RB 1RZFH 4FQPA 3RWDA 2AXGA 1M05B 1AGBA 5L2JB 4K3EL 2VXVL 3G6AB 5JZ7D 2BMKA 5IBTH 2X4OA 3O3EA 1MI5A 3HUJB 3I85A 3QEQB 5F89B 2NY5L 4LSRH 3UTTD 2A6DB 4G42A 3ZZ1A 4PJBB 5CINH 3MBXH 5DUBB 2BDNL 4LKXB 4KQ3H 4BELD 4NO0D 4RMQA 2DMBA 1OGAB 3OXRA 1Q72H 3E6FA 4YXLH 5E1AA 1FCGA 5F7DB 1N4XH 2CRMA 1PG7W 1J88A 3QPXH 1XR8A 1S5HB 5ENWA 1T5WA 1VEOA 4JDTL 1CG9A 5F7LB 4G8EB 3BPCA 3N0PB 3W9EA 2W07A 3ZKMC 1XF2B 2VWEE 1MHEB 3QFJE 5GRUH 2PYED 2W38A 1RHHA 4X7SH 1NMAL 3RIFF 4KTDH 4U3HA 3SDYH 4BZYA 4RWYH 3VFUA 1NKRA 2YUWA 4G7YL 1N6UA 5A2LH 2A77H 3CLEL 4MA7L 4NO0B 2CLVA 1G7PA 5MEND 4G8GE 3PP4L 4H8WH 2IC2A 5D7KE 4JZOA 1IARB 2IQ9L 4PLKD 1CFVL 4NDMB 4L9LB 5J4MA 3REWB 1ONQA 3LKRB 3F5WB 3KYMA 5C71A 4U6VL 1UXWB 1EEZB 2IFFH 4OF6A 3ZDXE 2PYEB 4PJDF 4G6KL 5C0DA 3GO1L 2OK0H 4F7TA 4KKCC 2UUDK 4AJ0A 5LKNA 2R23B 4U1IA 3T09A 4Y4KB 4YWGH 4P2CG 4LBEA 3V6OE 2ZUSA 5C0EB 2AJVL 5BRZA 4GAGH 5MENB 2OJZH 2ZOLA 3MLSL 4WHYH 4MXVE 1MJUH 2C26A 3P73B 3VFPB 4NQEE 5GGSA 3IDYB 4R7DB 3O3AA 2MCG1 3NABH 4P4KD 4XBEH 3VXRA 4XMLH 1JGEA 2JCCB 3SE4C 3E3QC 4GBXA 5DUML 3HZVB 2G60L 3MV9D 2Z0BA 3PHOA 4PJHA 1SVCP 2BNUB 3VH8B 2BNRE 4NQDE 5IVNA 5FEBA 5ELIA 1CTNA 1QSFD 3ZKXB 2BOBA 2B1AL 2FX8H 5EO9A 1JF5A 4BSVA 4LFHD 1OAKH 2P4AB 4X7TB 1JHKL 1ZEAH 1IGJA 2ZCKH 1G7HA 2DWEB 2FECI 3QBTB 2A6JB 4JVPA 4P4KB 3UTSA 3OKLB 1ED3A 5TQ2H 1VACB 2ICWJ 5CJXC 2XPGB 1OSZA 3UMTA 4BZ1H 5E9DD 3MV9B 5CKAA 1YJDC 2DQIH 4ODTL 1XIWD 1BWMA 3R4DA 2DJ4A 5HGBB 2FWOA 1PLGL 1NCWL 1UYWL 4OB5H 1UC6A 4X8JB 4ODWA 3C9NA 1NUFA 2X9YA 5LGJA 1OD7A 5IT2H 4NWUL 2NNAB 3BAEL 1KFAH 1N5AB 5DD6A 4KJQD 4TVPE 4P5TC 2DS4A 5CCKH 4JFXB 4WEBL 4HJJL 1V7MH 1QHPA 5EUOB 2ICCA 1AIFA 4WI9A 5A3IC 1OAZL 2K3TA 5JHDA 3UAJC 4N1HB 1FPTH 5DI8B 1HKLH 5E9DB 4BQCA 4IS6A 3KPMA 3CU1A 3DO7A 3D85B 5JXEC 5JPNB 2F54E 1UZ6F 1G7LB 5KSVB 4POZC 3VXNB 1Z5LA 4K2UH 2VDMH 2DQGL 3WEXA 1VGKB 4HBCH 3H9SE 1JGDB 5CIPB 4HWBL 1R0AL 2CDGA 4YBLC 5DURB 5FYKD 5ALBL 1IGYB 4FZEL 5EBGA 5B38B 2XTJD 1CLYH 3D25B 5DHVB 4RGND 3V5HA 3V4VL 1P7KB 2XWBB 4U6YB 1T4KB 5DGQA 5JUEH 5C7XH 2A0LC 1RZKC 4OUUA 3CC5A 1FL6B 1TZIB 1AR1D 1N8ZB 4RFEA 3F12A 3VFWB 1XAUA 4I2XB 1Q0XH 3KLHD 3HMWH 5F1KC 2P24B 4ZUWB 3SJVB 1QVOA 4MQSB 3INUL 1BZ9B 3QQ4A 4V2CB 1L7IL 4HIHA 1NGWA 4WFGD 4Y2DC 4U1HB 3RVUD 3DX6A 2WBJC 4Y5XB 3QRGL 5IJVA 5J0BA 3X3FH 1MVUB 4OQ1A 4Z7UA 3C2SA 1A02N 1FZMA 2IH1A 3TCLA 3G5YA 1BJ1J 1QACA 3GSNB 4RGNB 3ZE2E 4ORGB 3GSWB 4PG9B 4M43L 4FXGB 1BBJA 5A16B 4G9FA 1IFHH 4X4XB 5B22A 5B8CC 3Q6GH 3AXLA 1J11A 2J8HA 4DW2L 1B6UA 4Z7QE 3O6ML 5EU7C 2EDJA 4OF5A 3MV8E 2YN3A 3VGBA 4KGJA 1S7SB 4H20H 1OAQH 4LLUB 4XXCA 4EI5A 1NAKH 1T83C 4M6OL 2A9ML 5GGTL 1UG9A 1ZAGA 2WP3T 5KANG 3MXVH 1JV5B 3MROB 1A7RH 3FHAA 4YO0B 1K3ZA 1C7SA 1H3PH 1IAKA 4U6XA 1S7UA 1TQCB 2EEDA 1BMGA 5KANI 3L7EB 3BZ4B 5ACMA 4OLZH 1ADQL 3QH3A 4X9IA 4XWGL 4TN9A 3D18B 4MMXC 4U1MA 5IB5A 1F4AA 4ODXA 3UBXB 2MHAB 1MHHB 2AV1A 3TIEB 4LPTA 1AE6L 1IC4H 4QO1A 4OSUH 3S34L 2DLFL 1WV7T 3C60B 4Y1AD 4KKAD 5D71L 1G9NH 3DUHA 4EDXB 1S3KH 1S7RB 1HWGB 2LABA 2X1QA 4KFZC 4LHUA 4MA1B 2AXFB 4PRIB 5IBLC 1LO5B 2C4FT 2AI0L 1I3RB 4XVJL 3PDGA 2Y36L 3GMQB 1E6OL 4F15B 3WIHL 4JQIH 2FHFA 4KPHL 3TZVB 1D5ZB 2BNQE 4PJGA 3UTQA 2F8XC 5IKCB 3LKSA 1EAPA 4CADA 1F5WA 3V0WH 1LE5A 4Z76A 4JREB 2ADJB 1ZLVK 3KYNA 1Y18A 3NN8B 5JZ7C 3N9GH 1QR1A 5IF0B 3HC0B 4Y1AB 3MRDA 3X12A 1CDGA 1N6VA 5F21B 4X8XA 2YPKA 1R3IH 2NY5H 4XP4L 2I27N 1QZ1A 3V7AE 1BFSA 2ORBL 4QRQA 2GQHA 1NGXB 4E41E 5I1LA 4PYHA 5TPWL 5GJTH 3FRPG 3VD5A 1UH4A 4L9LC 4ODUA 5B4MC 1FORH 4U6HB 1U8KA 2Z92B 1KNOB 1CVRA 5DHYA 4J3VA 1M7IA 3BFOA 1G7QB 4CVXA 4JDTH 3EIFA 2V5SA 3GBML 5HPOA 5JIIA 3CZJA 3LD8B 1JIBA 1RIHL 3KNBA 2O5XL 1HN1A 4Y4KC 5IVXA 2BCKA 3PJSB 4R8WL 4KMQA 1FV1B 3ZMRA 1EJ6A 2X4RB 3PV6B 5D5MA 4I1NB 1A8JH 3DYMA 4NCDA 4NO2B 4G7YH 5D1ZA 4AH2B 5TDPB 1UJ3B 2VDNH 4LARH 1DANU 2GSIA 1PEWA 3KPRE 3L3KA 3KPSE 3A6CL 1U92A 4RMVA 3IDYC 3AB0B 1MCNA 1GOGA 1PY4A 3LHPH 4NHCL 5EOCH 4G6AC 2HFEA 4RWHA 4X6FA 2A73A 4XMPH 5LBSL 1K5NB 4NP4L 3GDBA 3EYQD 3K1DA 1TZGL 4S11A 5E2TH 1XGRB 2LAGB 4BUGA 4UMGA 4WUKL 2IANE 1GZQB 2HT2D 3ZKXC 3MNVA 2HLFD 4HC1L 2VE6A 3KWWA 4A6YB 4ZO9A 3ABZA 5IVZA 5C6PB 1MLCB 1YPZA 1LP9F 4XP5L 4DGIH 4OT1L 1AQDA 5BOZG 1NCBH 1SJHB 3TC9A 2EYRB 4P4KC 1NLDL 4TVPH 1UJTA 4Q6IB 1BQLL 1QBLH 1TJGL 4I0CC 1EEYB 4PGJA 1P7HL 2AK1H 2NY1B 3G5VB 3FQRA 3T4YB 3DRTB 2NY0B 3WNPA 1B0RA 1N2RA 1OGTA 4MX7A 4N8VA 3ARDD 3H8NA 1W0WB 3F7YB 5JLZA 1HQRA 3VFGL 4DN4H 3LN5A 1BVKB 1UKTA 3S88H 4P99A 3IAQA 3VW3L 3D5OF 3SKJH 2YHGA 3PWUB 1I8LC 5E5MB 5T3ZL 4L1DA 2AW2A 4XNXH 2JJUA 1X5AA 8FABB 1HXYA 3CFKB 1YNKL 1H0DB 3F7PC 2WINA 3PDOB 4MCZB 3VH8G 4R96A 2Q86B 2EIEA 4NQCE 1CICD 1OY3B 3QAZB 1EXUA 3S5LB 3ZHDA 4X98A 4LLVB 3QQ3A 3O2DL 3TT3L 1VCAA 4LASH 1K4CB 3OKMB 1JGUL 3ARDB 3UTTA 4O9HL 2H6PA 3TBTA 2W9EH 4ODTH 1BVLA 1RZJL 5IG7B 2NY3D 4G8FB 3FB6B 1A1NA 4XNUL 2P48B 5DDHA 5FUOL 5D2LE 1RULH 4DKFL 4U3CA 4KJQC 2JIXD 5EULV 1WBZA 4JZJB 2DBLL 4FFVC 5B39B 5I73B 1SY6H 3VFNB 3RA7H 1RZIB 3U0TA 2OTPA 3QIWD 1QFHA 4HS6B 3GHBH 1U3HA 5BV7H 4JFZH 2VZ3A 2PYEA 2KUTA 5IMLB 4WEBH 3N1QC 1CICB 3J8F7 1S7WA 2YA0A 3C6LA 5HHXL 1EMTH 4YDKL 5IGXL 5CJQL 4LFHG 4Y5XC 1IQWH 3Q5TA 2DJUA 4XNZB 5HYFA 3QFJD 1CK0L 1A7NL 4KVCH 5C0ND 1EUUA 4EEEA 4PJAF 1TFHA 2DQGH 1AD0B 2X7LB 2XACC 1MEXH 4PP2A 4RGNC 3WFEH 4QY8B 2ADGB 3CSBA 4DOHB 5T3ZE 2JIXB 1Q9LB 4O5LL 1HILB 5BVPH 1J18A 1CL7L 3V4VH 3AY4C 1ZWIA 1JUFB 3GI9L 4G6MH 1IGFH 1S5IL 1AR1C 3LKOA 5D7KD 3KLHC 2IBZX 1KCUL 2NTSP 1A7PL 2AXHA 2BRRL 1U8NA 3JXAA 3V6ZA 4YHMH 1U91A 3JTSB 3NFSL 1IEBA 2IQAB 5FECA 2VXUL 2X4QB 3ZL4H 3RVUC 5J8OA 2NW2B 5B38G 4DAGH 4XPAL 2F8OA 1P1ZB 3KHQA 4HUWB 2GHWB 2OR7A 3QRGH 2XFXB 5TJWK 5D7JD 1JYXA 1GPOL 5H37H 2V9QA 4I8DA 5EORL 3STZB 2C1OA 4P46D 4RZCA 3H7BB 1A2YB 3VMOA 3B9EA 4RAVA 4L29A 4RIRA 4ZOBA 4KJWD 1TQCC 2GTZB 1UM6L 4G8GB 4X6DF 4R4ND 3RPIA 4ZUVA 3OPZH 3PWVB 2Y07H 4DW2H 3MC0A 4NQED 3MRJA 1QNZH 1TTUA 1HYSD 3ARXA 1A6ZB 3TBSB 3C60C 5FM4A 3S37L 4K55A 3GJFH 1QSFA 1TLKA 1NKOA 1W0VA 2AEPH 2VDRH 2WWMC 4LCIL 5D7JB 4MA1C 2Q3ZA 3AS0A 2HMID 1ACYL 4QNPE 4GFTB 5DQ9B 4FQQB 5DRNB 4F15C 4NRXA 1N5AA 3MZGB 3GNMH 2BNRD 4ZQKB 4OV6F 4NHUB 4NQDD 3NH7L 4H8WC 3TZVC 2YK1L 1E4XI 1JTOA 2DLEA 1T7ZA 1SHMA 1CZ8L 2W59A 4L4VE 1FGNL 3BHBA 3H42L 3VXUE 4HUVB 2Q87A 1ES0A 4JREC 4NQEB 3TN0D 4HSQA 5HYIA 1XIWA 2H2SC 1A9EA 4DGYH 4JZNA 1HSAB 1PZ5A 4LLYA 1YZZA 1X5YA 1AE6H 4XCFH 3QO0B 2X10A 4HGKC 1HINH 4J8RA 3T4AA 3MFFA 3L5WB 5HHNB 4K3HA 1MPAL 2DLFH 5TDOA 1HSBA 1HDMA 5KTEL 3G08A 2BY1A 1GGCL 4WRLA 5EU4B 2MKLC 4UNTA 1DLFL 2BNRB 5DQJB 1LWRA 2XQBH 1XH3B 5DD5H 3UBXG 2IAMD 4MD0A 2CSPA 3NAAH 5BS0E 5EOTB 5I19L 3VFVB 4NC1C 4JANA 3K2UL 1R5IA 2N56A 5IEKB 3SKUD 1RMFL 4B7IA 1I3GH 3UBXI 2FD6H 3CX5K 3TN0B 4OZHE 4D9LH 3SDCB 4ZNEA 1B9ZA 3LD8C 4K94L 1ZXQA 2G75A 5DLMH 1E28A 2F53A 4DZ8B 1NFDE 1EDQA 4R26L 1KIQA 4YUEL 1PSKH 1UJ3C 2W92A 4KK6D 2BXYA 4KI1A 2F54D 1CDYA 2IFGA 3AB0C 1I8KA 3MA7B 2AJSL 3H9SD 1F45A 4M9PA 4HG4K 4JO2H 1IM3B 3DLQR 3SGKC 1NGQH 4QRPE 2EE6A 1FFOA 3WUWA 3S3PA 2VZ1A 4KI5E 1T1YB 2FH8A 5DJDB 3IF1B 1D5XB 3CAFA 2VXTL 3U7WH 4K3DH 4N0YL 5L88H 2F5BH 2E7HA 4EJ1C 5EBLB 5CZXD 4R8WH 2OZ4H 4Z7WF 4EVNB 1KG0B 1FIGH 4ONOA 5C0GA 4LSDA 3EZJB 2F54B 5IV2A 3BGMA 2V5YA 5IQ9A 4J3SA 5ADPL 3H9SB 1IQDA 1TETH 5FDWA 1MCOL 4Q6IC 2D03H 4N0CD 1NBVH 4YHNA 1A3QA 3QDHA 2C3VA 3VFRB 2NY1C 1WFOA 3LQAL 1H3WM 1AO7E 4W4OA 1VESA 2NY0C 4Y5YA 1L4IA 4NM4H 1DFBL 3EYQC 5TDNA 2FYYB 1DR9A 1EVUA 2GK2A 3VXPA 1TZGH 4XWOD 4ZFFB 3FCTB 5IHUH 1GGIH 3NGBB 4UDUB 2X44D 2YBRB 3MV8D 3BX7C 2H9GA 3GMQA 5E2VL 4HPOL 4BFGA 1BJ8A 2A74B 4XBPB 3DROA 4EUPA 3GMMA 4MAYB 1T1WB 4XP5H 5KW9L 1MJ7H 2YKLH 3KPQA 5EBWB 2AJUL 4UQ3B 1NLDH 2A6KB 3ZTJH 3QAZC 3SKOB 1YYML 1ZHLA 3D69A 5C0BB 3EOAB 2LTQC 5JORA 4JDZB 3SDXE 3HE7D 3ARDC 1OQOA 3IFOA 1KB5L 1G1YA 3MOBH 4QRUA 3EJYD 2XN9E 2YRZA 3LPGA 3TBVA 3VXOB 4WW1A 2YD7A 3MV8B 4OIIL 4OV5A 5J3HD 5DK0A 1LD9A 2XWJB 3VW3H 4JZJC 3F8UB 3ILPA 5HYSB 4OCXL 3OAYH 5I73C 2WLYA 4P5KB 1IEAA 4YNYB 3O4LE 1D5IH 4DQOH 1YEGL 1L9NA 5GIRB 1RURH 4E9LA 1AI1L 1CICC 5HGHA 4FXKA 2CDFB 4JN1H 5IESL 4OD2A 1XGQB 2DL2A 5D1QB 3GMOB 3FO0L 1WWCA 3HE7B 2ERJB 2BNQD 1I1AA 4YFLF 3OX8B 4UTBL 4XNZC 3OZ9L 5I2IB 4WI8A 2FL5A 4F7EB 4GQPH 3KLSA 5KS9E 1T2QH 1UEYA 2HTKD 1NCCH 4ZUUA 2CUHA 1K9TA 1MF2L 4XH2B 1F6AB 4XNUH 1DQMH 1IM9B 1QG3A 1QO3A 3O2WL 4JDVB 4C59B 1J7VR 5HDQL 1BJ1H 1KTDB 4YFEA 3S5LG 5KG9A 1IL1A 5E08L 1KTRL 2DBLH 2PTTB 1LO2L 3EYVB 2D7NA 2EDTA 1R3KA 2ZUUA 4N8CH 1KENL 3QUYB 3RWJB 5GGUB 1I4FA 2XWTB 3T0EE 3NZ8A 4MNGA 1U8MB 3NA4A 4HKXB 2VWEC 4F57L 1J1PH 2VLKE 1GZQA 5B39G 3P9LA 3KYKL 4L8BA 3U4BL 5L9DH 3BRFA 3MODL 2Q1EA 1WZ1L 4YPJA 1P84J 3IKKA 1G9NC 2HH0L 1ZHNB 3GJFB 1KN2H 1AGCB 1D6VH 3U9UB 4U2ZA 4OKDA 4F9LA 2A38A 3CX2A 3TIDB 1QPPA 1FH5L 1LK3L 1N64H 1QUNA 5FHAL 3FN0L 1QBBA 1WAAF 5JHLL 2ZSVB 4E41B 5HVWA 1Z9OA 1DBMH 1KCVL 2FJFA 3G5VA 3KPRD 4ELME 4IMLA 3KPSD 1SYVA 1L7TH 2BRRH 1CCZA 1LEKB 4YDVB 3NFSH 2VOTA 2VXUH 5DK3A 4O2EA 1EHLL 2ZG3A 4J2XA 5D7JC 3UEZA 1CI5A 4ZPTA 2GW5A 3BH9A 2AV7A 2YEZB 3SDDA 2NY5C 1CFSA 1A6TB 3V6OC 4U31A 2IAND 1KF9B 4KJWC 5FUCE 3E6HA 3L9RB 3TNMA 1XCTB 2BSRA 3FOLA 2C9AA 1ITCA 3KPRB 2E7LA 3LY6A 3KPSB 1B88A 1HYSC 4M5YL 4LLVA 4IRZH 1I9JL 4HAGA 1XF4B 2DQUH 3LS4L 4TQEH 3WIFB 4CL7A 3HMXH 1FDLL 5JPMB 5ID1A 5TF0A 5I1KH 4PTUA 4NSKB 3RY5A 3OJDA 1PYWB 1F90L 4P9HH 4HCRL 3MV7D 1BJMA 3PWPB 3U6RB 2H32H 3P0GB 4LCIH 4ZTOH 3LKQA 4OCWL 1ACYH 3PHQB 4PLOB 5MEQA 5EN2B 4M8QA 1YY9D 1VFMA 3BPLB 4V1DD 4MCYA 3CUPB 3HN3A 4LIQH 4P3CL 3MO1A 4MA3A 4Z7VE 1T0MA 1ZT4A 4PRDA 1RJLA 5GJSL 1MRFH 3TN0C 5CJOH 3SDCC 2GCYB 1NL0H 3H42H 5IR1A 3F6IA 5ISZE 1QLFB 5C07E 2ID5A 4Y4FB 2VISA 5DYOA 4FQIH 4FNLL 2AABH 4GRMB 4OIBA 2VH5L 4QHUA 4NQCD 1AHWA 3FO1B 3RI5K 4ONFL 4JCMA 5EZJB 1CU4L 1F11A 4C83A 4CMMA 4OLUH 2DKSA 4M48L 3OBAA 5FKPA 5DJ8B 4C56A 2JIXA 2WIIB 5I8CA 3DV4A 1WT5C 1YEIH 4OGYH 1INQA 3MGAA 3O3UN 3QIWA 2Q6WA 3EW3B 2P5EA 4NNPL 5SWZB 4GMSL 3MR9B 1DDHA 4PJIE 2HT4C 1T89A 4UOW1 2E9WA 3LRGA 2IQAA 32C2B 4JFEB 3DXAE 5CBAA 2FZ3A 1LEGA 4RNRB 3VRJB 3V8OA 3QFJA 3KYOA 4K94H 4TULH 4I77L 2FEEL 4NQCB 1EPFA 3NPSB 3QUXB 3MJ7B 5K59F 2ICWB 4BZ2L 1YY8A 4OCLC 1IILE 5TQ0H 3WO3B 3GSUB 4F9PC 3DUUA 2EDOA 3U4EA 5GS0L 4I0PD 1IVLA 3WN5B 5F9OL 4JRXE 4CW1B 3L7FB 5DK2B 4O2FA 3HC4L 3CU7A 5IW6B 5D2LB 3G5ZB 1WSST 4PJ7A 1GL4B 1QYGH 5T3ZD 2AAVA 2I07A 3JV4B 4UINL 4OLVL 3T0AA 4RAUA 3V6BR 4JG1H 2XKNB 1MREH 3C5JB 4WFEE 5LAXA 3O6KL 3HKFA 1AC0A 2DD8H 3BOVA 3FO2B 1MUJB 3QCUL 4HEME 4QRRA 1P6FA 2AJZA 4PGDA 5CZXC 2MJWA 3F6LA 4CN4A 2NR6C 1NDMA 1PD6A 3CCHB 3IFNH 3F58H 4GUPA 5DC0A 4P46A 4WI6A 4MAYC 3BD4A 3CDCA 1F3JA 5SWSE 2NY2D 3EFDL 3D0VB 1OB1B 1DUZA 4N0CC 5ICZA 1WIPA 3S35H 2KZWA 2CKBL 4K7FA 4NQEA 5IOPB 5DA4A 3PGFL 4FXLA 4FA8A 2APFA 3CNKA 43CAB 1FNHA 1KCLA 4JLRA 2NY7L 3MRBB 5EBMA 2W65A 4YHKL 3QO0A 4XWOC 2Y06H 3FB7B 1BOGB 5GRJH 2VITA 5D6DC 4HH9B 3ARWA 1YUHA 5DMYA 4PJCE 1XF3A 4G5ZL 2CXGA 2BNRA 4UT9H 3PWJA 1A1MA 5KBNC 4NQDA 1S7TB 5J6HB 2MKWA 3T1FB 4BH7B 2ZOKB 4XPTL 5BW7A 3T3ME 2DLIA 2HLAB 1NJ9B 2DN7A 3QXAB 1A7OH 3VWJD 4TYUA 1U58B 4MNQA 5D1QC 3HE7C 4NQUA 3IXAB 1IEHA 1T20B 3U83A 4BKLA 2ERJC 3OG4B 1NCAH 2OXGA 4L4VD 4OD3H 2UZYB 2DTML 2M8XA 3BP7A 3VXUD 5JMRA 2R8SH 2BY3A 4TUJB 3LIZL 2LQRA 3K81A 5BZWA 3MACL 1PKQE 2IAMA 4L8SB 3GMNB 1KCSH 2YWYA 4KJYA 4R9HA 1DL7L 3A0OA 1H8OA 3VWJB 3IB4A 3QUYC 5JOPE 4FQXD 4ELKB 1D5XA 1MCEA 5BS0D 4LCWE 3X11B 1AFVL 4TSAH 4M00A 4L4VB 5HYSG 3FL7A 5E00B 1NBYA 1QSED 2HTKC 4JG0H 2BVPB 3I9GH 5KSBA 2J1KA 2VRAA 3O8XD 1MF2H 4DZBB 4OAWB 1S9XB 3CDYA 3U0PB 3U46B 3H9SA 4FMKA 2FGZA 4PRHA 1RUAH 4M1DH 4N1EA 2BY2A 1M7DB 4KU1A 1Q94B 3W9DA 5LXGH 4U1KA 5F72S 5FUZH 1XZ0B 4BK5A 3K4DA 3BJ91 5HY9A 4FQXB 5BZDA 2VC2L 5BS0B 2ARJA 5DJ2A 4IRJB 1KJVB 3VI4F 4DGVL 4WFFE 4JVUA 4ZFFA 2KBGA 4QRPD 4RMSA 5H37G 4LSSH 3BZFB 4QHLA 1DQDL 4KI5D 4OZHB 3DRQB 4R7NB 5HHPB 2MMXA 1L0XA 1WZ1H 3HS0B 3O45A 5LGHH 5BJTA 1UZ8A 4PLNC 4BM7A 1TQBB 2H32B 4Q74A 1ERNA 1TNNA 1RVFH 1V7NH 1VADB 1BIIB 2FNBA 5IFJB 1I7RB 3QUZA 1T03H 5ESAB 1T7WA 1A3RL 2VLRE 4YIQA 4JO3H 3LB6D 4FFYL 4LEXH 1QSVA 3L3HA 5F71A 4AEIL 2D3VA 1OTUD 5FYLE 5KN5B 2FO4A 4U1NA 3MRIB 5I1EH 4JQXC 4MJ6B 3KHOA 5TH2A 5DQDH 4ZO8A 4A2MA 4P5MB 2E7CA 4XNYH 4L4TA 4P0DA 2UVEA 2PYFB 5AUMB 3EAKA 1K2DB 4PGBA 3V7AG 2XG5A 4XP6L 1AO7D 3ZDYE 4ZG1A 3GRWH 3QEGH 2QQNH 3E8UH 3I3EA 5ETUA 5FO9A 5H94B 4Z0XB 3RWIA 1UCBL 2AJYL 3SGJC 3ARBD 5J1AB 3R1GH 3D3VB 3BPLC 1MQKH 1T3FB 1MCQA 1MIEH 1QKZL 4HWBA 4ALAH 5F44A 4MWFB 5J56B 2VDOH 5ECJE 3S3JA 2VYRE 3ULUH 5HD8D 1XGUB 5C0CE 1B3JA 3P4MA 3BYTA 2VZTA 3GMOA 2ITDB 3ULVL 4Y4FC 4M5YH 2P5WE 4HS8H 5INCA 1FG2A 3QDGE 1BZQK 2V17H 2R0WL 4OD1L 3V4PH 3I6GB 4JO1H 1AO7B 1HQ4B 3OXSA 1EHNA 4LSQH 1J8HB 1IBGH 5BMFL 1ZHKA 4HCRH 4EXKA 3BIBX 1FNEB 2GSGA 4QRSB 2Z91B 2FH6A 3FMGH 1PJ9A 5C0RH 5IB1B 2X5PA 4MXWL 4OKVB 4YXKL 1XGYH 4FFZL 2XN9D 4HV8A 4WUUE 2IMMA 3IDMB 3EYVA 2IH3B 2R0KH 4P3CH 4R4BB 3UROR 5J06A 5ID0B 4S2SB 5DJZB 3SCMD 1KJ3H 5FK9A 4JKWA 2BNQA 3O4LD 1NAMA 5C92A 1DBAH 4CVUA 3QIBD 4K23L 4LNRB 3C6SA 2B8OT 4K71B 3O6FD 3NPSC 2V2TB 3QUXC 1Z2KA 1JGVH 4X9FA 1ZHNA 5F1NA 3TO4D 3U9UA 3WN5C 3VDBA 1CU4H 3WJJA 1IGCH 2J8UA 3RU8L 2AEWA 5GGTA 3JTTA 5L7XL 2XN9B 1U8OA 4HIIB 1X5KA 4GW4B 1P2CB 3ES6B 3ROLB 1BFTA 4N9OB 2OS7A 4M7ZB 1BWWA 4KMTL 3SCMB 3QDJA 2V6HA 4P59H 1CD1B 3I3BA 1R5VB 5INDA 3RUGE 3ULVE 5C0JB 1FC2D 1M71B 3O4LB 5JOEA 4KJPC 4M7LH 2PR4L 3UJJH 3F7QA 2OL3L 5FYJH 2P8MA 4GAYB 4ZUSB 3KDMA 3WE6B 4EKXA 1DVFD 2IPKB 3O6FB 2CIIA 4OF7A 4FFWD 5IWLA 1IC7L 2KQNA 1JYWA 2Z93A 4I77H 1JPGA 1D5BA 2PW2A 4XRCB 3TO4B 4OJFH 4BZ2H 3MUY1 4UBDD 2VLKD 2XG4A 3KJ6L 2EIZB 5KS9B 2YD8A 3JBG7 3EJZD 1YDPB 4XNQB 1Q9OA 1GYAA 1Q9WA 3L9RA 3FB5B 4FHBD 2H2PD 1JNNL 2JLLA 4MA8L 2HKFL 1OP9A 2IJ0C 1XF4A 3VFTB 2XICA 4HK3N 3MLZH 2EKSA 2X4NA 3SGEH 1CLOH 3GSRB 2EC9T 3OGCA 3M17B 3LDBB 4YDJB 4XCEA 1C5BL 4GW5B 5GSVA 3GJFK 3B2VL 4I18A 2Y9RT 3T0EB 2D0FA 5J13B 5KJRH 1KB5B 4LQFL 1FVCA 4JY4B 2IANA 4FS0A 1GGBL 3VRLE 1ZKAA 1P69B 5H35B 4PJGF 2I9LA 3AM8C 1S9YA 4FQCH 1QFWL 2GCYA 3T04D 2W9LA 3MCLL 4KUCD 4FG6D 3MJ9H 4HK0A 5DMKB 1ZA6B 1P4LB 2J5LB 4GKSB 1MRDH 4ONHA 5FHBL 4GRMA 2VTFA 1GXEA 1UB6B 4NN7B 3MV7A 1C12B 2B4CH 1P9MA 4YHKH 2WSKA 1CLCA 1NDGB 1F6LL 4Y16B 5DC4B 3SDAA 4ELMB 4JFPA 1J9CT 3G6JE 3CH1A 2H26B 4UQ2B 1NLBH 1X4XA 1T7YA 4V1DA 5CS7A 2ICES 4L8SC 5CHNA 2VQ1B 1FL3A 3TJEL 1A4JB 4XPBH 3P77B 5HJ3A 2ADFL 2BJMH 3LV3B 4D0BA 4HUUB 1CWVA 2R2HA 3MREB 5AD0A 2Q7NA 3VWJC 3DV6A 4NZDA 4X7CC 5C0FA 4KRPD 4XHJD 5TE7H 1BQUA 4FMFA 4NKMA 4S1SH 5IVXF 2VDPL 1RUKH 3P9MA 5K9KB 4ZS6C 5GSRB 5D5MF 4HT1H 3OKOA 5F1OB 4Q9QL 3Q1SH 3CFEB 2DTMH 5ISZD 4MMZC 1T0PB 3O3BB 3MLVL 5C07D 2X4SA 3CZFB 1A6UH 2X4PA 1AH1A 5LG1A 1JHTB 25C8H 4KZDL 5DK2A 2DWDB 2GY5A 4HC1A 3V0VB 4MQ7B 1SBSL 3FJTA 3GIVB 1Z3GL 5DJAA 5J9PA 3HNVL 4XCYA 2PNDA 5D2LA 4HIJB 1A3LH 3U36B 4KRPB 2IPTL 2YPVH 5F1SA 1MCWW 4FQXC 4QT5A 4E5XB 4N90E 1RAMA 1O7SA 2G5RA 2D7QA 1SJEB 3QZWA 4IRJC 5FYLH 4U49A 2FX7L 1U93A 3MA9L 1ZA3A 3QJHA 2UZIL 4NQXA 2ESVE 2E8YA 1A0QL 1YPZF 3AS3A 3DXAD 4HEPG 5C07B 1M6OB 1T04B 3PL6B 4I0PA 4ZYKA 4P9HC 3MCKA 1ACZA 3B9DA 3TBYB 5AAWA 1XGPB 1RHFA 2OTWB 4UAOB 1AQKH 1CIDA 1TZHA 1KTKE 2GT9B 5IOPA 1OPGH 3DTXB 4Z95H 5ICXB 3RWEB 1CL7I 4E0RA 1KEGL 4JRXD 43CAA 4P2QE 5EIVA 4LEOA 5EWIH 4LSVH 3STLB 4ZS7L 3LN4B 5SWQB 5EPMB 3FTGB 2RFXA 4HJ0D 3U82B 4M7JL 4PJIB 4X6CF 1FZOB 1YEDA 1CT8A 4HMEA 4KI5C 4K7PX 3MLTA 3O2DA 4F7MA 1DQJA 5IJKC 4Z6AT 3L5JA 3W5NA 4HFUL 4PUBH 4NUJB 4WFED 4S1QL 1W72H 3D6GA 5T1MB 4WTXA 4LLQB 2VB5A 4AIOA 4PREB 4O51B 1J1XH 3L1OL 3U9PH 3T0VA 2YD9A 3GMLA 4YHOH 3LB6C 1CGTA 4WTWA 1J86A 2MQ3A 3FT3A 3OB0H 5I1IH 3DX7B 5FFLA 4FFYH 5SWSD 3G9VA 4UILL 2GJZB 4KY1L 5K33A 1CE6A 5HI3C 1KJ2H 4LF3A 4HK3J 2P8PA 4W81A 3ZYOA 4Q2ZB 1F4YL 3RRQA 3L95A 3VJ6A 4ZD3L 2VLJE 4K94C 5F96L 3IJSB 3VA6A 4PP1D 4XP9H 3TP4A 2H8PB 5EIIB 4JPWH 3T77A 2FLBT 5FV2A 1UCBH 1ZT7A 2YMXL 1FAIL 1OSPL 3KJ4B 3ECBB 1NANH 3OAYK 3VD3A 4ZDHA 2NY6D 2YC1A 5HD8C 1OT1A 1FG9C 1LVEA 5GS0D 3MRNB 4PR5B 1A1OB 3ROOA 5KSAD 1U6AL 3T65A 3V5KA 3QFDB 4LRNL 1VGEL 5SWSB 2R1XB 4JKMA 1OTTD 3BRDA 3VXUA 1JI1A 1P4BL 4K71C 1KPVB 4YJZL 1QR4A 4M61B 5EC2A 4KMLB 4OD1H 1B0GB 4JHWL 4MVBD 2APWA 1YQVL 1U95B 1SBBA 3U0PA 4HWZB 1CLZH 3QO1A 4YXKH 1MHPL 4PJCB 4M7ZC 5FCUL 3JWDH 4HKJB 2GKIA 2WLZA 4RQQB 3SCMC 4GW1A 5HGDA 1NAMH 5ITFA 3DECA 2H45A 4HQQL 5KSAB 1KC5H 3WNNA 4D0CA 3T0DA 5HI5D 1S7VA 4QHMA 2Y7QA 5A43C 8CGTA 4JM2D 4HX1A 2SEBA 3WJLA 4XGZB 3P4OB 1CGYA 3BP5B 1KT2B 3BDXA 1NGZB 1QSEA 1T21B 2J4WL 4AT6B 3O6FC 1CD0A 3HI6L 4F37F 1H5BA 5JOPD 4ZAKD 3MQIA 2HWZH 1KELL 2BC4B 3JV5A 1EFQA 4LCWD 3O8XA 2DQEL 4HS3A 5T5NG 2HJFB 1CGXA 3OJ2C 1NFDA 3WNLA 5LQBH 2HVKB 5C9JB 3GMPA 3BMVA 3RU8H 2JF1A 4NQTA 4GOSA 4GG6B 1RZGB 3DMMB 1H3GA 4NNXA 3DVNB 3QT2A 3MRKA 5JNYA 1N7MH 1PKQB 4NC0B 5KN5A 3WBDA 3TPKA 3DGGA 3NCCB 5JQ6H 4JM2B 3B9VA 4GG8B 5I18H 4QRPA 2CKBB 3LDBC 4HGMA 5C09A 2NY4D 2D0HA 5I16A 2NW3A 4FFWC 1JK8B 5E8EA 1MIML 4Z0XA 5E6ID 3T0EC 5J13C 2FB4L 3OSKA 3EYFA 5J1AA 4UBDC 2OQJA 2HVJA 5I66B 5E99H 1RZ7H 1S78D 3UPRB 4K8RH 3EJZC 5CEYA 2BFVL 4PBXA 3S36L 3MNWB 2YWZA 1TJHH 5CP7B 4Z77B 1G7IA 3LQZB 4EOWL 4HXBL 2DI9A 1IAMA 4EN3D 4MA8H 4HUXA 3BQUB 4U1GC 2J5LC 1SYSB 4HIEB 1FRGH 4NN7C 2X4TB 3FQTA 3RVWD 3UC0H 2NY4B 1XCQB 2VLRD 4Y16C 5DFVD 4JFFA 3WHE0 3BIAX 1GC1L 3HPJB 1JP5A 1YEEH 2N1KA 5FYLD 5E6IB 3ALXA 4YBHA 1HI6A 3ARBA 3B2VH 5HXMA 2I9TA 4IIQA 43C9B 2K7PA 3DX8A 1GVIA 4PJXE 1FE8L 3ALPA 4TSCH 2MOVA 3LN9A 4X5WA 3C08L 1CR9L 3VMPA 4P3DB 1FO0L 5E8PB 5FKAB 5J89A 5CJBA 2VDKH 4LCYA 1REIA 35C8L 3DURA 2ZWLT 4Q9BA 3AVEA 5DJZA 4MDIB 1GHFL 2RGSA 1NCTA 1PG7H 4ODBD 1FZJB 3GSVB 3DETD 2HT3D 5FGBC 5AYQA 4YR6B 4FG6C 3AREA 1MY7A 1F2QA 3UZQA 1QFWH 3HG1B 3BKYL 3HPLB 4KV5F 5FUCC 2P7TB 4NZUH 4X99B 3BO8B 2VLRB 5FHBH 3SE3C 5C0CD 4PY8J 1WEJL 3SDXA 2YPLA 2J88L 4WW2B 2QTEA 4HBQA 1J0ZA 4TRPL 2P5WD 1UWEL 3GK8H 3LKNA 1CDUA 3QDGD 3I6KA 1KEML 2W9DH 3MLUH 4ZSOA 1C5DB 4W6YB 5TGBB 1JNLL 4FQHA 5AWNH 4D3CL 4DKDC 2XA3A 3SCMA 1WFNA 3FFDB 1XR9B 5HHOD 4KRPC 2F74A 4XHJC 2BHZA 1IC5H 3DGCR 5D2NE 3B83A 4GRWH 4MXQD 4LCCA 4WUUD 2CKNA 3QIBA 5IW1B 1EZVY 2CRZA 3BP6A 4AM0B 5C0CB 4DJMA 2PXYA 2RQ8A 4G9DB 1PQZA 4XRCA 3TO4A 3PL6C 1LDPH 4BA8A 2FECL 2ATKB 2EKJA 5TE4L 3GUTB 3QDGB 4UIKL 5DZOA 1P5UA 3M45A 1ZLSH 4UAOC 1W72B 1OP3H 1YMHA 1K6QL 1C5CH 1D9KD 3MUHL 3V0AC 4EDWH 3IKCB 1BREA 5E5RB 1BEYH 3NFPA 2Z4QB 3LVEA 4JQVA 12E8H 6FABH 4TVSa 3HFML 1DUYB 3FQNA 1UZ6E 4WUUB 3RDTA 3ULUC 3TVMD 3QA3B 1OOAA 3IETB 5H8DA 5EU5B 1DVFA 3TWCH 5E7BA 3MRQB 2R1YA 2FIKB 4LLWA 2FX7H 3BJLA 5D7LE 2XOTA 1YEFL 5T1LD 1KJ2B 4FQ1L 3ULVD 1KLUB 4NQVA 1OP5H 1QFWM 5C08E 4HH8A 3IVKB 3IFPA 5JDJA 5GISH 2VLKA 5DGRA 3QNZB 4YAQB 4FP8L 3NTCH 5IB4A 3W39A 2VDLH 3WHXB 1RI8A 1BFOB 1ZLWH 5FYJU 3CH8A 2ITCA 5T3XL 4O58L 1U42A 3IFLL 2Y4SA 1WCBA 3TVMB 3K80A 3KLDA 1PX4A 2BHYA 1KEGH 2DM4A 2JB6B 2B1HH 5C3TA 4I3GA 5I1AA 2WUCL 4NOBA 4XB8A 1Z9LA 3Q2CA 3AMKA 1YNLL 5D72H 2W0PA 1YN6B 5E2JA 1UACH 3DSFL 1DJSA 1KJMA 4HFUH 5F9AC 4OZIA 3IU3B 5CAYB 4HAFA 4LU5H 5GRXG 3KJ4C 4MDJA 5L8JB 3MGOA 1RJZA 5DRZB 4C54A 4QCIB 2HAZA 1YJDL 4MD5B 2E6JA 1UVQB 4JFDA 1K8IB 1EEUA 4GXVH 4YGAB 1BLNA 2DQJH 1P7QA 2EYSB 4IHOB 1J05B 4NYLA 1I7ZB 3QJFA 1EIBA 3S4SB 3SN6N 1F00I 3MRRB 5I1DA 1X5LA 3BEWB 3O3BA 4YHZH 4BJLA 1TCRA 4OCYH 4PP1C 4YDIH 4YGVB 4Q58C 4TNWF 1KSRA 2FJGB 4X7EC 1CFNA 3LSOB 2R0LL 2O5ZH 5GGVH 2QADD 4F7PB 1LO0L 4MJIE 5I1CH 1S9VB 3MUZ1 1OSPH 2J2ZA 5FA3B 5AZ2H 3U36A 5ICYA 5T3XE 1P5VA 2EH8L 4FQJL 3C2AH 3HZYB 4KHXL 4I9WE 3Q3GA 3QPQC 5KSAC 1KXQE 3QCTL 1LE9A 5I1GH 1OTTC 2YUZA 1VPOH 3MRCB 4Z7VA 5BVJB 1A6AA 4XNMB 3B5HA 3I75A 4HMCA 4KK9D 1OD9A 4MAUH 5ISZA 4KAQL 1QEWB 1D7FA 5DFWH 4QRTA 5FO8B 4F3FA 2BSSA 2N7AA 3OKNA 5D9SA 1HHGA 1FFNB 4WNQB 2OL3B 3TBYA 1J8KA 4PJFE 4XVTH 1DLHA 2A6IA 5CFHA 3EYOA 1FJ1A 5IM7B 3G6JB 4LRIA 1X3DA 4QYOA 5KAQG 3DMMC 3QYCA 1J1OH 1ULVA 1W8OA 4R90L 4LP5A 5IMKA 5LCVH 5IIEB 2PN5A 1FL5B 5EPMA 4NPYB 4JM2C 3B6SB 2ARWA 1R24B 5D7SL 4R0LB 2AK4D 4PY7A 4AIXA 4WWKB 4RDQF 3DXAA 3CFDA 1DE4B 4PJEA 4N90D 1BPVA 4R97B 2B4CC 1K8DA 5IFHH 3CK0L 1DBJL 4WTZG 5DO2D 2DQEH 2CLRA 2R2EA 2ESVD 3OKEA 1H3TA 4Z8FH 4ETYA 3JV6A 3M07A 4JRXA 3QWOB 3QCVH 3IU4L 3NCJH 1U0QA 1CFQB 1NCDL 4GSDL 4J4PC 3GBNH 3BQUC 3V6FB 2WAHA 4KDVA 3ZTNL 1VFBA 3T0WA 4RFNB 1R5WA 2NY4C 3SGEI 3VD9A 4OM1L 4KK5D 3DUSA 2V2XA 1URLA 4P2QD 5E6IC 2FR4B 2XYCA 1ZGLP 3RKPA 1MFCH 4JR9L 1MIMH 5IROA 3TA3D 1KPUB 2MQCA 2XV6B 1GCFA 3BGAA 1KN4L 1FBIL 3EUUA 4XPFL 3O41B 3BI9X 1YMME 4FTVE 2EDDA 5DR5L 2YD4A 1WBXB 1OW0A 2AJ3A 1IMHC 3KPNB 3IRZA 4RGMB 1R3HB 2JJVA 1KCKA 4U0QB 3Q6FA 3BUYB 3MBEA 3P4NA 4WHCA 4EOWH 1JHLL 1BGXL 3GSQB 1CQYA 3GGWA 1DCLA 4HZAA 3CFCH 4X4ZA 1K3IA 4LGRB 4YHLH 4GRWB 4FQLL 5DFVC 4P4RA 4M61A 1KCRH 3RWHA 4QTIL 3M8OH 4P2QB 1B0GA 1IAIL 1LP9E 4WW2C 3EKCA 2EDHA 2R4SH 3NIGE 5SX5K 2Q8AH 5FM5M 5E8DH 2DQTL 2NX5E 2P45B 2HJKB 3DI2B 3FO9A 1CFTA 3MLYL 3AUVA 4NO5A 3W0WE 1MFDH 2D31A 2VNCA 2VLJD 1CR9H 4W6WB 4XVUD 1FO0H 2KL6A 3PQYE 3WS3B 4F80A 1FFPB 4PV8B 3DO3A 1CDJA 2DQHL 2QSCL 3DETC 1NH6A 4IMKA 3BZEB 4E42B 5I17B 5MHSE 2GFBA 3QG6A 4UNUA 4AENB 1KT2A 1UM4L 1LNUB 1NGZA 2Z35A 4OTXL 2EEAA 5C6WH 4GXUM 1MJ8L 3RP1A 1A9BA 2NLJA 2PO6B 1JPFA 3RX8A 2R2BB 1N0XH 3RL2A 5DJYB 4ODVL 1TVHB 2J88H 4JFQB 3RWCB 3CXDL 1ZTXL 3ALWA 1YN7B 2VLJB 2QKIA 5FA4A 1KEMH 4GAJL 4PJ7F 3VG9B 3BXNA 3QEQE 5E2WH 4UB0L 4WEMB 4D3CH 2DM2A 4H88L 4OF0A 3QISA 5DJ6A 1FVEB 2R56L 2MCPH 3NBNA 4H5SA 5ADOL 2Q8BL 4ZFZA 3WFZA 3MCG1 4MNHB 1N59A 4N0RA 4ZAKA 3OR6A 4F58L 2ATPB 2VN4A 4LCWA 5E5UB 2ZG1A 5GZOC 2NXZB 3ARQA 1GJIA 4PJ9D 2BOCA 2DDQL 1QRNA 2DB8A 5F8QC 2PUQT 4MXVF 3OAZH 1HHIB 5TE4H 1S7XB 4IDJL 2C5DC 3TPUA 2X41A 3O4OB 2P8LB 5H2BA 1K6QH 7FABL 4ZODA 1MNUH 1T1XB 3E1F1 3L3DB 1CXHA 4OZ4A 3TVMC 4QXGL 1E4KC 3HFMH 1A14L 2FATH 5D93B 5DJXA 1HE7A 1XCQA 2QR0B 1J0HA 1JN6B 2XZZA 3OR7A 3TLRA 5MP6L 1PEZA 5EZIL 1VFAB 1YEFH 2CMRL 1S7QB 4FQ1H 3RVTC 3QHFH 5HPMB 1TVBB 4OFYA 1DSFH 1KTLB 1UWXH 1I1RA 2CO6B 4PLJD 3QIUD 1UKSA 5F6HI 1FZJA 3SY0B 3BH8B 4EN3A 1HXMB 3CMOH 3L3GA 1U8PA 4XPGH 3GB7B 3JWDC 1N0LA 3IFLH 4YHPB 2X89D 4I13B 1CGSH 5DTFA 2VL5A 3QDME 2JJTC 3CDGB 4GKZA 1HNGA 4AL8L 1GGYA 4MD4A 4X6EA 4S10A 4F7CA 2VXSH 3GJEB 4WW2A 1MRCL 5GS1A 1RU9L 1RIVL 2Y72A 1CD9B 5FO7A 5ALCL 2F5AL 1JTTA 3NIDF 3IDGB 5C2BL 1GIGL 5DD1H 2Q20A 3DSFH 3BE1H 3N06B 4X6DE 1AGDB 4LHJB 5EO0A 3D39D 3JUZA 5C0IB 3U1SH 2Y6SD 5HYJA 5C0AD 2XNAA 4AY0A 5CD3A 3HR6A 3ZKSD 2R29H 4QXUL 4C4KT 1I1YB 5TF1L 3B5GA 1TDQA 4PJDB 3WFHA 5T5FH 3IXTA 1HHJB 2VAJA 5DRWB 1ZLUH 3REVB 4BUHA 3TT1H 2YSSB 3TYFA 5KSBF 4IOIA 4MSWB 3GI8H 4XBGB 1FNGB 3PWLB 2CDEB 2P5WA 5JW4Q 4L3EA 2CRYA 15C8H 4X7FC 4OLYL 3QB7C 2DKMA 1INEL 3RGVD 1OF2A 5HHOA 3S4SG 4CMHB 2FX9L 5CEZE 3QUML 2AS5M 2V2WA 1JZ8A 2GITB 2V7HA 2AKRA 3L3IB 3IETA 2R39A 2ENSA 3OKKB 4LSUL 5JR1H 1Y0LA 2WUBH 3MUGB 4NT6A 4O02L 2GUOA 3A6BH 4R0LC 4KK9C 1NEZB 4WWKC 4NO3B 2J6EL 4JFHE 1MWAA 2MNUA 2D9QB 4R97C 4EQ3A 1B2WH 4L5FL 1CIUA 2GTWB 5L6YH 4JFOA 2X4UB 3EO9H 5GGQL 4GQ9L 5ANME 4QTHB 5IW3A 3SKMA 2BXZA 3RIAF 4R3SB 5LGKA 4JY5H 4LVOB 5KVEH 3IDXH 3DVFA 5MERB 2WM0A 4P9MH 4QWWC 1D9KA 3G6DL 4UT7H 4AMKH 4WY7H 3GSXA 3TV3L 5T1KA 4EIZC 2WP3O 1RZFL 3RX5A 1WC7B 4YE4H 4LCUA 3FRUA 2E7BA 3DIFB 5IBTL 3LEXA 2ADIB 1ZK9A 3CPLA 1UB5B 4RFNC 5CINL 3MBXL 4KQ3L 1YYLH 1QBAA 1YN6A 5D2NB 5T1LA 3RUGA 2PW1A 2G5BA 4YLQT 1Q72L 5LJYH 1MH5B 4YXLL 3FQXB 1N4XL 2HFFA 4JPIB 3QPXL 1JPSH 3FQWA 2VZOA 5JW5A 2R69H 2HN7B 5D7LD 1FVDA 4NRZB 2FLRT 2J8OA 5GRUL 1Q9KB 4MD5A 5C08D 4RGMC 2AEIT 3V5DB 4X7SL 1YECH 3ZKMD 4ZFGH 4MJ5B 5IP4A 2V7NA 1I85A 4AYFA 2Q76A 4C55A 1FO0B 3SDYL 3OB0K 4RRPG 3I02B 4I3RH 4JRYD 4RWYL 5SX4H 4Z7WE 3EO0A 2HG5A 3L3JA 1YNTA 2A77L 3BEWA 3JWOH 3O11A 1ZS8B 4H8WL 3C8KA 3HRZB 3MLRH 1B0WA 2EDFA 1KLGB 3SEPA 2VMFA 3OGOE 1HH6B 5HSFA 5FB8B 3IDJB 5DD0H 5D7LB 3ZHKA 1KN4H 1HHKA 3QULA 5F9JA 1MLBB 2IFFL 5C08B 1NC4B 3MGTB 4ISVB 3K3QA 3FAXA 4PRNB 3ARGA 3RY6A 2BSTB 2OK0L 4PD4K 4Y5VB 4Y0GA 1JTPA 5HHVL 2HKHH 5F7KC 1QFWI 4PS4H 2XZQH 4GAGL 1FLRL 4P2OD 2PO6C 4EBQH 4Z78A 4WV1A 5JDSA 3SPVA 4I5BB 1G7JB 2J8UF 2OL3A 1IAIH 2VZSA 3V95A 4PG2C 2DQTH 2ZSWA 3IDIB 5EU3B 1I1FA 2OXHA 2YA2A 4XVUC 3NABL 5AZEH 4XBEL 4GRLB 3ZDZF 3VG9C 3SO5A 2R1WB 3BDYH 4XMLL 4PJ8A 1ETZB 1WZMA 3MNZB 1QLRB 2YN5A 4WDIB 3WXVH 3KPLB 1DN0B 4PRIE 3VXQA 4MJID 4LDEB 1HOCB 5T3XD 2UWEA 4P2OB 4I9WD 1JF6A 3CFBB 2NXZC 4H1LH 1OAKL 1ZEAL 3BISA 1GGUA 5I8KH 4P2RE 5HYEA 4CDGC 5EB9A 4H26B 4UUJB 3O4OC 5TQ2L 3MRPA 1HEZA 4OFVA 3KXFB 2ZPKH 1CFQA 4BZ1L 1U8JA 4F33A 1G6RH 4OZGA 5D93C 2APTA 4XAKD 2X42A 1A6VH 2AK4A 5IFAL 2FJHB 4OB5L 2X6MA 3V4UH 3IS1X 3EYUH 5IT2L 1KPUA 2Q7YB 3S37X 1KFAL 4NC1E 1MJJB 5DUPH 2ESVA 4X4MA 5CCKL 2H3NA 1T5XA 1V7ML 4LPXA 2VN7A 4P5TD 3TO2B 1HCVA 3L3OB 4HWEH 1EFXD 3KPNA 4TOYL 2J12B 5A3ID 1IAIM 1FPTL 1XGTA 5EG6C 7FABH 5E94A 4Y8AA 3WS6C 3KPOA 4P23B 3LEYH 4QXGH 5JXED 1A14H 2VDML 1MAKA 4HBCL 3UXFA 4N0UA 5I76B 3C8DA 5CSZB 4XCNB 4NN5B 5BCAA 3TA3A 1CLYL 3CSYA 3EO1A 2Z31D 3PGCA 4AIZA 1WAAE 4Z9KB 2D9CA 4KDWA 4UV7H 2D7MA 1A7QH 2IBGA 2EXWC 1JZ6A 1QQDB 3N1GC 3O3DB 1EFXB 1Q0XL 2BK8A 3MUJA 3MRFA 3HMWL 4UU9A 5K9JL 3MYJA 4DTGL 2CLZB 1RJYB 4TUOB 4AK1A 3C5ZA 5CEZH 3LCYA 1YMMD 4FTVD 5D7IA 5F9DC 3PIQB 1FN4B 4AEFA 1AC6A 2FSEA 3X3FL 3EZ8A 2NXYB 2WBJD 2WNGA 3RNKB 1JPTH 3OV6A 4H25B 2CRIA 5DT1H 1W8NA 3HZKA 3FT2A 3L6FB 1H15A 3CFJB 4IRSD 4XB7A 2OX5A 4ORZC 3RL1B 3VWKA 2Z31B 3LEVL 5L8LB 1OQXA 2EICA 2F5AH 1IFHL 1AJ7H 3JVGA 2IWGA 3PXJA 4I4WB 4JKLA 3Q6GL 1QP1A 4CMHC 2FHBA 1T7XA 2Y6SC 4QF1A 5ESVB 3MXWH 3BKJH 5C8JA 2NX5D 4J3OC 4F2MB 4G80A 1EV2E 4ZXBB 2Z9TA 4XVSH 4FTVB 3W0WD 2WZPD 2VZVA 2VSCA 5TF1H 3PQYD 1NAKL 4Y8DC 3RWGA 4JJ5B 4ONGH 1QA9A 2MQ0A 3BP4B 5MHSD 4ZUTA 2X9XA 4HZLA 3MXVL 2E8ZA 4IRSB 1A7RL 4D94A 4LVOC 1H3PL 2APVA 5F3BA 2DIJA 2OR9H 2JK5A 4M3KB 1Y6KR 4N9GB 4TUKH 3VE0A 1HH9B 4WO4B 1LP9B 3RGHA 4OLZL 4KKLC 1MAJA 2QSTA 1OP3K 2HJLB 3O81A 4JN2A 1RK0B 3UYPA 3CVHA 1BX2A 1IC4L 3HLAB 4OSUL 3B9AA 2UYLB 1OM3H 3EYSH 2FIRT 1MWAH 5K9OA 3PQYB 1G9NL 3QEQD 4NZRH 2YZ8A 4LOUD 5D2NC 2RCSL 2YD3A 4Y4HA 5DJ0A 4PJ9A 4JRWA 2J6EH 3IGAB 5IBLD 3LS5H 4D0DB 1OP5K 3ARFB 3HNTH 2XA8H 4OQTL 5GGQH 2W91A 4DCQB 1FAKT 2DLGA 1SEQH 4NWTL 3OHXA 2HTLC 1U8IB 4XCCH 1BECA 3HR5A 5A2KH 3MRGB 1ZLWK 5IEHB 3V0WL 1NEZG 4NKDA 1T1ZB 1YEHH 2VDQL 1J87A 3GB7A 2F19H 3OAUH 4HWNA 5CILL 3N9GL 4HFWB 2QHRL 3DX9A 4R4FH 7CGTA 3Q48A 4FN0A 3SBWC 5FF6B 5KVGH 4WFHD 4NIKB 4LAJH 5K59E 4DOHE 1R3IL 3BW9B 1QLEH 4BSWA 4DFHA 2OYPA 5GJTL 5HGGS 4XI5D 3X3GH 1JGLH 2OJEA 3BT2H 3UJTH 5D6CB 1FORL 4LHQB 2I60L 5B4MD 3TFKC 3MJ8B 4UDTA 5DEGB 4GKOA 3BMWA 4Z5RB 3QIUA 4HJGA 4NNYB 1J5OH 2IADA 1JNHA 2W60A 2ZP0T 2VUYA 4Y5VC 4N0FA 5DVLA 3T2QA 4G43B 1SJXA 2WBKA 5HHQB 3X13B 1J12A 1NMBL 4Y4KD 4WGWB 2QEJA 1P4IH 2VLLA 3O2VL 1BD2E 2OSLB 2VDNL 3ME0A 4LARL 5EA0H 3VRIA 1C08B 3B9KB 5IQ7L 3H9HB 1BBDH 4GLRH 1U8HB 5F88A 1I7UB 1ROWA 3QDMD 4BK4A 3D0LA 4PJAB 1I9RH 3D39A 4H1LB 1MCBA 4YHIA 2A1WH 1U2CA 4YEEA 1MCRA 3G9AB 4GRLC 3LHPL 5EOCL 3H0TA 5C0AA 5DRXB 1MI5E 1I7TB 1MHCA 4PJXA 4XMPL 5FGCB 3NA9L 1IKNC 3B3IA 2EIBA 4OZFH 1T7VA 3L3IA 4G6AD 3EDEA 5DVOA 4L1HA 5E2TL 3MTRA 3LKPB 3VFOB 1INDH 1YC7A 3RIFK 5HHVH 5IMMA 1NEZA 5DWUH 1G6RB 4RGOH 4P2OC 2ZJSH 1JRHH 4M6AA 4G8IA 5F93C 5HYQA 3LRHA 5EC1A 4JCLA 2GTWA 1FLRH 4S1DC 1FYTA 2XXMB 1NFDF 4WU7B 3HCVA 3GSOB 3QDMB 3BZDA 4DGIL 4X9GA 5MERA 1NCBL 1MCHA 3UDWC 3PABA 4TVPL 3RGVA 4N5ED 1C8PA 4OCSH 1QBLL 3OF6A 4LAQH 2AK1L 3F7VB 5HVGB 3D1MC 3MRHB 4PRBB 1S8DA 1XF5A 4APQA 2DQFB 1WBYB 4X6DB 3VI3F 3VXSA 3EFFA 1ZSDA 3EOYG 2VLME 4DN4L 2VR5A 4BFIB 3WLBB 3S88L 3CJJA 4LLDB 3SKJL 3VMNA 1EO8L 1F42A 3A6OA 3ZSTA 3ORJA 5SV4A 4PRAB 2ED7A 5HDOA 4BQ8A 2X70A 4XNXL 4HLZG 5CP3A 4JFHD 3BN3B 4PGEA 5IK3A 1NBZA 1AXIB 1BZ7A 4JJHA 2AEQL 1H3VA 5K9QG 4K9EH 1ND0A 2EIDA 1G9EA 2VSDA 1IC1A 4LASL 1I9IH 5BRZE 2YD6A 3L5IA 4P23C 3DVGA 3BKMH 2W9EL 3IS0X 5JXAH 3D85D 2AP2A 3AU1A 4D9QE 5C3LD 2PCPA 2CIKA 3N1FC 3QEUA 4U1SB 2R0ZH 4RSVA 1UM5H 1QBML 3D87B 5IFAH 1RZ8B 4KTEH 4NN5C 4XTRC 5DURD 1RULL 5B3NA 4U1LB 3HC3H 1TMCB 3F62A 3EOBB 5CWSA 3ZSSA 5IMOB 1SY6L 2IALA 5D7LA 3RA7L 5M7QA 4FFVD 4HLJA 3GHBL 5BV7L 1B90A 4JFZL 2C7UA 1R3LB 3GMRB 3UTZB 4B53A 3T2OA 3MGTA 3NFNB 2EDYA 5ANMB 4GMTH 3GM0A 4QXTB 1AR2A 5DJCB 3SJVD 1EMTL 4TOYH 4JRYA 3K8LA 4MZ2A 5GZNC 5DXWA 2ZUVA 4B5EA 1IQWL 3NPZB 1ZT1B 4WCYH 2NXYC 4D8PA 4KVCL 4W70A 3SDXF 5ABDE 1U8QA 4NQSA 3T8XA 1MEXL 3WFEL 3VFMB 3HI1B 3UTSE 2YR3A 2Z31C 5BVPL 5A1AA 1MCFA 4G6ML 1CGWA 1IGFL 5KVDH 4I3SL 2ZNWA 2R1WA 4QHNB 4HDIA 4M03A 1J0JA 1EGJA 2COQA 3R06A 4M1GH 4S0TD 3MNZA 3ARYA 3OWEA 4UV4H 4YHML 4ZXBC 5K9JH 1UXSA 1X6NA 3ZL4L 1P53A 4DTGH 4OM0H 4DAGL 1UEMA 4YPGA 3AAZB 3KPPB 4I48B 3QUMB 1D5MA 4R2GD 4J1UB 1RFDH 3FQUA 4NUGH 4IRSC 4Z7WB 3OJMB 5MEPB 4OUOA 1X44A 5JHDE 4YFDB 2DMCA 5FOBB 1ZVSA 3LEVH 4WO4C 5C0BE 3JSSA 1BHGA 3P11L 2VIRA 4JAMA 4PJ5E 1JWUB 3DVIA 2L4OA 3OPZL 4DN3H 2Y07L 3S97C 1C16B 3SE4A 3HAEH 3FFCA 1QNZL 5DEFA 4S1RH 4PGCA 4XMKH 4XXDA 1FNFA 4MJIA 4G7VL 1AGFA 3HZMA 1G7MB 3X14B 1BF2A 5JO5A 1N5YL 4HXAH 1UT9A 4HHAA 2AEPL 2VDRL 4R2GB 5I8EA 3C60D 3DBXA 4NFBA 4HKZB 5CEXA 3W11D 3LRSB 2WWMD 4KHTL 3EDFA 4PRID 5JW4M 3GNML 4X6BA 3ARFC 1LK2B 1OAYH 3IJHB 5ESQB 4MZ3A 3K8KA 1WFUA 3QR2A 5F1IB 3TZVD 1FNLA 1G1CA 3WD5H 3CVHH 3MMEB 1E27A 5F6IB 4PJFA 4HPYH 4W68A 2RAMA 2DQDH 1G6VK 1SEBB 3MRMB 5CJXA 4BYHA 4DGYL 3OL2A 1UKQA 4MB4A 4XCFL 3S96A 5CMAA 2H2SD 1HINL 4LOUC 5JOFB 4NFCA 3NZHL 4JHBA 2X40A 4YXHH 3ZT7A 4ETQB 4G9FE 4OZIF 1ZMYA 4GKNA 3M1BB 2RCSH 3QI9B 2P49B 2XQBL 5DD5L 1ZGLA 1KGCE 3NCYS 3FB8B 3U0WL 2DYPA 3NAAL 3QNXB 4OQTH 4P5TA 3CX5J 4XC3H 4DVBA 1QQDA 4NWTH 3SKNA 3P9WB 4KUCF 1I3GL 1NFIA 2FD6L 5HGAB 4D9LL 2NZIA 5JW4R 2UUDH 2W0FB 4P2RB 2VDQH 4JB9H 3G04A 5I8OH 5DLML 5CILH 3D2UA 3FT4A 5JXEA 2C1PB 4OZFB 3RNKA 1LEIA 2QHRH 1AXSB 4EI6B 4ODHL 5EO1A 4WHDA 2RBLA 2GAZB 5SX4I 5BQ7B 3OKDB 5EFIB 1PSKL 3L6FA 4XI5C 3B9KC 2VABA 4U1JB 4CVZA 4HG4J 3GM8A 4WWID 4PFEA 1S9WB 4JFYB 4WHTB 3C5SA 1IGIL 1VEPA 1K4DA 3U2SB 1ZHBA 3ZLQC 5FAAA 1C1EL 4JO2L 2YUVA 4XZUB 2A83A 3TNNA 1GGTA 1NGQL 2I60H 4MS8D 1NC2A 2MSPA 4DEPB 1MCIA 4Z0BH 1AGEB 1NGYB 1AP2A 4Y7MA 2QL1A 4X5XA 4X80L 1YMMA 2X9WA 4Z7VF 3RHWF 3EDKA 3U7WL 1FYHB 4UTAH 4K3DL 4NKOA 3VXTB 5ACZA 4Y2DA 5L88L 4L3CA 1EHAA 2WBJA 5E8OB 2F5BL 3VXMA 1FNSH 2OZ4L 3GHEH 1ZLUK 1NMBH 1FIGL 1U8LB 4WJ5B 4ENED 1OWRM 1ORQB 1T6WA 3VGGA 4PBWD 3O2VH 5CLTA 3RNQA 3PGDB 3O9WB 1A4KB 3TBWA 4PJGE 3BD5A 1IAOA 5IQ7H 5D1XD 2VAAB 3BVNA 1IAII 1X5XA 1MOEA 3QSKB 4LLMA 3ZYIA 1TETL 3UO1H 1JF1A 2D03L 3QEHB 5IB3B 4ZPVA 2HJLA 3QG7H 5B8CA 5MEOB 3VGDA 1NBVL 2NX5A 4Y19E 3IJYA 4KDTC 4H0HB 4HKBA 5E8NA 4NM4L 3W0WA 2NY1D 3NA9H 5KOVC 3PWPE 1I8MA 5I1J