2IQCA

Crystal structure of human fancf protein that functions in the assembly of a dna damage signaling complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
199
structure length
173
Chain Sequence
EDSLMKTQAELLLERLQEVRPARFLSSLWERLPQNNFLKVIAVALLQPGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fanconi anemia group F protein
publication title Structural determinants of human FANCF protein that function in the assembly of a DNA damage signaling complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 56
structure length 173
sequence length 199
ec nomenclature
pdb deposition date 2006-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.490 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2iqcA00
2IQCA
chains in the Genus database with same CATH superfamily
2H6GA 4U7EB 5A23A 2YINA 3IHYA 4LSZE 3APCA 5C1DA 4UI9K 4CRWA 5ANLA 3EHMA 4V3IA 3RRNB 5CHEE 3AU4A 3O48A 4GYYA 3TG4A 3L17A 3ENEA 4KMOA 1TN6A 3D9IA 3E34A 3TWTA 4GYWA 2X6JA 4BWRA 3ASOE 5JJTA 4HRNA 3B7TA 3ZHEB 2RFAA 2XRZA 1HO8A 1A17A 3E33A 3CKBA 1K8KG 3UMVA 2VSXE 4BSXA 2WPVA 3NBNB 4YDWA 3VLDA 3EHRA 2JABA 1PC2A 3D9LA 3U4TA 2WXLA 3FU3A 4HORA 3O4ZA 3ML8A 3U66A 3LVQE 2QYUA 2LAHA 1TYQG 4EBAA 4RG9A 4F53A 4MS6A 1S70B 3KSQA 1N95A 2JLBA 2Q7FA 3KAEA 4A55A 2XGMA 3KEAA 3MJWA 4UWHA 3TGOA 3Q15A 4UWGA 3J5QB 3IXEA 2XCCA 4LNBA 4O1OA 3CHRA 3RIBA 4LERA 2LO6A 5FZSA 5HKPA 4A1GA 3AS4A 3ESKA 2EIJE 2P58C 1EDUA 2P2CP 3CVYA 2KATA 4YDEA 2MRIA 2DZNA 2EQXA 3PNLB 3R9MA 3L08A 4EQFA 3MV3B 4DPRA 2B0OE 3B7BA 1FCHA 4JA9A 3W9FA 4I9EA 5D66A 4CGWA 2DIWA 3ONKA 4ABNA 2HYZA 2PZIA 4WWOA 3UT8A 1LTXA 1H2TC 4HBDA 3LCAA 3X2QE 4B94A 2OVFA 5FZRA 4FJYA 3PZ1A 2A5UA 4I9CA 5LCWC 1FT1A 1OY3D 2XS8A 4I2WA 1U2VG 3FY4A 3TXNA 1UW4B 1VDYA 2VGXA 5ENSD 4UI9C 3Q73A 2FBNA 2R5SA 3S7BA 2WQ6A 3TWUA 4NURA 3FEYA 2WXNA 3D9KA 1E8YA 3Q7FA 4B89A 4CDRA 2LXLA 5AJDA 4DI4A 3D9OA 1XGWA 4GTOA 4ANVA 1OWPA 3AG2E 3GW4A 3GZSA 3TXMA 2WXGA 3QARA 5G55A 5HI7A 3G2SA 3UX4A 4GMLA 4DI3A 4HOQA 2E2EA 3G2WA 3U9WA 4YVQC 4BY6A 1H6KA 1K1AA 3PZ2A 3ZRHA 4UUCA 4M3OA 3FDHA 3SI5A 5CERB 4HFGA 3UKUG 2L6BA 5ENQD 1V54E 1PY1A 5CEAA 5HQ8A 3JUEA 4F7AA 1HH8A 2Y4UA 2XCBA 2CFUA 3T8KA 1NL4A 2FI7A 3CK7A 3AS5A 5FZQA 5CBOA 5M72A 2MHKA 1O1SA 2X6KA 1JPLA 1OWOA 1N4PA 5A7DB 5JHAA 2V8SE 3ASGA 2J08A 2LUHA 2FULA 2R02A 4C48B 4B0ZA 4BX8A 2QFCA 2XRYA 2H6HA 4I1OB 5EDSA 1O1TA 3FUHA 3UIPC 5AQ9A 5DIZA 1OWNA 1ELRA 2XQ0A 4EZJA 4G23A 3LPZA 2BKKB 4WNGA 5E76A 3CV0A 3BG1B 4AIFA 4G26A 3PRZA 5B1BE 1EYHA 2B6CA 4FJZA 3MKQB 5CMYA 4GA1A 5G05J 4HRLA 4GTPA 5IY5E 4XE0A 1SA5A 3E4BA 1UN8A 3R9AB 3TWSA 5E75A 2ZXWE 4RG6A 3G2TA 5EX3A 3ZUVB 1WG0A 2WMOA 3N71A 3FTVA 2A5EA 3ZN3A 2R05A 3MKRA 3VLFA 4AXHA 4XX5A 2VTBB 3HG0D 3D9MA 1DNPA 4TXQA 5AAOA 4J8FA 1HX8A 5EYLA 2BTDA 4GA2A 2KBXA 2IOSA 3SGHA 4YDYA 2ZGDA 4FLBA 4GTVA 3UM3A 1TNOA 1BLXB 1KPSB 2R03A 4E6HA 1A5EA 4WNDA 4DJAA 2IQCA 3ISMC 3K9IA 3AS8A 4N2SA 3PREA 2XGOA 1MHQA 3FWVA 1E90A 3LDZA 3QOUA 3RAUA 3LVRE 4L7TA 3SBTB 1ELKA 2Y3AA 3FH7A 2NSZA 4DX2A 1RZ4A 2QY7A 3IEGA 4URKA 1D8EA 3RO3A 1QYMA 5KJNA 4L2LA 3E32A 4GPKA 3FHEA 3EIJA 2AW6A 2KCLA 4F1SA 3V2XA 3ZNGA 4G8LA 1HE8A 3I4GA 1BI7B 2IEJA 1MYOA 1NA0A 1QZ2A 3S7FA 1DC2A 2XGSA 2DVWA 3DEOA 3PE3A 3HIZA 3RRMB 4JPSA 1YYHA 3ZEFA 3L9TA 3S7DA 1DCQA 4AOFA 5BW8C 3FTYA 5J90A 2VQ2A 2ZU6B 3ONLA 1SZ9A 1Z3XA 2FO7A 4WNEA 2YQ8A 2ETCA 3ABME 5AN8A 1Q2ZA 5J08A 3FU6A 4QQIA 1OWLA 5HRYA 3IBEA 2X38A 2L0IA 4MLPA 3C3OA 4K5CA 4X8QA 3PUKA 2F8XK 1AWCB 3DSXA 4HRMB 4UWFA 5G05C 4JZYA 4KBQA 2KM4A 4GCOA 3ZHEA 1BD8A 4OVVA 3ZXSA 3ZFWA 2WXHA 2WXKA 2VGYA 4U04A 4A1SA 1NP7A 3FP3A 3FEXA 3FTSA 3FUJA 4MRUA 2I9CA 5FTPA 4IULA 2FF4A 1OCZE 2P9NG 4XZ4A 3SNXA 5BNWA 2Y1LE 4FLHA 1E7VA 3DEPA 5LCWJ 3SFXA 3SFYA 4C9BB 4PS7A 2UWJG 3MA5A 2C0MA 3V31A 2BUGA 3JYSA 3CHMA 1OT8A 1N4SA 4UI9J 3L16A 2J49A 2GRNB 3L82A 4KYOB 5B3SE 2P9LG 1OCOE 3PVLA 4UWKA 1Y6IA 3D9NA 4CZ2D 4LRZA 4XKBA 3ABLE 3NAWA 2IF4A 3HXFA 5T4YA 3U64A 3NZUA 3JQ1A 3SD5A 3CIAA 5ARFA 5ENOD 2HM8A 2J9QA 4OVUA 3D9HA 2QZAA 3W9GA 1N4QA 4GZ3A 2I6HA 1W3BA 3HHMA 1IQUA 2PM6A 4B8AA 3AU5A 5EILA 3EUVA 4I1AA 2KCVA 3UM1A 3B7RL 4Y6WA 3Q78A 4TV3A 3WG7E 3CEQA 4MBGA 1IKND 4I43A 4LCTA 2RG8A 4K03A 5FQ7A 3UM0A 4CT4A 3UI2A 3V2OA 5JA4D 3T8MA 4LG6A 3HXDA 1UJJA 2WXOA 3I3NA 1MX2A 4YVOA 4Q69A 3JXJA 3UTMA 3TWVA 3S7JA 4B93B 1TN7A 3URZA 3D9PA 1TJCA 2OCCE 3DSVA 3HDXA 2KZTB 3CGHA 3OXFA 4PDXA 3VTXA 4GZ6A 4ANWA 5FQ8A 4GPMA 4EZLA 4KZ0A 4GMRA 3QDNA 2V5QC 3S2AA 3CHSA 2WB2A 1OUVA 4JA7A 4L2YA 4ILHB 4JB8P 1QNFA 3LY9A 4HOTA 4CDNA 3LKUA 4NRHB 5CCMA 3ASNE 3QWWA 4U07A 5JHBA 3C3RA 2J4DA 4G24A 3B13A 2P9PG 3FUDA 4U8YD 4EZKA 2LAIA 3DSSA 2ZIRA 1SZAA 2VSNA 2AXZA 4GTSA 4TXRA 5KJLA 1MX6A 2XPZA 2BF0X 1FT2A 3RO2A 4KT6B 2L0TB 3LJ3A 4HI9A 4DUIA 3PZDA 1HG5A 3PS6A 4AM9A 2X6IA 1ZB1A 4HQDA 3ABKE 4DLQA 2PM7A 3CVVA 1KT0A 2M63A 2NC9A 4L23A 1O5MA 1QBQA 5CECB 4EHMA 1EPUA 1INZA 4GTRA 1JUQA 4JD2G 3RU0A 1OCCE 4UQXA 4DX6D 3WXXA 2UY1B 4UQZA 2CHZA 2KCKA 1H6OA 3FTUA 4BT9A 3MKQA 2I2OA 3QKYA 5KWDA 3DSUA 1TNYA 4G11A 1E7UA 5JMND 4H7YA 5FWQA 1P5QA 2I1KA 3ZGQA 5KBAA 2GGFA 4AVXA 3TG5A 2L9BA 2BEDA 2AXUA 2Y0BG 2VTBA 1NA3A 3RRUA 3T9KA 4BERA 2VYIA 5CBNA 3Q47B 3L22A 4Q96A 4FHJA 1FVFA 1MQSA 5KNGA 1H0AA 2YNQA 2EIME 1NI1A 1S63A 4A3VA 3ZVVA 4DX7D 4P29A 3PZ4A 2J09A 1IXVA 5FINA 5D0OD 2X3MA 1N9AA 2WXMA 4N3CA 3NF1A 5T3RA 1KZPA 3GZ2A 1FPPA 5BUZA 1X5BA 4HVBA 4K5AB 2OEWA 4ACLA 1JCSA 5ENRD 2ETBA 5FIOA 3UM2A 5FQ4A 2LSUA 5A6CA 3B7UX 1HF8A 2EILE 2R59A 4F1PA 4GAAA 4O60A 3LS8A 3Q9UC 3TWQA 4TUMA 1WM5A 4AY6A 4FULA 4RVBA 2EINE 4K0RA 1IHGA 1YMPA 4EBAG 3CHOA 3PE4A 1HU3A 1L5JA 4XI9A 5T8IA 1DVPA 3CVWA 4LNUD 3LJNA 5CRVA 3CVLA 3MV2B 4Q94A 3EJNA 4RLYA 4GTQA 4CT0A 4FADA 2XENA 3JCKC 2H6FA 3EDTB 1GW6A 3E37A 5KJMA 3CK9A 1MZCA 5D2MC 3BU8A 3HVEB 4J8EA 4CDMA 1MJ0A 3LY8A 4U96D 5DBKA 3ZPJA 1HS6A 4I17A 5KNHD 4A63B 3IHVA 3DWLG 3TWWA 3Q4AB 4M7CA 4XEIG 1DCEA 5CEDB 3EHNA 2VSYA 1SW6A 2IU1A 2WMNA 3PUJA 2OOEA 5FJYA 3FUNA 3MCXA 4Y6CA 4BSZB 3BUAA 4GCNA 1YCSB 5EX0A 3DPYA 4XI0A 3CVNA 2WQHA 1N94A 4PS3A 3ULEG 4KZCA 2DBAA 2WXJA 3ESLA 4DLOA 5AQBA 4U0ZA 3ZW3A 1SVXA 3JXIA 4FP7A 1TNZA 5B1AE 1FVHA 1V55E 1BI8B 3MX3A 3Q75A 2LSVA 4GZCA 5G04J 3NB2A 3ZU7B 5JJ7A 1Z3YA 1HZ4A 1UN9A 2NXPA 2VSOE 3HRAA 1UJKA 3MYVA 2YHCA 3C72A 3CHPA 3U3WA 3OXLA 3QNKA 1B89A 5H7PA 4CEMA 4MKTA 5BPPA 4IYPA 5AQ7A 4IRUA 1TJFA 3CQCB 2PL2A 3ASHA 2F8YA 3SHFA 4JEHA 4TUUA 5ITZF 3AG1E 1H2UA 3IKOB 3TWXA 4RQIA 4OYSA 4WUYA 2LNIA 4RSYA 3SBSA 3UQ3A 5KJKA 3I4RB 3FUIA 4J6IA 4DK5A 4E85A 5JJ6A 4K5BA 2AXVA 2C0LA 4KVOA 2HE0A 2AWIA 1N11A 3QWVA 1K3ZD 3RJVA 2GRQB 3CQGB 5HS0A 1SA4A 3JQ0A 3FH8A 3KS2A 3HXCA 4U95D 4YDOA 3SO8A 2IO3C 2KZTA 4WWPA 3BG0B 2WVIA 4FHKA 5G2NA 2XZTG 3DSWA 4ANUA 3HYMB 3EIQC 3ZXPA 5ENNA 4L1BA 4UWLA 1OCRE 2R2LA 5FQ6A 2P9UG 3GZ1A 3UKRG 5CRUA 2F0YA 3TJPA 3IV0A 2A4ZA 1JWGA 1OXJA 5AENA 2IJGX 2IOLA 4C0MA 4CYMD 2PQRA 3AAAC 5FT9A 3CVPA 2CHXA 3ZIMA 4OAVB 4TRQA 5C2YA 4QFVA 2LXMA 5BV0A 3Q9NC 2AVPA 3AJIA 2ILRA 4N2QA 2ETAA 2CHWA 5EYPF 1N0RA 4BTAA 4I6EA 2XPIA 4JL0A 3T5VA 5BV1A 5G04C 1K1BA 3CVQA 3EU9A 4XKCA 4DX1A 2V4HC 4ILIA 2EIKE 1ELWA 2XS1A 3RK6A 2Y4TA 3BQOA 3FTWA 4AY5A 4JXTA 5KCMA 2UY1A 4W9RA 1E96B 3Q49B 1XNFA 3HXEA 4HLLA 5EN5D 3ZKJA 2WXPA 4Z68A 1TEZA 3UXGA 4ZFHA 3NQPA 3KD7A 3PNTB 4OAUC 3PEVB 4HB5A 5BXOA 1Z5SC 1AP7A 2KXPC 1LD8A 2RD0A 3QAQA 4JHKA 4N39A 2DWZA 5CMWA 2WXIA 1H6PA 3ASDA 4XIFA 2P9SG 2F37A 4HLEA 1KLXA 4GTMA 4LNGA 2IY0C 1X81A 2R17C 3FU5A 1RW2A 5LOZA 2H6IA 4FA6A 2FEZA 4F6RD 4BT8A 5ARGA 3ML9A 3UT4A 4A3TA 2RKKA 3DXKG 3PDNA 5LP0A 3L13A 2IO2C 3DXMG 3CVUA 4GA0A 1UOHA 4JVSA 2CFZA 4ILGA 2OV8A 4BETA 2DYRE 1U3CA 4G1TA 3VTYA 4JHRA 4JW1A 1D8DA 1U3DA 3G2UA 1ZBPA 3SZ7A 4U8VD 1NZNA 4O6FA 4PUCA 4D10C 2QYJA 2KC7A 3PEUB 2OVBA 3GYZA 2DCPA 4C0EA 3Q7AA 4IN3B 3FTXA 3QB2A 2MYOA 3FUFA 4BTBA 2C2LA 1BPOA 4NACA 4I1MA 3FFLA 2XHEA 3KSLA 4DRXE 3ZYLA 2JEKA 3EHQA 4GZ5A 3UPVA 1LF8A 2PNNA 4H7XA 1MX4A 3QC1A 3DSTA 4LEUA 1TR4A 2ZISA 4KXKB 2HO1A 1H2VC 5EIDA 3NZSA 1BU9A 3VLEA 3F6QA 1Z6TA 2PQNA 4N3AA 2XEHA 1N54A 4WNFA 2X6FA 3ASFA 3CSTA 4AEZC 4DX5D 4NIKA 1WDYA 3D3MA 5AJLA 3G2VA 3LXUX 2CG2A 3C3QA 3MZLB 3C98A 4HI8A 3SY2A 1IYGA 4ME2A 3R7RA 4JC8A 3HVEA 3D9JA 4G8KA 4U0UA 4GU5A 1OWMA 2GW1A 4BFRA 3J5PA 1HG2A 3AG3E 2GRLA 2V5FA 2VGXB 3FU0A 2J07A 4ATZD 4N5CA 4CGVA 4F3VA 3FH5A 4GMJA 4N3BA 3L6AA 4ACKA 4GB9A 1KZOA 4LUNU 3ULQA 2DYSE 4O1PA 3ZYMA 2IONA 3FUEA 5BT1A 1IHBA 5CCLA 4ANXA 2GRRB 2P9KG 4ZHBA 3OTNA 1QQEA 3BEEA 5EKQD 4EPZA 3APDA 4L9PA 1E8ZA 5AIJA 3TL5A 3EU5A 3TAXA 1NFIE 2HR2A 4NQ0A 4PS8A 3CR3A 3ULYA 2CG3A 2VJ8A 3I5PA 3C5RA 3PH0C 3V79K 2I1JA 3CVXA 4WWNA 4I2ZA 5ENPD 1LD7A 4AP2A 3B7SA 5ENTD 3CKCA 4JEUA 3P1UA 4B8CB 3QWPA 3PZ3A 3T5XA 4J8SA 2OEVA 2DZOA 3QJZA 1Y8MA 4GYOA 3SFZA 3JUIA 1YA0A 4J8YA 4U8HA 4YNDA 2WXFA 1PAQA 5LFAA 4BEPA 1SQMA 3V30A 3L54A 1JCRA 3MEKA 1ZU2A 3UIOC 1EF1C 4HOUA 4J8DA 3NOGD 1WY6A 4GZDA 2RFMA 2ZGGA 4JHJA 3KEZA 4J0UA 2WM9A 1TN8A 4HOSA 4I6JA 2WXQA 3MGBA 2BKGA 2XPYA 3LY7A 2P9IG 4HNAD 3B95A 2XEEA 3P2BA 3CHQA 4R7LA 1IQRA 3ZYKA 1E8XA 1E8WA 4G25A 3Q79A 3CLJA 2J8SD 3DBSA 3QK0A 1S64A 4U63A 3UUXA 1WAO1 4FC8A 3DRAA 3FUMA 5AYWD 4WAFA 4N5QA 5ANRA 3RKVA 2AJAA 3TWRA 3APFA 1D9SA 2J4BA 3HXBA 4EECA 1HFAA 2E0IA 4J7WA 5BXUA 2GRMA 3Q5MA 2VGEA 3DPDA 3FTZA 2GRPB 2X6HA 1G3NB 4I6GA 3CSFA 2MOWA 4KVMA 2Y69E 3UINC 2YHEA 3UT7A 4BESA 2QC9A 3LEWA 4PH4B 3FUKA 1KT1A 3RSEG 2ONDA 2GROB 5D0QD 5AARA 3SQVA 1JCQA 3LYAA 1S0PA 4HS2A 1H19A 3E30A 4U0SA 4APOA 3NOCD 2WQ7A 3OXGA 2IFUA 4AJWA 4G2VA 2NYJA 4BX9A 3SF4A 4FU3A 4AV7A 2XEVA 2V0PA 4GTTA 2V4LA 2L6JA 1N52A 1TNUA 4HXIA 4CCAA 1N4RA 3R7QA 1JWFA 3AG4E 4UQYA 4TXPA 3CK8A 1N0QA 2XZDG 3OAWA 3FULA 5AQAA 3ZYQA 5EIBE 5LX8A 1UG3A 4ATGA 1O1RA 1TNBA 2WXRA 2FO1E 1HXIA 4APFA
chains in the Genus database with same CATH topology
1HE8A 3I4GA 2R17C 3FU5A 1NA0A 5LOZA 5A23A 2YINA 4FA6A 3IHYA 1QZ2A 3S7FA 2FEZA 2XGSA 5FQ4A 2LSUA 3APCA 5C1DA 4UI9K 4CRWA 5A6CA 3PE3A 3B7UX 1HF8A 3HIZA 5ARGA 4BT8A 3RRMB 5ANLA 3ML9A 3UT4A 4A3TA 3EHMA 4JPSA 4V3IA 3PDNA 3ZEFA 3RRNB 5LP0A 3L13A 2R59A 3S7DA 5CHEE 3CVUA 3AU4A 4GAAA 3O48A 4GYYA 4GA0A 4AOFA 5BW8C 3TG4A 3L17A 3FTYA 3ENEA 3LS8A 4KMOA 3D9IA 4JVSA 2CFZA 4ILGA 2OV8A 1U3CA 5J90A 4G1TA 3VTYA 2VQ2A 4GYWA 2X6JA 2ZU6B 4JHRA 4JW1A 4BWRA 3ONLA 1SZ9A 1Z3XA 1WM5A 1U3DA 4AY6A 2FO7A 4WNEA 3G2UA 5JJTA 1ZBPA 4FULA 4RVBA 2YQ8A 3SZ7A 3B7TA 3ZHEB 1NZNA 2XRZA 4O6FA 5J08A 4PUCA 1HO8A 4K0RA 1A17A 1IHGA 4D10C 4EBAG 3CHOA 3PE4A 1HU3A 1L5JA 3CKBA 3FU6A 4XI9A 1OWLA 1DVPA 5T8IA 3CVWA 2KC7A 3PEUB 3UMVA 2VSXE 3IBEA 2X38A 2OVBA 4BSXA 3GYZA 2WPVA 2L0IA 4MLPA 3VLDA 1PC2A 2DCPA 3PUKA 3D9LA 3U4TA 4C0EA 3CVLA 3MV2B 2WXLA 3FU3A 3FTXA 3QB2A 4IN3B 3EJNA 4Q94A 4HORA 3FUFA 3O4ZA 4UWFA 4BTBA 2C2LA 4CT0A 4FADA 1BPOA 3ML8A 4NACA 3LVQE 4I1MA 4JZYA 5G05C 3FFLA 2XHEA 4KBQA 3U66A 2KM4A 3JCKC 2LAHA 3ZYLA 3EDTB 4GCOA 4EBAA 3ZHEA 4RG9A 2JEKA 4OVVA 4F53A 4GZ5A 1GW6A 4MS6A 3UPVA 1LF8A 4H7XA 3ZXSA 3ZFWA 5KJMA 2WXHA 3CK9A 2JLBA 2Q7FA 3KAEA 2WXKA 3QC1A 4A55A 2XGMA 3MJWA 4UWHA 2VGYA 3HVEB 3Q15A 4LEUA 4U04A 4UWGA 3TGOA 4A1SA 1NP7A 4KXKB 2XCCA 2HO1A 3FP3A 1H2VC 3FEXA 3FTSA 4J8EA 3NZSA 3CHRA 3VLEA 3FUJA 4CDMA 3RIBA 4LERA 4MRUA 3LY8A 5DBKA 1Z6TA 2I9CA 2PQNA 5FTPA 2LO6A 4IULA 4N3AA 5EKQD 5FZSA 3ZPJA 1HS6A 4A1GA 4I17A 3AS4A 3ESKA 2FF4A 1N54A 2P58C 4WNFA 1EDUA 3IHVA 2X6FA 3ASFA 4XZ4A 3SNXA 5BNWA 3CSTA 3CVYA 4AEZC 3Q4AB 2KATA 3EHNA 3D3MA 2VSYA 5AJLA 3G2VA 2IU1A 2WMNA 1E7VA 2CG2A 2MRIA 3LXUX 4FLHA 2EQXA 3C98A 3MZLB 3PNLB 3PUJA 1IYGA 2OOEA 5FJYA 3FUNA 5LCWJ 4C9BB 3MCXA 4ME2A 3R7RA 3L08A 4JC8A 3HVEA 4PS7A 3D9JA 4Y6CA 2UWJG 3MA5A 4EQFA 2C0MA 3MV3B 4GCNA 5EX0A 4DPRA 4U0UA 1FCHA 2BUGA 4XI0A 3JYSA 3CHMA 3CVNA 4GU5A 1OWMA 4JA9A 2GW1A 2WQHA 4PS3A 4UI9J 3L16A 2J49A 4BFRA 4I9EA 4KYOB 4KZCA 1HG2A 4CGWA 2DIWA 2DBAA 3ONKA 4ABNA 2HYZA 2PZIA 2GRLA 3PVLA 4UWKA 2WXJA 3ESLA 2V5FA 2VGXB 4WWOA 3FU0A 4DLOA 2J07A 4U0ZA 4N5CA 1Y6IA 3UT8A 4CGVA 3ZW3A 4F3VA 3D9NA 1H2TC 4LRZA 3FH5A 4XKBA 3LCAA 4GMJA 4N3BA 3L6AA 2IF4A 4ACKA 4FP7A 4GB9A 4B94A 5T4YA 2OVFA 4LUNU 5FZRA 3U64A 3ULQA 3NZUA 4FJYA 3JQ1A 3SD5A 2A5UA 3ZYMA 3CIAA 5ARFA 2IONA 1FVHA 3FUEA 4I9CA 2HM8A 2J9QA 4OVUA 5BT1A 3MX3A 5LCWC 2LSVA 5CCLA 4ANXA 4I2WA 4GZCA 5G04J 3OTNA 2I6HA 4GZ3A 3FY4A 5JJ7A 1QQEA 1Z3YA 3BEEA 3TXNA 1HZ4A 1UW4B 1VDYA 1W3BA 1UN9A 2NXPA 2VGXA 2VSOE 1UJKA 3HHMA 4UI9C 1IQUA 4EPZA 2FBNA 3APDA 2R5SA 3MYVA 1E8ZA 3S7BA 2PM6A 2YHCA 4B8AA 3AU5A 5AIJA 2WQ6A 3CHPA 3TL5A 4I1AA 2KCVA 3U3WA 3OXLA 3QNKA 3B7RL 1B89A 3TAXA 4Y6WA 4CEMA 4NURA 3FEYA 4MKTA 2HR2A 2WXNA 4TV3A 4NQ0A 4PS8A 5BPPA 3CEQA 3CR3A 3D9KA 1E8YA 4IYPA 4I43A 4LCTA 4IRUA 2CG3A 1TJFA 2VJ8A 3CQCB 2RG8A 4K03A 5FQ7A 4B89A 2PL2A 4CDRA 3ASHA 5AJDA 4DI4A 4CT4A 3SHFA 3I5PA 4JEHA 3D9OA 1XGWA 4TUUA 4ANVA 1OWPA 3GW4A 3GZSA 3PH0C 3T8MA 3TXMA 2I1JA 2WXGA 1H2UA 3IKOB 1UJJA 2WXOA 3CVXA 3I3NA 3QARA 4YVOA 5G55A 4Q69A 5HI7A 3G2SA 4WWNA 4OYSA 4WUYA 4I2ZA 2LNIA 3S7JA 3UX4A 4GMLA 4RSYA 3SBSA 4DI3A 4HOQA 3UQ3A 2E2EA 5KJKA 3URZA 3G2WA 3D9PA 4YVQC 3I4RB 3U9WA 3FUIA 3B7SA 4J6IA 3CKCA 4JEUA 3P1UA 4AP2A 4BY6A 1H6KA 4DK5A 1TJCA 3ZRHA 4B8CB 4M3OA 3QWPA 4E85A 5JJ6A 3FDHA 3HDXA 3SI5A 2KZTB 3CGHA 4HFGA 3T5XA 3OXFA 4J8SA 4PDXA 2AXVA 3VTXA 1PY1A 2C0LA 4GZ6A 4ANWA 5FQ8A 4KVOA 2AWIA 5HQ8A 3QJZA 1Y8MA 4F7AA 4GYOA 1HH8A 2Y4UA 3SFZA 4EZLA 3QWVA 4KZ0A 2XCBA 2CFUA 3JUIA 3RJVA 1YA0A 3CQGB 2FI7A 3QDNA 3CK7A 4U8HA 3JQ0A 3FH8A 4YNDA 2WXFA 3AS5A 3S2AA 5FZQA 3KS2A 1PAQA 5M72A 3CHSA 2MHKA 2WB2A 1OUVA 5LFAA 4JA7A 4L2YA 1SQMA 2X6KA 1JPLA 1OWOA 4ILHB 3L54A 5A7DB 2KZTA 4WWPA 1QNFA 3MEKA 1ZU2A 3LY9A 5JHAA 4HOTA 4CDNA 2V8SE 3LKUA 3BG0B 1EF1C 2WVIA 4FHKA 3ASGA 4HOUA 4J8DA 2J08A 2FULA 4NRHB 1WY6A 5G2NA 5CCMA 4ANUA 4B0ZA 4BX8A 4GZDA 3HYMB 2QFCA 3EIQC 3QWWA 4U07A 2XRYA 5JHBA 4JHJA 3KEZA 4J0UA 2J4DA 2WM9A 4G24A 4I1OB 4HOSA 4I6JA 3B13A 2WXQA 5EDSA 3FUDA 3MGBA 3FUHA 4EZKA 5ENNA 2XPYA 2LAIA 4L1BA 3LY7A 1SZAA 4UWLA 2VSNA 2AXZA 5DIZA 1OWNA 5KJLA 5FQ6A 1ELRA 2BF0X 2XPZA 2XQ0A 3GZ1A 3P2BA 3CHQA 4R7LA 3RO2A 4KT6B 4EZJA 1IQRA 3ZYKA 2L0TB 4G23A 3LPZA 4WNGA 1E8XA 5E76A 3LJ3A 3TJPA 3CV0A 3BG1B 4AIFA 1E8WA 4G25A 4G26A 3IV0A 3PZDA 3PRZA 3CLJA 3DBSA 1HG5A 1EYHA 2A4ZA 1JWGA 3QK0A 3PS6A 4AM9A 2X6IA 4U63A 3UUXA 5AENA 4FJZA 3MKQB 5CMYA 4GA1A 5G05J 4DLQA 1WAO1 2IJGX 2PM7A 4FC8A 3CVVA 3FUMA 4XE0A 3E4BA 5AYWD 1KT0A 4WAFA 1UN8A 2IOLA 3R9AB 4C0MA 5ANRA 2M63A 3RKVA 2NC9A 5E75A 3APFA 4RG6A 4L23A 3G2TA 2PQRA 5EX3A 5FT9A 3CVPA 1EPUA 2J4BA 1INZA 2CHXA 3ZIMA 4TRQA 5C2YA 4QFVA 1JUQA 4EECA 1HFAA 5BV0A 2E0IA 2AVPA 2GRMA 2WMOA 3N71A 3FTVA 3Q5MA 3RU0A 4UQXA 3ZN3A 3DPDA 2ILRA 3FTZA 4N2QA 3MKRA 3VLFA 4AXHA 3WXXA 2UY1B 2CHWA 2X6HA 4XX5A 4UQZA 4BTAA 2CHZA 4I6EA 2XPIA 2KCKA 4I6GA 3FTUA 4JL0A 3CSFA 2VTBB 2MOWA 4KVMA 4BT9A 3T5VA 5BV1A 3MKQA 5G04C 3D9MA 1DNPA 2I2OA 3QKYA 2YHEA 3UT7A 3CVQA 4J8FA 1HX8A 3LEWA 4PH4B 3FUKA 1KT1A 2BTDA 4GA2A 4XKCA 2ONDA 4G11A 4ILIA 1E7UA 2IOSA 3SGHA 4H7YA 5D0QD 4FLBA 1ELWA 5FWQA 1P5QA 2I1KA 3ZGQA 3LYAA 3RK6A 2GGFA 2Y4TA 4E6HA 3FTWA 1S0PA 4AVXA 3TG5A 2L9BA 4AY5A 4HS2A 4JXTA 4WNDA 5KCMA 4DJAA 1H19A 2UY1A 2IQCA 4W9RA 1E96B 4U0SA 3Q49B 2AXUA 3K9IA 4APOA 2WQ7A 2VTBA 1XNFA 1NA3A 3OXGA 3RRUA 2IFUA 3AS8A 4AJWA 4N2SA 2WXPA 4G2VA 3PREA 4BX9A 2XGOA 1TEZA 1MHQA 2VYIA 3FWVA 1E90A 3SF4A 4FU3A 3Q47B 3L22A 4AV7A 2XEVA 3LDZA 4Q96A 4FHJA 3QOUA 2V0PA 2V4LA 1FVFA 2L6JA 3NQPA 3KD7A 1MQSA 3LVRE 3PNTB 3PEVB 1N52A 4L7TA 3SBTB 1H0AA 2YNQA 1ELKA 2Y3AA 3FH7A 4HXIA 2NSZA 4CCAA 4A3VA 3ZVVA 3R7QA 4P29A 1JWFA 2J09A 2RD0A 3QAQA 2QY7A 4JHKA 4N39A 4UQYA 5D0OD 5CMWA 2WXIA 2X3MA 3IEGA 2WXMA 3CK8A 3ASDA 4URKA 4XIFA 4N3CA 3NF1A 5T3RA 3RO3A 3OAWA 3FULA 3GZ2A 1KLXA 4HLEA 3ZYQA 5BUZA 4L2LA 5KJNA 4GPKA 3FHEA 3EIJA 1X5BA 1UG3A 2AW6A 2KCLA 5LX8A 4HVBA 4F1SA 4ATGA 2WXRA 4ACLA 1HXIA 4APFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IQC A; 
#chains in the Genus database with same CATH topology
 2H6G A;  4U7E B;  5A23 A;  2YIN A;  3IHY A;  4LSZ E;  3APC A;  5C1D A;  4UI9 K;  4CRW A;  5ANL A;  3EHM A;  4V3I A;  3RRN B;  5CHE E;  3AU4 A;  3O48 A;  4GYY A;  3TG4 A;  3L17 A;  3ENE A;  4KMO A;  1TN6 A;  3D9I A;  3E34 A;  3TWT A;  4GYW A;  2X6J A;  4BWR A;  3ASO E;  5JJT A;  4HRN A;  3B7T A;  3ZHE B;  2RFA A;  2XRZ A;  1HO8 A;  1A17 A;  3E33 A;  3CKB A;  1K8K G;  3UMV A;  2VSX E;  4BSX A;  2WPV A;  3NBN B;  4YDW A;  3VLD A;  3EHR A;  2JAB A;  1PC2 A;  3D9L A;  3U4T A;  2WXL A;  3FU3 A;  4HOR A;  3O4Z A;  3ML8 A;  3U66 A;  3LVQ E;  2QYU A;  2LAH A;  1TYQ G;  4EBA A;  4RG9 A;  4F53 A;  4MS6 A;  1S70 B;  3KSQ A;  1N95 A;  2JLB A;  2Q7F A;  3KAE A;  4A55 A;  2XGM A;  3KEA A;  3MJW A;  4UWH A;  3TGO A;  3Q15 A;  4UWG A;  3J5Q B;  3IXE A;  2XCC A;  4LNB A;  4O1O A;  3CHR A;  3RIB A;  4LER A;  2LO6 A;  5FZS A;  5HKP A;  4A1G A;  3AS4 A;  3ESK A;  2EIJ E;  2P58 C;  1EDU A;  2P2C P;  3CVY A;  2KAT A;  4YDE A;  2MRI A;  2DZN A;  2EQX A;  3PNL B;  3R9M A;  3L08 A;  4EQF A;  3MV3 B;  4DPR A;  2B0O E;  3B7B A;  1FCH A;  4JA9 A;  3W9F A;  4I9E A;  5D66 A;  4CGW A;  2DIW A;  3ONK A;  4ABN A;  2HYZ A;  2PZI A;  4WWO A;  3UT8 A;  1LTX A;  1H2T C;  4HBD A;  3LCA A;  3X2Q E;  4B94 A;  2OVF A;  5FZR A;  4FJY A;  3PZ1 A;  2A5U A;  4I9C A;  5LCW C;  1FT1 A;  1OY3 D;  2XS8 A;  4I2W A;  1U2V G;  3FY4 A;  3TXN A;  1UW4 B;  1VDY A;  2VGX A;  5ENS D;  4UI9 C;  3Q73 A;  2FBN A;  2R5S A;  3S7B A;  2WQ6 A;  3TWU A;  4NUR A;  3FEY A;  2WXN A;  3D9K A;  1E8Y A;  3Q7F A;  4B89 A;  4CDR A;  2LXL A;  5AJD A;  4DI4 A;  3D9O A;  1XGW A;  4GTO A;  4ANV A;  1OWP A;  3AG2 E;  3GW4 A;  3GZS A;  3TXM A;  2WXG A;  3QAR A;  5G55 A;  5HI7 A;  3G2S A;  3UX4 A;  4GML A;  4DI3 A;  4HOQ A;  2E2E A;  3G2W A;  3U9W A;  4YVQ C;  4BY6 A;  1H6K A;  1K1A A;  3PZ2 A;  3ZRH A;  4UUC A;  4M3O A;  3FDH A;  3SI5 A;  5CER B;  4HFG A;  3UKU G;  2L6B A;  5ENQ D;  1V54 E;  1PY1 A;  5CEA A;  5HQ8 A;  3JUE A;  4F7A A;  1HH8 A;  2Y4U A;  2XCB A;  2CFU A;  3T8K A;  1NL4 A;  2FI7 A;  3CK7 A;  3AS5 A;  5FZQ A;  5CBO A;  5M72 A;  2MHK A;  1O1S A;  2X6K A;  1JPL A;  1OWO A;  1N4P A;  5A7D B;  5JHA A;  2V8S E;  3ASG A;  2J08 A;  2LUH A;  2FUL A;  2R02 A;  4C48 B;  4B0Z A;  4BX8 A;  2QFC A;  2XRY A;  2H6H A;  4I1O B;  5EDS A;  1O1T A;  3FUH A;  3UIP C;  5AQ9 A;  5DIZ A;  1OWN A;  1ELR A;  2XQ0 A;  4EZJ A;  4G23 A;  3LPZ A;  2BKK B;  4WNG A;  5E76 A;  3CV0 A;  3BG1 B;  4AIF A;  4G26 A;  3PRZ A;  5B1B E;  1EYH A;  2B6C A;  4FJZ A;  3MKQ B;  5CMY A;  4GA1 A;  5G05 J;  4HRL A;  4GTP A;  5IY5 E;  4XE0 A;  1SA5 A;  3E4B A;  1UN8 A;  3R9A B;  3TWS A;  5E75 A;  2ZXW E;  4RG6 A;  3G2T A;  5EX3 A;  3ZUV B;  1WG0 A;  2WMO A;  3N71 A;  3FTV A;  2A5E A;  3ZN3 A;  2R05 A;  3MKR A;  3VLF A;  4AXH A;  4XX5 A;  2VTB B;  3HG0 D;  3D9M A;  1DNP A;  4TXQ A;  5AAO A;  4J8F A;  1HX8 A;  5EYL A;  2BTD A;  4GA2 A;  2KBX A;  2IOS A;  3SGH A;  4YDY A;  2ZGD A;  4FLB A;  4GTV A;  3UM3 A;  1TNO A;  1BLX B;  1KPS B;  2R03 A;  4E6H A;  1A5E A;  4WND A;  4DJA A;  2IQC A;  3ISM C;  3K9I A;  3AS8 A;  4N2S A;  3PRE A;  2XGO A;  1MHQ A;  3FWV A;  1E90 A;  3LDZ A;  3QOU A;  3RAU A;  3LVR E;  4L7T A;  3SBT B;  1ELK A;  2Y3A A;  3FH7 A;  2NSZ A;  4DX2 A;  1RZ4 A;  2QY7 A;  3IEG A;  4URK A;  1D8E A;  3RO3 A;  1QYM A;  5KJN A;  4L2L A;  3E32 A;  4GPK A;  3FHE A;  3EIJ A;  2AW6 A;  2KCL A;  4F1S A;  3V2X A;  3ZNG A;  4G8L A;  1HE8 A;  3I4G A;  1BI7 B;  2IEJ A;  1MYO A;  1NA0 A;  1QZ2 A;  3S7F A;  1DC2 A;  2XGS A;  2DVW A;  3DEO A;  3PE3 A;  3HIZ A;  3RRM B;  4JPS A;  1YYH A;  3ZEF A;  3L9T A;  3S7D A;  1DCQ A;  4AOF A;  5BW8 C;  3FTY A;  5J90 A;  2VQ2 A;  2ZU6 B;  3ONL A;  1SZ9 A;  1Z3X A;  2FO7 A;  4WNE A;  2YQ8 A;  2ETC A;  3ABM E;  5AN8 A;  1Q2Z A;  5J08 A;  3FU6 A;  4QQI A;  1OWL A;  5HRY A;  3IBE A;  2X38 A;  2L0I A;  4MLP A;  3C3O A;  4K5C A;  4X8Q A;  3PUK A;  2F8X K;  1AWC B;  3DSX A;  4HRM B;  4UWF A;  5G05 C;  4JZY A;  4KBQ A;  2KM4 A;  4GCO A;  3ZHE A;  1BD8 A;  4OVV A;  3ZXS A;  3ZFW A;  2WXH A;  2WXK A;  2VGY A;  4U04 A;  4A1S A;  1NP7 A;  3FP3 A;  3FEX A;  3FTS A;  3FUJ A;  4MRU A;  2I9C A;  5FTP A;  4IUL A;  2FF4 A;  1OCZ E;  2P9N G;  4XZ4 A;  3SNX A;  5BNW A;  2Y1L E;  4FLH A;  1E7V A;  3DEP A;  5LCW J;  3SFX A;  3SFY A;  4C9B B;  4PS7 A;  2UWJ G;  3MA5 A;  2C0M A;  3V31 A;  2BUG A;  3JYS A;  3CHM A;  1OT8 A;  1N4S A;  4UI9 J;  3L16 A;  2J49 A;  2GRN B;  3L82 A;  4KYO B;  5B3S E;  2P9L G;  1OCO E;  3PVL A;  4UWK A;  1Y6I A;  3D9N A;  4CZ2 D;  4LRZ A;  4XKB A;  3ABL E;  3NAW A;  2IF4 A;  3HXF A;  5T4Y A;  3U64 A;  3NZU A;  3JQ1 A;  3SD5 A;  3CIA A;  5ARF A;  5ENO D;  2HM8 A;  2J9Q A;  4OVU A;  3D9H A;  2QZA A;  3W9G A;  1N4Q A;  4GZ3 A;  2I6H A;  1W3B A;  3HHM A;  1IQU A;  2PM6 A;  4B8A A;  3AU5 A;  5EIL A;  3EUV A;  4I1A A;  2KCV A;  3UM1 A;  3B7R L;  4Y6W A;  3Q78 A;  4TV3 A;  3WG7 E;  3CEQ A;  4MBG A;  1IKN D;  4I43 A;  4LCT A;  2RG8 A;  4K03 A;  5FQ7 A;  3UM0 A;  4CT4 A;  3UI2 A;  3V2O A;  5JA4 D;  3T8M A;  4LG6 A;  3HXD A;  1UJJ A;  2WXO A;  3I3N A;  1MX2 A;  4YVO A;  4Q69 A;  3JXJ A;  3UTM A;  3TWV A;  3S7J A;  4B93 B;  1TN7 A;  3URZ A;  3D9P A;  1TJC A;  2OCC E;  3DSV A;  3HDX A;  2KZT B;  3CGH A;  3OXF A;  4PDX A;  3VTX A;  4GZ6 A;  4ANW A;  5FQ8 A;  4GPM A;  4EZL A;  4KZ0 A;  4GMR A;  3QDN A;  2V5Q C;  3S2A A;  3CHS A;  2WB2 A;  1OUV A;  4JA7 A;  4L2Y A;  4ILH B;  4JB8 P;  1QNF A;  3LY9 A;  4HOT A;  4CDN A;  3LKU A;  4NRH B;  5CCM A;  3ASN E;  3QWW A;  4U07 A;  5JHB A;  3C3R A;  2J4D A;  4G24 A;  3B13 A;  2P9P G;  3FUD A;  4U8Y D;  4EZK A;  2LAI A;  3DSS A;  2ZIR A;  1SZA A;  2VSN A;  2AXZ A;  4GTS A;  4TXR A;  5KJL A;  1MX6 A;  2XPZ A;  2BF0 X;  1FT2 A;  3RO2 A;  4KT6 B;  2L0T B;  3LJ3 A;  4HI9 A;  4DUI A;  3PZD A;  1HG5 A;  3PS6 A;  4AM9 A;  2X6I A;  1ZB1 A;  4HQD A;  3ABK E;  4DLQ A;  2PM7 A;  3CVV A;  1KT0 A;  2M63 A;  2NC9 A;  4L23 A;  1O5M A;  1QBQ A;  5CEC B;  4EHM A;  1EPU A;  1INZ A;  4GTR A;  1JUQ A;  4JD2 G;  3RU0 A;  1OCC E;  4UQX A;  4DX6 D;  3WXX A;  2UY1 B;  4UQZ A;  2CHZ A;  2KCK A;  1H6O A;  3FTU A;  4BT9 A;  3MKQ A;  2I2O A;  3QKY A;  5KWD A;  3DSU A;  1TNY A;  4G11 A;  1E7U A;  5JMN D;  4H7Y A;  5FWQ A;  1P5Q A;  2I1K A;  3ZGQ A;  5KBA A;  2GGF A;  4AVX A;  3TG5 A;  2L9B A;  2BED A;  2AXU A;  2Y0B G;  2VTB A;  1NA3 A;  3RRU A;  3T9K A;  4BER A;  2VYI A;  5CBN A;  3Q47 B;  3L22 A;  4Q96 A;  4FHJ A;  1FVF A;  1MQS A;  5KNG A;  1H0A A;  2YNQ A;  2EIM E;  1NI1 A;  1S63 A;  4A3V A;  3ZVV A;  4DX7 D;  4P29 A;  3PZ4 A;  2J09 A;  1IXV A;  5FIN A;  5D0O D;  2X3M A;  1N9A A;  2WXM A;  4N3C A;  3NF1 A;  5T3R A;  1KZP A;  3GZ2 A;  1FPP A;  5BUZ A;  1X5B A;  4HVB A;  4K5A B;  2OEW A;  4ACL A;  1JCS A;  5ENR D;  2ETB A;  5FIO A;  3UM2 A;  5FQ4 A;  2LSU A;  5A6C A;  3B7U X;  1HF8 A;  2EIL E;  2R59 A;  4F1P A;  4GAA A;  4O60 A;  3LS8 A;  3Q9U C;  3TWQ A;  4TUM A;  1WM5 A;  4AY6 A;  4FUL A;  4RVB A;  2EIN E;  4K0R A;  1IHG A;  1YMP A;  4EBA G;  3CHO A;  3PE4 A;  1HU3 A;  1L5J A;  4XI9 A;  5T8I A;  1DVP A;  3CVW A;  4LNU D;  3LJN A;  5CRV A;  3CVL A;  3MV2 B;  4Q94 A;  3EJN A;  4RLY A;  4GTQ A;  4CT0 A;  4FAD A;  2XEN A;  3JCK C;  2H6F A;  3EDT B;  1GW6 A;  3E37 A;  5KJM A;  3CK9 A;  1MZC A;  5D2M C;  3BU8 A;  3HVE B;  4J8E A;  4CDM A;  1MJ0 A;  3LY8 A;  4U96 D;  5DBK A;  3ZPJ A;  1HS6 A;  4I17 A;  5KNH D;  4A63 B;  3IHV A;  3DWL G;  3TWW A;  3Q4A B;  4M7C A;  4XEI G;  1DCE A;  5CED B;  3EHN A;  2VSY A;  1SW6 A;  2IU1 A;  2WMN A;  3PUJ A;  2OOE A;  5FJY A;  3FUN A;  3MCX A;  4Y6C A;  4BSZ B;  3BUA A;  4GCN A;  1YCS B;  5EX0 A;  3DPY A;  4XI0 A;  3CVN A;  2WQH A;  1N94 A;  4PS3 A;  3ULE G;  4KZC A;  2DBA A;  2WXJ A;  3ESL A;  4DLO A;  5AQB A;  4U0Z A;  3ZW3 A;  1SVX A;  3JXI A;  4FP7 A;  1TNZ A;  5B1A E;  1FVH A;  1V55 E;  1BI8 B;  3MX3 A;  3Q75 A;  2LSV A;  4GZC A;  5G04 J;  3NB2 A;  3ZU7 B;  5JJ7 A;  1Z3Y A;  1HZ4 A;  1UN9 A;  2NXP A;  2VSO E;  3HRA A;  1UJK A;  3MYV A;  2YHC A;  3C72 A;  3CHP A;  3U3W A;  3OXL A;  3QNK A;  1B89 A;  5H7P A;  4CEM A;  4MKT A;  5BPP A;  4IYP A;  5AQ7 A;  4IRU A;  1TJF A;  3CQC B;  2PL2 A;  3ASH A;  2F8Y A;  3SHF A;  4JEH A;  4TUU A;  5ITZ F;  3AG1 E;  1H2U A;  3IKO B;  3TWX A;  4RQI A;  4OYS A;  4WUY A;  2LNI A;  4RSY A;  3SBS A;  3UQ3 A;  5KJK A;  3I4R B;  3FUI A;  4J6I A;  4DK5 A;  4E85 A;  5JJ6 A;  4K5B A;  2AXV A;  2C0L A;  4KVO A;  2HE0 A;  2AWI A;  1N11 A;  3QWV A;  1K3Z D;  3RJV A;  2GRQ B;  3CQG B;  5HS0 A;  1SA4 A;  3JQ0 A;  3FH8 A;  3KS2 A;  3HXC A;  4U95 D;  4YDO A;  3SO8 A;  2IO3 C;  2KZT A;  4WWP A;  3BG0 B;  2WVI A;  4FHK A;  5G2N A;  2XZT G;  3DSW A;  4ANU A;  3HYM B;  3EIQ C;  3ZXP A;  5ENN A;  4L1B A;  4UWL A;  1OCR E;  2R2L A;  5FQ6 A;  2P9U G;  3GZ1 A;  3UKR G;  5CRU A;  2F0Y A;  3TJP A;  3IV0 A;  2A4Z A;  1JWG A;  1OXJ A;  5AEN A;  2IJG X;  2IOL A;  4C0M A;  4CYM D;  2PQR A;  3AAA C;  5FT9 A;  3CVP A;  2CHX A;  3ZIM A;  4OAV B;  4TRQ A;  5C2Y A;  4QFV A;  2LXM A;  5BV0 A;  3Q9N C;  2AVP A;  3AJI A;  2ILR A;  4N2Q A;  2ETA A;  2CHW A;  5EYP F;  1N0R A;  4BTA A;  4I6E A;  2XPI A;  4JL0 A;  3T5V A;  5BV1 A;  5G04 C;  1K1B A;  3CVQ A;  3EU9 A;  4XKC A;  4DX1 A;  2V4H C;  4ILI A;  2EIK E;  1ELW A;  2XS1 A;  3RK6 A;  2Y4T A;  3BQO A;  3FTW A;  4AY5 A;  4JXT A;  5KCM A;  2UY1 A;  4W9R A;  1E96 B;  3Q49 B;  1XNF A;  3HXE A;  4HLL A;  5EN5 D;  3ZKJ A;  2WXP A;  4Z68 A;  1TEZ A;  3UXG A;  4ZFH A;  3NQP A;  3KD7 A;  3PNT B;  4OAU C;  3PEV B;  4HB5 A;  5BXO A;  1Z5S C;  1AP7 A;  2KXP C;  1LD8 A;  2RD0 A;  3QAQ A;  4JHK A;  4N39 A;  2DWZ A;  5CMW A;  2WXI A;  1H6P A;  3ASD A;  4XIF A;  2P9S G;  2F37 A;  4HLE A;  1KLX A;  4GTM A;  4LNG A;  2IY0 C;  1X81 A;  2R17 C;  3FU5 A;  1RW2 A;  5LOZ A;  2H6I A;  4FA6 A;  2FEZ A;  4F6R D;  4BT8 A;  5ARG A;  3ML9 A;  3UT4 A;  4A3T A;  2RKK A;  3DXK G;  3PDN A;  5LP0 A;  3L13 A;  2IO2 C;  3DXM G;  3CVU A;  4GA0 A;  1UOH A;  4JVS A;  2CFZ A;  4ILG A;  2OV8 A;  4BET A;  2DYR E;  1U3C A;  4G1T A;  3VTY A;  4JHR A;  4JW1 A;  1D8D A;  1U3D A;  3G2U A;  1ZBP A;  3SZ7 A;  4U8V D;  1NZN A;  4O6F A;  4PUC A;  4D10 C;  2QYJ A;  2KC7 A;  3PEU B;  2OVB A;  3GYZ A;  2DCP A;  4C0E A;  3Q7A A;  4IN3 B;  3FTX A;  3QB2 A;  2MYO A;  3FUF A;  4BTB A;  2C2L A;  1BPO A;  4NAC A;  4I1M A;  3FFL A;  2XHE A;  3KSL A;  4DRX E;  3ZYL A;  2JEK A;  3EHQ A;  4GZ5 A;  3UPV A;  1LF8 A;  2PNN A;  4H7X A;  1MX4 A;  3QC1 A;  3DST A;  4LEU A;  1TR4 A;  2ZIS A;  4KXK B;  2HO1 A;  1H2V C;  5EID A;  3NZS A;  1BU9 A;  3VLE A;  3F6Q A;  1Z6T A;  2PQN A;  4N3A A;  2XEH A;  1N54 A;  4WNF A;  2X6F A;  3ASF A;  3CST A;  4AEZ C;  4DX5 D;  4NIK A;  1WDY A;  3D3M A;  5AJL A;  3G2V A;  3LXU X;  2CG2 A;  3C3Q A;  3MZL B;  3C98 A;  4HI8 A;  3SY2 A;  1IYG A;  4ME2 A;  3R7R A;  4JC8 A;  3HVE A;  3D9J A;  4G8K A;  4U0U A;  4GU5 A;  1OWM A;  2GW1 A;  4BFR A;  3J5P A;  1HG2 A;  3AG3 E;  2GRL A;  2V5F A;  2VGX B;  3FU0 A;  2J07 A;  4ATZ D;  4N5C A;  4CGV A;  4F3V A;  3FH5 A;  4GMJ A;  4N3B A;  3L6A A;  4ACK A;  4GB9 A;  1KZO A;  4LUN U;  3ULQ A;  2DYS E;  4O1P A;  3ZYM A;  2ION A;  3FUE A;  5BT1 A;  1IHB A;  5CCL A;  4ANX A;  2GRR B;  2P9K G;  4ZHB A;  3OTN A;  1QQE A;  3BEE A;  5EKQ D;  4EPZ A;  3APD A;  4L9P A;  1E8Z A;  5AIJ A;  3TL5 A;  3EU5 A;  3TAX A;  1NFI E;  2HR2 A;  4NQ0 A;  4PS8 A;  3CR3 A;  3ULY A;  2CG3 A;  2VJ8 A;  3I5P A;  3C5R A;  3PH0 C;  3V79 K;  2I1J A;  3CVX A;  4WWN A;  4I2Z A;  5ENP D;  1LD7 A;  4AP2 A;  3B7S A;  5ENT D;  3CKC A;  4JEU A;  3P1U A;  4B8C B;  3QWP A;  3PZ3 A;  3T5X A;  4J8S A;  2OEV A;  2DZO A;  3QJZ A;  1Y8M A;  4GYO A;  3SFZ A;  3JUI A;  1YA0 A;  4J8Y A;  4U8H A;  4YND A;  2WXF A;  1PAQ A;  5LFA A;  4BEP A;  1SQM A;  3V30 A;  3L54 A;  1JCR A;  3MEK A;  1ZU2 A;  3UIO C;  1EF1 C;  4HOU A;  4J8D A;  3NOG D;  1WY6 A;  4GZD A;  2RFM A;  2ZGG A;  4JHJ A;  3KEZ A;  4J0U A;  2WM9 A;  1TN8 A;  4HOS A;  4I6J A;  2WXQ A;  3MGB A;  2BKG A;  2XPY A;  3LY7 A;  2P9I G;  4HNA D;  3B95 A;  2XEE A;  3P2B A;  3CHQ A;  4R7L A;  1IQR A;  3ZYK A;  1E8X A;  1E8W A;  4G25 A;  3Q79 A;  3CLJ A;  2J8S D;  3DBS A;  3QK0 A;  1S64 A;  4U63 A;  3UUX A;  1WAO 1;  4FC8 A;  3DRA A;  3FUM A;  5AYW D;  4WAF A;  4N5Q A;  5ANR A;  3RKV A;  2AJA A;  3TWR A;  3APF A;  1D9S A;  2J4B A;  3HXB A;  4EEC A;  1HFA A;  2E0I A;  4J7W A;  5BXU A;  2GRM A;  3Q5M A;  2VGE A;  3DPD A;  3FTZ A;  2GRP B;  2X6H A;  1G3N B;  4I6G A;  3CSF A;  2MOW A;  4KVM A;  2Y69 E;  3UIN C;  2YHE A;  3UT7 A;  4BES A;  2QC9 A;  3LEW A;  4PH4 B;  3FUK A;  1KT1 A;  3RSE G;  2OND A;  2GRO B;  5D0Q D;  5AAR A;  3SQV A;  1JCQ A;  3LYA A;  1S0P A;  4HS2 A;  1H19 A;  3E30 A;  4U0S A;  4APO A;  3NOC D;  2WQ7 A;  3OXG A;  2IFU A;  4AJW A;  4G2V A;  2NYJ A;  4BX9 A;  3SF4 A;  4FU3 A;  4AV7 A;  2XEV A;  2V0P A;  4GTT A;  2V4L A;  2L6J A;  1N52 A;  1TNU A;  4HXI A;  4CCA A;  1N4R A;  3R7Q A;  1JWF A;  3AG4 E;  4UQY A;  4TXP A;  3CK8 A;  1N0Q A;  2XZD G;  3OAW A;  3FUL A;  5AQA A;  3ZYQ A;  5EIB E;  5LX8 A;  1UG3 A;  4ATG A;  1O1R A;  1TNB A;  2WXR A;  2FO1 E;  1HXI A;  4APF A; 
#chains in the Genus database with same CATH homology
 1HE8 A;  3I4G A;  2R17 C;  3FU5 A;  1NA0 A;  5LOZ A;  5A23 A;  2YIN A;  4FA6 A;  3IHY A;  1QZ2 A;  3S7F A;  2FEZ A;  2XGS A;  5FQ4 A;  2LSU A;  3APC A;  5C1D A;  4UI9 K;  4CRW A;  5A6C A;  3PE3 A;  3B7U X;  1HF8 A;  3HIZ A;  5ARG A;  4BT8 A;  3RRM B;  5ANL A;  3ML9 A;  3UT4 A;  4A3T A;  3EHM A;  4JPS A;  4V3I A;  3PDN A;  3ZEF A;  3RRN B;  5LP0 A;  3L13 A;  2R59 A;  3S7D A;  5CHE E;  3CVU A;  3AU4 A;  4GAA A;  3O48 A;  4GYY A;  4GA0 A;  4AOF A;  5BW8 C;  3TG4 A;  3L17 A;  3FTY A;  3ENE A;  3LS8 A;  4KMO A;  3D9I A;  4JVS A;  2CFZ A;  4ILG A;  2OV8 A;  1U3C A;  5J90 A;  4G1T A;  3VTY A;  2VQ2 A;  4GYW A;  2X6J A;  2ZU6 B;  4JHR A;  4JW1 A;  4BWR A;  3ONL A;  1SZ9 A;  1Z3X A;  1WM5 A;  1U3D A;  4AY6 A;  2FO7 A;  4WNE A;  3G2U A;  5JJT A;  1ZBP A;  4FUL A;  4RVB A;  2YQ8 A;  3SZ7 A;  3B7T A;  3ZHE B;  1NZN A;  2XRZ A;  4O6F A;  5J08 A;  4PUC A;  1HO8 A;  4K0R A;  1A17 A;  1IHG A;  4D10 C;  4EBA G;  3CHO A;  3PE4 A;  1HU3 A;  1L5J A;  3CKB A;  3FU6 A;  4XI9 A;  1OWL A;  1DVP A;  5T8I A;  3CVW A;  2KC7 A;  3PEU B;  3UMV A;  2VSX E;  3IBE A;  2X38 A;  2OVB A;  4BSX A;  3GYZ A;  2WPV A;  2L0I A;  4MLP A;  3VLD A;  1PC2 A;  2DCP A;  3PUK A;  3D9L A;  3U4T A;  4C0E A;  3CVL A;  3MV2 B;  2WXL A;  3FU3 A;  3FTX A;  3QB2 A;  4IN3 B;  3EJN A;  4Q94 A;  4HOR A;  3FUF A;  3O4Z A;  4UWF A;  4BTB A;  2C2L A;  4CT0 A;  4FAD A;  1BPO A;  3ML8 A;  4NAC A;  3LVQ E;  4I1M A;  4JZY A;  5G05 C;  3FFL A;  2XHE A;  4KBQ A;  3U66 A;  2KM4 A;  3JCK C;  2LAH A;  3ZYL A;  3EDT B;  4GCO A;  4EBA A;  3ZHE A;  4RG9 A;  2JEK A;  4OVV A;  4F53 A;  4GZ5 A;  1GW6 A;  4MS6 A;  3UPV A;  1LF8 A;  4H7X A;  3ZXS A;  3ZFW A;  5KJM A;  2WXH A;  3CK9 A;  2JLB A;  2Q7F A;  3KAE A;  2WXK A;  3QC1 A;  4A55 A;  2XGM A;  3MJW A;  4UWH A;  2VGY A;  3HVE B;  3Q15 A;  4LEU A;  4U04 A;  4UWG A;  3TGO A;  4A1S A;  1NP7 A;  4KXK B;  2XCC A;  2HO1 A;  3FP3 A;  1H2V C;  3FEX A;  3FTS A;  4J8E A;  3NZS A;  3CHR A;  3VLE A;  3FUJ A;  4CDM A;  3RIB A;  4LER A;  4MRU A;  3LY8 A;  5DBK A;  1Z6T A;  2I9C A;  2PQN A;  5FTP A;  2LO6 A;  4IUL A;  4N3A A;  5EKQ D;  5FZS A;  3ZPJ A;  1HS6 A;  4A1G A;  4I17 A;  3AS4 A;  3ESK A;  2FF4 A;  1N54 A;  2P58 C;  4WNF A;  1EDU A;  3IHV A;  2X6F A;  3ASF A;  4XZ4 A;  3SNX A;  5BNW A;  3CST A;  3CVY A;  4AEZ C;  3Q4A B;  2KAT A;  3EHN A;  3D3M A;  2VSY A;  5AJL A;  3G2V A;  2IU1 A;  2WMN A;  1E7V A;  2CG2 A;  2MRI A;  3LXU X;  4FLH A;  2EQX A;  3C98 A;  3MZL B;  3PNL B;  3PUJ A;  1IYG A;  2OOE A;  5FJY A;  3FUN A;  5LCW J;  4C9B B;  3MCX A;  4ME2 A;  3R7R A;  3L08 A;  4JC8 A;  3HVE A;  4PS7 A;  3D9J A;  4Y6C A;  2UWJ G;  3MA5 A;  4EQF A;  2C0M A;  3MV3 B;  4GCN A;  5EX0 A;  4DPR A;  4U0U A;  1FCH A;  2BUG A;  4XI0 A;  3JYS A;  3CHM A;  3CVN A;  4GU5 A;  1OWM A;  4JA9 A;  2GW1 A;  2WQH A;  4PS3 A;  4UI9 J;  3L16 A;  2J49 A;  4BFR A;  4I9E A;  4KYO B;  4KZC A;  1HG2 A;  4CGW A;  2DIW A;  2DBA A;  3ONK A;  4ABN A;  2HYZ A;  2PZI A;  2GRL A;  3PVL A;  4UWK A;  2WXJ A;  3ESL A;  2V5F A;  2VGX B;  4WWO A;  3FU0 A;  4DLO A;  2J07 A;  4U0Z A;  4N5C A;  1Y6I A;  3UT8 A;  4CGV A;  3ZW3 A;  4F3V A;  3D9N A;  1H2T C;  4LRZ A;  3FH5 A;  4XKB A;  3LCA A;  4GMJ A;  4N3B A;  3L6A A;  2IF4 A;  4ACK A;  4FP7 A;  4GB9 A;  4B94 A;  5T4Y A;  2OVF A;  4LUN U;  5FZR A;  3U64 A;  3ULQ A;  3NZU A;  4FJY A;  3JQ1 A;  3SD5 A;  2A5U A;  3ZYM A;  3CIA A;  5ARF A;  2ION A;  1FVH A;  3FUE A;  4I9C A;  2HM8 A;  2J9Q A;  4OVU A;  5BT1 A;  3MX3 A;  5LCW C;  2LSV A;  5CCL A;  4ANX A;  4I2W A;  4GZC A;  5G04 J;  3OTN A;  2I6H A;  4GZ3 A;  3FY4 A;  5JJ7 A;  1QQE A;  1Z3Y A;  3BEE A;  3TXN A;  1HZ4 A;  1UW4 B;  1VDY A;  1W3B A;  1UN9 A;  2NXP A;  2VGX A;  2VSO E;  1UJK A;  3HHM A;  4UI9 C;  1IQU A;  4EPZ A;  2FBN A;  3APD A;  2R5S A;  3MYV A;  1E8Z A;  3S7B A;  2PM6 A;  2YHC A;  4B8A A;  3AU5 A;  5AIJ A;  2WQ6 A;  3CHP A;  3TL5 A;  4I1A A;  2KCV A;  3U3W A;  3OXL A;  3QNK A;  3B7R L;  1B89 A;  3TAX A;  4Y6W A;  4CEM A;  4NUR A;  3FEY A;  4MKT A;  2HR2 A;  2WXN A;  4TV3 A;  4NQ0 A;  4PS8 A;  5BPP A;  3CEQ A;  3CR3 A;  3D9K A;  1E8Y A;  4IYP A;  4I43 A;  4LCT A;  4IRU A;  2CG3 A;  1TJF A;  2VJ8 A;  3CQC B;  2RG8 A;  4K03 A;  5FQ7 A;  4B89 A;  2PL2 A;  4CDR A;  3ASH A;  5AJD A;  4DI4 A;  4CT4 A;  3SHF A;  3I5P A;  4JEH A;  3D9O A;  1XGW A;  4TUU A;  4ANV A;  1OWP A;  3GW4 A;  3GZS A;  3PH0 C;  3T8M A;  3TXM A;  2I1J A;  2WXG A;  1H2U A;  3IKO B;  1UJJ A;  2WXO A;  3CVX A;  3I3N A;  3QAR A;  4YVO A;  5G55 A;  4Q69 A;  5HI7 A;  3G2S A;  4WWN A;  4OYS A;  4WUY A;  4I2Z A;  2LNI A;  3S7J A;  3UX4 A;  4GML A;  4RSY A;  3SBS A;  4DI3 A;  4HOQ A;  3UQ3 A;  2E2E A;  5KJK A;  3URZ A;  3G2W A;  3D9P A;  4YVQ C;  3I4R B;  3U9W A;  3FUI A;  3B7S A;  4J6I A;  3CKC A;  4JEU A;  3P1U A;  4AP2 A;  4BY6 A;  1H6K A;  4DK5 A;  1TJC A;  3ZRH A;  4B8C B;  4M3O A;  3QWP A;  4E85 A;  5JJ6 A;  3FDH A;  3HDX A;  3SI5 A;  2KZT B;  3CGH A;  4HFG A;  3T5X A;  3OXF A;  4J8S A;  4PDX A;  2AXV A;  3VTX A;  1PY1 A;  2C0L A;  4GZ6 A;  4ANW A;  5FQ8 A;  4KVO A;  2AWI A;  5HQ8 A;  3QJZ A;  1Y8M A;  4F7A A;  4GYO A;  1HH8 A;  2Y4U A;  3SFZ A;  4EZL A;  3QWV A;  4KZ0 A;  2XCB A;  2CFU A;  3JUI A;  3RJV A;  1YA0 A;  3CQG B;  2FI7 A;  3QDN A;  3CK7 A;  4U8H A;  3JQ0 A;  3FH8 A;  4YND A;  2WXF A;  3AS5 A;  3S2A A;  5FZQ A;  3KS2 A;  1PAQ A;  5M72 A;  3CHS A;  2MHK A;  2WB2 A;  1OUV A;  5LFA A;  4JA7 A;  4L2Y A;  1SQM A;  2X6K A;  1JPL A;  1OWO A;  4ILH B;  3L54 A;  5A7D B;  2KZT A;  4WWP A;  1QNF A;  3MEK A;  1ZU2 A;  3LY9 A;  5JHA A;  4HOT A;  4CDN A;  2V8S E;  3LKU A;  3BG0 B;  1EF1 C;  2WVI A;  4FHK A;  3ASG A;  4HOU A;  4J8D A;  2J08 A;  2FUL A;  4NRH B;  1WY6 A;  5G2N A;  5CCM A;  4ANU A;  4B0Z A;  4BX8 A;  4GZD A;  3HYM B;  2QFC A;  3EIQ C;  3QWW A;  4U07 A;  2XRY A;  5JHB A;  4JHJ A;  3KEZ A;  4J0U A;  2J4D A;  2WM9 A;  4G24 A;  4I1O B;  4HOS A;  4I6J A;  3B13 A;  2WXQ A;  5EDS A;  3FUD A;  3MGB A;  3FUH A;  4EZK A;  5ENN A;  2XPY A;  2LAI A;  4L1B A;  3LY7 A;  1SZA A;  4UWL A;  2VSN A;  2AXZ A;  5DIZ A;  1OWN A;  5KJL A;  5FQ6 A;  1ELR A;  2BF0 X;  2XPZ A;  2XQ0 A;  3GZ1 A;  3P2B A;  3CHQ A;  4R7L A;  3RO2 A;  4KT6 B;  4EZJ A;  1IQR A;  3ZYK A;  2L0T B;  4G23 A;  3LPZ A;  4WNG A;  1E8X A;  5E76 A;  3LJ3 A;  3TJP A;  3CV0 A;  3BG1 B;  4AIF A;  1E8W A;  4G25 A;  4G26 A;  3IV0 A;  3PZD A;  3PRZ A;  3CLJ A;  3DBS A;  1HG5 A;  1EYH A;  2A4Z A;  1JWG A;  3QK0 A;  3PS6 A;  4AM9 A;  2X6I A;  4U63 A;  3UUX A;  5AEN A;  4FJZ A;  3MKQ B;  5CMY A;  4GA1 A;  5G05 J;  4DLQ A;  1WAO 1;  2IJG X;  2PM7 A;  4FC8 A;  3CVV A;  3FUM A;  4XE0 A;  3E4B A;  5AYW D;  1KT0 A;  4WAF A;  1UN8 A;  2IOL A;  3R9A B;  4C0M A;  5ANR A;  2M63 A;  3RKV A;  2NC9 A;  5E75 A;  3APF A;  4RG6 A;  4L23 A;  3G2T A;  2PQR A;  5EX3 A;  5FT9 A;  3CVP A;  1EPU A;  2J4B A;  1INZ A;  2CHX A;  3ZIM A;  4TRQ A;  5C2Y A;  4QFV A;  1JUQ A;  4EEC A;  1HFA A;  5BV0 A;  2E0I A;  2AVP A;  2GRM A;  2WMO A;  3N71 A;  3FTV A;  3Q5M A;  3RU0 A;  4UQX A;  3ZN3 A;  3DPD A;  2ILR A;  3FTZ A;  4N2Q A;  3MKR A;  3VLF A;  4AXH A;  3WXX A;  2UY1 B;  2CHW A;  2X6H A;  4XX5 A;  4UQZ A;  4BTA A;  2CHZ A;  4I6E A;  2XPI A;  2KCK A;  4I6G A;  3FTU A;  4JL0 A;  3CSF A;  2VTB B;  2MOW A;  4KVM A;  4BT9 A;  3T5V A;  5BV1 A;  3MKQ A;  5G04 C;  3D9M A;  1DNP A;  2I2O A;  3QKY A;  2YHE A;  3UT7 A;  3CVQ A;  4J8F A;  1HX8 A;  3LEW A;  4PH4 B;  3FUK A;  1KT1 A;  2BTD A;  4GA2 A;  4XKC A;  2OND A;  4G11 A;  4ILI A;  1E7U A;  2IOS A;  3SGH A;  4H7Y A;  5D0Q D;  4FLB A;  1ELW A;  5FWQ A;  1P5Q A;  2I1K A;  3ZGQ A;  3LYA A;  3RK6 A;  2GGF A;  2Y4T A;  4E6H A;  3FTW A;  1S0P A;  4AVX A;  3TG5 A;  2L9B A;  4AY5 A;  4HS2 A;  4JXT A;  4WND A;  5KCM A;  4DJA A;  1H19 A;  2UY1 A;  2IQC A;  4W9R A;  1E96 B;  4U0S A;  3Q49 B;  2AXU A;  3K9I A;  4APO A;  2WQ7 A;  2VTB A;  1XNF A;  1NA3 A;  3OXG A;  3RRU A;  2IFU A;  3AS8 A;  4AJW A;  4N2S A;  2WXP A;  4G2V A;  3PRE A;  4BX9 A;  2XGO A;  1TEZ A;  1MHQ A;  2VYI A;  3FWV A;  1E90 A;  3SF4 A;  4FU3 A;  3Q47 B;  3L22 A;  4AV7 A;  2XEV A;  3LDZ A;  4Q96 A;  4FHJ A;  3QOU A;  2V0P A;  2V4L A;  1FVF A;  2L6J A;  3NQP A;  3KD7 A;  1MQS A;  3LVR E;  3PNT B;  3PEV B;  1N52 A;  4L7T A;  3SBT B;  1H0A A;  2YNQ A;  1ELK A;  2Y3A A;  3FH7 A;  4HXI A;  2NSZ A;  4CCA A;  4A3V A;  3ZVV A;  3R7Q A;  4P29 A;  1JWF A;  2J09 A;  2RD0 A;  3QAQ A;  2QY7 A;  4JHK A;  4N39 A;  4UQY A;  5D0O D;  5CMW A;  2WXI A;  2X3M A;  3IEG A;  2WXM A;  3CK8 A;  3ASD A;  4URK A;  4XIF A;  4N3C A;  3NF1 A;  5T3R A;  3RO3 A;  3OAW A;  3FUL A;  3GZ2 A;  1KLX A;  4HLE A;  3ZYQ A;  5BUZ A;  4L2L A;  5KJN A;  4GPK A;  3FHE A;  3EIJ A;  1X5B A;  1UG3 A;  2AW6 A;  2KCL A;  5LX8 A;  4HVB A;  4F1S A;  4ATG A;  2WXR A;  4ACL A;  1HXI A;  4APF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...