2IQCA

Crystal structure of human fancf protein that functions in the assembly of a dna damage signaling complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
199
structure length
173
Chain Sequence
b'EDSLMKTQAELLLERLQEVRPARFLSSLWERLPQNNFLKVIAVALLQPGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fanconi anemia group F protein
publication title Structural determinants of human FANCF protein that function in the assembly of a DNA damage signaling complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 56
structure length 173
sequence length 199
ec nomenclature
pdb deposition date 2006-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.490 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2iqcA00
2IQCA
chains in the Genus database with same CATH superfamily
2FBNA 5LFAA 3VLDA 2P58C 2HR2A 2AJAA 5FIOA 1OWOA 4GZ6A 2XCCA 4LNUD 4HQDA 4KVMA 1KLXA 2IU1A 3KS2A 2KM4A 1H2VC 1N11A 4HI8A 4LSZE 3S7BA 3TWQA 4FADA 4O60A 2J08A 4IYPA 4G1TA 4U8VD 2PM6A 4LNGA 2P9KG 3S7DA 1MZCA 4DX5D 4BT8A 4Y6WA 3AG1E 3K9IA 3URZA 5FZRA 3HXFA 3ESKA 2AXZA 3LKUA 1IQRA 4HB5A 4YDWA 1OCZE 4FC8A 2IFUA 2IJGX 3EHQA 1FVFA 4ZHBA 2WMNA 1BD8A 4HRNA 1N0QA 3UPVA 3FUHA 2R2LA 3PDNA 1HS6A 3D9IA 3O4ZA 5AENA 2C0MA 2ETCA 4E85A 1OUVA 3PZ2A 5J90A 3CVNA 4G25A 3E30A 3ZYMA 1QNFA 1OCCE 1JPLA 3CKCA 2XPZA 4B8AA 4FHJA 2R59A 4I2ZA 4G11A 4A3TA 5D2MC 2I2OA 5ENOD 1YYHA 3L17A 1NFIE 1FT2A 3IKOB 4UQXA 2Q7FA 2VGXB 2AWIA 2YHCA 5LCWC 3UM3A 2FO1E 3CIAA 5G04J 4U8HA 4G8KA 3HVEB 3UIPC 2IY0C 3ABKE 4NURA 3SBTB 5CRVA 3PS6A 4JD2G 1E7UA 1QYMA 4I9CA 5FQ6A 1HX8A 3APCA 3ML8A 3TGOA 2JEKA 5EYPF 4FULA 2UWJG 4KZCA 1IKND 4KBQA 1DCEA 4GPKA 1HF8A 3ULQA 2OVBA 3ASHA 3QK0A 2BKGA 2QZAA 4WUYA 4BX9A 3S7FA 3Q79A 1N9AA 2WXGA 5ENQD 4I1MA 1D9SA 1N0RA 3CSTA 1HO8A 3FUFA 3E37A 3UI2A 2OVFA 2VSXE 1OCOE 4YVQC 1ZU2A 3P1UA 1FCHA 4UUCA 5BPPA 4GZDA 2I6HA 3DRAA 4YVOA 1NA0A 2KCKA 4DX2A 3UT4A 4UI9K 3V2XA 4WWPA 4HORA 1KT0A 5AQ7A 5IY5E 4F1PA 3ZEFA 2GRLA 3ASOE 3L13A 5ARGA 3MA5A 1HH8A 5JJ7A 1JUQA 2F8XK 2AXUA 4J7WA 3DSWA 1JWFA 4U8YD 3V31A 2AXVA 4JHKA 3LVQE 2XPIA 3SO8A 3CHRA 3RKVA 4GTTA 4GPMA 4JVSA 4KXKB 2M63A 2XPYA 1G3NB 4CDRA 1N52A 4EPZA 1UN8A 1H19A 3QNKA 5AAOA 2X6HA 3LJNA 3ASGA 1SZAA 2LAHA 2GRRB 1O1RA 2GROB 2IQCA 2LAIA 4L2YA 1NI1A 2Y0BG 2MYOA 1H2TC 3LY8A 3RRMB 3OXFA 3DSSA 1DNPA 4FP7A 4KMOA 1SA5A 4HI9A 2Y4TA 3HG0D 4F6RD 3DSVA 3CVQA 2PNNA 1E8ZA 4J8YA 5FTPA 4CZ2D 2PZIA 4U7EB 4YDEA 3U3WA 5FZSA 1KPSB 2A5EA 2HYZA 1TN6A 4ATZD 5J08A 1X5BA 1IHGA 3NBNB 4APOA 2J4BA 2RFMA 4BSZB 4P29A 4C48B 4L9PA 1BPOA 3ZVVA 5KBAA 1H6KA 3UT7A 2J8SD 5LCWJ 2A4ZA 2WVIA 2R02A 1K1AA 3FU3A 5CERB 4WWNA 4H7YA 2YINA 4XI0A 1UG3A 3U64A 5HI7A 3RIBA 2V5FA 4F7AA 4DX1A 3CKBA 1MYOA 3MJWA 1XGWA 4M7CA 4GTRA 4HOTA 3L22A 2HM8A 2P9PG 3RK6A 1H0AA 1N4PA 5EDSA 3CVXA 3ISMC 4IRUA 3KEAA 1KT1A 3BG0B 3TXNA 3JQ0A 5FINA 5B3SE 3PRZA 3FHEA 1JCSA 4ANXA 4BTAA 2FULA 3ASFA 3HHMA 4EZLA 3BEEA 3FP3A 3CGHA 4UWKA 2EQXA 4N2QA 3AU5A 1NA3A 2XEHA 3EJNA 2IONA 3SHFA 3ZHEB 3G2WA 3ULYA 3AAAC 5EX3A 3CR3A 2ZGDA 3ZYKA 4GTSA 4JZYA 1QZ2A 2B6CA 2XZDG 4XI9A 1Z5SC 4DJAA 3B7UX 3CK7A 5KNGA 4B8CB 5CEDB 4C0EA 2CG2A 2R05A 3ABLE 2PQNA 2Y3AA 3Q47B 3J5QB 2DVWA 4FJYA 4A3VA 4EBAG 4GZ3A 3D9PA 2RD0A 4A55A 4BT9A 3CHQA 4GZCA 4BSXA 4DLOA 3IV0A 1MX2A 3EDTB 3E32A 2J07A 4JEHA 3B13A 1EDUA 1UW4B 3LY9A 1FVHA 1MJ0A 2ONDA 3Q5MA 1ELWA 1Y6IA 4TXRA 2VSYA 4AIFA 4RVBA 4APFA 3T8MA 1NZNA 2WXLA 2KATA 4RLYA 3L08A 3V30A 4UWLA 1JCRA 2IO2C 4AV7A 4JB8P 1ELRA 1TNYA 3DEOA 3FDHA 5FQ7A 2IF4A 3DEPA 5KCMA 3P2BA 4LEUA 3ASNE 4U0ZA 4GTMA 4TV3A 5LX8A 1S63A 2DCPA 3BQOA 5EIBE 5AARA 1O5MA 4RG6A 3AS8A 4U0UA 1LD8A 3C5RA 3CK9A 5FWQA 3NZUA 3N71A 3CVUA 5G05C 2YNQA 1FT1A 3C72A 4U63A 1U3CA 2X3MA 3CQGB 1VDYA 4Q69A 3Q78A 3QKYA 5EN5D 2WXJA 3J5PA 4MRUA 3R9AB 1YA0A 4WNFA 3MZLB 4FHKA 3S2AA 4MS6A 3ZNGA 3ZUVB 4AM9A 5B1BE 2VTBB 1NL4A 4I6JA 3PE4A 3PEUB 2Y69E 2QY7A 4XX5A 3FTUA 3PNTB 4GYYA 4N3BA 2WQ7A 1O1SA 3I4GA 4LG6A 3Q7AA 1E7VA 3FTWA 5AYWD 2XRYA 3R7QA 4ACLA 4HOSA 3MKQB 3TWUA 3UXGA 3G2TA 3FY4A 5C2YA 5HKPA 5HS0A 3NZSA 3Q15A 4HRMB 3S7JA 2E0IA 4FLBA 3EHNA 4HOQA 4RQIA 5EILA 2KC7A 2AVPA 3UINC 4B94A 1SA4A 3FUJA 3U9WA 1NP7A 3FTVA 1OWPA 4BETA 3HXDA 3IBEA 4GMJA 3CHSA 3I3NA 3APFA 5EYLA 2WXMA 3T5XA 4K03A 3MCXA 3MV2B 2PQRA 4ILGA 2C0LA 4BESA 3FUNA 3JUIA 1N95A 3C98A 1EYHA 5CHEE 3PEVB 4I6GA 4U04A 3QARA 3SFYA 2WXIA 3ZXSA 2L6JA 4HRLA 5FQ4A 3SGHA 4NIKA 3ZGQA 5FT9A 2ETAA 3UMVA 2XGOA 3DPYA 3MEKA 4E6HA 5JHBA 3UQ3A 5BV0A 1OCRE 3LPZA 5C1DA 3L16A 4JHRA 3EHMA 4JXTA 3KD7A 4UQZA 4WNEA 4URKA 3JUEA 5LOZA 5AQAA 4MLPA 3TWTA 3AG4E 3RSEG 2XENA 4NACA 5ENRD 1TNZA 4AEZC 4GCNA 2I1JA 3B7SA 3UM1A 5ANRA 2VGYA 3CHOA 4UWFA 5KNHD 5AQBA 4U0SA 5ENPD 1MHQA 1YCSB 1LF8A 2L0TB 5G05J 3JYSA 3W9GA 2ETBA 1MX6A 2WXOA 3GYZA 4J8DA 4B89A 5AJLA 5BXUA 3VTXA 3VLEA 1OWNA 2XGSA 3BG1B 2NXPA 3FUMA 3FH7A 1E96B 3TWXA 3UKUG 5HQ8A 1MQSA 4NQ0A 3MKRA 3TG5A 2EIJE 3AG3E 4PDXA 3E33A 4OVUA 4CGWA 3HYMB 4DX7D 4V3IA 2CHXA 3AS5A 3EHRA 5HRYA 4XEIG 2C2LA 1WY6A 3LYAA 3C3OA 5E76A 3ZFWA 5BT1A 4JL0A 3R7RA 3CEQA 1JCQA 2KCVA 2WXKA 2CFZA 4GA2A 2DYSE 4JPSA 1HG5A 3CHPA 4CYMD 2BUGA 1TJFA 2FO7A 3D9KA 2EIME 4F53A 4BFRA 4U96D 3PZ1A 3EU5A 4FA6A 3HDXA 1V54E 2UY1A 3Q49B 4QFVA 4I17A 3CSFA 2DIWA 3B7TA 1TN8A 4JW1A 2OEWA 3G2SA 4L1BA 2VYIA 3OAWA 4EECA 4WNGA 4BWRA 2E2EA 1RW2A 3U66A 2ZGGA 4HFGA 4UI9C 2ILRA 3RO3A 4ME2A 3IEGA 5D0OD 4HNAD 4NRHB 3QJZA 3DSUA 2VGXA 4N39A 1S64A 2P9NG 1N4SA 3BUAA 1GW6A 3L9TA 1E8YA 3NOCD 3HVEA 3ZN3A 1N4QA 2JLBA 3NF1A 3AG2E 2PM7A 4W9RA 1HU3A 1ZBPA 1OY3D 2IOSA 2FF4A 4BEPA 2RKKA 3AS4A 2GRQB 3FULA 3SY2A 2XQ0A 4O1OA 3IXEA 5BUZA 3FU0A 5KJMA 4XIFA 3IHYA 2I1KA 3D9HA 1N94A 3ZW3A 1IYGA 2NYJA 3WXXA 1L5JA 3B7RL 4AJWA 3FTXA 3CVWA 2KZTB 3EU9A 3ZXPA 2IO3C 2DZNA 5H7PA 1TJCA 2BTDA 4L7TA 3UM2A 5D0QD 2LUHA 3NOGD 3ZYLA 5ENNA 2GW1A 4GTVA 4I6EA 1SQMA 2ZU6B 5CECB 3SFZA 2EINE 4BTBA 3QB2A 4JA9A 4M3OA 1LD7A 3ENEA 3ULEG 3TG4A 2I9CA 3FH8A 3ESLA 1OWMA 4L23A 2IOLA 5EKQD 2XEVA 4OAVB 4GMRA 4LCTA 3U4TA 3NB2A 1OWLA 4RSYA 5JA4D 1DC2A 5G55A 2A5UA 1Z3YA 2L9BA 4CCAA 4IN3B 3PZ3A 3UIOC 3FUIA 3JXIA 4DK5A 2J49A 4GA1A 4WAFA 4CGVA 4GYOA 4GTOA 1IXVA 1UOHA 2VSOE 3HRAA 5G2NA 4EZKA 4JC8A 3G2UA 4BERA 2WXNA 1PAQA 4N2SA 2DZOA 3NQPA 5AIJA 1H6PA 4O6FA 4CEMA 1RZ4A 1O1TA 3FUEA 3RO2A 5T4YA 2MRIA 1FPPA 2CG3A 3QAQA 4G26A 4DRXE 2LXMA 4PS7A 4CT4A 2B0OE 5BNWA 1BLXB 4UI9J 3TXMA 4C0MA 3LEWA 4KZ0A 2AW6A 3D9OA 2WB2A 3PUKA 3DSTA 3CVVA 1Q2ZA 3B95A 2WXHA 2IEJA 2J09A 3TWVA 4J8SA 3OXGA 3MV3B 2P9LG 1K3ZD 4DPRA 3Q9UC 1BI7B 4HVBA 3VTYA 4J0UA 4B0ZA 3L82A 5A7DB 4DI3A 1DCQA 2GRMA 2LSVA 2NSZA 1H2UA 5DIZA 3V79K 5JHAA 3CLJA 2X6FA 4F3VA 1UN9A 2X38A 3I5PA 3FTYA 4LUNU 3HXCA 3ONKA 2R5SA 4XZ4A 4HBDA 4UWHA 2LO6A 1ELKA 1E90A 4Y6CA 2XEEA 2R03A 4J6IA 4MBGA 5CBOA 4I1AA 2LXLA 5CCMA 1QBQA 4ABNA 4GB9A 3PZ4A 3DXMG 2QYJA 2V5QC 3ZHEA 3FEYA 3ZPJA 5M72A 3JQ1A 3D9NA 2WXQA 2WXRA 2XCBA 3Q73A 1BI8B 1KZPA 2XRZA 2V0PA 3E4BA 5JMND 5ARFA 2WQ6A 3HIZA 3SZ7A 4N5CA 3CVYA 1K1BA 4OVVA 3HXEA 3LVRE 1A17A 3UM0A 1IHBA 3O48A 4ILIA 2V4LA 1WM5A 4FLHA 1JWGA 1H6OA 1S70B 3FH5A 3ASDA 2WXFA 3JXJA 5ITZF 5FJYA 2KXPC 1V55E 4GA0A 4I43A 4I1OB 3QC1A 3QDNA 1YMPA 2LSUA 4OAUC 2OOEA 2WMOA 3I4RB 5DBKA 4TRQA 1EF1C 4FJZA 4EHMA 4PS3A 3KEZA 1TNUA 2CFUA 4N5QA 3C3RA 1TNOA 4KT6B 1TYQG 3D9JA 5BW8C 4H7XA 2X6JA 2YHEA 1E8XA 2RFAA 3QWWA 5KJKA 2UY1B 3LDZA 4PS8A 4TXPA 2DWZA 4ANVA 3PNLB 1Z3XA 3D3MA 5FZQA 4J8FA 2XZTG 3DSXA 1SW6A 2HE0A 3GZSA 4EQFA 3FUDA 4OYSA 4K5BA 1IQUA 4EZJA 1WG0A 4XE0A 1TEZA 5A23A 2VGEA 4AY6A 3SQVA 4LRZA 2L6BA 2WM9A 4DI4A 4D10C 4R7LA 1OXJA 5D66A 1P5QA 4LNBA 2F0YA 3CVPA 2VTBA 4BX8A 3F6QA 1WAO1 1HXIA 3PE3A 3C3QA 2MHKA 2ZIRA 4B93B 2YQ8A 3UTMA 4AP2A 2DYRE 1EPUA 2VSNA 1UJKA 3GZ1A 2EIKE 3T8KA 2OCCE 4Z68A 2P9UG 3FEXA 3FTSA 1W3BA 2VQ2A 2WXPA 3MGBA 4TUUA 5AN8A 3MKQA 3QOUA 4C9BB 4L2LA 5CMYA 2XGMA 4A1GA 3LCAA 3QWVA 1S0PA 4O1PA 3ML9A 3L54A 2KCLA 3ONLA 3ZRHA 4U95D 5ENSD 5B1AE 2F8YA 2KBXA 2XS1A 3TJPA 4G8LA 2BEDA 3UUXA 1OT8A 4CDMA 2OV8A 3TWSA 2XS8A 3PREA 2OEVA 3CK8A 4RG9A 3LJ3A 4Q94A 4PUCA 4HLLA 3PVLA 4N3AA 2NC9A 3Q7FA 1MX4A 1SZ9A 3IHVA 3KSQA 5LP0A 4KVOA 4QQIA 4AY5A 5CBNA 2H6HA 3V2OA 2QYUA 2WPVA 2BF0X 4HOUA 1AP7A 1HZ4A 4JHJA 5CRUA 3G2VA 4TUMA 4CT0A 3LS8A 5JJTA 2WQHA 5FQ8A 3MYVA 2J4DA 1Z6TA 4UWGA 4U07A 3FFLA 3VLFA 2VJ8A 2J9QA 5ANLA 4K5CA 3T9KA 4K0RA 5BXOA 4YNDA 3ZU7B 4KYOB 4BY6A 2GRPB 3RU0A 5KJNA 5EIDA 2CHZA 3RRUA 3ZKJA 3D9LA 4HLEA 3EIQC 3Q75A 4HS2A 3CQCB 2GRNB 4ILHB 3D9MA 3FU5A 4J8EA 3BU8A 4WNDA 2QFCA 2R17C 1D8EA 1N54A 2V8SE 1DVPA 2X6IA 1INZA 4K5AB 4X8QA 3LY7A 4YDOA 3B7BA 3E34A 3UT8A 3AJIA 1WDYA 2RG8A 4A1SA 1KZOA 1PC2A 5BV1A 4IULA 3GZ2A 3EIJA 4YDYA 1X81A 4A63B 2V4HC 5CEAA 4ANWA 3CVLA 3RJVA 4GYWA 2JABA 1HFAA 3ABME 2P9SG 5ENTD 1HE8A 3SD5A 3TWRA 3PUJA 3JCKC 4GZ5A 3MX3A 1TN7A 4AOFA 1B89A 4DLQA 4F1SA 5CMWA 4XKBA 4AVXA 4CDNA 5AQ9A 3OXLA 2FEZA 3WG7E 1QQEA 3DXKG 1HG2A 4UQYA 3T5VA 1TNBA 1K8KG 2F37A 3PZDA 2ZXWE 1U2VG 4HXIA 4EBAA 1E8WA 4ACKA 1BU9A 2XHEA 4ZFHA 1XNFA 1Y8MA 1AWCB 1A5EA 3ZIMA 3TL5A 1D8DA 3Q4AB 3KAEA 3SBSA 4FU3A 2Y1LE 3KSLA 2FI7A 2H6GA 2H6FA 4DX6D 4ATGA 3GW4A 2LNIA 1TR4A 1N4RA 4ANUA 4GAAA 2Y4UA 4XKCA 4GMLA 4G23A 3CHMA 3RRNB 1SVXA 3SNXA 3L6AA 1LTXA 2DBAA 3EUVA 3UKRG 1U3DA 3X2QE 3Q9NC 4N3CA 2EILE 2GGFA 2MOWA 3ZYQA 3SF4A 3OTNA 4G24A 3R9MA 3DWLG 5EX0A 2PL2A 3FWVA 3FUKA 5JJ6A 2HO1A 4I2WA 4DUIA 4CRWA 5E75A 3CV0A 4GTPA 5AJDA 3HXBA 3SFXA 3RAUA 2ZISA 4GCOA 4PH4B 5A6CA 5CCLA 4GTQA 2P9IG 3W9FA 4JA7A 4G2VA 5KJLA 1ZB1A 4AXHA 3PH0C 4TXQA 4MKTA 3FTZA 5G04C 4WWOA 4I9EA 1PY1A 4GU5A 3QWPA 3DPDA 3FU6A 3UX4A 2CHWA 2L0IA 5T3RA 2P2CP 3NAWA 3APDA 5T8IA 2X6KA 3SI5A 3LXUX 3TAXA 1UJJA 4JEUA 2KZTA 2BKKB 4Q96A 5KWDA 3AU4A 3TWWA 3DBSA 4LERA 2H6IA 2QC9A
chains in the Genus database with same CATH topology
2DIWA 2EQXA 2FBNA 3B7TA 4N2QA 5LFAA 3VLDA 3AU5A 2P58C 4JW1A 1NA3A 3EJNA 3G2SA 4L1BA 2VYIA 2HR2A 2IONA 3SHFA 3OAWA 4EECA 4WNGA 4BWRA 2E2EA 3GZSA 4EQFA 1OWOA 3FUDA 2XCCA 4GZ6A 4OYSA 3ZHEB 1IQUA 3U66A 3G2WA 4EZJA 5EX3A 4HFGA 3CR3A 3ZYKA 4XE0A 4JZYA 1QZ2A 4KVMA 4DJAA 4XI9A 1KLXA 2ILRA 4UI9C 3B7UX 5A23A 1TEZA 3CK7A 4B8CB 3RO3A 2IU1A 3KS2A 4ME2A 2KM4A 4C0EA 2CG2A 3IEGA 1H2VC 5D0OD 4AY6A 4LRZA 4NRHB 2PQNA 2Y3AA 2WM9A 3QJZA 2VGXA 3Q47B 4N39A 3S7BA 4DI4A 4FJYA 4D10C 4FADA 4R7LA 4A3VA 4EBAG 2J08A 1P5QA 4GZ3A 4IYPA 3D9PA 2RD0A 1GW6A 3CVPA 2VTBA 4BX8A 4A55A 1WAO1 1E8YA 1HXIA 4G1TA 4BT9A 3PE3A 3CHQA 4GZCA 3HVEA 3ZN3A 2MHKA 4BSXA 2YQ8A 4DLOA 3IV0A 3EDTB 2J07A 2JLBA 4JEHA 2PM6A 3NF1A 3S7DA 3B13A 1EDUA 4AP2A 1UW4B 2PM7A 3LY9A 4W9RA 1FVHA 1HU3A 4BT8A 2ONDA 4Y6WA 1EPUA 1ZBPA 2VSNA 3K9IA 3URZA 2IOSA 5FZRA 2FF4A 3Q5MA 1UJKA 1ELWA 1Y6IA 3ESKA 3GZ1A 2VSYA 4AIFA 4RVBA 4APFA 3T8MA 1NZNA 3FEXA 3FTSA 2WXLA 2AXZA 2KATA 3LKUA 3AS4A 1IQRA 1W3BA 2VQ2A 2WXPA 3FULA 2XQ0A 3MGBA 4TUUA 3MKQA 4FC8A 3L08A 3QOUA 2IFUA 4C9BB 4L2LA 2IJGX 5CMYA 5BUZA 2XGMA 4UWLA 4A1GA 3LCAA 3FU0A 3QWVA 1FVFA 5KJMA 4AV7A 4XIFA 1ELRA 1S0PA 3IHYA 3ML9A 3L54A 2KCLA 2WMNA 2I1KA 3ONLA 3ZRHA 3ZW3A 3FDHA 5FQ7A 2IF4A 3UPVA 3FUHA 1IYGA 5KCMA 3TJPA 3WXXA 3PDNA 3P2BA 4LEUA 1HS6A 1L5JA 3B7RL 3D9IA 3UUXA 4AJWA 4CDMA 2OV8A 3FTXA 4U0ZA 3O4ZA 3PREA 3CK8A 4RG9A 2KZTB 3LJ3A 3CVWA 4Q94A 4PUCA 5AENA 2C0MA 3PVLA 4N3AA 4E85A 4TV3A 1OUVA 2NC9A 5LX8A 1SZ9A 3IHVA 5LP0A 5J90A 2DCPA 3CVNA 1TJCA 2BTDA 4G25A 4KVOA 3ZYMA 1QNFA 4AY5A 4L7TA 1JPLA 3CKCA 2XPZA 4B8AA 4FHJA 2WPVA 2R59A 5D0QD 2BF0X 4I2ZA 4RG6A 4HOUA 3AS8A 4U0UA 4G11A 1HZ4A 3CK9A 5FWQA 4A3TA 3NZUA 3N71A 4JHJA 3G2VA 3CVUA 5G05C 2YNQA 3ZYLA 4CT0A 3LS8A 5ENNA 4U63A 1U3CA 2I2OA 2X3MA 2GW1A 5JJTA 2WQHA 5FQ8A 3CQGB 3MYVA 1VDYA 4Q69A 2J4DA 1Z6TA 3L17A 4I6EA 1SQMA 4UWGA 2ZU6B 4U07A 3SFZA 3FFLA 3QKYA 3VLFA 3IKOB 2WXJA 2VJ8A 4UQXA 2J9QA 4BTBA 5ANLA 4MRUA 3QB2A 2Q7FA 4JA9A 3R9AB 4M3OA 2VGXB 3ENEA 3TG4A 1YA0A 2I9CA 4K0RA 4WNFA 3FH8A 2AWIA 3ESLA 3MZLB 4FHKA 4YNDA 3S2AA 2YHCA 5LCWC 1OWMA 4KYOB 2IOLA 4MS6A 4L23A 5EKQD 2XEVA 3CIAA 4BY6A 3RU0A 4AM9A 5KJNA 2VTBB 4LCTA 2CHZA 3U4TA 5G04J 1OWLA 4RSYA 3RRUA 4U8HA 4I6JA 3HVEB 5G55A 3PE4A 2A5UA 3D9LA 4HLEA 1Z3YA 2L9BA 3PEUB 4CCAA 4IN3B 4NURA 2QY7A 4XX5A 3FTUA 3SBTB 3EIQC 3PNTB 4GYYA 4N3BA 4HS2A 3CQCB 3PS6A 2WQ7A 3FUIA 4ILHB 3D9MA 4DK5A 1E7UA 3I4GA 3FU5A 4J8EA 4WNDA 4I9CA 5FQ6A 1HX8A 2J49A 2QFCA 3APCA 3ML8A 3TGOA 4GA1A 1E7VA 2R17C 3FTWA 4WAFA 2JEKA 4CGVA 1N54A 4GYOA 2V8SE 4FULA 5AYWD 1DVPA 2X6IA 1INZA 2VSOE 2XRYA 2UWJG 4KZCA 5G2NA 4EZKA 3R7QA 4JC8A 3G2UA 4KBQA 4ACLA 2WXNA 1PAQA 3MKQB 4HOSA 4GPKA 1HF8A 3LY7A 3ULQA 4N2SA 3NQPA 3UT8A 5AIJA 2OVBA 3ASHA 3G2TA 3QK0A 3FY4A 5C2YA 2RG8A 4A1SA 4O6FA 4CEMA 3NZSA 1PC2A 3FUEA 3Q15A 3RO2A 5BV1A 4IULA 3GZ2A 5T4YA 3S7JA 3EIJA 4WUYA 4BX9A 2MRIA 3S7FA 2E0IA 4FLBA 4ANWA 2CG3A 3EHNA 4HOQA 2WXGA 3QAQA 3CVLA 4G26A 4I1MA 3RJVA 4GYWA 2KC7A 4PS7A 2AVPA 1HFAA 4CT4A 4B94A 5BNWA 3CSTA 3SD5A 1HE8A 1HO8A 3FUJA 3FUFA 3PUJA 3JCKC 4GZ5A 3U9WA 3MX3A 1NP7A 3FTVA 1OWPA 4UI9J 2OVFA 3TXMA 4AOFA 3IBEA 2VSXE 3U3WA 4GMJA 3CHSA 1B89A 3I3NA 3APFA 4YVQC 1ZU2A 4C0MA 3LEWA 3P1UA 4DLQA 4KZ0A 1FCHA 2AW6A 2WXMA 3D9OA 5BPPA 2WB2A 3PUKA 3T5XA 4F1SA 3CVVA 4GZDA 5CMWA 4K03A 4XKBA 4AVXA 2I6HA 4CDNA 4YVOA 3MCXA 3MV2B 2PQRA 4ILGA 1NA0A 2C0LA 2KCKA 2WXHA 3FUNA 3OXLA 3UT4A 3JUIA 4UI9K 4WWPA 4HORA 2FEZA 2J09A 1KT0A 1QQEA 3C98A 1HG2A 3ZEFA 4J8SA 1EYHA 2GRLA 3OXGA 3L13A 3MV3B 4UQYA 3PEVB 5CHEE 4I6GA 3T5VA 4DPRA 5ARGA 4U04A 3MA5A 3QARA 4HVBA 1HH8A 5JJ7A 1JUQA 3VTYA 4J0UA 4B0ZA 2WXIA 3PZDA 2AXUA 5A7DB 4DI3A 2GRMA 3ZXSA 2L6JA 1JWFA 5FQ4A 3SGHA 3ZGQA 2AXVA 2LSVA 1H2UA 2NSZA 4HXIA 5DIZA 4JHKA 3LVQE 5JHAA 5FT9A 3CLJA 2X6FA 3UMVA 4EBAA 4F3VA 1UN9A 2XPIA 3CHRA 3RKVA 2XGOA 1E8WA 2X38A 3I5PA 4JVSA 4KXKB 3FTYA 4LUNU 2M63A 2XPYA 4ACKA 4CDRA 3MEKA 4E6HA 5JHBA 2XHEA 3ONKA 1N52A 1XNFA 3UQ3A 4EPZA 1Y8MA 5BV0A 1UN8A 1H19A 3LPZA 3QNKA 5C1DA 3L16A 3ZIMA 2X6HA 4JHRA 3TL5A 2R5SA 3Q4AB 3ASGA 1SZAA 3EHMA 3KAEA 4JXTA 2LAHA 4UWHA 4XZ4A 3KD7A 4FU3A 4UQZA 4WNEA 3SBSA 4URKA 2FI7A 2LO6A 2IQCA 2LAIA 1ELKA 1E90A 4L2YA 5LOZA 4ATGA 3GW4A 4Y6CA 2LNIA 4MLPA 1H2TC 4ANUA 3LY8A 4GAAA 2Y4UA 4XKCA 4J6IA 3RRMB 3OXFA 1DNPA 4GMLA 4G23A 3CHMA 4I1AA 5CCMA 3RRNB 3SNXA 4ABNA 3L6AA 4FP7A 4KMOA 4NACA 2DBAA 4GB9A 2Y4TA 4AEZC 1U3DA 4GCNA 3ZHEA 3FEYA 3CVQA 4N3CA 3ZPJA 5M72A 3JQ1A 2GGFA 1E8ZA 3D9NA 2I1JA 2MOWA 2WXQA 2WXRA 3B7SA 2XCBA 5FTPA 3ZYQA 3SF4A 3OTNA 4G24A 2XRZA 2V0PA 3E4BA 5ANRA 2VGYA 5EX0A 3CHOA 4UWFA 2PL2A 2PZIA 3FWVA 3FUKA 3HIZA 5ARFA 5FZSA 3SZ7A 4N5CA 2HO1A 5JJ6A 2WQ6A 4I2WA 4U0SA 3CVYA 4OVVA 2HYZA 4CRWA 1MHQA 3LVRE 1LF8A 2L0TB 1A17A 5E75A 5G05J 3JYSA 5J08A 1X5BA 3CV0A 1IHGA 2WXOA 4APOA 3GYZA 2J4BA 4J8DA 4B89A 4P29A 5AJLA 3O48A 5AJDA 1BPOA 3ZVVA 4ILIA 3VTXA 1H6KA 2V4LA 3UT7A 3VLEA 4GCOA 4PH4B 1WM5A 1OWNA 2XGSA 4FLHA 1JWGA 3BG1B 2NXPA 3FUMA 3FH7A 5A6CA 1E96B 2A4ZA 5LCWJ 2WVIA 5CCLA 3FH5A 3ASDA 2WXFA 5HQ8A 3FU3A 1MQSA 4NQ0A 3MKRA 3TG5A 5FJYA 4JA7A 4GA0A 4I43A 4I1OB 4H7YA 2YINA 4G2VA 4XI0A 3QC1A 4WWNA 5KJLA 4PDXA 4AXHA 3PH0C 1UG3A 3QDNA 3U64A 4OVUA 2LSUA 5HI7A 4MKTA 3RIBA 3FTZA 2V5FA 5G04C 4F7AA 4CGWA 3CKBA 2OOEA 2WMOA 4WWOA 3HYMB 4V3IA 4I9EA 1PY1A 2CHXA 3AS5A 3I4RB 3MJWA 4GU5A 5DBKA 1XGWA 3QWPA 4TRQA 1EF1C 4FJZA 4PS3A 4HOTA 3DPDA 3KEZA 2HM8A 3L22A 2C2LA 3FU6A 3UX4A 2CHWA 1WY6A 2L0IA 3LYAA 5T3RA 2CFUA 5E76A 3ZFWA 5BT1A 3RK6A 4JL0A 4KT6B 3R7RA 1H0AA 3APDA 3CEQA 3D9JA 5EDSA 3CVXA 5BW8C 4IRUA 5T8IA 4H7XA 1KT1A 2KCVA 3BG0B 2X6JA 2CFZA 2WXKA 4GA2A 2YHEA 1E8XA 2X6KA 3SI5A 3LXUX 3JQ0A 3TXNA 3TAXA 3QWWA 1UJJA 4JPSA 1HG5A 3FHEA 3PRZA 4JEUA 2UY1B 3CHPA 5KJKA 3LDZA 4PS8A 4ANXA 4BTAA 2KZTA 2BUGA 1TJFA 2FULA 3ASFA 4ANVA 2FO7A 3D9KA 3HHMA 4Q96A 4F53A 3AU4A 4EZLA 3BEEA 4BFRA 3PNLB 1Z3XA 3DBSA 3FP3A 4LERA 3CGHA 3D3MA 4UWKA 4FA6A 3HDXA 5FZQA 4J8FA 2UY1A 3Q49B 4QFVA 4I17A 3CSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IQC A; 
#chains in the Genus database with same CATH topology
 2FBN A;  5LFA A;  3VLD A;  2P58 C;  2HR2 A;  2AJA A;  5FIO A;  1OWO A;  4GZ6 A;  2XCC A;  4LNU D;  4HQD A;  4KVM A;  1KLX A;  2IU1 A;  3KS2 A;  2KM4 A;  1H2V C;  1N11 A;  4HI8 A;  4LSZ E;  3S7B A;  3TWQ A;  4FAD A;  4O60 A;  2J08 A;  4IYP A;  4G1T A;  4U8V D;  2PM6 A;  4LNG A;  2P9K G;  3S7D A;  1MZC A;  4DX5 D;  4BT8 A;  4Y6W A;  3AG1 E;  3K9I A;  3URZ A;  5FZR A;  3HXF A;  3ESK A;  2AXZ A;  3LKU A;  1IQR A;  4HB5 A;  4YDW A;  1OCZ E;  4FC8 A;  2IFU A;  2IJG X;  3EHQ A;  1FVF A;  4ZHB A;  2WMN A;  1BD8 A;  4HRN A;  1N0Q A;  3UPV A;  3FUH A;  2R2L A;  3PDN A;  1HS6 A;  3D9I A;  3O4Z A;  5AEN A;  2C0M A;  2ETC A;  4E85 A;  1OUV A;  3PZ2 A;  5J90 A;  3CVN A;  4G25 A;  3E30 A;  3ZYM A;  1QNF A;  1OCC E;  1JPL A;  3CKC A;  2XPZ A;  4B8A A;  4FHJ A;  2R59 A;  4I2Z A;  4G11 A;  4A3T A;  5D2M C;  2I2O A;  5ENO D;  1YYH A;  3L17 A;  1NFI E;  1FT2 A;  3IKO B;  4UQX A;  2Q7F A;  2VGX B;  2AWI A;  2YHC A;  5LCW C;  3UM3 A;  2FO1 E;  3CIA A;  5G04 J;  4U8H A;  4G8K A;  3HVE B;  3UIP C;  2IY0 C;  3ABK E;  4NUR A;  3SBT B;  5CRV A;  3PS6 A;  4JD2 G;  1E7U A;  1QYM A;  4I9C A;  5FQ6 A;  1HX8 A;  3APC A;  3ML8 A;  3TGO A;  2JEK A;  5EYP F;  4FUL A;  2UWJ G;  4KZC A;  1IKN D;  4KBQ A;  1DCE A;  4GPK A;  1HF8 A;  3ULQ A;  2OVB A;  3ASH A;  3QK0 A;  2BKG A;  2QZA A;  4WUY A;  4BX9 A;  3S7F A;  3Q79 A;  1N9A A;  2WXG A;  5ENQ D;  4I1M A;  1D9S A;  1N0R A;  3CST A;  1HO8 A;  3FUF A;  3E37 A;  3UI2 A;  2OVF A;  2VSX E;  1OCO E;  4YVQ C;  1ZU2 A;  3P1U A;  1FCH A;  4UUC A;  5BPP A;  4GZD A;  2I6H A;  3DRA A;  4YVO A;  1NA0 A;  2KCK A;  4DX2 A;  3UT4 A;  4UI9 K;  3V2X A;  4WWP A;  4HOR A;  1KT0 A;  5AQ7 A;  5IY5 E;  4F1P A;  3ZEF A;  2GRL A;  3ASO E;  3L13 A;  5ARG A;  3MA5 A;  1HH8 A;  5JJ7 A;  1JUQ A;  2F8X K;  2AXU A;  4J7W A;  3DSW A;  1JWF A;  4U8Y D;  3V31 A;  2AXV A;  4JHK A;  3LVQ E;  2XPI A;  3SO8 A;  3CHR A;  3RKV A;  4GTT A;  4GPM A;  4JVS A;  4KXK B;  2M63 A;  2XPY A;  1G3N B;  4CDR A;  1N52 A;  4EPZ A;  1UN8 A;  1H19 A;  3QNK A;  5AAO A;  2X6H A;  3LJN A;  3ASG A;  1SZA A;  2LAH A;  2GRR B;  1O1R A;  2GRO B;  2IQC A;  2LAI A;  4L2Y A;  1NI1 A;  2Y0B G;  2MYO A;  1H2T C;  3LY8 A;  3RRM B;  3OXF A;  3DSS A;  1DNP A;  4FP7 A;  4KMO A;  1SA5 A;  4HI9 A;  2Y4T A;  3HG0 D;  4F6R D;  3DSV A;  3CVQ A;  2PNN A;  1E8Z A;  4J8Y A;  5FTP A;  4CZ2 D;  2PZI A;  4U7E B;  4YDE A;  3U3W A;  5FZS A;  1KPS B;  2A5E A;  2HYZ A;  1TN6 A;  4ATZ D;  5J08 A;  1X5B A;  1IHG A;  3NBN B;  4APO A;  2J4B A;  2RFM A;  4BSZ B;  4P29 A;  4C48 B;  4L9P A;  1BPO A;  3ZVV A;  5KBA A;  1H6K A;  3UT7 A;  2J8S D;  5LCW J;  2A4Z A;  2WVI A;  2R02 A;  1K1A A;  3FU3 A;  5CER B;  4WWN A;  4H7Y A;  2YIN A;  4XI0 A;  1UG3 A;  3U64 A;  5HI7 A;  3RIB A;  2V5F A;  4F7A A;  4DX1 A;  3CKB A;  1MYO A;  3MJW A;  1XGW A;  4M7C A;  4GTR A;  4HOT A;  3L22 A;  2HM8 A;  2P9P G;  3RK6 A;  1H0A A;  1N4P A;  5EDS A;  3CVX A;  3ISM C;  4IRU A;  3KEA A;  1KT1 A;  3BG0 B;  3TXN A;  3JQ0 A;  5FIN A;  5B3S E;  3PRZ A;  3FHE A;  1JCS A;  4ANX A;  4BTA A;  2FUL A;  3ASF A;  3HHM A;  4EZL A;  3BEE A;  3FP3 A;  3CGH A;  4UWK A;  2EQX A;  4N2Q A;  3AU5 A;  1NA3 A;  2XEH A;  3EJN A;  2ION A;  3SHF A;  3ZHE B;  3G2W A;  3ULY A;  3AAA C;  5EX3 A;  3CR3 A;  2ZGD A;  3ZYK A;  4GTS A;  4JZY A;  1QZ2 A;  2B6C A;  2XZD G;  4XI9 A;  1Z5S C;  4DJA A;  3B7U X;  3CK7 A;  5KNG A;  4B8C B;  5CED B;  4C0E A;  2CG2 A;  2R05 A;  3ABL E;  2PQN A;  2Y3A A;  3Q47 B;  3J5Q B;  2DVW A;  4FJY A;  4A3V A;  4EBA G;  4GZ3 A;  3D9P A;  2RD0 A;  4A55 A;  4BT9 A;  3CHQ A;  4GZC A;  4BSX A;  4DLO A;  3IV0 A;  1MX2 A;  3EDT B;  3E32 A;  2J07 A;  4JEH A;  3B13 A;  1EDU A;  1UW4 B;  3LY9 A;  1FVH A;  1MJ0 A;  2OND A;  3Q5M A;  1ELW A;  1Y6I A;  4TXR A;  2VSY A;  4AIF A;  4RVB A;  4APF A;  3T8M A;  1NZN A;  2WXL A;  2KAT A;  4RLY A;  3L08 A;  3V30 A;  4UWL A;  1JCR A;  2IO2 C;  4AV7 A;  4JB8 P;  1ELR A;  1TNY A;  3DEO A;  3FDH A;  5FQ7 A;  2IF4 A;  3DEP A;  5KCM A;  3P2B A;  4LEU A;  3ASN E;  4U0Z A;  4GTM A;  4TV3 A;  5LX8 A;  1S63 A;  2DCP A;  3BQO A;  5EIB E;  5AAR A;  1O5M A;  4RG6 A;  3AS8 A;  4U0U A;  1LD8 A;  3C5R A;  3CK9 A;  5FWQ A;  3NZU A;  3N71 A;  3CVU A;  5G05 C;  2YNQ A;  1FT1 A;  3C72 A;  4U63 A;  1U3C A;  2X3M A;  3CQG B;  1VDY A;  4Q69 A;  3Q78 A;  3QKY A;  5EN5 D;  2WXJ A;  3J5P A;  4MRU A;  3R9A B;  1YA0 A;  4WNF A;  3MZL B;  4FHK A;  3S2A A;  4MS6 A;  3ZNG A;  3ZUV B;  4AM9 A;  5B1B E;  2VTB B;  1NL4 A;  4I6J A;  3PE4 A;  3PEU B;  2Y69 E;  2QY7 A;  4XX5 A;  3FTU A;  3PNT B;  4GYY A;  4N3B A;  2WQ7 A;  1O1S A;  3I4G A;  4LG6 A;  3Q7A A;  1E7V A;  3FTW A;  5AYW D;  2XRY A;  3R7Q A;  4ACL A;  4HOS A;  3MKQ B;  3TWU A;  3UXG A;  3G2T A;  3FY4 A;  5C2Y A;  5HKP A;  5HS0 A;  3NZS A;  3Q15 A;  4HRM B;  3S7J A;  2E0I A;  4FLB A;  3EHN A;  4HOQ A;  4RQI A;  5EIL A;  2KC7 A;  2AVP A;  3UIN C;  4B94 A;  1SA4 A;  3FUJ A;  3U9W A;  1NP7 A;  3FTV A;  1OWP A;  4BET A;  3HXD A;  3IBE A;  4GMJ A;  3CHS A;  3I3N A;  3APF A;  5EYL A;  2WXM A;  3T5X A;  4K03 A;  3MCX A;  3MV2 B;  2PQR A;  4ILG A;  2C0L A;  4BES A;  3FUN A;  3JUI A;  1N95 A;  3C98 A;  1EYH A;  5CHE E;  3PEV B;  4I6G A;  4U04 A;  3QAR A;  3SFY A;  2WXI A;  3ZXS A;  2L6J A;  4HRL A;  5FQ4 A;  3SGH A;  4NIK A;  3ZGQ A;  5FT9 A;  2ETA A;  3UMV A;  2XGO A;  3DPY A;  3MEK A;  4E6H A;  5JHB A;  3UQ3 A;  5BV0 A;  1OCR E;  3LPZ A;  5C1D A;  3L16 A;  4JHR A;  3EHM A;  4JXT A;  3KD7 A;  4UQZ A;  4WNE A;  4URK A;  3JUE A;  5LOZ A;  5AQA A;  4MLP A;  3TWT A;  3AG4 E;  3RSE G;  2XEN A;  4NAC A;  5ENR D;  1TNZ A;  4AEZ C;  4GCN A;  2I1J A;  3B7S A;  3UM1 A;  5ANR A;  2VGY A;  3CHO A;  4UWF A;  5KNH D;  5AQB A;  4U0S A;  5ENP D;  1MHQ A;  1YCS B;  1LF8 A;  2L0T B;  5G05 J;  3JYS A;  3W9G A;  2ETB A;  1MX6 A;  2WXO A;  3GYZ A;  4J8D A;  4B89 A;  5AJL A;  5BXU A;  3VTX A;  3VLE A;  1OWN A;  2XGS A;  3BG1 B;  2NXP A;  3FUM A;  3FH7 A;  1E96 B;  3TWX A;  3UKU G;  5HQ8 A;  1MQS A;  4NQ0 A;  3MKR A;  3TG5 A;  2EIJ E;  3AG3 E;  4PDX A;  3E33 A;  4OVU A;  4CGW A;  3HYM B;  4DX7 D;  4V3I A;  2CHX A;  3AS5 A;  3EHR A;  5HRY A;  4XEI G;  2C2L A;  1WY6 A;  3LYA A;  3C3O A;  5E76 A;  3ZFW A;  5BT1 A;  4JL0 A;  3R7R A;  3CEQ A;  1JCQ A;  2KCV A;  2WXK A;  2CFZ A;  4GA2 A;  2DYS E;  4JPS A;  1HG5 A;  3CHP A;  4CYM D;  2BUG A;  1TJF A;  2FO7 A;  3D9K A;  2EIM E;  4F53 A;  4BFR A;  4U96 D;  3PZ1 A;  3EU5 A;  4FA6 A;  3HDX A;  1V54 E;  2UY1 A;  3Q49 B;  4QFV A;  4I17 A;  3CSF A;  2DIW A;  3B7T A;  1TN8 A;  4JW1 A;  2OEW A;  3G2S A;  4L1B A;  2VYI A;  3OAW A;  4EEC A;  4WNG A;  4BWR A;  2E2E A;  1RW2 A;  3U66 A;  2ZGG A;  4HFG A;  4UI9 C;  2ILR A;  3RO3 A;  4ME2 A;  3IEG A;  5D0O D;  4HNA D;  4NRH B;  3QJZ A;  3DSU A;  2VGX A;  4N39 A;  1S64 A;  2P9N G;  1N4S A;  3BUA A;  1GW6 A;  3L9T A;  1E8Y A;  3NOC D;  3HVE A;  3ZN3 A;  1N4Q A;  2JLB A;  3NF1 A;  3AG2 E;  2PM7 A;  4W9R A;  1HU3 A;  1ZBP A;  1OY3 D;  2IOS A;  2FF4 A;  4BEP A;  2RKK A;  3AS4 A;  2GRQ B;  3FUL A;  3SY2 A;  2XQ0 A;  4O1O A;  3IXE A;  5BUZ A;  3FU0 A;  5KJM A;  4XIF A;  3IHY A;  2I1K A;  3D9H A;  1N94 A;  3ZW3 A;  1IYG A;  2NYJ A;  3WXX A;  1L5J A;  3B7R L;  4AJW A;  3FTX A;  3CVW A;  2KZT B;  3EU9 A;  3ZXP A;  2IO3 C;  2DZN A;  5H7P A;  1TJC A;  2BTD A;  4L7T A;  3UM2 A;  5D0Q D;  2LUH A;  3NOG D;  3ZYL A;  5ENN A;  2GW1 A;  4GTV A;  4I6E A;  1SQM A;  2ZU6 B;  5CEC B;  3SFZ A;  2EIN E;  4BTB A;  3QB2 A;  4JA9 A;  4M3O A;  1LD7 A;  3ENE A;  3ULE G;  3TG4 A;  2I9C A;  3FH8 A;  3ESL A;  1OWM A;  4L23 A;  2IOL A;  5EKQ D;  2XEV A;  4OAV B;  4GMR A;  4LCT A;  3U4T A;  3NB2 A;  1OWL A;  4RSY A;  5JA4 D;  1DC2 A;  5G55 A;  2A5U A;  1Z3Y A;  2L9B A;  4CCA A;  4IN3 B;  3PZ3 A;  3UIO C;  3FUI A;  3JXI A;  4DK5 A;  2J49 A;  4GA1 A;  4WAF A;  4CGV A;  4GYO A;  4GTO A;  1IXV A;  1UOH A;  2VSO E;  3HRA A;  5G2N A;  4EZK A;  4JC8 A;  3G2U A;  4BER A;  2WXN A;  1PAQ A;  4N2S A;  2DZO A;  3NQP A;  5AIJ A;  1H6P A;  4O6F A;  4CEM A;  1RZ4 A;  1O1T A;  3FUE A;  3RO2 A;  5T4Y A;  2MRI A;  1FPP A;  2CG3 A;  3QAQ A;  4G26 A;  4DRX E;  2LXM A;  4PS7 A;  4CT4 A;  2B0O E;  5BNW A;  1BLX B;  4UI9 J;  3TXM A;  4C0M A;  3LEW A;  4KZ0 A;  2AW6 A;  3D9O A;  2WB2 A;  3PUK A;  3DST A;  3CVV A;  1Q2Z A;  3B95 A;  2WXH A;  2IEJ A;  2J09 A;  3TWV A;  4J8S A;  3OXG A;  3MV3 B;  2P9L G;  1K3Z D;  4DPR A;  3Q9U C;  1BI7 B;  4HVB A;  3VTY A;  4J0U A;  4B0Z A;  3L82 A;  5A7D B;  4DI3 A;  1DCQ A;  2GRM A;  2LSV A;  2NSZ A;  1H2U A;  5DIZ A;  3V79 K;  5JHA A;  3CLJ A;  2X6F A;  4F3V A;  1UN9 A;  2X38 A;  3I5P A;  3FTY A;  4LUN U;  3HXC A;  3ONK A;  2R5S A;  4XZ4 A;  4HBD A;  4UWH A;  2LO6 A;  1ELK A;  1E90 A;  4Y6C A;  2XEE A;  2R03 A;  4J6I A;  4MBG A;  5CBO A;  4I1A A;  2LXL A;  5CCM A;  1QBQ A;  4ABN A;  4GB9 A;  3PZ4 A;  3DXM G;  2QYJ A;  2V5Q C;  3ZHE A;  3FEY A;  3ZPJ A;  5M72 A;  3JQ1 A;  3D9N A;  2WXQ A;  2WXR A;  2XCB A;  3Q73 A;  1BI8 B;  1KZP A;  2XRZ A;  2V0P A;  3E4B A;  5JMN D;  5ARF A;  2WQ6 A;  3HIZ A;  3SZ7 A;  4N5C A;  3CVY A;  1K1B A;  4OVV A;  3HXE A;  3LVR E;  1A17 A;  3UM0 A;  1IHB A;  3O48 A;  4ILI A;  2V4L A;  1WM5 A;  4FLH A;  1JWG A;  1H6O A;  1S70 B;  3FH5 A;  3ASD A;  2WXF A;  3JXJ A;  5ITZ F;  5FJY A;  2KXP C;  1V55 E;  4GA0 A;  4I43 A;  4I1O B;  3QC1 A;  3QDN A;  1YMP A;  2LSU A;  4OAU C;  2OOE A;  2WMO A;  3I4R B;  5DBK A;  4TRQ A;  1EF1 C;  4FJZ A;  4EHM A;  4PS3 A;  3KEZ A;  1TNU A;  2CFU A;  4N5Q A;  3C3R A;  1TNO A;  4KT6 B;  1TYQ G;  3D9J A;  5BW8 C;  4H7X A;  2X6J A;  2YHE A;  1E8X A;  2RFA A;  3QWW A;  5KJK A;  2UY1 B;  3LDZ A;  4PS8 A;  4TXP A;  2DWZ A;  4ANV A;  3PNL B;  1Z3X A;  3D3M A;  5FZQ A;  4J8F A;  2XZT G;  3DSX A;  1SW6 A;  2HE0 A;  3GZS A;  4EQF A;  3FUD A;  4OYS A;  4K5B A;  1IQU A;  4EZJ A;  1WG0 A;  4XE0 A;  1TEZ A;  5A23 A;  2VGE A;  4AY6 A;  3SQV A;  4LRZ A;  2L6B A;  2WM9 A;  4DI4 A;  4D10 C;  4R7L A;  1OXJ A;  5D66 A;  1P5Q A;  4LNB A;  2F0Y A;  3CVP A;  2VTB A;  4BX8 A;  3F6Q A;  1WAO 1;  1HXI A;  3PE3 A;  3C3Q A;  2MHK A;  2ZIR A;  4B93 B;  2YQ8 A;  3UTM A;  4AP2 A;  2DYR E;  1EPU A;  2VSN A;  1UJK A;  3GZ1 A;  2EIK E;  3T8K A;  2OCC E;  4Z68 A;  2P9U G;  3FEX A;  3FTS A;  1W3B A;  2VQ2 A;  2WXP A;  3MGB A;  4TUU A;  5AN8 A;  3MKQ A;  3QOU A;  4C9B B;  4L2L A;  5CMY A;  2XGM A;  4A1G A;  3LCA A;  3QWV A;  1S0P A;  4O1P A;  3ML9 A;  3L54 A;  2KCL A;  3ONL A;  3ZRH A;  4U95 D;  5ENS D;  5B1A E;  2F8Y A;  2KBX A;  2XS1 A;  3TJP A;  4G8L A;  2BED A;  3UUX A;  1OT8 A;  4CDM A;  2OV8 A;  3TWS A;  2XS8 A;  3PRE A;  2OEV A;  3CK8 A;  4RG9 A;  3LJ3 A;  4Q94 A;  4PUC A;  4HLL A;  3PVL A;  4N3A A;  2NC9 A;  3Q7F A;  1MX4 A;  1SZ9 A;  3IHV A;  3KSQ A;  5LP0 A;  4KVO A;  4QQI A;  4AY5 A;  5CBN A;  2H6H A;  3V2O A;  2QYU A;  2WPV A;  2BF0 X;  4HOU A;  1AP7 A;  1HZ4 A;  4JHJ A;  5CRU A;  3G2V A;  4TUM A;  4CT0 A;  3LS8 A;  5JJT A;  2WQH A;  5FQ8 A;  3MYV A;  2J4D A;  1Z6T A;  4UWG A;  4U07 A;  3FFL A;  3VLF A;  2VJ8 A;  2J9Q A;  5ANL A;  4K5C A;  3T9K A;  4K0R A;  5BXO A;  4YND A;  3ZU7 B;  4KYO B;  4BY6 A;  2GRP B;  3RU0 A;  5KJN A;  5EID A;  2CHZ A;  3RRU A;  3ZKJ A;  3D9L A;  4HLE A;  3EIQ C;  3Q75 A;  4HS2 A;  3CQC B;  2GRN B;  4ILH B;  3D9M A;  3FU5 A;  4J8E A;  3BU8 A;  4WND A;  2QFC A;  2R17 C;  1D8E A;  1N54 A;  2V8S E;  1DVP A;  2X6I A;  1INZ A;  4K5A B;  4X8Q A;  3LY7 A;  4YDO A;  3B7B A;  3E34 A;  3UT8 A;  3AJI A;  1WDY A;  2RG8 A;  4A1S A;  1KZO A;  1PC2 A;  5BV1 A;  4IUL A;  3GZ2 A;  3EIJ A;  4YDY A;  1X81 A;  4A63 B;  2V4H C;  5CEA A;  4ANW A;  3CVL A;  3RJV A;  4GYW A;  2JAB A;  1HFA A;  3ABM E;  2P9S G;  5ENT D;  1HE8 A;  3SD5 A;  3TWR A;  3PUJ A;  3JCK C;  4GZ5 A;  3MX3 A;  1TN7 A;  4AOF A;  1B89 A;  4DLQ A;  4F1S A;  5CMW A;  4XKB A;  4AVX A;  4CDN A;  5AQ9 A;  3OXL A;  2FEZ A;  3WG7 E;  1QQE A;  3DXK G;  1HG2 A;  4UQY A;  3T5V A;  1TNB A;  1K8K G;  2F37 A;  3PZD A;  2ZXW E;  1U2V G;  4HXI A;  4EBA A;  1E8W A;  4ACK A;  1BU9 A;  2XHE A;  4ZFH A;  1XNF A;  1Y8M A;  1AWC B;  1A5E A;  3ZIM A;  3TL5 A;  1D8D A;  3Q4A B;  3KAE A;  3SBS A;  4FU3 A;  2Y1L E;  3KSL A;  2FI7 A;  2H6G A;  2H6F A;  4DX6 D;  4ATG A;  3GW4 A;  2LNI A;  1TR4 A;  1N4R A;  4ANU A;  4GAA A;  2Y4U A;  4XKC A;  4GML A;  4G23 A;  3CHM A;  3RRN B;  1SVX A;  3SNX A;  3L6A A;  1LTX A;  2DBA A;  3EUV A;  3UKR G;  1U3D A;  3X2Q E;  3Q9N C;  4N3C A;  2EIL E;  2GGF A;  2MOW A;  3ZYQ A;  3SF4 A;  3OTN A;  4G24 A;  3R9M A;  3DWL G;  5EX0 A;  2PL2 A;  3FWV A;  3FUK A;  5JJ6 A;  2HO1 A;  4I2W A;  4DUI A;  4CRW A;  5E75 A;  3CV0 A;  4GTP A;  5AJD A;  3HXB A;  3SFX A;  3RAU A;  2ZIS A;  4GCO A;  4PH4 B;  5A6C A;  5CCL A;  4GTQ A;  2P9I G;  3W9F A;  4JA7 A;  4G2V A;  5KJL A;  1ZB1 A;  4AXH A;  3PH0 C;  4TXQ A;  4MKT A;  3FTZ A;  5G04 C;  4WWO A;  4I9E A;  1PY1 A;  4GU5 A;  3QWP A;  3DPD A;  3FU6 A;  3UX4 A;  2CHW A;  2L0I A;  5T3R A;  2P2C P;  3NAW A;  3APD A;  5T8I A;  2X6K A;  3SI5 A;  3LXU X;  3TAX A;  1UJJ A;  4JEU A;  2KZT A;  2BKK B;  4Q96 A;  5KWD A;  3AU4 A;  3TWW A;  3DBS A;  4LER A;  2H6I A;  2QC9 A; 
#chains in the Genus database with same CATH homology
 2DIW A;  2EQX A;  2FBN A;  3B7T A;  4N2Q A;  5LFA A;  3VLD A;  3AU5 A;  2P58 C;  4JW1 A;  1NA3 A;  3EJN A;  3G2S A;  4L1B A;  2VYI A;  2HR2 A;  2ION A;  3SHF A;  3OAW A;  4EEC A;  4WNG A;  4BWR A;  2E2E A;  3GZS A;  4EQF A;  1OWO A;  3FUD A;  2XCC A;  4GZ6 A;  4OYS A;  3ZHE B;  1IQU A;  3U66 A;  3G2W A;  4EZJ A;  5EX3 A;  4HFG A;  3CR3 A;  3ZYK A;  4XE0 A;  4JZY A;  1QZ2 A;  4KVM A;  4DJA A;  4XI9 A;  1KLX A;  2ILR A;  4UI9 C;  3B7U X;  5A23 A;  1TEZ A;  3CK7 A;  4B8C B;  3RO3 A;  2IU1 A;  3KS2 A;  4ME2 A;  2KM4 A;  4C0E A;  2CG2 A;  3IEG A;  1H2V C;  5D0O D;  4AY6 A;  4LRZ A;  4NRH B;  2PQN A;  2Y3A A;  2WM9 A;  3QJZ A;  2VGX A;  3Q47 B;  4N39 A;  3S7B A;  4DI4 A;  4FJY A;  4D10 C;  4FAD A;  4R7L A;  4A3V A;  4EBA G;  2J08 A;  1P5Q A;  4GZ3 A;  4IYP A;  3D9P A;  2RD0 A;  1GW6 A;  3CVP A;  2VTB A;  4BX8 A;  4A55 A;  1WAO 1;  1E8Y A;  1HXI A;  4G1T A;  4BT9 A;  3PE3 A;  3CHQ A;  4GZC A;  3HVE A;  3ZN3 A;  2MHK A;  4BSX A;  2YQ8 A;  4DLO A;  3IV0 A;  3EDT B;  2J07 A;  2JLB A;  4JEH A;  2PM6 A;  3NF1 A;  3S7D A;  3B13 A;  1EDU A;  4AP2 A;  1UW4 B;  2PM7 A;  3LY9 A;  4W9R A;  1FVH A;  1HU3 A;  4BT8 A;  2OND A;  4Y6W A;  1EPU A;  1ZBP A;  2VSN A;  3K9I A;  3URZ A;  2IOS A;  5FZR A;  2FF4 A;  3Q5M A;  1UJK A;  1ELW A;  1Y6I A;  3ESK A;  3GZ1 A;  2VSY A;  4AIF A;  4RVB A;  4APF A;  3T8M A;  1NZN A;  3FEX A;  3FTS A;  2WXL A;  2AXZ A;  2KAT A;  3LKU A;  3AS4 A;  1IQR A;  1W3B A;  2VQ2 A;  2WXP A;  3FUL A;  2XQ0 A;  3MGB A;  4TUU A;  3MKQ A;  4FC8 A;  3L08 A;  3QOU A;  2IFU A;  4C9B B;  4L2L A;  2IJG X;  5CMY A;  5BUZ A;  2XGM A;  4UWL A;  4A1G A;  3LCA A;  3FU0 A;  3QWV A;  1FVF A;  5KJM A;  4AV7 A;  4XIF A;  1ELR A;  1S0P A;  3IHY A;  3ML9 A;  3L54 A;  2KCL A;  2WMN A;  2I1K A;  3ONL A;  3ZRH A;  3ZW3 A;  3FDH A;  5FQ7 A;  2IF4 A;  3UPV A;  3FUH A;  1IYG A;  5KCM A;  3TJP A;  3WXX A;  3PDN A;  3P2B A;  4LEU A;  1HS6 A;  1L5J A;  3B7R L;  3D9I A;  3UUX A;  4AJW A;  4CDM A;  2OV8 A;  3FTX A;  4U0Z A;  3O4Z A;  3PRE A;  3CK8 A;  4RG9 A;  2KZT B;  3LJ3 A;  3CVW A;  4Q94 A;  4PUC A;  5AEN A;  2C0M A;  3PVL A;  4N3A A;  4E85 A;  4TV3 A;  1OUV A;  2NC9 A;  5LX8 A;  1SZ9 A;  3IHV A;  5LP0 A;  5J90 A;  2DCP A;  3CVN A;  1TJC A;  2BTD A;  4G25 A;  4KVO A;  3ZYM A;  1QNF A;  4AY5 A;  4L7T A;  1JPL A;  3CKC A;  2XPZ A;  4B8A A;  4FHJ A;  2WPV A;  2R59 A;  5D0Q D;  2BF0 X;  4I2Z A;  4RG6 A;  4HOU A;  3AS8 A;  4U0U A;  4G11 A;  1HZ4 A;  3CK9 A;  5FWQ A;  4A3T A;  3NZU A;  3N71 A;  4JHJ A;  3G2V A;  3CVU A;  5G05 C;  2YNQ A;  3ZYL A;  4CT0 A;  3LS8 A;  5ENN A;  4U63 A;  1U3C A;  2I2O A;  2X3M A;  2GW1 A;  5JJT A;  2WQH A;  5FQ8 A;  3CQG B;  3MYV A;  1VDY A;  4Q69 A;  2J4D A;  1Z6T A;  3L17 A;  4I6E A;  1SQM A;  4UWG A;  2ZU6 B;  4U07 A;  3SFZ A;  3FFL A;  3QKY A;  3VLF A;  3IKO B;  2WXJ A;  2VJ8 A;  4UQX A;  2J9Q A;  4BTB A;  5ANL A;  4MRU A;  3QB2 A;  2Q7F A;  4JA9 A;  3R9A B;  4M3O A;  2VGX B;  3ENE A;  3TG4 A;  1YA0 A;  2I9C A;  4K0R A;  4WNF A;  3FH8 A;  2AWI A;  3ESL A;  3MZL B;  4FHK A;  4YND A;  3S2A A;  2YHC A;  5LCW C;  1OWM A;  4KYO B;  2IOL A;  4MS6 A;  4L23 A;  5EKQ D;  2XEV A;  3CIA A;  4BY6 A;  3RU0 A;  4AM9 A;  5KJN A;  2VTB B;  4LCT A;  2CHZ A;  3U4T A;  5G04 J;  1OWL A;  4RSY A;  3RRU A;  4U8H A;  4I6J A;  3HVE B;  5G55 A;  3PE4 A;  2A5U A;  3D9L A;  4HLE A;  1Z3Y A;  2L9B A;  3PEU B;  4CCA A;  4IN3 B;  4NUR A;  2QY7 A;  4XX5 A;  3FTU A;  3SBT B;  3EIQ C;  3PNT B;  4GYY A;  4N3B A;  4HS2 A;  3CQC B;  3PS6 A;  2WQ7 A;  3FUI A;  4ILH B;  3D9M A;  4DK5 A;  1E7U A;  3I4G A;  3FU5 A;  4J8E A;  4WND A;  4I9C A;  5FQ6 A;  1HX8 A;  2J49 A;  2QFC A;  3APC A;  3ML8 A;  3TGO A;  4GA1 A;  1E7V A;  2R17 C;  3FTW A;  4WAF A;  2JEK A;  4CGV A;  1N54 A;  4GYO A;  2V8S E;  4FUL A;  5AYW D;  1DVP A;  2X6I A;  1INZ A;  2VSO E;  2XRY A;  2UWJ G;  4KZC A;  5G2N A;  4EZK A;  3R7Q A;  4JC8 A;  3G2U A;  4KBQ A;  4ACL A;  2WXN A;  1PAQ A;  3MKQ B;  4HOS A;  4GPK A;  1HF8 A;  3LY7 A;  3ULQ A;  4N2S A;  3NQP A;  3UT8 A;  5AIJ A;  2OVB A;  3ASH A;  3G2T A;  3QK0 A;  3FY4 A;  5C2Y A;  2RG8 A;  4A1S A;  4O6F A;  4CEM A;  3NZS A;  1PC2 A;  3FUE A;  3Q15 A;  3RO2 A;  5BV1 A;  4IUL A;  3GZ2 A;  5T4Y A;  3S7J A;  3EIJ A;  4WUY A;  4BX9 A;  2MRI A;  3S7F A;  2E0I A;  4FLB A;  4ANW A;  2CG3 A;  3EHN A;  4HOQ A;  2WXG A;  3QAQ A;  3CVL A;  4G26 A;  4I1M A;  3RJV A;  4GYW A;  2KC7 A;  4PS7 A;  2AVP A;  1HFA A;  4CT4 A;  4B94 A;  5BNW A;  3CST A;  3SD5 A;  1HE8 A;  1HO8 A;  3FUJ A;  3FUF A;  3PUJ A;  3JCK C;  4GZ5 A;  3U9W A;  3MX3 A;  1NP7 A;  3FTV A;  1OWP A;  4UI9 J;  2OVF A;  3TXM A;  4AOF A;  3IBE A;  2VSX E;  3U3W A;  4GMJ A;  3CHS A;  1B89 A;  3I3N A;  3APF A;  4YVQ C;  1ZU2 A;  4C0M A;  3LEW A;  3P1U A;  4DLQ A;  4KZ0 A;  1FCH A;  2AW6 A;  2WXM A;  3D9O A;  5BPP A;  2WB2 A;  3PUK A;  3T5X A;  4F1S A;  3CVV A;  4GZD A;  5CMW A;  4K03 A;  4XKB A;  4AVX A;  2I6H A;  4CDN A;  4YVO A;  3MCX A;  3MV2 B;  2PQR A;  4ILG A;  1NA0 A;  2C0L A;  2KCK A;  2WXH A;  3FUN A;  3OXL A;  3UT4 A;  3JUI A;  4UI9 K;  4WWP A;  4HOR A;  2FEZ A;  2J09 A;  1KT0 A;  1QQE A;  3C98 A;  1HG2 A;  3ZEF A;  4J8S A;  1EYH A;  2GRL A;  3OXG A;  3L13 A;  3MV3 B;  4UQY A;  3PEV B;  5CHE E;  4I6G A;  3T5V A;  4DPR A;  5ARG A;  4U04 A;  3MA5 A;  3QAR A;  4HVB A;  1HH8 A;  5JJ7 A;  1JUQ A;  3VTY A;  4J0U A;  4B0Z A;  2WXI A;  3PZD A;  2AXU A;  5A7D B;  4DI3 A;  2GRM A;  3ZXS A;  2L6J A;  1JWF A;  5FQ4 A;  3SGH A;  3ZGQ A;  2AXV A;  2LSV A;  1H2U A;  2NSZ A;  4HXI A;  5DIZ A;  4JHK A;  3LVQ E;  5JHA A;  5FT9 A;  3CLJ A;  2X6F A;  3UMV A;  4EBA A;  4F3V A;  1UN9 A;  2XPI A;  3CHR A;  3RKV A;  2XGO A;  1E8W A;  2X38 A;  3I5P A;  4JVS A;  4KXK B;  3FTY A;  4LUN U;  2M63 A;  2XPY A;  4ACK A;  4CDR A;  3MEK A;  4E6H A;  5JHB A;  2XHE A;  3ONK A;  1N52 A;  1XNF A;  3UQ3 A;  4EPZ A;  1Y8M A;  5BV0 A;  1UN8 A;  1H19 A;  3LPZ A;  3QNK A;  5C1D A;  3L16 A;  3ZIM A;  2X6H A;  4JHR A;  3TL5 A;  2R5S A;  3Q4A B;  3ASG A;  1SZA A;  3EHM A;  3KAE A;  4JXT A;  2LAH A;  4UWH A;  4XZ4 A;  3KD7 A;  4FU3 A;  4UQZ A;  4WNE A;  3SBS A;  4URK A;  2FI7 A;  2LO6 A;  2IQC A;  2LAI A;  1ELK A;  1E90 A;  4L2Y A;  5LOZ A;  4ATG A;  3GW4 A;  4Y6C A;  2LNI A;  4MLP A;  1H2T C;  4ANU A;  3LY8 A;  4GAA A;  2Y4U A;  4XKC A;  4J6I A;  3RRM B;  3OXF A;  1DNP A;  4GML A;  4G23 A;  3CHM A;  4I1A A;  5CCM A;  3RRN B;  3SNX A;  4ABN A;  3L6A A;  4FP7 A;  4KMO A;  4NAC A;  2DBA A;  4GB9 A;  2Y4T A;  4AEZ C;  1U3D A;  4GCN A;  3ZHE A;  3FEY A;  3CVQ A;  4N3C A;  3ZPJ A;  5M72 A;  3JQ1 A;  2GGF A;  1E8Z A;  3D9N A;  2I1J A;  2MOW A;  2WXQ A;  2WXR A;  3B7S A;  2XCB A;  5FTP A;  3ZYQ A;  3SF4 A;  3OTN A;  4G24 A;  2XRZ A;  2V0P A;  3E4B A;  5ANR A;  2VGY A;  5EX0 A;  3CHO A;  4UWF A;  2PL2 A;  2PZI A;  3FWV A;  3FUK A;  3HIZ A;  5ARF A;  5FZS A;  3SZ7 A;  4N5C A;  2HO1 A;  5JJ6 A;  2WQ6 A;  4I2W A;  4U0S A;  3CVY A;  4OVV A;  2HYZ A;  4CRW A;  1MHQ A;  3LVR E;  1LF8 A;  2L0T B;  1A17 A;  5E75 A;  5G05 J;  3JYS A;  5J08 A;  1X5B A;  3CV0 A;  1IHG A;  2WXO A;  4APO A;  3GYZ A;  2J4B A;  4J8D A;  4B89 A;  4P29 A;  5AJL A;  3O48 A;  5AJD A;  1BPO A;  3ZVV A;  4ILI A;  3VTX A;  1H6K A;  2V4L A;  3UT7 A;  3VLE A;  4GCO A;  4PH4 B;  1WM5 A;  1OWN A;  2XGS A;  4FLH A;  1JWG A;  3BG1 B;  2NXP A;  3FUM A;  3FH7 A;  5A6C A;  1E96 B;  2A4Z A;  5LCW J;  2WVI A;  5CCL A;  3FH5 A;  3ASD A;  2WXF A;  5HQ8 A;  3FU3 A;  1MQS A;  4NQ0 A;  3MKR A;  3TG5 A;  5FJY A;  4JA7 A;  4GA0 A;  4I43 A;  4I1O B;  4H7Y A;  2YIN A;  4G2V A;  4XI0 A;  3QC1 A;  4WWN A;  5KJL A;  4PDX A;  4AXH A;  3PH0 C;  1UG3 A;  3QDN A;  3U64 A;  4OVU A;  2LSU A;  5HI7 A;  4MKT A;  3RIB A;  3FTZ A;  2V5F A;  5G04 C;  4F7A A;  4CGW A;  3CKB A;  2OOE A;  2WMO A;  4WWO A;  3HYM B;  4V3I A;  4I9E A;  1PY1 A;  2CHX A;  3AS5 A;  3I4R B;  3MJW A;  4GU5 A;  5DBK A;  1XGW A;  3QWP A;  4TRQ A;  1EF1 C;  4FJZ A;  4PS3 A;  4HOT A;  3DPD A;  3KEZ A;  2HM8 A;  3L22 A;  2C2L A;  3FU6 A;  3UX4 A;  2CHW A;  1WY6 A;  2L0I A;  3LYA A;  5T3R A;  2CFU A;  5E76 A;  3ZFW A;  5BT1 A;  3RK6 A;  4JL0 A;  4KT6 B;  3R7R A;  1H0A A;  3APD A;  3CEQ A;  3D9J A;  5EDS A;  3CVX A;  5BW8 C;  4IRU A;  5T8I A;  4H7X A;  1KT1 A;  2KCV A;  3BG0 B;  2X6J A;  2CFZ A;  2WXK A;  4GA2 A;  2YHE A;  1E8X A;  2X6K A;  3SI5 A;  3LXU X;  3JQ0 A;  3TXN A;  3TAX A;  3QWW A;  1UJJ A;  4JPS A;  1HG5 A;  3FHE A;  3PRZ A;  4JEU A;  2UY1 B;  3CHP A;  5KJK A;  3LDZ A;  4PS8 A;  4ANX A;  4BTA A;  2KZT A;  2BUG A;  1TJF A;  2FUL A;  3ASF A;  4ANV A;  2FO7 A;  3D9K A;  3HHM A;  4Q96 A;  4F53 A;  3AU4 A;  4EZL A;  3BEE A;  4BFR A;  3PNL B;  1Z3X A;  3DBS A;  3FP3 A;  4LER A;  3CGH A;  3D3M A;  4UWK A;  4FA6 A;  3HDX A;  5FZQ A;  4J8F A;  2UY1 A;  3Q49 B;  4QFV A;  4I17 A;  3CSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...