2IQCA

Crystal structure of human fancf protein that functions in the assembly of a dna damage signaling complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
199
structure length
173
Chain Sequence
EDSLMKTQAELLLERLQEVRPARFLSSLWERLPQNNFLKVIAVALLQPGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of human FANCF protein that function in the assembly of a DNA damage signaling complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Fanconi anemia group F protein
total genus 56
structure length 173
sequence length 199
ec nomenclature
pdb deposition date 2006-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.490 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2iqcA00
2IQCA
chains in the Genus database with same CATH superfamily
5EILA 4HRNA 5BXOA 4FHKA 1V55E 3B13A 1NA3A 4I9CA 5EDSA 5E75A 4Q96A 3HVEA 4J7WA 3UTMA 3AU5A 4RVBA 3MGBA 4N5CA 2CG2A 4MS6A 3SY2A 3D9KA 1DNPA 2L0IA 2XEHA 4GTVA 3FULA 4BFRA 3HXFA 3UKRG 3T5VA 5JMND 3PRZA 3URZA 4XE0A 3Q78A 4DRXE 5ENRD 3Q79A 4XIFA 2P9NG 3CK9A 3IHVA 1OWOA 3RK6A 4JD2G 2OOEA 4DX5D 4EECA 5KNGA 3ASDA 2ZIRA 5G05C 4BTBA 3QWWA 3ESLA 5CRUA 3DEOA 2C0LA 1U2VG 2BF0X 4TUUA 4KT6B 2I1JA 4K0RA 3CVLA 3ESKA 3G2UA 3AS8A 3ISMC 2ZU6B 4JC8A 3FU5A 5IY5E 3LXUX 4C0MA 2IOSA 1G3NB 3ZHEA 2IFUA 3WXXA 4CGVA 2PQRA 4GTOA 4JHJA 4WAFA 1RW2A 3C3RA 3LVRE 1YMPA 4L9PA 3UT7A 4Y6CA 2RD0A 3V2XA 3Q9UC 3CVQA 2XS1A 3ZNGA 3V30A 4NIKA 4EZJA 3FTXA 3FWVA 2WXMA 1A5EA 2V4LA 1LF8A 1OCZE 4U95D 5KJMA 2Y69E 5H7PA 4FA6A 2H6IA 3C3OA 3IXEA 3UM3A 2HR2A 5EKQD 4LNGA 3SZ7A 3G2SA 1MZCA 4MKTA 4N39A 4C9BB 4BWRA 1ZU2A 4A3TA 3T8MA 1HX8A 4ANXA 2E2EA 5FQ7A 1DCQA 3IBEA 3CVPA 3UM0A 4UUCA 4GZ5A 1DC2A 5LFAA 5G55A 3PDNA 4LERA 3PS6A 3DEPA 2OVFA 4NACA 4I6EA 4FADA 1TN8A 4N2SA 3E37A 4G2VA 3L08A 5LOZA 1HS6A 3WG7E 4MRUA 4BSZB 3HHMA 4FC8A 2QC9A 2P9LG 4CDMA 4BT9A 4V3IA 4H7YA 4L2LA 5AJDA 2L6JA 2X6JA 5BW8C 1SA5A 2GRNB 2P9UG 4ANWA 4G23A 4G8KA 4N5QA 3E4BA 4DJAA 2DYRE 4B8AA 1E7UA 1NFIE 4I2ZA 3RO2A 3EHRA 3LY7A 1FVHA 3TG4A 2I9CA 4GMLA 4JXTA 3D9OA 4B94A 3KSLA 4DPRA 4KXKB 3V79K 2J4BA 2X38A 2CFUA 5T8IA 4HQDA 3RSEG 2NSZA 2GRQB 5CMWA 1LD7A 1JWFA 2V0PA 3JQ0A 3L22A 3NZUA 1HE8A 4UWFA 2XPIA 2FBNA 3C5RA 4XZ4A 2RG8A 1BI8B 4LCTA 1EF1C 3W9GA 2XHEA 4GTTA 4WWNA 3J5PA 4A3VA 4CCAA 4XEIG 1KZPA 3HXBA 3QARA 3B7TA 3J5QB 2E0IA 4EZKA 2F0YA 2LSUA 2XEVA 3RJVA 4GTRA 2KZTA 5FQ6A 1DVPA 4TXQA 4RSYA 3TJPA 4JVSA 3DWLG 3EHNA 4X8QA 1EPUA 4PS7A 3PZDA 2V4HC 3NB2A 4HI9A 5HS0A 3VTYA 3ONKA 3JQ1A 4FHJA 3RRMB 4JHRA 3UUXA 1HG5A 3EIQC 5EX0A 4AP2A 2I1KA 2R5SA 1FT1A 3SBTB 3RAUA 2Y1LE 3IV0A 3HDXA 5FJYA 5FZRA 2V5QC 3NZSA 1K8KG 4GA2A 1BI7B 4BETA 4Y6WA 5ENTD 2R17C 3CHPA 1B89A 2QY7A 4ACKA 2R02A 1ELWA 3MCXA 3CVNA 4YDOA 5BXUA 2P9KG 5LX8A 2P9PG 5EIBE 4YDYA 1Q2ZA 2OV8A 1TNBA 2L9BA 2X6KA 1E8YA 1BPOA 4F7AA 1WAO1 3CHMA 4U0ZA 2F8YA 2B6CA 2X6HA 3ZYLA 2IU1A 2WQHA 2JABA 4GPKA 3HXCA 1D9SA 2KM4A 3FH7A 2ZXWE 5ENNA 2VJ8A 4A1GA 3DSUA 4FLBA 4J6IA 4F6RD 1V54E 1K1BA 3ML9A 3PEUB 2P9SG 3U64A 3ASHA 4OYSA 1HG2A 3CLJA 5T3RA 5A6CA 2KZTB 1YA0A 5B1BE 4EBAA 3S2AA 5LP0A 2WVIA 4PS8A 3TWQA 3TAXA 1MQSA 4N3BA 3QNKA 3V2OA 4EHMA 4KZCA 3AS5A 4I6JA 4NRHB 4LRZA 4PDXA 3RKVA 1H6PA 2WXLA 4GYWA 3UI2A 1H0AA 3QWPA 3L16A 4ANUA 1L5JA 1PAQA 2PQNA 2EIJE 3Q7FA 2HYZA 2R03A 4I1MA 3FUFA 2R59A 3UIOC 2DVWA 4J8FA 3GZ1A 2H6GA 3VLEA 3IKOB 3UQ3A 3LYAA 4L1BA 2LXLA 4TRQA 1TNYA 1TJCA 3DSSA 2R2LA 3NF1A 3PNLB 4XKBA 4DX6D 3CR3A 2FO7A 3D9PA 4K03A 2VSXE 4U04A 5CRVA 2HM8A 3Q4AB 4G8LA 1NI1A 4WNFA 1JCRA 2VGXA 2IF4A 4KZ0A 3OTNA 5G04J 4URKA 3AG1E 1KT0A 4UWGA 3D9MA 2GRPB 4Z68A 4BERA 1IKND 4HLEA 3L54A 1N4SA 4A63B 4U07A 2LO6A 3C72A 4M7CA 1XNFA 3LKUA 4H7XA 4ME2A 3CVYA 3AS4A 4G26A 2XRYA 1TNOA 2AXUA 2VSNA 1PY1A 1FVFA 4DI4A 3CVVA 3B7BA 3SFYA 4HOUA 4HOSA 4RLYA 4GA1A 4XI9A 4K5BA 3PZ2A 3MYVA 4ZHBA 3RO3A 3CQGB 2DWZA 3E32A 1KLXA 1HFAA 2I2OA 2PZIA 4HBDA 4AM9A 4GYOA 2MYOA 5JHAA 3EUVA 2V5FA 3LY9A 4HOQA 4JB8P 3CK8A 4LSZE 4U7EB 5ARFA 3ZU7B 1N9AA 1FT2A 4OVVA 1HXIA 5B1AE 4GB9A 2DBAA 3D9JA 3UINC 4GTPA 2L0TB 5BT1A 2I6HA 4HB5A 4JHKA 2A5EA 2AVPA 3LJNA 2YHEA 5LCWJ 3ZHEB 3FUKA 5AN8A 4LUNU 1EDUA 3PNTB 4L7TA 4IRUA 5JJ7A 3UT4A 3ULYA 1BLXB 3KD7A 4DI3A 2LAIA 2QYUA 3FH5A 1BU9A 3LEWA 2XGOA 4DLQA 1SW6A 4GTQA 2KCLA 2J4DA 3ENEA 5AENA 3PZ4A 2FULA 1AWCB 3FTWA 2DCPA 1Z3XA 3JXIA 3PE3A 3FUJA 1OWPA 2H6HA 3BG1B 4O1OA 2V8SE 2DZNA 1UN9A 3FU6A 1E7VA 2PL2A 3UMVA 3PVLA 4QFVA 3SHFA 1N54A 4GPMA 4G25A 5FWQA 5JJ6A 4JA7A 4HRMB 1N0QA 4NURA 3OXFA 3I4GA 2JLBA 3BUAA 1JCSA 4BTAA 3B7SA 3E30A 1D8EA 1SQMA 1TJFA 4G1TA 4GCNA 4I43A 2VGYA 3FHEA 3SFZA 3ZW3A 2VQ2A 2WXRA 2YNQA 2FO1E 1QZ2A 4F1SA 3FUHA 4HI8A 4E85A 3NOCD 5C2YA 5CMYA 5BPPA 4WWOA 4P29A 4U0UA 4JEHA 2XPZA 1S70B 3D9LA 5KBAA 1IHBA 1OXJA 3ZRHA 4JW1A 4DX2A 2ONDA 1GW6A 1OY3D 3N71A 3TXNA 1K1AA 3OAWA 3VLDA 3IHYA 2IQCA 5JJTA 4D10C 3ASOE 2ETCA 1FPPA 2EQXA 3FUMA 1MX6A 2YINA 4U0SA 1E8WA 2KBXA 2ZGGA 3RIBA 3QKYA 2IJGX 3KAEA 4JL0A 3BEEA 4AIFA 4DX1A 5AQ9A 4A1SA 2ZISA 5HRYA 4CRWA 3CVXA 4UWLA 4GZ3A 3UKUG 1H2TC 3CKCA 4DUIA 4I6GA 4Q94A 4J8EA 4F53A 2MRIA 2BUGA 1VDYA 3T5XA 4WWPA 3MJWA 2BEDA 3Q49B 5HKPA 4GMRA 2NC9A 2EINE 5AAOA 1LD8A 5BV0A 3NOGD 5EYPF 2CHZA 1OCRE 2LSVA 5FT9A 4AJWA 3GYZA 3CIAA 3AG4E 4CT0A 2CHXA 3C3QA 3LS8A 3G2VA 3R7RA 2L6BA 3NAWA 3ZYQA 1IXVA 2X3MA 3AAAC 4OVUA 1U3DA 3B95A 5KWDA 1IQRA 2XZDG 3D9NA 3FFLA 2WXJA 3MEKA 4YVOA 1N4PA 3FUIA 2H6FA 4HORA 5DIZA 3PUKA 2PNNA 4N3CA 1WY6A 1UG3A 1UJKA 4TXPA 5CCLA 3S7DA 5KJKA 3AG3E 1Z5SC 5E76A 2QYJA 4KVMA 2R05A 5FTPA 2UY1B 3DRAA 4DLOA 3Q47B 1E90A 4KMOA 4ATGA 2B0OE 3D9IA 3SFXA 1Y6IA 2IO2C 2IY0C 4APFA 2AJAA 2Y4TA 4IULA 4CYMD 3AU4A 4C0EA 3ABLE 4CDNA 4GA0A 4APOA 5AIJA 4ZFHA 5J90A 3GZ2A 4AV7A 4GCOA 4ABNA 2VGEA 4WUYA 4J8YA 4OAVB 1EYHA 4XX5A 1KPSB 5KJLA 3E34A 3ZGQA 1N52A 4ILIA 2HO1A 3DXMG 2Q7FA 2KCKA 4UI9C 3MA5A 1MHQA 4L2YA 5BV1A 3L17A 5ITZF 3QAQA 2FF4A 3CVWA 1TNUA 4HLLA 5CBNA 4W9RA 1TEZA 4GZCA 3Q15A 3SF4A 2J9QA 4TV3A 4WNGA 4PH4B 1N4RA 5LCWC 4HOTA 1H2VC 3BQOA 1JCQA 4FJYA 4HNAD 1YCSB 4B89A 3MX3A 1S0PA 5JHBA 3EJNA 2RFMA 5CCMA 2GRRB 3D9HA 2VYIA 3CK7A 2KCVA 1PC2A 2P9IG 3APFA 2OVBA 3JUIA 1NA0A 1Y8MA 3EIJA 1O1TA 1HU3A 3ABKE 3CGHA 5AJLA 3CHSA 2IO3C 2IOLA 3ZEFA 2M63A 4JEUA 3TWSA 2J49A 2GW1A 1NP7A 2VSYA 4XKCA 1UJJA 1YYHA 2XZTG 2LAHA 2FI7A 1D8DA 3LVQE 4B8CB 5A23A 3SO8A 5BNWA 4FULA 2FEZA 4CT4A 4GYYA 1JWGA 3B7RL 2J09A 4B93B 1QQEA 4J8SA 2VGXB 3KEAA 3TWVA 4YNDA 3LJ3A 5D66A 4GMJA 5G04C 4MBGA 4EZLA 2Y4UA 5T4YA 3ULEG 3FEYA 5ENPD 3MKRA 1N94A 2MHKA 2GGFA 4JA9A 5EN5D 1WG0A 3DSXA 3TWUA 2WQ6A 4U96D 2GRLA 3QK0A 4IN3B 3TG5A 3ABME 2OCCE 3GW4A 2X6FA 1AP7A 2DIWA 3L82A 5M72A 2NXPA 3LDZA 3P1UA 2PM6A 2WXKA 3DBSA 4I2WA 2RKKA 5D2MC 5BUZA 4JPSA 3CHOA 5EIDA 5DBKA 4YVQC 2F37A 5EX3A 3G2WA 5A7DB 4CGWA 3VTXA 2WM9A 2DZOA 3SQVA 3FUDA 4OAUC 3T8KA 4LNUD 3TGOA 5FZQA 2AXZA 2CFZA 3O48A 3PUJA 3R9AB 4HS2A 1KT1A 1NL4A 1P5QA 4RG6A 3UM2A 4FP7A 1N11A 4Q69A 4UI9K 3SD5A 4G11A 1HH8A 5ARGA 4C48B 4L23A 2CG3A 5G05J 3JXJA 3FUEA 4GTSA 1TN7A 2WXOA 2XS8A 3ML8A 2KC7A 3CQCB 4B0ZA 5ENQD 3NBNB 3FU3A 2J08A 2RFAA 3UPVA 5D0OD 4EQFA 3TWXA 4GZDA 3U3WA 2UY1A 3EHQA 5AARA 3ZFWA 2OEWA 2XENA 2J07A 3T9KA 4MLPA 5ENOD 2XQ0A 1TYQG 2NYJA 5ANRA 5C1DA 4K5CA 3GZSA 3HG0D 1FCHA 3S7JA 4I1AA 2XGSA 3FH8A 3ZYKA 2X6IA 4FLHA 5CEAA 3R7QA 4U8YD 3SGHA 3AG2E 1O5MA 3S7BA 4GU5A 1MYOA 4R7LA 2BKKB 3CV0A 4BY6A 3LCAA 3UX4A 1K3ZD 4AEZC 2WXNA 4XI0A 2AWIA 1TR4A 3CKBA 3FTVA 2GROB 2WB2A 3EU5A 4WNDA 3L6AA 2WMOA 2YQ8A 3ZN3A 2BTDA 4KYOB 2WQ7A 3MZLB 3QWVA 3HIZA 4UQZA 3SNXA 4BX8A 3DSVA 2EIKE 4GZ6A 4BEPA 3HRAA 3PEVB 3MV3B 3HXEA 3NQPA 5B3SE 2XGMA 3LY8A 4GAAA 5J08A 1WM5A 3DXKG 1OUVA 1HZ4A 4NQ0A 2F8XK 4QQIA 2Y3AA 3L9TA 3P2BA 1QNFA 2PM7A 3ZIMA 3KEZA 2GRMA 2A5UA 3VLFA 4RQIA 3DPYA 4BESA 3W9FA 3FTSA 2OEVA 4U8VD 3TWWA 3ZUVB 3QDNA 4I1OB 4YDWA 2CHWA 3APDA 3I4RB 2IEJA 3ULQA 1MX4A 3CHRA 1OWMA 2LNIA 1A17A 1X81A 3FTUA 1E96B 3E33A 1Z3YA 4UQYA 3HVEB 2ZGDA 4HVBA 4GTMA 1QYMA 3EHMA 3Q9NC 3X2QE 2LXMA 3AJIA 4TXRA 5FZSA 5FIOA 1QBQA 4N2QA 4LNBA 3QOUA 3I3NA 3R9MA 2XRZA 2DYSE 2VSOE 1TNZA 1ZB1A 3FEXA 3HYMB 3SI5A 2AXVA 1NZNA 3FTZA 3CEQA 1E8XA 3EU9A 1MJ0A 3JUEA 4AOFA 5CBOA 2VTBB 3FP3A 1S63A 1UOHA 2KXPC 1UW4B 4I9EA 2WPVA 3ASGA 2HE0A 3QB2A 3TWRA 1Z6TA 4O6FA 3RU0A 1ELRA 4AY5A 3PH0C 4KVOA 4J0UA 4A55A 5ENSD 3CHQA 4EPZA 5FQ4A 1IHGA 4F1PA 5AQAA 4O60A 1H6OA 1JUQA 1UN8A 4U63A 3ASNE 1RZ4A 4UI9J 4ILHB 3Q73A 4RG9A 1H2UA 3ONLA 3OXLA 1O1RA 5G2NA 3C98A 4PUCA 2P58C 1ELKA 4BSXA 1OWNA 4EBAG 3DPDA 3PZ1A 3FU0A 4ACLA 3BG0B 1U3CA 4DK5A 3I5PA 3ZYMA 5D0QD 3ZXSA 3CVUA 1LTXA 1OCOE 3PZ3A 4TUMA 2KATA 4AY6A 1OWLA 4I17A 1SZAA 3Q5MA 2UWJG 3EDTB 4JZYA 3ZXPA 3B7UX 3Q7AA 3MKQB 3APCA 4WNEA 4AVXA 2ETBA 4LEUA 2YHCA 1MX2A 3UXGA 3TXMA 2QFCA 3FTYA 4G24A 1KZOA 3SBSA 4BX9A 5KCMA 5ANLA 3U4TA 3PE4A 5KJNA 2MOWA 5JA4D 5AQBA 3F6QA 5AYWD 2LUHA 2P2CP 5FINA 1DCEA 1E8ZA 5EYLA 5HQ8A 3IEGA 4YDEA 3CSTA 3K9IA 2C2LA 4ATZD 3G2TA 1N0RA 4O1PA 3HXDA 3TL5A 3KS2A 3BU8A 4LG6A 3RRNB 3JYSA 4PS3A 2WXFA 1IQUA 2Y0BG 3O4ZA 3V31A 3DSTA 4J8DA 2BKGA 1W3BA 4U8HA 3ZKJA 5CERB 3QC1A 4F3VA 1OCCE 4IYPA 1JPLA 4ILGA 3QJZA 2WXGA 2XEEA 3DSWA 3MV2B 2IONA 3L13A 1SZ9A 3UM1A 4UWKA 2XCBA 1ZBPA 4ANVA 4KBQA 1HF8A 4CDRA 3D3MA 4M3OA 3U66A 1N4QA 1N95A 5CHEE 3UIPC 3PREA 4UQXA 2WXQA 2ETAA 4CZ2D 1HO8A 2XCCA 1INZA 1IYGA 5KNHD 3LPZA 3ASFA 2WXIA 2EILE 4AXHA 1SVXA 4K5AB 3MKQA 4FU3A 3S7FA 4BT8A 4HRLA 3CSFA 5HI7A 2AW6A 3Q75A 3FDHA 2EIME 2WXHA 1XGWA 4N3AA 5AQ7A 3U9WA 2QZAA 3JCKC 1X5BA 3OXGA 2VTBA 2C0MA 2XPYA 3KSQA 5CECB 2ILRA 4E6HA 2WXPA 2JEKA 1TN6A 2WMNA 4FJZA 5FQ8A 1H19A 4HXIA 4UWHA 4CEMA 1SA4A 1WDYA 3ZVVA 3FY4A 3FUNA 5CEDB 1BD8A 4DX7D 3ZPJA 4HFGA 1S64A 3UT8A 2A4ZA 1OT8A 1O1SA 3RRUA 3TWTA 1H6KA 2J8SD
chains in the Genus database with same CATH topology
4UQZA 3SNXA 4BX8A 4FHKA 4GZ6A 3TAXA 1MQSA 3PEVB 1IQRA 3MV3B 3D9NA 3QNKA 4N3BA 3B13A 3NQPA 1NA3A 3FFLA 4I9CA 5EDSA 2XGMA 5E75A 4Q96A 4KZCA 3AS5A 2WXJA 3HVEA 3LY8A 3MEKA 4GAAA 5J08A 4YVOA 3AU5A 1WM5A 3FUIA 3MGBA 4N5CA 4RVBA 4I6JA 1OUVA 4HORA 2CG2A 4MS6A 4NRHB 5DIZA 1HZ4A 3PUKA 4LRZA 4PDXA 4N3CA 3D9KA 1WY6A 1UG3A 4NQ0A 3RKVA 1DNPA 1UJKA 2L0IA 5CCLA 2Y3AA 2WXLA 4GYWA 3P2BA 3S7DA 1QNFA 3FULA 2PM7A 3ZIMA 4BFRA 5KJKA 1H0AA 3KEZA 3QWPA 2GRMA 5E76A 3L16A 4ANUA 4KVMA 1L5JA 2A5UA 3VLFA 3T5VA 5FTPA 1PAQA 2PQNA 3PRZA 4XE0A 3URZA 2UY1B 2HYZA 4XIFA 4DLOA 3FTSA 4I1MA 3FUFA 3Q47B 1E90A 3CK9A 4KMOA 4ATGA 2R59A 3IHVA 1OWOA 4J8FA 3RK6A 3QDNA 3GZ1A 4I1OB 2OOEA 3D9IA 1Y6IA 3VLEA 4EECA 3ASDA 3IKOB 5G05C 2CHWA 4APFA 2Y4TA 3UQ3A 3APDA 3I4RB 4IULA 4BTBA 3QWWA 3LYAA 3ESLA 4L1BA 3AU4A 4TRQA 4C0EA 3ULQA 1TJCA 3CHRA 4CDNA 1OWMA 4GA0A 4APOA 5AIJA 2LNIA 3NF1A 5J90A 2C0LA 3GZ2A 3PNLB 4XKBA 2BF0X 4TUUA 4KT6B 2I1JA 1A17A 4AV7A 3CR3A 4K0RA 2FO7A 3FTUA 1E96B 4GCOA 4ABNA 3D9PA 1Z3YA 4K03A 2VSXE 3CVLA 4WUYA 4U04A 3ESKA 3G2UA 2HM8A 3Q4AB 4WNFA 2VGXA 3AS8A 4UQYA 2IF4A 1EYHA 4KZ0A 4XX5A 3HVEB 3OTNA 4HVBA 5G04J 5KJLA 2ZU6B 3EHMA 3ZGQA 4URKA 4JC8A 3FU5A 1N52A 4ILIA 3LXUX 2HO1A 4UI9C 2Q7FA 2KCKA 4C0MA 2IOSA 3QWVA 1KT0A 4UWGA 5FZSA 3D9MA 3MA5A 1MHQA 4L2YA 3ZHEA 2IFUA 3WXXA 5BV1A 4HLEA 4CGVA 4N2QA 3L54A 2PQRA 3L17A 4JHJA 4WAFA 3QOUA 4U07A 2LO6A 3LVRE 3QAQA 1XNFA 2FF4A 3LKUA 3CVWA 3I3NA 4H7XA 3UT7A 4Y6CA 4ME2A 3CVYA 2XRZA 2RD0A 3AS4A 4W9RA 2VSOE 1TEZA 4GZCA 3Q15A 4G26A 3SF4A 3CVQA 2J9QA 4TV3A 4WNGA 2XRYA 4PH4B 3FEXA 2AXUA 2VSNA 1PY1A 2AXVA 1NZNA 3HYMB 3SI5A 4EZJA 1FVFA 3FTXA 3FTZA 3CEQA 3FWVA 2WXMA 5LCWC 1E8XA 4DI4A 4HOTA 2V4LA 3CVVA 1LF8A 1H2VC 4AOFA 4HOUA 4FJYA 4HOSA 4GA1A 5KJMA 4XI9A 2VTBB 3MYVA 4FA6A 4B89A 3RO3A 3FP3A 3CQGB 2HR2A 5EKQD 3SZ7A 1UW4B 3G2SA 1KLXA 4I9EA 1HFAA 2I2OA 2PZIA 4MKTA 4N39A 4AM9A 2WPVA 3ASGA 3MX3A 4GYOA 5JHAA 1S0PA 5JHBA 3EJNA 4C9BB 5CCMA 4BWRA 1ZU2A 4A3TA 3T8MA 3QB2A 1HX8A 2V5FA 4ANXA 1Z6TA 2E2EA 3LY9A 4O6FA 3RU0A 1ELRA 2VYIA 4AY5A 5FQ7A 3CK7A 3IBEA 3PH0C 4KVOA 4J0UA 3CVPA 2KCVA 4A55A 4HOQA 1PC2A 3APFA 3CHQA 4EPZA 5FQ4A 4GZ5A 3CK8A 1IHGA 2OVBA 5LFAA 3JUIA 5G55A 5ARFA 3PDNA 1NA0A 1Y8MA 3EIJA 4LERA 3PS6A 4OVVA 1HXIA 2OVFA 1HU3A 1JUQA 3CGHA 5AJLA 1UN8A 3CHSA 4U63A 2IOLA 4NACA 4I6EA 4GB9A 3ZEFA 2DBAA 2M63A 4JEUA 4UI9J 4FADA 3D9JA 4ILHB 4N2SA 2J49A 2L0TB 1H2UA 3ONLA 3OXLA 4RG9A 5BT1A 4G2VA 2I6HA 2GW1A 1NP7A 5G2NA 3L08A 5LOZA 1HS6A 2VSYA 3C98A 4PUCA 4XKCA 2P58C 1UJJA 1ELKA 4JHKA 4MRUA 4BSXA 3HHMA 4FC8A 2AVPA 2YHEA 1OWNA 4EBAG 3DPDA 3FU0A 4CDMA 2LAHA 5LCWJ 4BT9A 2FI7A 4ACLA 3ZHEB 3BG0B 3FUKA 1U3CA 4DK5A 4V3IA 3LVQE 4LUNU 4B8CB 1EDUA 3I5PA 3MZLB 3PNTB 4H7YA 4L2LA 3ZYMA 5A23A 5D0QD 4L7TA 5AJDA 4IRUA 2L6JA 2X6JA 5JJ7A 5BW8C 5BNWA 3ZXSA 3UT4A 3CVUA 4FULA 4ANWA 4G23A 3KD7A 4DI3A 2FEZA 4CT4A 2LAIA 3E4BA 4GYYA 3FH5A 2KATA 4AY6A 1JWGA 3B7RL 3LEWA 4DJAA 1OWLA 4I17A 2J09A 1SZAA 3Q5MA 4B8AA 2XGOA 1QQEA 2UWJG 1E7UA 4I2ZA 3EDTB 4J8SA 4DLQA 2VGXB 4JZYA 3RO2A 2KCLA 3B7UX 3LY7A 4YNDA 2J4DA 3MKQB 1FVHA 3ENEA 3LJ3A 3TG4A 4GMJA 5G04C 2I9CA 4EZLA 3APCA 4GMLA 4JXTA 3D9OA 4WNEA 4AVXA 4B94A 4DPRA 5AENA 4LEUA 2FULA 4KXKB 3FTWA 2YHCA 2DCPA 2J4BA 1Z3XA 2Y4UA 3PE3A 2X38A 5T4YA 3FUJA 2CFUA 1OWPA 5T8IA 2QFCA 3FTYA 3TXMA 2NSZA 3FEYA 3MKRA 5CMWA 4G24A 2MHKA 3SBSA 2GGFA 1JWFA 3BG1B 2V0PA 4JA9A 4BX9A 2V8SE 3JQ0A 5KCMA 1UN9A 3FU6A 3L22A 1E7VA 3NZUA 5ANLA 3U4TA 3PE4A 2PL2A 5KJNA 2MOWA 3UMVA 1HE8A 3PVLA 4QFVA 2WQ6A 3SHFA 2GRLA 4UWFA 2XPIA 2FBNA 1N54A 3QK0A 4XZ4A 4IN3B 3TG5A 2RG8A 4LCTA 5AYWD 3GW4A 1EF1C 2X6FA 2XHEA 4G25A 1E8ZA 5FWQA 5HQ8A 3IEGA 5JJ6A 3CSTA 4JA7A 3K9IA 2DIWA 2C2LA 5M72A 2NXPA 4WWNA 3LDZA 3P1UA 3G2TA 2PM6A 2WXKA 3DBSA 4I2WA 4NURA 4A3VA 4EBAA 4CCAA 3TL5A 3OXFA 5BUZA 4JPSA 3KS2A 3CHOA 3I4GA 2JLBA 3QARA 3B7TA 5DBKA 4YVQC 2E0IA 5EX3A 2LSUA 4EZKA 2XEVA 3G2WA 3RRNB 4BTAA 3B7SA 3JYSA 3RJVA 5FQ6A 2KZTA 5A7DB 1DVPA 4PS3A 4CGWA 4RSYA 2WXFA 3TJPA 4JVSA 3VTXA 2WM9A 1IQUA 3EHNA 3O4ZA 3FUDA 1EPUA 4PS7A 1SQMA 1TJFA 4G1TA 4I43A 4GCNA 2VGYA 3FHEA 3SFZA 3ZW3A 2VQ2A 3PZDA 2WXRA 4J8DA 2YNQA 1QZ2A 3VTYA 3ONKA 3TGOA 5FZQA 3JQ1A 1W3BA 4U8HA 4F1SA 2AXZA 2CFZA 3FUHA 3O48A 3PUJA 4FHJA 4E85A 3R9AB 3QC1A 3RRMB 4F3VA 4HS2A 4IYPA 1KT1A 4JHRA 1JPLA 4ILGA 3QJZA 1P5QA 2WXGA 4RG6A 3UUXA 1HG5A 3EIQC 5C2YA 4FP7A 3MV2B 5CMYA 2IONA 5BPPA 4WWOA 4Q69A 3L13A 4P29A 4U0UA 1SZ9A 2XPZA 4JEHA 5EX0A 3D9LA 2I1KA 4UWKA 4AP2A 2R5SA 3ZRHA 2XCBA 3SBTB 1ZBPA 4UI9K 3SD5A 4ANVA 4G11A 4KBQA 3IV0A 1HF8A 3HDXA 4JW1A 1HH8A 5ARGA 5FJYA 4L23A 3D3MA 4M3OA 5FZRA 4CDRA 2CG3A 5G05J 3FUEA 3U66A 2ONDA 1GW6A 2WXOA 3N71A 3TXNA 3NZSA 3ML8A 2KC7A 5CHEE 3CQCB 4GA2A 4B0ZA 3OAWA 3VLDA 3IHYA 4Y6WA 3FU3A 2IQCA 3PREA 2J08A 2R17C 4UQXA 2WXQA 3UPVA 3CHPA 5D0OD 4EQFA 1B89A 2QY7A 4ACKA 5JJTA 1HO8A 4D10C 4GZDA 2XCCA 3U3WA 2EQXA 2UY1A 3FUMA 2YINA 3ZFWA 1INZA 1ELWA 4U0SA 3MCXA 2J07A 3LPZA 1IYGA 1E8WA 3ASFA 4MLPA 3CVNA 2WXIA 3RIBA 4AXHA 3QKYA 2IJGX 2XQ0A 3KAEA 4JL0A 5LX8A 3BEEA 4AIFA 5ANRA 5C1DA 3MKQA 4FU3A 3GZSA 3S7FA 2OV8A 4BT8A 4A1SA 3CVXA 4CRWA 3CSFA 4UWLA 2L9BA 1FCHA 4GZ3A 5HI7A 3S7JA 2AW6A 4I1AA 2XGSA 3FH8A 1H2TC 2X6KA 1E8YA 3CKCA 1BPOA 3FDHA 3ZYKA 4F7AA 1WAO1 2X6IA 2WXHA 1XGWA 4I6GA 4N3AA 3CHMA 4J8EA 4Q94A 4FLHA 4F53A 4U0ZA 3R7QA 2MRIA 2BUGA 2X6HA 3ZYLA 3SGHA 1VDYA 2IU1A 3T5XA 2WQHA 5LP0A 3U9WA 3JCKC 3MJWA 4WWPA 3Q49B 1X5BA 3S7BA 4GU5A 4GPKA 2NC9A 3OXGA 2VTBA 2C0MA 2XPYA 4R7LA 5BV0A 2KM4A 3FH7A 2ILRA 3CV0A 2WXPA 4E6HA 2JEKA 4BY6A 2CHZA 5ENNA 2VJ8A 4A1GA 3LCAA 3UX4A 4FLBA 4J6IA 2LSVA 5FT9A 4AJWA 2WMNA 4AEZC 4FJZA 2WXNA 5FQ8A 1H19A 4XI0A 4HXIA 3ML9A 3GYZA 3PEUB 4UWHA 2AWIA 4CEMA 3U64A 3CKBA 3ZVVA 3FY4A 3CIAA 3FTVA 3FUNA 3ASHA 4OYSA 2WB2A 4CT0A 2CHXA 1HG2A 4WNDA 3LS8A 3G2VA 3L6AA 3R7RA 3ZPJA 3CLJA 4HFGA 3UT8A 2A4ZA 2WMOA 5T3RA 5A6CA 2YQ8A 2KZTB 3RRUA 1YA0A 1H6KA 2BTDA 4KYOB 3ZN3A 3ZYQA 2X3MA 4OVUA 3S2AA 2WQ7A 1U3DA 2WVIA 3HIZA 4PS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IQC A; 
#chains in the Genus database with same CATH topology
 5EIL A;  4HRN A;  5BXO A;  4FHK A;  1V55 E;  3B13 A;  1NA3 A;  4I9C A;  5EDS A;  5E75 A;  4Q96 A;  3HVE A;  4J7W A;  3UTM A;  3AU5 A;  4RVB A;  3MGB A;  4N5C A;  2CG2 A;  4MS6 A;  3SY2 A;  3D9K A;  1DNP A;  2L0I A;  2XEH A;  4GTV A;  3FUL A;  4BFR A;  3HXF A;  3UKR G;  3T5V A;  5JMN D;  3PRZ A;  3URZ A;  4XE0 A;  3Q78 A;  4DRX E;  5ENR D;  3Q79 A;  4XIF A;  2P9N G;  3CK9 A;  3IHV A;  1OWO A;  3RK6 A;  4JD2 G;  2OOE A;  4DX5 D;  4EEC A;  5KNG A;  3ASD A;  2ZIR A;  5G05 C;  4BTB A;  3QWW A;  3ESL A;  5CRU A;  3DEO A;  2C0L A;  1U2V G;  2BF0 X;  4TUU A;  4KT6 B;  2I1J A;  4K0R A;  3CVL A;  3ESK A;  3G2U A;  3AS8 A;  3ISM C;  2ZU6 B;  4JC8 A;  3FU5 A;  5IY5 E;  3LXU X;  4C0M A;  2IOS A;  1G3N B;  3ZHE A;  2IFU A;  3WXX A;  4CGV A;  2PQR A;  4GTO A;  4JHJ A;  4WAF A;  1RW2 A;  3C3R A;  3LVR E;  1YMP A;  4L9P A;  3UT7 A;  4Y6C A;  2RD0 A;  3V2X A;  3Q9U C;  3CVQ A;  2XS1 A;  3ZNG A;  3V30 A;  4NIK A;  4EZJ A;  3FTX A;  3FWV A;  2WXM A;  1A5E A;  2V4L A;  1LF8 A;  1OCZ E;  4U95 D;  5KJM A;  2Y69 E;  5H7P A;  4FA6 A;  2H6I A;  3C3O A;  3IXE A;  3UM3 A;  2HR2 A;  5EKQ D;  4LNG A;  3SZ7 A;  3G2S A;  1MZC A;  4MKT A;  4N39 A;  4C9B B;  4BWR A;  1ZU2 A;  4A3T A;  3T8M A;  1HX8 A;  4ANX A;  2E2E A;  5FQ7 A;  1DCQ A;  3IBE A;  3CVP A;  3UM0 A;  4UUC A;  4GZ5 A;  1DC2 A;  5LFA A;  5G55 A;  3PDN A;  4LER A;  3PS6 A;  3DEP A;  2OVF A;  4NAC A;  4I6E A;  4FAD A;  1TN8 A;  4N2S A;  3E37 A;  4G2V A;  3L08 A;  5LOZ A;  1HS6 A;  3WG7 E;  4MRU A;  4BSZ B;  3HHM A;  4FC8 A;  2QC9 A;  2P9L G;  4CDM A;  4BT9 A;  4V3I A;  4H7Y A;  4L2L A;  5AJD A;  2L6J A;  2X6J A;  5BW8 C;  1SA5 A;  2GRN B;  2P9U G;  4ANW A;  4G23 A;  4G8K A;  4N5Q A;  3E4B A;  4DJA A;  2DYR E;  4B8A A;  1E7U A;  1NFI E;  4I2Z A;  3RO2 A;  3EHR A;  3LY7 A;  1FVH A;  3TG4 A;  2I9C A;  4GML A;  4JXT A;  3D9O A;  4B94 A;  3KSL A;  4DPR A;  4KXK B;  3V79 K;  2J4B A;  2X38 A;  2CFU A;  5T8I A;  4HQD A;  3RSE G;  2NSZ A;  2GRQ B;  5CMW A;  1LD7 A;  1JWF A;  2V0P A;  3JQ0 A;  3L22 A;  3NZU A;  1HE8 A;  4UWF A;  2XPI A;  2FBN A;  3C5R A;  4XZ4 A;  2RG8 A;  1BI8 B;  4LCT A;  1EF1 C;  3W9G A;  2XHE A;  4GTT A;  4WWN A;  3J5P A;  4A3V A;  4CCA A;  4XEI G;  1KZP A;  3HXB A;  3QAR A;  3B7T A;  3J5Q B;  2E0I A;  4EZK A;  2F0Y A;  2LSU A;  2XEV A;  3RJV A;  4GTR A;  2KZT A;  5FQ6 A;  1DVP A;  4TXQ A;  4RSY A;  3TJP A;  4JVS A;  3DWL G;  3EHN A;  4X8Q A;  1EPU A;  4PS7 A;  3PZD A;  2V4H C;  3NB2 A;  4HI9 A;  5HS0 A;  3VTY A;  3ONK A;  3JQ1 A;  4FHJ A;  3RRM B;  4JHR A;  3UUX A;  1HG5 A;  3EIQ C;  5EX0 A;  4AP2 A;  2I1K A;  2R5S A;  1FT1 A;  3SBT B;  3RAU A;  2Y1L E;  3IV0 A;  3HDX A;  5FJY A;  5FZR A;  2V5Q C;  3NZS A;  1K8K G;  4GA2 A;  1BI7 B;  4BET A;  4Y6W A;  5ENT D;  2R17 C;  3CHP A;  1B89 A;  2QY7 A;  4ACK A;  2R02 A;  1ELW A;  3MCX A;  3CVN A;  4YDO A;  5BXU A;  2P9K G;  5LX8 A;  2P9P G;  5EIB E;  4YDY A;  1Q2Z A;  2OV8 A;  1TNB A;  2L9B A;  2X6K A;  1E8Y A;  1BPO A;  4F7A A;  1WAO 1;  3CHM A;  4U0Z A;  2F8Y A;  2B6C A;  2X6H A;  3ZYL A;  2IU1 A;  2WQH A;  2JAB A;  4GPK A;  3HXC A;  1D9S A;  2KM4 A;  3FH7 A;  2ZXW E;  5ENN A;  2VJ8 A;  4A1G A;  3DSU A;  4FLB A;  4J6I A;  4F6R D;  1V54 E;  1K1B A;  3ML9 A;  3PEU B;  2P9S G;  3U64 A;  3ASH A;  4OYS A;  1HG2 A;  3CLJ A;  5T3R A;  5A6C A;  2KZT B;  1YA0 A;  5B1B E;  4EBA A;  3S2A A;  5LP0 A;  2WVI A;  4PS8 A;  3TWQ A;  3TAX A;  1MQS A;  4N3B A;  3QNK A;  3V2O A;  4EHM A;  4KZC A;  3AS5 A;  4I6J A;  4NRH B;  4LRZ A;  4PDX A;  3RKV A;  1H6P A;  2WXL A;  4GYW A;  3UI2 A;  1H0A A;  3QWP A;  3L16 A;  4ANU A;  1L5J A;  1PAQ A;  2PQN A;  2EIJ E;  3Q7F A;  2HYZ A;  2R03 A;  4I1M A;  3FUF A;  2R59 A;  3UIO C;  2DVW A;  4J8F A;  3GZ1 A;  2H6G A;  3VLE A;  3IKO B;  3UQ3 A;  3LYA A;  4L1B A;  2LXL A;  4TRQ A;  1TNY A;  1TJC A;  3DSS A;  2R2L A;  3NF1 A;  3PNL B;  4XKB A;  4DX6 D;  3CR3 A;  2FO7 A;  3D9P A;  4K03 A;  2VSX E;  4U04 A;  5CRV A;  2HM8 A;  3Q4A B;  4G8L A;  1NI1 A;  4WNF A;  1JCR A;  2VGX A;  2IF4 A;  4KZ0 A;  3OTN A;  5G04 J;  4URK A;  3AG1 E;  1KT0 A;  4UWG A;  3D9M A;  2GRP B;  4Z68 A;  4BER A;  1IKN D;  4HLE A;  3L54 A;  1N4S A;  4A63 B;  4U07 A;  2LO6 A;  3C72 A;  4M7C A;  1XNF A;  3LKU A;  4H7X A;  4ME2 A;  3CVY A;  3AS4 A;  4G26 A;  2XRY A;  1TNO A;  2AXU A;  2VSN A;  1PY1 A;  1FVF A;  4DI4 A;  3CVV A;  3B7B A;  3SFY A;  4HOU A;  4HOS A;  4RLY A;  4GA1 A;  4XI9 A;  4K5B A;  3PZ2 A;  3MYV A;  4ZHB A;  3RO3 A;  3CQG B;  2DWZ A;  3E32 A;  1KLX A;  1HFA A;  2I2O A;  2PZI A;  4HBD A;  4AM9 A;  4GYO A;  2MYO A;  5JHA A;  3EUV A;  2V5F A;  3LY9 A;  4HOQ A;  4JB8 P;  3CK8 A;  4LSZ E;  4U7E B;  5ARF A;  3ZU7 B;  1N9A A;  1FT2 A;  4OVV A;  1HXI A;  5B1A E;  4GB9 A;  2DBA A;  3D9J A;  3UIN C;  4GTP A;  2L0T B;  5BT1 A;  2I6H A;  4HB5 A;  4JHK A;  2A5E A;  2AVP A;  3LJN A;  2YHE A;  5LCW J;  3ZHE B;  3FUK A;  5AN8 A;  4LUN U;  1EDU A;  3PNT B;  4L7T A;  4IRU A;  5JJ7 A;  3UT4 A;  3ULY A;  1BLX B;  3KD7 A;  4DI3 A;  2LAI A;  2QYU A;  3FH5 A;  1BU9 A;  3LEW A;  2XGO A;  4DLQ A;  1SW6 A;  4GTQ A;  2KCL A;  2J4D A;  3ENE A;  5AEN A;  3PZ4 A;  2FUL A;  1AWC B;  3FTW A;  2DCP A;  1Z3X A;  3JXI A;  3PE3 A;  3FUJ A;  1OWP A;  2H6H A;  3BG1 B;  4O1O A;  2V8S E;  2DZN A;  1UN9 A;  3FU6 A;  1E7V A;  2PL2 A;  3UMV A;  3PVL A;  4QFV A;  3SHF A;  1N54 A;  4GPM A;  4G25 A;  5FWQ A;  5JJ6 A;  4JA7 A;  4HRM B;  1N0Q A;  4NUR A;  3OXF A;  3I4G A;  2JLB A;  3BUA A;  1JCS A;  4BTA A;  3B7S A;  3E30 A;  1D8E A;  1SQM A;  1TJF A;  4G1T A;  4GCN A;  4I43 A;  2VGY A;  3FHE A;  3SFZ A;  3ZW3 A;  2VQ2 A;  2WXR A;  2YNQ A;  2FO1 E;  1QZ2 A;  4F1S A;  3FUH A;  4HI8 A;  4E85 A;  3NOC D;  5C2Y A;  5CMY A;  5BPP A;  4WWO A;  4P29 A;  4U0U A;  4JEH A;  2XPZ A;  1S70 B;  3D9L A;  5KBA A;  1IHB A;  1OXJ A;  3ZRH A;  4JW1 A;  4DX2 A;  2OND A;  1GW6 A;  1OY3 D;  3N71 A;  3TXN A;  1K1A A;  3OAW A;  3VLD A;  3IHY A;  2IQC A;  5JJT A;  4D10 C;  3ASO E;  2ETC A;  1FPP A;  2EQX A;  3FUM A;  1MX6 A;  2YIN A;  4U0S A;  1E8W A;  2KBX A;  2ZGG A;  3RIB A;  3QKY A;  2IJG X;  3KAE A;  4JL0 A;  3BEE A;  4AIF A;  4DX1 A;  5AQ9 A;  4A1S A;  2ZIS A;  5HRY A;  4CRW A;  3CVX A;  4UWL A;  4GZ3 A;  3UKU G;  1H2T C;  3CKC A;  4DUI A;  4I6G A;  4Q94 A;  4J8E A;  4F53 A;  2MRI A;  2BUG A;  1VDY A;  3T5X A;  4WWP A;  3MJW A;  2BED A;  3Q49 B;  5HKP A;  4GMR A;  2NC9 A;  2EIN E;  5AAO A;  1LD8 A;  5BV0 A;  3NOG D;  5EYP F;  2CHZ A;  1OCR E;  2LSV A;  5FT9 A;  4AJW A;  3GYZ A;  3CIA A;  3AG4 E;  4CT0 A;  2CHX A;  3C3Q A;  3LS8 A;  3G2V A;  3R7R A;  2L6B A;  3NAW A;  3ZYQ A;  1IXV A;  2X3M A;  3AAA C;  4OVU A;  1U3D A;  3B95 A;  5KWD A;  1IQR A;  2XZD G;  3D9N A;  3FFL A;  2WXJ A;  3MEK A;  4YVO A;  1N4P A;  3FUI A;  2H6F A;  4HOR A;  5DIZ A;  3PUK A;  2PNN A;  4N3C A;  1WY6 A;  1UG3 A;  1UJK A;  4TXP A;  5CCL A;  3S7D A;  5KJK A;  3AG3 E;  1Z5S C;  5E76 A;  2QYJ A;  4KVM A;  2R05 A;  5FTP A;  2UY1 B;  3DRA A;  4DLO A;  3Q47 B;  1E90 A;  4KMO A;  4ATG A;  2B0O E;  3D9I A;  3SFX A;  1Y6I A;  2IO2 C;  2IY0 C;  4APF A;  2AJA A;  2Y4T A;  4IUL A;  4CYM D;  3AU4 A;  4C0E A;  3ABL E;  4CDN A;  4GA0 A;  4APO A;  5AIJ A;  4ZFH A;  5J90 A;  3GZ2 A;  4AV7 A;  4GCO A;  4ABN A;  2VGE A;  4WUY A;  4J8Y A;  4OAV B;  1EYH A;  4XX5 A;  1KPS B;  5KJL A;  3E34 A;  3ZGQ A;  1N52 A;  4ILI A;  2HO1 A;  3DXM G;  2Q7F A;  2KCK A;  4UI9 C;  3MA5 A;  1MHQ A;  4L2Y A;  5BV1 A;  3L17 A;  5ITZ F;  3QAQ A;  2FF4 A;  3CVW A;  1TNU A;  4HLL A;  5CBN A;  4W9R A;  1TEZ A;  4GZC A;  3Q15 A;  3SF4 A;  2J9Q A;  4TV3 A;  4WNG A;  4PH4 B;  1N4R A;  5LCW C;  4HOT A;  1H2V C;  3BQO A;  1JCQ A;  4FJY A;  4HNA D;  1YCS B;  4B89 A;  3MX3 A;  1S0P A;  5JHB A;  3EJN A;  2RFM A;  5CCM A;  2GRR B;  3D9H A;  2VYI A;  3CK7 A;  2KCV A;  1PC2 A;  2P9I G;  3APF A;  2OVB A;  3JUI A;  1NA0 A;  1Y8M A;  3EIJ A;  1O1T A;  1HU3 A;  3ABK E;  3CGH A;  5AJL A;  3CHS A;  2IO3 C;  2IOL A;  3ZEF A;  2M63 A;  4JEU A;  3TWS A;  2J49 A;  2GW1 A;  1NP7 A;  2VSY A;  4XKC A;  1UJJ A;  1YYH A;  2XZT G;  2LAH A;  2FI7 A;  1D8D A;  3LVQ E;  4B8C B;  5A23 A;  3SO8 A;  5BNW A;  4FUL A;  2FEZ A;  4CT4 A;  4GYY A;  1JWG A;  3B7R L;  2J09 A;  4B93 B;  1QQE A;  4J8S A;  2VGX B;  3KEA A;  3TWV A;  4YND A;  3LJ3 A;  5D66 A;  4GMJ A;  5G04 C;  4MBG A;  4EZL A;  2Y4U A;  5T4Y A;  3ULE G;  3FEY A;  5ENP D;  3MKR A;  1N94 A;  2MHK A;  2GGF A;  4JA9 A;  5EN5 D;  1WG0 A;  3DSX A;  3TWU A;  2WQ6 A;  4U96 D;  2GRL A;  3QK0 A;  4IN3 B;  3TG5 A;  3ABM E;  2OCC E;  3GW4 A;  2X6F A;  1AP7 A;  2DIW A;  3L82 A;  5M72 A;  2NXP A;  3LDZ A;  3P1U A;  2PM6 A;  2WXK A;  3DBS A;  4I2W A;  2RKK A;  5D2M C;  5BUZ A;  4JPS A;  3CHO A;  5EID A;  5DBK A;  4YVQ C;  2F37 A;  5EX3 A;  3G2W A;  5A7D B;  4CGW A;  3VTX A;  2WM9 A;  2DZO A;  3SQV A;  3FUD A;  4OAU C;  3T8K A;  4LNU D;  3TGO A;  5FZQ A;  2AXZ A;  2CFZ A;  3O48 A;  3PUJ A;  3R9A B;  4HS2 A;  1KT1 A;  1NL4 A;  1P5Q A;  4RG6 A;  3UM2 A;  4FP7 A;  1N11 A;  4Q69 A;  4UI9 K;  3SD5 A;  4G11 A;  1HH8 A;  5ARG A;  4C48 B;  4L23 A;  2CG3 A;  5G05 J;  3JXJ A;  3FUE A;  4GTS A;  1TN7 A;  2WXO A;  2XS8 A;  3ML8 A;  2KC7 A;  3CQC B;  4B0Z A;  5ENQ D;  3NBN B;  3FU3 A;  2J08 A;  2RFA A;  3UPV A;  5D0O D;  4EQF A;  3TWX A;  4GZD A;  3U3W A;  2UY1 A;  3EHQ A;  5AAR A;  3ZFW A;  2OEW A;  2XEN A;  2J07 A;  3T9K A;  4MLP A;  5ENO D;  2XQ0 A;  1TYQ G;  2NYJ A;  5ANR A;  5C1D A;  4K5C A;  3GZS A;  3HG0 D;  1FCH A;  3S7J A;  4I1A A;  2XGS A;  3FH8 A;  3ZYK A;  2X6I A;  4FLH A;  5CEA A;  3R7Q A;  4U8Y D;  3SGH A;  3AG2 E;  1O5M A;  3S7B A;  4GU5 A;  1MYO A;  4R7L A;  2BKK B;  3CV0 A;  4BY6 A;  3LCA A;  3UX4 A;  1K3Z D;  4AEZ C;  2WXN A;  4XI0 A;  2AWI A;  1TR4 A;  3CKB A;  3FTV A;  2GRO B;  2WB2 A;  3EU5 A;  4WND A;  3L6A A;  2WMO A;  2YQ8 A;  3ZN3 A;  2BTD A;  4KYO B;  2WQ7 A;  3MZL B;  3QWV A;  3HIZ A;  4UQZ A;  3SNX A;  4BX8 A;  3DSV A;  2EIK E;  4GZ6 A;  4BEP A;  3HRA A;  3PEV B;  3MV3 B;  3HXE A;  3NQP A;  5B3S E;  2XGM A;  3LY8 A;  4GAA A;  5J08 A;  1WM5 A;  3DXK G;  1OUV A;  1HZ4 A;  4NQ0 A;  2F8X K;  4QQI A;  2Y3A A;  3L9T A;  3P2B A;  1QNF A;  2PM7 A;  3ZIM A;  3KEZ A;  2GRM A;  2A5U A;  3VLF A;  4RQI A;  3DPY A;  4BES A;  3W9F A;  3FTS A;  2OEV A;  4U8V D;  3TWW A;  3ZUV B;  3QDN A;  4I1O B;  4YDW A;  2CHW A;  3APD A;  3I4R B;  2IEJ A;  3ULQ A;  1MX4 A;  3CHR A;  1OWM A;  2LNI A;  1A17 A;  1X81 A;  3FTU A;  1E96 B;  3E33 A;  1Z3Y A;  4UQY A;  3HVE B;  2ZGD A;  4HVB A;  4GTM A;  1QYM A;  3EHM A;  3Q9N C;  3X2Q E;  2LXM A;  3AJI A;  4TXR A;  5FZS A;  5FIO A;  1QBQ A;  4N2Q A;  4LNB A;  3QOU A;  3I3N A;  3R9M A;  2XRZ A;  2DYS E;  2VSO E;  1TNZ A;  1ZB1 A;  3FEX A;  3HYM B;  3SI5 A;  2AXV A;  1NZN A;  3FTZ A;  3CEQ A;  1E8X A;  3EU9 A;  1MJ0 A;  3JUE A;  4AOF A;  5CBO A;  2VTB B;  3FP3 A;  1S63 A;  1UOH A;  2KXP C;  1UW4 B;  4I9E A;  2WPV A;  3ASG A;  2HE0 A;  3QB2 A;  3TWR A;  1Z6T A;  4O6F A;  3RU0 A;  1ELR A;  4AY5 A;  3PH0 C;  4KVO A;  4J0U A;  4A55 A;  5ENS D;  3CHQ A;  4EPZ A;  5FQ4 A;  1IHG A;  4F1P A;  5AQA A;  4O60 A;  1H6O A;  1JUQ A;  1UN8 A;  4U63 A;  3ASN E;  1RZ4 A;  4UI9 J;  4ILH B;  3Q73 A;  4RG9 A;  1H2U A;  3ONL A;  3OXL A;  1O1R A;  5G2N A;  3C98 A;  4PUC A;  2P58 C;  1ELK A;  4BSX A;  1OWN A;  4EBA G;  3DPD A;  3PZ1 A;  3FU0 A;  4ACL A;  3BG0 B;  1U3C A;  4DK5 A;  3I5P A;  3ZYM A;  5D0Q D;  3ZXS A;  3CVU A;  1LTX A;  1OCO E;  3PZ3 A;  4TUM A;  2KAT A;  4AY6 A;  1OWL A;  4I17 A;  1SZA A;  3Q5M A;  2UWJ G;  3EDT B;  4JZY A;  3ZXP A;  3B7U X;  3Q7A A;  3MKQ B;  3APC A;  4WNE A;  4AVX A;  2ETB A;  4LEU A;  2YHC A;  1MX2 A;  3UXG A;  3TXM A;  2QFC A;  3FTY A;  4G24 A;  1KZO A;  3SBS A;  4BX9 A;  5KCM A;  5ANL A;  3U4T A;  3PE4 A;  5KJN A;  2MOW A;  5JA4 D;  5AQB A;  3F6Q A;  5AYW D;  2LUH A;  2P2C P;  5FIN A;  1DCE A;  1E8Z A;  5EYL A;  5HQ8 A;  3IEG A;  4YDE A;  3CST A;  3K9I A;  2C2L A;  4ATZ D;  3G2T A;  1N0R A;  4O1P A;  3HXD A;  3TL5 A;  3KS2 A;  3BU8 A;  4LG6 A;  3RRN B;  3JYS A;  4PS3 A;  2WXF A;  1IQU A;  2Y0B G;  3O4Z A;  3V31 A;  3DST A;  4J8D A;  2BKG A;  1W3B A;  4U8H A;  3ZKJ A;  5CER B;  3QC1 A;  4F3V A;  1OCC E;  4IYP A;  1JPL A;  4ILG A;  3QJZ A;  2WXG A;  2XEE A;  3DSW A;  3MV2 B;  2ION A;  3L13 A;  1SZ9 A;  3UM1 A;  4UWK A;  2XCB A;  1ZBP A;  4ANV A;  4KBQ A;  1HF8 A;  4CDR A;  3D3M A;  4M3O A;  3U66 A;  1N4Q A;  1N95 A;  5CHE E;  3UIP C;  3PRE A;  4UQX A;  2WXQ A;  2ETA A;  4CZ2 D;  1HO8 A;  2XCC A;  1INZ A;  1IYG A;  5KNH D;  3LPZ A;  3ASF A;  2WXI A;  2EIL E;  4AXH A;  1SVX A;  4K5A B;  3MKQ A;  4FU3 A;  3S7F A;  4BT8 A;  4HRL A;  3CSF A;  5HI7 A;  2AW6 A;  3Q75 A;  3FDH A;  2EIM E;  2WXH A;  1XGW A;  4N3A A;  5AQ7 A;  3U9W A;  2QZA A;  3JCK C;  1X5B A;  3OXG A;  2VTB A;  2C0M A;  2XPY A;  3KSQ A;  5CEC B;  2ILR A;  4E6H A;  2WXP A;  2JEK A;  1TN6 A;  2WMN A;  4FJZ A;  5FQ8 A;  1H19 A;  4HXI A;  4UWH A;  4CEM A;  1SA4 A;  1WDY A;  3ZVV A;  3FY4 A;  3FUN A;  5CED B;  1BD8 A;  4DX7 D;  3ZPJ A;  4HFG A;  1S64 A;  3UT8 A;  2A4Z A;  1OT8 A;  1O1S A;  3RRU A;  3TWT A;  1H6K A;  2J8S D; 
#chains in the Genus database with same CATH homology
 4UQZ A;  3SNX A;  4BX8 A;  4FHK A;  4GZ6 A;  3TAX A;  1MQS A;  3PEV B;  1IQR A;  3MV3 B;  3D9N A;  3QNK A;  4N3B A;  3B13 A;  3NQP A;  1NA3 A;  3FFL A;  4I9C A;  5EDS A;  2XGM A;  5E75 A;  4Q96 A;  4KZC A;  3AS5 A;  2WXJ A;  3HVE A;  3LY8 A;  3MEK A;  4GAA A;  5J08 A;  4YVO A;  3AU5 A;  1WM5 A;  3FUI A;  3MGB A;  4N5C A;  4RVB A;  4I6J A;  1OUV A;  4HOR A;  2CG2 A;  4MS6 A;  4NRH B;  5DIZ A;  1HZ4 A;  3PUK A;  4LRZ A;  4PDX A;  4N3C A;  3D9K A;  1WY6 A;  1UG3 A;  4NQ0 A;  3RKV A;  1DNP A;  1UJK A;  2L0I A;  5CCL A;  2Y3A A;  2WXL A;  4GYW A;  3P2B A;  3S7D A;  1QNF A;  3FUL A;  2PM7 A;  3ZIM A;  4BFR A;  5KJK A;  1H0A A;  3KEZ A;  3QWP A;  2GRM A;  5E76 A;  3L16 A;  4ANU A;  4KVM A;  1L5J A;  2A5U A;  3VLF A;  3T5V A;  5FTP A;  1PAQ A;  2PQN A;  3PRZ A;  4XE0 A;  3URZ A;  2UY1 B;  2HYZ A;  4XIF A;  4DLO A;  3FTS A;  4I1M A;  3FUF A;  3Q47 B;  1E90 A;  3CK9 A;  4KMO A;  4ATG A;  2R59 A;  3IHV A;  1OWO A;  4J8F A;  3RK6 A;  3QDN A;  3GZ1 A;  4I1O B;  2OOE A;  3D9I A;  1Y6I A;  3VLE A;  4EEC A;  3ASD A;  3IKO B;  5G05 C;  2CHW A;  4APF A;  2Y4T A;  3UQ3 A;  3APD A;  3I4R B;  4IUL A;  4BTB A;  3QWW A;  3LYA A;  3ESL A;  4L1B A;  3AU4 A;  4TRQ A;  4C0E A;  3ULQ A;  1TJC A;  3CHR A;  4CDN A;  1OWM A;  4GA0 A;  4APO A;  5AIJ A;  2LNI A;  3NF1 A;  5J90 A;  2C0L A;  3GZ2 A;  3PNL B;  4XKB A;  2BF0 X;  4TUU A;  4KT6 B;  2I1J A;  1A17 A;  4AV7 A;  3CR3 A;  4K0R A;  2FO7 A;  3FTU A;  1E96 B;  4GCO A;  4ABN A;  3D9P A;  1Z3Y A;  4K03 A;  2VSX E;  3CVL A;  4WUY A;  4U04 A;  3ESK A;  3G2U A;  2HM8 A;  3Q4A B;  4WNF A;  2VGX A;  3AS8 A;  4UQY A;  2IF4 A;  1EYH A;  4KZ0 A;  4XX5 A;  3HVE B;  3OTN A;  4HVB A;  5G04 J;  5KJL A;  2ZU6 B;  3EHM A;  3ZGQ A;  4URK A;  4JC8 A;  3FU5 A;  1N52 A;  4ILI A;  3LXU X;  2HO1 A;  4UI9 C;  2Q7F A;  2KCK A;  4C0M A;  2IOS A;  3QWV A;  1KT0 A;  4UWG A;  5FZS A;  3D9M A;  3MA5 A;  1MHQ A;  4L2Y A;  3ZHE A;  2IFU A;  3WXX A;  5BV1 A;  4HLE A;  4CGV A;  4N2Q A;  3L54 A;  2PQR A;  3L17 A;  4JHJ A;  4WAF A;  3QOU A;  4U07 A;  2LO6 A;  3LVR E;  3QAQ A;  1XNF A;  2FF4 A;  3LKU A;  3CVW A;  3I3N A;  4H7X A;  3UT7 A;  4Y6C A;  4ME2 A;  3CVY A;  2XRZ A;  2RD0 A;  3AS4 A;  4W9R A;  2VSO E;  1TEZ A;  4GZC A;  3Q15 A;  4G26 A;  3SF4 A;  3CVQ A;  2J9Q A;  4TV3 A;  4WNG A;  2XRY A;  4PH4 B;  3FEX A;  2AXU A;  2VSN A;  1PY1 A;  2AXV A;  1NZN A;  3HYM B;  3SI5 A;  4EZJ A;  1FVF A;  3FTX A;  3FTZ A;  3CEQ A;  3FWV A;  2WXM A;  5LCW C;  1E8X A;  4DI4 A;  4HOT A;  2V4L A;  3CVV A;  1LF8 A;  1H2V C;  4AOF A;  4HOU A;  4FJY A;  4HOS A;  4GA1 A;  5KJM A;  4XI9 A;  2VTB B;  3MYV A;  4FA6 A;  4B89 A;  3RO3 A;  3FP3 A;  3CQG B;  2HR2 A;  5EKQ D;  3SZ7 A;  1UW4 B;  3G2S A;  1KLX A;  4I9E A;  1HFA A;  2I2O A;  2PZI A;  4MKT A;  4N39 A;  4AM9 A;  2WPV A;  3ASG A;  3MX3 A;  4GYO A;  5JHA A;  1S0P A;  5JHB A;  3EJN A;  4C9B B;  5CCM A;  4BWR A;  1ZU2 A;  4A3T A;  3T8M A;  3QB2 A;  1HX8 A;  2V5F A;  4ANX A;  1Z6T A;  2E2E A;  3LY9 A;  4O6F A;  3RU0 A;  1ELR A;  2VYI A;  4AY5 A;  5FQ7 A;  3CK7 A;  3IBE A;  3PH0 C;  4KVO A;  4J0U A;  3CVP A;  2KCV A;  4A55 A;  4HOQ A;  1PC2 A;  3APF A;  3CHQ A;  4EPZ A;  5FQ4 A;  4GZ5 A;  3CK8 A;  1IHG A;  2OVB A;  5LFA A;  3JUI A;  5G55 A;  5ARF A;  3PDN A;  1NA0 A;  1Y8M A;  3EIJ A;  4LER A;  3PS6 A;  4OVV A;  1HXI A;  2OVF A;  1HU3 A;  1JUQ A;  3CGH A;  5AJL A;  1UN8 A;  3CHS A;  4U63 A;  2IOL A;  4NAC A;  4I6E A;  4GB9 A;  3ZEF A;  2DBA A;  2M63 A;  4JEU A;  4UI9 J;  4FAD A;  3D9J A;  4ILH B;  4N2S A;  2J49 A;  2L0T B;  1H2U A;  3ONL A;  3OXL A;  4RG9 A;  5BT1 A;  4G2V A;  2I6H A;  2GW1 A;  1NP7 A;  5G2N A;  3L08 A;  5LOZ A;  1HS6 A;  2VSY A;  3C98 A;  4PUC A;  4XKC A;  2P58 C;  1UJJ A;  1ELK A;  4JHK A;  4MRU A;  4BSX A;  3HHM A;  4FC8 A;  2AVP A;  2YHE A;  1OWN A;  4EBA G;  3DPD A;  3FU0 A;  4CDM A;  2LAH A;  5LCW J;  4BT9 A;  2FI7 A;  4ACL A;  3ZHE B;  3BG0 B;  3FUK A;  1U3C A;  4DK5 A;  4V3I A;  3LVQ E;  4LUN U;  4B8C B;  1EDU A;  3I5P A;  3MZL B;  3PNT B;  4H7Y A;  4L2L A;  3ZYM A;  5A23 A;  5D0Q D;  4L7T A;  5AJD A;  4IRU A;  2L6J A;  2X6J A;  5JJ7 A;  5BW8 C;  5BNW A;  3ZXS A;  3UT4 A;  3CVU A;  4FUL A;  4ANW A;  4G23 A;  3KD7 A;  4DI3 A;  2FEZ A;  4CT4 A;  2LAI A;  3E4B A;  4GYY A;  3FH5 A;  2KAT A;  4AY6 A;  1JWG A;  3B7R L;  3LEW A;  4DJA A;  1OWL A;  4I17 A;  2J09 A;  1SZA A;  3Q5M A;  4B8A A;  2XGO A;  1QQE A;  2UWJ G;  1E7U A;  4I2Z A;  3EDT B;  4J8S A;  4DLQ A;  2VGX B;  4JZY A;  3RO2 A;  2KCL A;  3B7U X;  3LY7 A;  4YND A;  2J4D A;  3MKQ B;  1FVH A;  3ENE A;  3LJ3 A;  3TG4 A;  4GMJ A;  5G04 C;  2I9C A;  4EZL A;  3APC A;  4GML A;  4JXT A;  3D9O A;  4WNE A;  4AVX A;  4B94 A;  4DPR A;  5AEN A;  4LEU A;  2FUL A;  4KXK B;  3FTW A;  2YHC A;  2DCP A;  2J4B A;  1Z3X A;  2Y4U A;  3PE3 A;  2X38 A;  5T4Y A;  3FUJ A;  2CFU A;  1OWP A;  5T8I A;  2QFC A;  3FTY A;  3TXM A;  2NSZ A;  3FEY A;  3MKR A;  5CMW A;  4G24 A;  2MHK A;  3SBS A;  2GGF A;  1JWF A;  3BG1 B;  2V0P A;  4JA9 A;  4BX9 A;  2V8S E;  3JQ0 A;  5KCM A;  1UN9 A;  3FU6 A;  3L22 A;  1E7V A;  3NZU A;  5ANL A;  3U4T A;  3PE4 A;  2PL2 A;  5KJN A;  2MOW A;  3UMV A;  1HE8 A;  3PVL A;  4QFV A;  2WQ6 A;  3SHF A;  2GRL A;  4UWF A;  2XPI A;  2FBN A;  1N54 A;  3QK0 A;  4XZ4 A;  4IN3 B;  3TG5 A;  2RG8 A;  4LCT A;  5AYW D;  3GW4 A;  1EF1 C;  2X6F A;  2XHE A;  4G25 A;  1E8Z A;  5FWQ A;  5HQ8 A;  3IEG A;  5JJ6 A;  3CST A;  4JA7 A;  3K9I A;  2DIW A;  2C2L A;  5M72 A;  2NXP A;  4WWN A;  3LDZ A;  3P1U A;  3G2T A;  2PM6 A;  2WXK A;  3DBS A;  4I2W A;  4NUR A;  4A3V A;  4EBA A;  4CCA A;  3TL5 A;  3OXF A;  5BUZ A;  4JPS A;  3KS2 A;  3CHO A;  3I4G A;  2JLB A;  3QAR A;  3B7T A;  5DBK A;  4YVQ C;  2E0I A;  5EX3 A;  2LSU A;  4EZK A;  2XEV A;  3G2W A;  3RRN B;  4BTA A;  3B7S A;  3JYS A;  3RJV A;  5FQ6 A;  2KZT A;  5A7D B;  1DVP A;  4PS3 A;  4CGW A;  4RSY A;  2WXF A;  3TJP A;  4JVS A;  3VTX A;  2WM9 A;  1IQU A;  3EHN A;  3O4Z A;  3FUD A;  1EPU A;  4PS7 A;  1SQM A;  1TJF A;  4G1T A;  4I43 A;  4GCN A;  2VGY A;  3FHE A;  3SFZ A;  3ZW3 A;  2VQ2 A;  3PZD A;  2WXR A;  4J8D A;  2YNQ A;  1QZ2 A;  3VTY A;  3ONK A;  3TGO A;  5FZQ A;  3JQ1 A;  1W3B A;  4U8H A;  4F1S A;  2AXZ A;  2CFZ A;  3FUH A;  3O48 A;  3PUJ A;  4FHJ A;  4E85 A;  3R9A B;  3QC1 A;  3RRM B;  4F3V A;  4HS2 A;  4IYP A;  1KT1 A;  4JHR A;  1JPL A;  4ILG A;  3QJZ A;  1P5Q A;  2WXG A;  4RG6 A;  3UUX A;  1HG5 A;  3EIQ C;  5C2Y A;  4FP7 A;  3MV2 B;  5CMY A;  2ION A;  5BPP A;  4WWO A;  4Q69 A;  3L13 A;  4P29 A;  4U0U A;  1SZ9 A;  2XPZ A;  4JEH A;  5EX0 A;  3D9L A;  2I1K A;  4UWK A;  4AP2 A;  2R5S A;  3ZRH A;  2XCB A;  3SBT B;  1ZBP A;  4UI9 K;  3SD5 A;  4ANV A;  4G11 A;  4KBQ A;  3IV0 A;  1HF8 A;  3HDX A;  4JW1 A;  1HH8 A;  5ARG A;  5FJY A;  4L23 A;  3D3M A;  4M3O A;  5FZR A;  4CDR A;  2CG3 A;  5G05 J;  3FUE A;  3U66 A;  2OND A;  1GW6 A;  2WXO A;  3N71 A;  3TXN A;  3NZS A;  3ML8 A;  2KC7 A;  5CHE E;  3CQC B;  4GA2 A;  4B0Z A;  3OAW A;  3VLD A;  3IHY A;  4Y6W A;  3FU3 A;  2IQC A;  3PRE A;  2J08 A;  2R17 C;  4UQX A;  2WXQ A;  3UPV A;  3CHP A;  5D0O D;  4EQF A;  1B89 A;  2QY7 A;  4ACK A;  5JJT A;  1HO8 A;  4D10 C;  4GZD A;  2XCC A;  3U3W A;  2EQX A;  2UY1 A;  3FUM A;  2YIN A;  3ZFW A;  1INZ A;  1ELW A;  4U0S A;  3MCX A;  2J07 A;  3LPZ A;  1IYG A;  1E8W A;  3ASF A;  4MLP A;  3CVN A;  2WXI A;  3RIB A;  4AXH A;  3QKY A;  2IJG X;  2XQ0 A;  3KAE A;  4JL0 A;  5LX8 A;  3BEE A;  4AIF A;  5ANR A;  5C1D A;  3MKQ A;  4FU3 A;  3GZS A;  3S7F A;  2OV8 A;  4BT8 A;  4A1S A;  3CVX A;  4CRW A;  3CSF A;  4UWL A;  2L9B A;  1FCH A;  4GZ3 A;  5HI7 A;  3S7J A;  2AW6 A;  4I1A A;  2XGS A;  3FH8 A;  1H2T C;  2X6K A;  1E8Y A;  3CKC A;  1BPO A;  3FDH A;  3ZYK A;  4F7A A;  1WAO 1;  2X6I A;  2WXH A;  1XGW A;  4I6G A;  4N3A A;  3CHM A;  4J8E A;  4Q94 A;  4FLH A;  4F53 A;  4U0Z A;  3R7Q A;  2MRI A;  2BUG A;  2X6H A;  3ZYL A;  3SGH A;  1VDY A;  2IU1 A;  3T5X A;  2WQH A;  5LP0 A;  3U9W A;  3JCK C;  3MJW A;  4WWP A;  3Q49 B;  1X5B A;  3S7B A;  4GU5 A;  4GPK A;  2NC9 A;  3OXG A;  2VTB A;  2C0M A;  2XPY A;  4R7L A;  5BV0 A;  2KM4 A;  3FH7 A;  2ILR A;  3CV0 A;  2WXP A;  4E6H A;  2JEK A;  4BY6 A;  2CHZ A;  5ENN A;  2VJ8 A;  4A1G A;  3LCA A;  3UX4 A;  4FLB A;  4J6I A;  2LSV A;  5FT9 A;  4AJW A;  2WMN A;  4AEZ C;  4FJZ A;  2WXN A;  5FQ8 A;  1H19 A;  4XI0 A;  4HXI A;  3ML9 A;  3GYZ A;  3PEU B;  4UWH A;  2AWI A;  4CEM A;  3U64 A;  3CKB A;  3ZVV A;  3FY4 A;  3CIA A;  3FTV A;  3FUN A;  3ASH A;  4OYS A;  2WB2 A;  4CT0 A;  2CHX A;  1HG2 A;  4WND A;  3LS8 A;  3G2V A;  3L6A A;  3R7R A;  3ZPJ A;  3CLJ A;  4HFG A;  3UT8 A;  2A4Z A;  2WMO A;  5T3R A;  5A6C A;  2YQ8 A;  2KZT B;  3RRU A;  1YA0 A;  1H6K A;  2BTD A;  4KYO B;  3ZN3 A;  3ZYQ A;  2X3M A;  4OVU A;  3S2A A;  2WQ7 A;  1U3D A;  2WVI A;  3HIZ A;  4PS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...