2ISFA

Crystal structure of c298a w219y aldose reductase complexed with phenylacetic acid
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
314
structure length
314
Chain Sequence
SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Structural and thermodynamic studies of simple aldose reductase-inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 100
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2006-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2isfA00
1FRBA 4JQ4A 2PDHA 3LZ5A 2PDKA 4PUUA 3WBXA 2BGQA 2BP1A 4WDUA 2PDPA 2ACQA 4Q7BA 3EB3A 4QX4A 4FZIA 3CAVA 2HV5A 4AUBA 2PDUA 1SM9A 3LNMA 1QRQA 2PDXA 3VXGA 3C3UA 4XK2A 1ADSA 4XZHA 3LEPA 1RY0A 2F2KA 2IPWA 1AZ1A 3O3RA 2IPFA 4YS1A 4JQ2A 2PDIA 4LB4A 3FX4A 4JQ1A 5HNTA 2R24A 4YVPA 4EXBA 2FZDA 1RALA 1Q13A 3RX3A 3R7MA 1MZRA 2PDMA 2PDFA 1AH3A 4LB3A 4MHBA 1S2CA 3WBYA 4XZMX 4FALA 4DZ5A 1X97A 2IQDA 3EAUA 1Z89A 3EB4A 3BURA 4RPQA 3ONBA 3R6IA 2FVLA 3V0TA 3M0IA 4JTAA 2DV0A 1ZUAX 4PMJA 2PFHA 3CAQA 3ONCA 2DUZA 3DOPA 4ICCX 4XO6A 5LIWX 5LIYX 4GABA 1A80A 1PZ0A 1RY8A 1Q5MA 5DANA 3BV7A 3UGRA 1R38A 1ZQ5A 4XZIA 4DBWA 2I16A 4L1XA 5C7HA 1YNQA 3F7JA 4YVXA 2BGSA 1XJBA 1AH0A 4XZLX 1ZGDA 1AFSA 1MI3A 2PDLA 2PF8A 4XAPA 2IKGA 4XVEA 3P2VA 4QR6A 2IPGA 3LZ3A 4JTDA 5LIUX 2NVCA 4ZFCA 1VP5A 4DBUA 3CMFA 4WDWA 5JH2A 4XVDA 1IEIA 1YNPA 1HQTA 3GUGA 2PDGA 3MC5A 3BUVA 2I17A 4XO7A 4FAMA 4F40A 2INEA 1T40A 1C9WA 1S1RA 2C91A 3G1RA 4I5XA 3S3GA 4G5DA 3O0KA 1GVEA 3B3DA 1EXBA 4XZNX 4PRTA 3KRBA 2PDYA 2HVOA 3M4HA 2IKIA 2R9RA 4WEVX 1HW6A 4H7CA 4PRRA 5LIKX 2A79A 2WZMA 4QBXA 2AGTA 2ISFA 4JTQA 2CLPA 3V0SA 4IJCA 3H4GA 4LBRA 4ASTA 4GA8A 1Z9AA 3COTA 1LWIA 3R58A 2J8TA 2IKHA 4EXAA 2IQ0A 4JTCA 3ERPA 2IS7A 2HVNA 3NTYA 3UZWA 1PWLA 3UFYA 1Z8AA 3U2CA 3GHTA 2FZ9A 3R94A 5KETA 4YVVA 1YE4A 4JIHA 3UG8A 4R9OA 1XGDA 1AZ2A 3UZXA 4WRHA 3LD5A 2ACUA 3MB9A 4IJRA 4QXIA 4HMNA 3UZZA 1MRQA 5HNUA 4WGHA 3V36A 1YE6A 4GCAA 1XF0A 1S2AA 4GIEA 3T42A 1K8CA 1OG6A 2PEVA 3R43A 3N6QA 4WDXA 2FGBA 3LBOA 3Q65A 1UR3M 5LIXX 4HBKA 2HE8A 2PDWA 3R8GA 3DN5A 3UWEA 5HA7A 2PD9A 3H7UA 2NVDA 3WG6A 1PWMA 1EF3A 4L1WA 2PDNA 4OTKA 1X98A 5M2FX 5AZ0A 3UZYA 1VBJA 2ACSA 3CV6A 2ACRA 4IGSA 3H7RA 2ALRA 3LQGA 3LN3A 2HE5A 3WCZA 2WZTA 1QWKA 2INZA 1ZSXA 3LENA 3GHUA 3RX4A 1T41A 4YU1A 3D3FA 3GHSA 3GHRA 4Q3MA 3V0UA 3N2TA 2PDQA 4LAZA 2HDJA 3BCJA 3WBWA 2PZNA 4DBSA 2FZ8A 1X96A 1PZ1A 4FA3A 3LQLA 1Z3NA 2P5NA 1M9HA 3G5EA 3RX2A 2F38A 3UYIA 4JQAA 2QXWA 2PDBA 1US0A 4LBSA 3FJNA 2PD5A 4JIIX 3LUTA 3QKZA 2IPJA 2VDGA 4WDTA 4PUWA 3M64A 1EL3A 3Q67A 1PYFA 5AZ1A 1S1PA 4PR4A 4GQ0A 4JIRA 3UP8A 1J96A 3CASA 2PDJA 4H8NA 4LAUA 2FZBA 5JH1A 2IKJA 1JEZA 4GQGA 1AH4A 4GACA 1EKOA 1IHIA 3V35A 4JQ3A 2HEJA 3R8HA 2PDCA 4NKCA 4JTRA 2DUXA 1LQAA 3CV7A
chains in the Genus database with same CATH superfamily
3S5SA 2J9ZA 3DESA 4H19A 4Z1YA 4PUKA 1VRXA 3WBEA 2WOQA 4EPBC 1TJ1A 1GTHA 2GQ8A 3EOUA 4PMDA 1GYLA 3ABRA 4J5NA 2ACQA 3O6AA 4IFRA 3DHDA 4D6HA 2C1IA 4Z1BA 4NNAA 5CZKA 3EWXA 2NVAA 4DWDA 1HP5A 2WMFA 3QV8A 4Q4OA 4GNKB 1NWTA 2DT1A 3PFRA 2XIBA 2E25A 1R2RA 1A5SA 4DXXA 3VU2A 5CPOA 1H7OA 1TTIA 1TREA 1JDDA 2VR5A 1E1EA 3FX4A 3QV7A 3T4WA 2R1LA 2J74A 3NL6A 1QI2A 2OKOA 2J62A 2DPEA 3SJ3A 3GC4A 4EXBA 3HPFA 3W4RA 4Q4PA 1IR1A 2HJPA 1H60A 3WEOA 1TWIA 2ODOA 2WVSA 5BU9A 3L0KA 1JGMA 5KITA 2VC7A 1B9BA 3WQ4A 3APGA 4WHBA 1G5AA 5GVJA 1H7WA 4PB3A 4L56A 4HA3A 5LNRA 1VJIA 2XGIA 1V6WA 3BICA 4ICCX 4MFEA 1NFGA 4FHAA 2EF9A 4OJYA 2FYMA 4JKKA 2A0NA 2ISDA 1NFBA 1DEDA 3UZ5A 2XG9A 3K8KA 1WV2A 2CW6A 2GGGA 4UC5A 5I07A 2XFRA 5KINA 1A4MA 1JF5A 2LLEA 1IXQA 1IT7A 1E6QM 4OOUA 1GTEA 2VZVA 4UTLA 5DBTA 2DFAA 2TAAA 3KOZA 2WANA 4M19A 1DTNA 2NVCA 1LLWA 1XP3A 3L4YA 3GG0A 2VZUA 2NX1A 3CMFA 4JNYA 1E6ZA 3W3OA 1ME9A 1W5NA 5HPCA 4JHOA 2G96A 5HJXA 1IF2A 4AG0A 3MC5A 1SJDA 4AD0A 4B5WA 3JS3A 1AVAA 4P7RA 3WQEA 4DJFD 3JZEA 1WKEA 2CLMA 2X1SA 4FNTA 3WQ8A 2PLMA 3G1RA 4PSPA 3IIPA 1RVGA 3BGGA 3RHGA 1CCWB 2BXVA 4ATDA 3N2MA 1WA3A 3CZLA 3CIXA 1C3FA 5I5RA 1OFQA 5DT7A 4DXKA 2W4XA 1HNYA 1SZRA 3BCDA 5F2MA 3EWWA 4FF5A 1KC7A 4OQVA 2A79A 4R7JA 1JRBA 3GS6A 3IJIA 4P61A 5T8GA 3ENLA 1KRBC 3W88A 3WEZA 4LBRA 1HZYA 1O94A 1T8XA 3COTA 2WM0A 2V3EA 3CWNA 2R14A 3NDZA 3SW6A 3CQJA 3HG4A 3MKVA 3ERPA 2IS7A 3KOWA 2NWSA 4WK9A 4UTTC 1FWSA 1K4GA 4EPDC 3LDVA 3F4VA 3GAKA 3W22A 2E8YA 3UA4A 3CQHA 3EMZA 3I6TA 2G3NA 4ZSUA 3W9ZA 1KTBA 2PF0A 1AJZA 3DHUA 1WPCA 4JIHA 4Z2GA 1EYEA 5AVNA 1FFQA 3RYSA 2E6FA 1AW2A 1V02E 1VQTA 1KR0A 5CSYA 4WGHA 3WL1A 1VJSA 2SFPA 1OG6A 4TVCA 4ZR8A 3LGGA 3EEZA 3M44A 4RE0A 3CHDA 1J5SA 5G4EA 1QFEA 1W0MA 3RR1A 3VDBA 3L5LA 1UASA 2Z29A 2MNRA 1T99A 3ZVHA 2INFA 1H63A 1D3HA 1G7UA 1Q8AA 4CQBA 2GGHA 1GQKA 1PIIA 4A22A 4GPNA 4XD6A 5ABGA 4DN1A 2QV5A 2PDNA 2P50A 1KFLA 1P1MA 5BOOA 1TZ7A 4O0KA 1SGJA 4PCTA 1B57A 1IWBA 4EAYA 3ARPA 3GDKA 3AICA 3TC3A 1R9ZA 3GXNA 3H7VA 4KWOA 3V5FA 3WQFA 2YXXA 4NXKA 3U2EA 5AHLA 1Q65A 3KRZA 2CZ5A 2V5DA 4O52A 1N8WA 3O1NA 4UUIA 3VIIA 4HHLA 4J3TA 3CB8A 2GLKA 1YMYA 3PP7A 3AZRA 2GVYA 6XIMA 4O14A 4O12A 4DUOA 2J24A 5CJNA 3QTGA 4Q4KA 1GOKA 2PI6A 3CIWA 3WLPA 2E7FA 3VOCA 3UGVA 1UUQA 4ONVA 4Q4SA 4FOUA 5AB3A 1G69A 3ZLFA 4NJJA 2X16A 3S5OA 3P5ZA 1LG2A 3NXFA 1EEXA 4F0MA 2NV9A 5A1AA 4L80A 2V67A 1A0EA 2TRSA 4TR9A 3W7CA 5KZ6A 3KRUA 3MZ2A 1SJBA 3B05A 4O28A 1LOSA 2XSBA 2WMGA 4GI8A 2C15A 2IKJA 4GQGA 4DYKA 3NVTA 4HA4A 1TQXA 4H6KA 3KE0A 1WAUA 4GVGA 4HOXA 1U30A 3BSMA 3QY6A 5HMEA 3MDWA 1JZ7A 1NP0A 4RV8A 4XBJA 4IIGA 3BG3A 4AWTA 1FDZA 3IGUA 5BRQA 2AAAA 4A3UA 1LQAA 1UR4A 4B9ZA 4KRTA 5DMLA 4FXFA 2IMRA 1WXJA 4PUUA 4AFYA 3LCXA 1VPQA 3DYMA 1W1VA 3WQOA 3A3XA 3EB3A 3EWCA 4FZIA 4DJEA 1XLHA 1XSJA 3CB3A 4Q7NA 4FX8A 4PUNA 1R5YA 3IUDA 1XDJA 3GU2A 3ZT6A 2C16A 1ADSA 2F2KA 3DG7A 4UTWC 1QPQA 2VDHA 4GI9A 3VGDA 3WKZA 4L61A 4PB5A 1XH1A 3NURA 2QAFA 4PMNA 4ZBCA 3DYPA 1BTMA 4MJMA 2Z2AA 3E2VA 4TV5A 2DZUA 2VEKA 1Q13A 3EDJA 4H3DA 2PDMA 2WO5A 4HSHA 4IJBA 4BEUA 4QDPA 1I4NA 4Q8WA 4TVUA 3O05A 4HHHA 2EKGA 1KBBA 3ZZ1A 3EB4A 3PG9A 4RV3A 3WMSA 1UW9A 2ZKMX 4QE5A 4WXYA 3AHTA 1UH4A 1J12A 1H11A 1IXNA 8XIMA 3BMVA 5LIWX 3MSDA 3SN4A 1XPGA 1A80A 1DYSA 3VOFA 5C55A 3C56A 4N0RA 3AIWA 3GW0A 3ARVA 1SFLA 1W1YA 2DH3A 3HQNA 4C6MA 3VNMA 3AOFA 3CPGA 3BXWA 1TE6A 1TX2A 4BQ3A 1R8LA 1QO5A 4E2DA 4LW7A 3GFYA 3H24A 2XWDA 3W1AA 3YPIA 1SYTA 2BODX 1CEOA 2Z28A 3HG3A 4GGHA 3CL6A 4GH3A 1J01A 2WPBA 3FVMA 2GYIA 2XH2A 1F7BA 1JIBA 4UOQA 4ZTXA 4C1KA 3LZ3A 4NJHA 1M3UA 1CZ1A 3A4XA 3SQSA 4TV6A 5CPSA 3QBUA 4G7FA 1Q6QA 3URQA 2QVNA 2YSWA 3ZJ6A 1HQTA 4XUGA 3J7HA 5E70A 1H09A 1P7TB 2EG6A 1QT1A 4XO7A 1P48A 4YIWA 4AHQA 1Z7AA 3ABQA 4IQEA 3DENA 3IIZA 5G1MA 3EWBX 3QW4B 5I3JA 1NF7A 3KVKA 3IJ9A 3CO4A 4C6CA 1GVEA 3B0XA 4NZCA 4KFOA 2PDYA 1YPIA 4GG9A 1K02A 1DXIA 2J47A 4O4WA 1VFLA 3PTQA 2PTYA 3QVQA 1IGSA 3UWUA 3RR4A 4IMDA 4QBXA 2WQPA 2YZRA 1EUNA 3U5UA 2CPUA 3E2QA 1ZBKA 3U7VA 2YL6A 1TPB1 3H4GA 1J8VA 1JYNA 1B3XA 4U4MA 3ZJ7A 2PGFA 4W7WA 1OY0A 3VDAA 4EXAA 3WENA 3MSYA 1WDSA 3S2MA 3A5FA 1UWTA 1V6UA 5A3HA 5CJ5A 5K9CA 3Q37A 3OJGA 4CEUC 4CLMA 4W84A 4PBFA 2YW4A 4XV0A 1E9ZB 1IT8A 2HISA 3IRDA 3QFEA 4AVFA 1LWJA 4M24A 1OM0A 1LQ2A 5C71A 4DRSA 1V0MA 1Y65A 6XIAA 3M5VA 5C2CA 4MB5A 5FJUA 4LCQA 5LKYA 3QSRA 4OT7A 1S2AA 4O17A 4EX4A 3QSTA 1PVNA 4HCLA 1D7KA 1NWSA 1VH7A 1E1FA 2VRJA 2FGBA 5LA1A 3H6OA 4ZOCA 4BY3A 3QQ0A 4UMBA 3AC0A 5HA7A 2HMCA 1DBTA 5D4YA 5AYXA 3U4FA 4M0XA 3WD0A 4P7OA 4PSRA 2FMNA 1I60A 1EB3A 2FTPA 2GFTA 4RE4A 2WV8A 3M0KA 5G2HA 1EJ7L 3AU2A 2POTA 1PDZA 1KLYA 3GVWA 1QI0A 2QF7A 1KM2A 2OO6A 1KM6A 1TB3A 1CXLA 1E0VA 2DIEA 4I7WA 5AYBA 2ADAA 1JD7A 3IVUA 3OZMA 3C6CA 4MUPA 4F2UA 2GZXA 3BW4A 4HPHA 1LCOA 3R25A 3TYEA 4P7QA 3ZT7A 4GKTA 1SMDA 3SRFA 1P6CA 4L6OA 3AHZA 3UBPC 3URBA 3RK8A 3UNDA 5D9PA 1VHNA 1MXDA 2JGQA 3D0CA 2POZA 4LAZA 1OFDA 3WBWA 2PZNA 2XH4A 2IQTA 5CC7A 1KFEA 3LMZA 3LB0A 3QRHA 1NOWA 2J7FA 1WUEA 4GZIA 3V7PA 1V8EA 2WJDA 1KGWA 4LC8A 1XFBA 3KWSA 3GZ3A 5B7ZA 4B90A 2Y5SA 3SCNA 3KEHA 4GJ1A 4JIIX 3Q2DA 2ZUWA 3INPA 1Q85A 1CDGA 2IPJA 3W7EA 2C0HA 4EE9A 4Y6GA 1HJXA 3APTA 2BMBA 4GXMA 4L9XA 4GUGA 2QDEA 4IUGA 3MA8A 5FAGA 3CUFA 3SURA 4JL1A 3BOXA 1EBGA 4YHGA 1RJQA 2ZA1A 2CZFA 1FCVA 4FR1A 1KM0A 4J7RA 1F9CA 4R9XA 1BGGA 3XIMA 3LLFA 2W61A 1T0OA 4TOQA 3WDRA 4ZEPA 2EG7A 5I3FA 5DCEA 1MYRA 1FRBA 2QF8A 1V6VA 2A3EA 5LSMA 1LRTA 4O1AA 2R1MA 3LPFA 3GNNA 4UQEA 3FJLA 3PULA 5TD4A 4ADTA 4J3VA 2PDPA 4WSHA 2ASHA 3JR2A 3VMNA 3FK4A 2PZ0A 1XLCA 4M7TA 3G0SA 3W28A 3TQKA 3ZWSA 4AZIA 1OBAA 4YMZA 1NOUA 4LUJA 4PMQA 3ZQ9A 1DQWA 4WXZA 3S1WA 2ALDA 4LB4A 3SY8A 5BOFA 1GVFA 3PZTA 1ITCA 4HSOA 5F2IA 1K9FA 3PZVA 2B7NA 1B4KA 3ITTA 3WLNA 1EP2A 4N9CA 1AH3A 4L6DA 3W25A 3MMDA 4MWAD 2WHLA 1JNDA 4Q8OA 3OGSA 4ERGA 1TPVA 5FJIA 3V5OA 1DJQA 3MUIA 1I2RA 1SUXA 4AB4A 5GNXA 3BW3A 3AS1A 4Y9MA 5G5IA 1F6PA 4GABA 3KHDA 3KWXA 2W66A 4JFSA 2J7BA 2WMKA 1RLDA 1OZMA 4C6IA 1NTHA 1W1B1 1XBVA 5DANA 2ZYFA 1V5XA 3SUVA 3F7JA 4Q6XA 4YTRA 1AH0A 1P7TA 3TN5A 4F66A 5EMLA 1JPDX 4IZGA 4HJWA 4BQ5A 3P2VA 3L4WA 4H00A 3CQKA 1OK6A 1QDSA 4X60A 5BNKA 3DHFA 4B2DA 5JH2A 4KGLA 1FWEC 3AXHA 4HB7A 1IEIA 3W82A 3WLTA 1JPIA 3DIPA 2C14A 3FYYA 2WC4A 2I17A 2P8CA 3UY7A 4F0SA 1O4UA 3WNOA 4Z1DA 4NZJA 1H1ZA 4RNIA 2XFFA 1S1RA 1ZTVA 4UZSA 3DEQA 2XUCA 1OCNA 5C54A 2Q8ZA 3W1MA 3EX4A 4LUSA 2VM8A 3T9PA 3DH7A 2FTYA 4M8UA 4MZ1A 4GYPC 3L2LA 4H4IA 3C86A 5KSWA 4YTQA 1I2NA 3TLQA 2DW7A 4WEVX 4AZBA 3GKAA 1PE1A 4TXEA 1HW6A 4GYKA 5CPLA 5CH9A 4Q8NA 3GVGA 3NPXA 4HU8A 4G7EB 2CZDA 3WH7A 2ABAA 3W7JA 4QFUA 1VFFA 4GUFA 3C0JA 4KCUA 2X42A 4QJ1A 3GXMA 1OC5A 2ZCGA 3LCFA 1I9CB 1PIFA 1M01A 1YADA 3EDFA 3THQA 1M7JA 6CGTA 1AD1A 1C8VA 3PPCA 1JFXA 4GD0A 4QG6A 2ZXDA 2V68A 1MEHA 1EJRC 1FWGC 1HUVA 2CKSA 3WQWA 1G7VA 1HF6A 5FEZA 3T8QA 4DO5A 4D9PA 3AISA 3QF0A 5I77A 4RZBA 4E8CA 1NDVA 4IXHA 1FVPA 1RA0A 5DRIA 2ISWA 3WX7A 1XYBA 3GVRA 1P0BA 3VI2A 2FJKA 2ZZ6A 1M7OA 2UY4A 4GCAA 3T08A 4XTIA 2R94A 1XF0A 4F2BA 2OQHA 3OTRA 3RN6A 1DXEA 5AHMA 4EKJA 2PMQA 1G4EA 2X05A 1VFHA 5LIXX 2PC4A 1S3TC 2OT1A 3E3HA 3NQMA 2ONEA 3A3HA 3F1QA 3B03A 4I7VA 1MRAA 3GK0A 1ECQA 3SFWA 5CAKA 5DBUA 4M82A 5J8LA 4HNNA 2QJMA 1PL9A 6PTDA 1JI2A 2CWNA 4L1WA 4RUBA 4G1NA 5A6JA 3AI0A 4ZQPA 2JIWA 1FWCC 3VC5A 4IGNA 2CZEA 4CD5A 1EPXA 3TIMA 5C9RA 4HYWA 3WNNA 4QAWA 9CGTA 2QPSA 3LENA 4ORIA 3T0TA 4ZOEA 3N4AA 1KR1A 5TF0A 3SN1A 4YU1A 3NPVA 2DDXA 8TIMA 1XLKA 1HGYA 2DVUA 3C2YA 5CC6A 3AHYA 3MUXA 1K7FA 3O16A 3WELA 2YYUA 2X1UA 3UXAA 1W1A1 1E72M 3O06A 2DP3A 1D8CA 2O9PA 3AYRA 2ANUA 2X2GA 5IHRA 4S2BA 1W9UA 2JFEX 2ZFAA 1UP3A 3LV6A 2QCHA 3S5YA 3UCDA 5IDZA 3VD9A 3W7MA 2G95A 1OFPA 4US5D 3VD5A 4UFJA 1ITUA 1I75A 5C7VA 2OWWA 2UV8G 5HULA 4FIQA 1GCYA 3IJDA 1RK5A 1LP6A 3NPWA 3SB0A 4LS2A 5CQ1A 4ZO9A 5BWFA 1D2KA 4OGZA 4K3ZA 1I45A 2PP3A 5T9CE 3NJ3A 5K4ZA 3BLIA 4LAUA 3PPGA 3A6OA 2HBVA 1SJCA 4GACA 1CB7B 3I7RA 1BXBA 4Z2HA 4HNLA 5G4WA 3M6DA 3WH9A 4ACZB 1GPWA 2QJIA 3FA5A 4XAGA 3L4VA 1YDNA 3OBAA 4E4UA 4MPKA 3CV7A 1QOPA 2EHHA 2PWFA 1E6SM 1H7PA 5LZLA 1ZBCA 4LVBA 3TMLA 1PBGA 4ALDA 4BF5A 1GKRA 3G1SA 2BZNA 5HAOA 2J8FA 4J2PA 1LUCB 4ZO6A 3IJLA 1GG0A 1KXVA 3CUJA 4FNRA 3W1UA 1A3WA 2J13A 2UZ9A 3BLOA 3CHVA 3TJLA 1UBPC 3CZJA 1CGUA 3A9IA 1JI1A 3O3RA 4H8VA 1Y5XA 2ZZ1A 4JQ2A 3O15A 2RH9A 1EZ2A 3KBSA 4I6VA 3VGBA 3KP0A 1XR2A 3AJXA 5FESA 2D0HA 3RX3A 3BSHA 4JICA 2PU0A 3T2QA 5DO8A 4R5EA 4Y90A 4W7UA 4XZMX 3EAUA 3DC8A 2DIKA 2FVLA 1JQXA 2PTXA 2QCCA 1HJWA 4CNSA 4HIBA 4Y2WA 4XIMA 2WZEA 2C13A 4O1CA 1R3SA 4Y7EA 5CBBA 5DMNA 3B0UX 5LIYX 1CIUA 3W1LA 1VEPA 5I06A 3CUZA 3GDTA 2ZADA 3QYSA 3I65A 2VL4A 4P7NA 2VNCA 2OMAA 1OFRA 2J7EA 3EWUA 1E71M 3DBPA 4W4QA 2RKXA 3TTQA 1LQ0A 3GLCA 4LS1A 1MXGA 1EIBA 1QWGA 2DZTA 4JN7A 1RH9A 3PAOA 4IPNB 3IIVA 4QQ3A 3NM3A 1JPHA 1EX1A 2IPGA 3LG3A 1U22A 4F79A 3FXYA 3WLIA 4MNMA 3QC0A 4M56A 4GGBA 1PYMA 5HXMA 2OEJA 5L9FA 3WF2A 3W74A 1TIMA 3EX3A 3GUGA 4UNKA 4A05A 5I3HA 3HMCA 3K4DA 1IZCA 1GOQA 1IQ8A 1Z44A 4NG3A 3MJYA 3WJSA 3ABXA 4MADA 2A7RA 4HOZA 1A4LA 3BLKA 4PMZA 1UR2A 5JVLA 1YBQA 5JBFA 3I10A 2C91A 4IWWA 5K9DA 4HHPA 3FDGA 4H04A 3GO2A 4YXGA 4GNJA 3WQ5A 4HU0A 3B40A 2DY3A 3OGVA 1XL9A 5JQ9A 1EGMA 2XYLA 3KBMA 1R0MA 4IP7A 3UD6A 1JF6A 4H83A 3PR2A 1XUZA 2X7WA 4KWWA 1QUMA 4RZ4A 4F8XA 1DJZA 2UBPC 5K4XA 3W23A 5EMMA 2IQ0A 1G1YA 1GZ1A 1M04A 1EC8A 5FL1A 1LBFA 2WM1A 1PO9A 4L1GA 5AYZA 2E40A 2EG8A 1K8ZA 2YW3A 3SCPA 1FWDC 3IACA 4A35A 1RQEA 3WLSA 3BC9A 4R9OA 3W72A 3ZR4A 3P7YA 3GTXA 3N3MA 1AZ2A 3UZXA 1K7EA 1R3QA 3S47A 4GYFA 1TO3A 2ACUA 2GJNA 4JN6A 1EJVC 2VD9A 3MB9A 4FX6M 4I9AA 4QXIA 3MI2A 3WH6A 3WQ6A 3V36A 2V9DA 8A3HA 4H9YA 4KS0A 4AWUA 2VOTA 4NAEB 3MUAA 3S2NA 2QCFA 2TPSA 2CLFA 3RPDA 4Q8VA 3LV5A 3W85A 3PZ9A 3OIHA 1FY6A 1QNPA 3VIOA 1BD0A 4GNVA 4K7YA 5BW6A 3HPAA 3RO8A 4DJDA 4MM1A 1WZMA 2P76A 1RD6A 4DM1A 3CUHA 3IS4A 2E5BA 4IFKA 3RGTA 2AL2B 3WK2A 1JZ4A 3TMQA 1W9XA 1CGWA 3T2PA 1TG7A 3WJYA 1EDQA 1W5PA 1IEVA 1XIDA 5REQB 2B4GA 4R27A 1H51A 1CT5A 3EZ4A 1BG9A 4MMWA 5E5CA 2YLLA 2ACRA 4M80A 1GOXA 4B4FA 2DORA 1EBHA 3QXBA 3WCZA 3VNZA 2RAGA 4LNCA 4F0HA 3VFCA 1RA5A 2Y89A 3P8JA 4Z1AA 3GX9A 3IPWA 3LCWA 3THCA 4XISA 3GHSA 3OQEA 4D8LA 3MP4A 4NL1A 1SJAA 4A2SA 4XUYA 1X7FA 4IIHA 1GORA 5H2ZA 3OVPA 1NP2A 4E6MA 2J7GA 3BAJA 1R9YA 4R3UA 1NAL1 1NU5A 4XQ6A 2P5NA 1SR9A 3PUGA 3WQCA 4JQAA 4GO9A 1M41A 1GVRA 5JIWA 4B91A 2ZQ0A 2CERA 1BGAA 3WLJA 3U8GA 2PD5A 3KDOA 4U5IA 1QI3A 4AZ7A 4ACZA 1YIXA 1J11A 1R3RA 3OBEA 1TR1A 1EL3A 1BWVA 1E5NA 4OHQA 2OZTA 1DWAM 1W2PA 1YTDA 2TSYA 2XSAA 3QGAC 3EDKA 3NZRA 1H5VA 4ZXOA 4DWSB 4HGXA 1W8GA 1Q6GA 1AH4A 5DF0A 1PZ3A 1ITQA 2YL8A 1YTKA 2B7PA 3W86A 3OA3A 4QNEA 2F6UA 4D6GA 4GHRA 1J10A 1O12A 3BJFA 3G6MA 2PDKA 3MSRA 3OQ8A 3MKKA 1O5QA 2ZVRA 3EOOA 3LBCA 3ANVA 3GYCA 3L7RA 3BQ6A 3ZSSA 2XVNA 4QX4A 3BJSA 3UXKA 5CC5A 4UIOA 1SM9A 2HK1A 3I3BA 2ZZ4A 3NO3A 3GXDA 3B8TA 4BJHA 4C6LA 5D2YA 3GE7A 4JX4A 1LDCA 3NOYA 4LAKA 5F1UA 4S2CA 3CM4A 3ARYA 1KV8A 4W8BA 1ZZMA 1L6FA 3THDA 1TWSA 1YHTA 1EWDA 4AW7A 4F9DA 3HQOA 3GR4A 1F73A 4K36A 3IUHA 4N9BA 1XH2A 4RPQA 4FXSA 3UETA 5EA9A 1PJ9A 2OZ8A 3VD4A 4QHRA 1KTCA 4HU4A 2WZHA 2RDTA 2YA0A 3W71A 1I2QA 2CCRA 2GSJA 1HXJA 1XH0A 3PJXA 3XINA 3BAKA 3IJ8A 2RFGA 1OEPA 2WVTA 5I2UA 2F8QA 4TO8A 4KGJA 3BAYA 5E9XA 3UJEA 1FWAC 1H7XA 1R38A 4Y96A 2DZXA 4I3GA 4PMOA 4PUMA 4FX7A 3AIEA 2FLIA 1EUAA 1DJNA 3UJRA 1W9DM 2WMIB 2D1ZA 1JDEA 3N11A 2PF8A 5HATA 4CD7A 1MW0A 5H91A 4GY0A 2PGWA 1O68A 3FGCA 4Q22A 1PS9A 1TA3B 2C18A 3GXTA 3UT0A 2JKAA 3VNLA 1CBGA 1VP5A 4B15A 4IG2B 4KERA 2VO5A 3K4WA 3EOSA 2X1IA 5EBAA 2X30A 1WCGA 4PFMA 4IQJA 2NQZA 3MP5A 1L9WA 2A7PA 1J4EA 3S6OA 4Q8QA 1MW3A 1PKMA 1C9WA 1H49A 2VEMA 3MSGA 1ZBVA 4QITA 3MO4A 3WDHA 3PBVA 4G5DA 3GVQA 4ZSTA 3LOTA 3LS9A 3BANA 2A85A 4XG1A 5LIKX 3TTOA 2OEMA 1SO6A 2WZMA 2WMJA 1E1CB 4K6AA 5DCBA 3GTFA 4DUXA 1DHKA 4HZMA 4O54A 4QJ5B 4UCFA 3VM7A 4CQDA 3TUUA 1X8CA 3PBUA 1UR1A 1V6YA 3ANUA 1R6WA 1EGVA 4DB7A 3R58A 1OD0A 3S5ZA 5AYYA 4PCFA 3STEA 3ME3A 4ZQOA 3P62A 2OR2A 1Q6EA 4D71A 4S3AA 1NWUA 1Z8AA 5A6TC 1KXQA 3KUMA 4L4PA 4GIRA 1WUFA 1NQ6A 5H6HA 3B0YA 3TU9A 5DXYA 2CNCA 2XM1A 2A7NA 3K46A 4NZ1A 2PGRA 3HM7A 1K9EA 5CGMA 2PCEA 2QCNA 2VFEA 2YKKA 1Q2SA 1R3WA 1WZAA 3OO2A 1HVQA 4GZEA 3W6LA 5I23A 3SRDA 3T42A 3F4DA 4DF0A 1QJWA 1J79A 2PEVA 4PL1A 3R43A 5REQA 1GVSA 2ZXQA 2QZRA 4JHMA 3N6QA 1Q2RA 3G8EA 8XIAA 2BVYA 4CQCA 2PS2A 1R47A 4LAOA 3WLKX 3UWEA 1TELA 3BLEA 1PCWA 3V1HA 1ZBWA 1R85A 1UWSA 4PUEA 3GSMA 2H6RA 2V69A 1EOMA 3MQTA 3LM7A 1X6LA 3AHVA 4EXQA 1OYAA 4P8VA 1G6CA 1K70A 1BQCA 3H7RA 3W37A 3LQGA 3KW3A 3RJYA 1LORA 1VS1A 5L6UA 4U2ZA 2INZA 3HG5A 5A6KA 4WJ8A 1ECEA 4ZE4A 3C2FA 3NEVA 4Z17A 3JRKA 1A49A 2PODA 3D3FA 3O6CA 4QLLA 3AUOA 1BG4A 3BV4A 2QUVA 1N8IA 3W02A 2PDQA 1VLIA 4Q8UA 3N25A 3BCJA 2C8NA 3TYDA 3QM3A 1PZ1A 1W37A 3SGUA 1F74A 2KX9A 3UNTA 3ABOA 5EMYA 4AEFA 4Z08A 4BEQA 2VWSA 3FJ4A 4UFLA 3BVJA 3N2OA 4ADUA 4R85A 2ZWYA 4DEFA 2ISVA 4K1WA 3MWAA 3SO7A 5JXQA 3UP8A 2VOMA 2PGEA 4XZWA 4RW5A 1QNSA 1FA2A 4ZODA 4O10A 4M3PA 1Z48A 3W1RA 2ZX6A 3WJXA 1TMLA 2X2YA 2Z0IA 1VAHA 1VFSA 2PU1A 3P67A 4PODA 3MUZ1 4ZOAA 1EKOA 5DCDA 1D9EA 1BSLA 5HR7A 1JRCA 3NGJA 3AROA 4I6KA 3AMGA 3I7SA 1H1YA 4RE3A 3EEGA 4CN6A 4JFWA 1YRRA 1B3ZA 5H8UA 1CW2A 1QHZA 3W29A 5E93A 4JQ4A 4OFCA 5I6SA 5D2XA 1JUKA 2D0GA 2FIQA 2DZBA 1WDQA 1XIBA 1BWLA 3PVFA 2HV5A 2RJGA 3FW6A 4HZ6A 1OGSA 3AAMA 4UFMA 4MYAA 1CXIA 1F6KA 1GWJA 4CNOA 2AAMA 4XZHA 4RW3A 4UOZA 5EU9A 1DJGA 1YEYA 1VBUA 2IPFA 3UWQA 4HZ7A 9RUBA 2H3DA 1G4TA 3QY7A 3DAQA 1MFUA 3LHYA 2R24A 1J0JA 2OOGA 3C2EA 1SO3A 3G77A 3G1AA 5F4XA 1PDYA 3RITA 4Z1CA 3M0JA 3QPEA 5HPOA 3T09A 5CSRA 4GYJA 4IFOA 4LB3A 1S2CA 1VD6A 2R1PA 2ZBTA 2JE8A 3NDOA 4GX8A 4AZ5A 1F3XA 1X1NA 5EY5A 9XIMA 4KCVA 1JCJA 3QEZA 3IIOA 4ADSA 1PUDA 3FDKA 4I9MA 4HCHA 1BVZA 2A6LA 1CI1A 5LYRA 2WCAA 3SN0A 2WMIA 3VDGA 3EA2A 1GG1A 3GBEA 3DFYA 2HQAA 2E1WA 2ZUVA 1RY8A 1U5JA 1TA3A 1WBHA 1E6XM 3LRLA 2OOFA 4PFHA 1BLIA 3DG6A 4V1YA 4DM2A 5JIPA 1SU5A 2Y8UA 4IG2A 1GVOA 5BMWA 3FHAA 4NZ3A 1HKWA 6ENLA 3MMUA 4G2DA 3BJTA 2E67A 3SGZA 5BRBA 3SZ8A 3IVTA 4K38A 3WMBA 1MNZA 5FACA 1MO0A 3NNTA 4DPPA 3BLFA 4A21A 2VQUA 5C2XA 1X39A 3AYVA 1XUUA 4DO6A 2OELA 1OGBA 3RDKA 1S3HA 2Q02A 1XLBA 1XRVA 3VGGA 5IBXC 4IQDA 2QIIA 1TPH1 3I6EA 3N1AA 4GWEA 1D3GA 4IMEA 3LTYA 4IQLA 4FSAA 3E12A 1KTNA 1JQVA 1E1CA 2XWEA 3HGRA 1UKOA 2QPXA 2W63A 4DZIA 3CAWA 4ML4A 1QNOA 5ECVA 1W3NA 4C7FA 5AFDA 3JW7A 1SFTA 3C2OA 4IPIA 1MUWA 3S3GA 3PAJA 1XG4A 2F7FA 3EXSA 3B8DA 1ZU8A 2R9RA 3VIGA 3R1ZA 4H9XA 2QJJA 3GIPA 4S3JA 1PTGA 3UESA 3ISIX 1LBLA 4ZCWA 1C90A 1UIPA 4GISA 1X1ZA 5ABHA 4GC3A 5A6BD 3V0SA 2O7SA 4M51A 1Q66A 1ISXA 4GKLA 1FDJA 2W27A 5D37A 5CLTA 3PPFA 1NIUA 4ZB5A 3LPGA 1GOOA 2B7QA 3O07A 2CZVA 3S9YA 4W8LA 3VE9A 5A94A 1OYBA 3R10A 4V28A 4ZXLA 5HWNA 1V0LA 1U1JA 1Y5VA 3SGGA 3VOIA 4AU0A 2GJRA 4HYRA 3G0UA 2YDRA 2D20A 3KLLA 4WRHA 1CXEA 5I00A 2BXZA 4HN4A 2Q3OA 3VYLA 1TUXA 3GR8A 5C8BB 3BOFA 4LUIA 5I3GA 4ZMGA 3VO0A 4PEKA 2RUSA 6TAAA 1I2OA 3GU1A 5A6SA 5C9WA 4RDWA 5AHFA 4UXDA 3IK4A 2C0AA 2MUCA 5KZMA 5LNUA 4PC8A 3DYOA 3HJZA 4IISA 4HTBA 1SMAA 5CZTA 4IP5A 1R3TA 5DT5A 2FB2A 3TOPA 3C0QA 2Q09A 4QS6A 1Z41A 2QDGA 3CPUA 1YLVA 4CU8A 2VC6A 4KFPA 4NNBA 5MKGB 1EF2A 1OG0A 3UZYA 4HU3A 4S3EA 3W1PA 4ZQMA 3GD6A 2HE5A 2JEPA 1LLOA 4UFKA 1UIOA 3SI9A 1RCOB 4QSHA 3VUPA 3EX6A 3N19B 4H41A 2VZSA 4L7ZA 4DWSD 2GDUA 3SDOA 2XZ9A 4IICA 4XD3A 1E6NA 5EMUA 2QQ6A 1W17A 2G3FA 1QK2A 5FCZA 5DMMA 3W2MA 4Z2IA 3PPHA 3EKZA 3B04A 3UG5A 3BDKA 4YTSA 2ON3A 2WZIA 2XN0A 4OKDA 4GUHA 4DAFA 2FH8A 3CO8A 5FJJA 2BDQA 4YCPA 2QDDA 1V0NA 4RL3A 5I09A 1EQCA 1KBKA 4BI5A 3G5EA 4YLWA 4R88A 1TIWA 2E1DA 1KLZA 3KXQA 3OLGA 1L6YA 1XC6A 2CLIA 4EPEC 3QLLA 3CLMA 4D6CA 2E9LA 4P8WA 4LUYA 1TR9A 1MNSA 1XLEA 3LUTA 4GIAA 2XIJA 3O2LA 3GRIA 1S1PA 1UH3A 4GQ0A 2OYLA 4DO4A 4KEUA 3VE7A 3MI3A 1XD0A 1GVIA 1QATA 3FFSA 1QNVA 1UC5A 1UR8A 4H8NA 3L0NA 1XIFA 4REQA 4HT3A 4ZO7A 1EPVA 3N2XA 1GKPA 4JY8A 3RRAA 5A6MA 2FPYA 4AD1A 3FSTA 4QROA 4JX6A 5LGXA 3NUKA 4AD3A 5T26A 5DY2A 4UQDA 4RLIA 1RVKA 2PDCA 3GW3A 3CTTA 2OSXA 1JXJA 3GTNA 1UQYA 3LZ5A 2CKRA 3GDLA 5KEZA 1AW1A 4NX5A 2PTWA 3WBXA 3STGA 4XSMA 1FBAA 3B9AA 3S1GA 2FHCA 3VXGA 4UTFA 4GZJA 1I1XA 1GK8A 3UXDA 1OYCA 5EMJA 4I7UA 3DCPA 3MMWA 3G22A 3MBFA 4LF2A 1E4MM 3USBA 4BF9A 4O1DA 3LNPA 1XCWA 4DLFA 2OB3A 4PCNA 3BGAA 1HO4A 3PJUA 4N4QA 4MHBA 4I9TA 1U1HA 4DJFA 2Y2WA 3CYJA 4DZ5A 4MG4A 2IQDA 3LXAA 3AS3A 3ONBA 1XLAA 3STCA 1REQB 2D22A 1IZJA 2AOSA 3TJ4A 3ONCA 2DUZA 3FN9A 3TFXA 3M0VA 4XO6A 4M81A 3NSXA 3VGFA 2QJGA 1A3HA 2OEKA 2DZWA 4W7VA 1IE7C 8RUCA 1WQ5A 3T78A 2Z4GA 2C79A 2I16A 3NL3A 4JS3A 3EXRA 4XZLX 3UW6A 1XLFA 2G4JA 3MYOA 1RQHA 2Y8KA 2DZVA 4Y9NA 4XAPA 1W1ZA 2A1YA 3LSBA 1C7SA 4AVNA 3NQBA 1XYLA 3ZVIA 4O1BA 1KKOA 2ATMA 1U5HA 3VMOA 3MU7A 3W6MA 5DN1A 3OA5A 1Q6RA 1R3YA 2P3ZA 4WD0A 2BOGX 4BR1A 1QK0A 1YXDA 1OHLA 1V3HA 2GUBA 4D8AA 4F2TA 3LA4A 2DZAA 1F5ZA 4B4HA 3P6LA 5MF5A 2RGMA 3QV9A 4KETA 3UJSA 3GDRA 5F4WA 3W7QA 4HZ8A 5A8OA 1S46A 3GYEA 3RF9A 1I6NA 3GAYA 1XIEA 2UY2A 2VXNA 4UB9A 3FOKA 1UZHA 1GUVA 3FIGA 3QMSA 3G1XA 3O0KA 2CYGA 5HR6A 2NUYA 4RXFA 2NSXA 5EGRA 2GWGA 4S39A 5AHEA 1V3IA 1UZ4A 2D2JA 4JEQA 5F2GA 4LEFA 1Q45A 4PRRA 3G3MA 1MDRA 3W01A 1US3A 2G3MA 1UD3A 4PL2A 3AMLA 3VZZA 1HT6A 3VGHA 2AMXA 3BLLA 4IJCA 4B3LA 1W3TA 2BG5A 3TXZA 3NCOA 1OWQA 1QHOA 1EO5A 4UMAA 3TW6A 1TTQA 1TE1A 2PSNA 1LOLA 1SZGA 3AMCA 1WP6A 3QHOA 3URNA 3LLDA 1E73M 1FWFC 2C7FA 4E5TA 3MY9A 1DJXA 1PWLA 4MYXA 1FXQA 3U2CA 4DJDC 2DSKA 3Q94A 3TC6A 4BHYA 2FGLA 1XSIA 4PTMA 4FLSA 3KVJA 4HHMA 1L8NA 1TWZA 4C91A 3TTYA 5BXTA 4ICNA 2A5HA 1BYBA 1NVMA 4JOMA 4EK7A 1U83A 1POKA 2FVKA 5FSDC 3ZO9A 2XN1A 1OGGA 3EPOA 4HMNA 1UWIA 1BFNA 2O0TA 1C8XA 4LEQA 2JKPA 4JNZA 4JHZA 1K8CA 2XFYA 2WNQA 3PBGA 1UOKA 3VX1A 3W7RA 1RCXB 1WO2A 3KFTA 1A5NC 1VEOA 2ZDSA 3QPYA 4HD5A 4IX0A 5MKGA 1R46A 5D2TA 4ROPA 1UROA 3FYOA 2FHFA 2NXGA 2E5DA 3MWCA 4HMDA 2DT3A 1M7XA 3NQ7A 4Q33A 1ZHAA 1K4HA 4FPSA 3I4EA 2NVDA 4FXRA 5D02A 1MW1A 3BGJA 1XYAA 2VI0A 1UUMA 1YYAA 2FKPA 3GQYA 1Q6LA 7REQB 3IV8A 4AD2A 3C8NA 2QW5A 3DKLA 2V5BA 1OFBA 1NY1A 3N3TA 3BK0A 1CLVA 3W53A 1FP9A 2YR1A 5AZ0A 3GXIA 3TNBA 2RDUA 1EO7A 2CXGA 4IGHA 3OZYA 3LBMA 4G8TA 4H2HA 3ZM8A 1G0CA 1Q7QA 3IVSA 1DHPA 2VMFA 2PE4A 2J7CA 3GFZA 3K1GA 2CXEA 2OSYA 7ENLA 2J4GA 3LCLA 4JIEA 1BYCA 4GJJA 2WAGA 2C19A 3UY8A 4UOJA 1EJWC 4S3FA 2G3IA 1G4PA 4BKNA 3MVIA 3CYVA 3OG2A 1RJRA 3H4WA 3W7HA 4PYSA 1YDVA 3LSCA 1XRTA 3EB2A 1LF1A 3PG8A 5LXEA 1M9HA 3R0KA 1JCTA 3TSBA 4DELA 3GXFA 5DRCA 2EJ1A 1AG1O 2OFJA 2YDSA 4JDBA 4K8EA 1ADDA 2W92A 4GI6A 3H8AA 2DIJA 1FKWA 3LPPA 2NUXA 2WLYA 3W7OA 2W91A 2GDQA 2G0WA 3QY8A 1PYFA 3LPOA 1TPDA 4E8GA 1FWHC 1KV5A 1GQNA 2QLYA 4CCCA 1UYQA 3BAWA 2V5JA 1W2VA 1E5JA 1SFJA 2A21A 1ZJIA 2L5HA 4V15A 1F05A 3RILA 1XBXA 2V2CA 4EWND 4AD5A 2Y88A 3GH4A 3H70A 2DJXA 3VKJA 2QGHA 2RJHA 2PAJA 4UTTA 3TAOA 3V35A 2PUZA 3HZ3A 3UCQA 3G1FA 2NW0A 3QLDA 1F8IA 1WE5A 3B9DA 4MWAB 2E9BA 4QSFA 2YL9A 3TCEA 3SAZA 3EA1A 1GZGA 4KQNA 2ZE3A 4KIRA 3CGTA 5U4NA 4WDUA 4ZA0A 1FWWA 4OOZA 1SZFA 1OCQA 5H1WA 2Z6JA 3MANA 2EQDA 3C2VA 3UPWA 4K39A 4O1EA 3WNLA 3FEMA 3B4YA 4LWWA 3IIXA 3MBDA 1GZJA 4U10A 3POCA 2W9MA 3BH4A 4LYPA 2PDIA 1QCWA 5GNYA 1VPYA 3MS8A 2ZZ2A 5FEXA 3UEQA 1P0DA 1LOQA 3NQGA 3UCCA 2WPGA 4U3AA 3U57A 3KHJA 3MZNA 2VUYA 3BOLA 3L5MA 5AY7A 2PWEA 2NLIA 4CVWA 4LANA 1E4NA 3BE7A 3W6YA 4KRUA 2YGYA 3F5LA 4X9YA 3V0TA 2QKFA 4DBEA 5IFPA 2QIWA 4MB1A 4NILA 3GH5A 2QUNA 2O56A 1ZUAX 3VD7A 4W87A 1S5VA 4DXVA 1S38A 1R3VA 3CQIA 4K8HA 4AWEA 3TR2A 2YXOA 1JD9A 2VTFA 3P93A 2OT0A 4JL2A 1KFJA 4US6A 3D3AA 5D8ZA 2VFGA 2HRWA 5E6ZA 1ITXA 1AL7A 5JBEA 3GR7A 7TIMA 4JTHA 1JG9A 2YCLB 3A24A 2EKCA 5G4HC 4N4PA 4A3QA 3CZKA 1XYFA 1WXYA 4A3YA 3IGXA 3HPZA 1ZFJA 1L8PA 3DU0A 3UXIA 3GY1A 3IWPA 2XIMA 3OPSA 4Y9AA 4CVUA 1AMYA 1KB3A 3VILA 4DBUA 3THAA 2G50A 4N7QA 4DF2A 1ME7A 2ZRZA 3CL7A 1VF8A 1QOXA 4O8RA 1CXHA 1TRIA 1Z6KA 2YIHA 3TROA 2O9OA 5GPRA 4A29A 4LRTA 2VGBA 4PUJA 2VD8A 3EPNA 5XINA 2FVMA 3CHEA 2EPLX 3WLMA 3BG9A 4J35A 4FLQA 1OVDA 2NXHA 1SPQA 3E0VA 4W5UA 4I5XA 1KFBA 4A2RA 3WH8A 4GJIA 3VIHA 1RAKA 4XZNX 1TV3A 5I3IA 5D9NA 3EWDA 4EIVA 1EJSC 3EDEA 4TVDA 1EDGA 3S42A 1PX4A 3DFPA 3NXLA 1S39A 4RCXA 1A5MC 1OF6A 3R2GA 4E4PA 2GJXB 3QC3A 4OIFA 3M1ZA 2Y62A 4PMXA 2A6NA 4MJZA 1XD1A 1JUEA 4H9VA 3TAKA 5M03A 2X09A 2WSYA 1K1DA 1CECA 2W5FA 3MCNA 1IWPA 3DGBA 4GX9A 4M6UA 4AMAA 3PSVA 1O5KA 5FJOA 4U5KA 3RU8X 1KGUA 3D5HA 1O1HA 3GHTA 4Y9OA 3NO5A 2WKLA 1GJPA 4YJ5A 2Z1SA 5F7UA 4MY9A 1AJ2A 4E2OA 2IUZA 4OVXA 4O19A 3SSJA 4K37A 5B7YA 3FAXA 1HP4A 1TFVA 1XYMA 2XISA 4NZ4A 3IGSA 4UTUA 3EX1A 3PHAA 4GBUA 4ILSA 5D38A 1Q6FA 4H2CA 3T05A 2VC5A 2HXUA 7REQA 1NFPA 4POCA 4CD6A 3KTXA 1UH2A 1O1ZA 2Q6ZA 2WVVB 2WKJA 3WQVA 2Q8LA 4EP8C 2FH6A 1OT1A 3K8MA 5DY3A 2PDWA 2X8RA 1ONXA 3R8GA 1DV7A 3AUJA 1WOBA 1W31A 3LCIA 3VDCA 1LT7A 1TYGA 1PIGA 3VAVA 5LA0A 5FL0A 1K6AA 5HDRA 3HPSA 4AWSA 3LLXA 3DKJA 2ACSA 2ZUMA 1KCKA 3O7UA 3NEHA 1I1WA 2YLAA 1UWQA 3P3BA 1XG3A 4Q32A 1QWKA 3HOJA 1FWJC 1KNWA 1VPXA 4JKMA 1GHSA 2P0OA 3BO9A 4H9TA 3A4WA 4UTJA 4DY1A 1E0WA 1KFKA 3RX4A 1T41A 1XKYA 1D7FA 1KRMA 3CV2A 1J0ZA 3KCLA 4JFVA 1RJPA 4ECLA 2CHRA 2V82A 3WFAA 2BX7A 3H2FA 2VZOA 4FNUA 4DBSA 1WKDA 1X96A 4J4KA 5IDIA 3CC1A 3RX2A 2OX4A 4U33A 3UYIA 4FK9A 3R79A 3WK3A 1US0A 3S6DA 4NXSA 1QPNA 4MPQA 1I8JA 4KCTA 3W73A 3UZJA 1H3GA 1IV8A 3TJIA 4NY2A 1CENA 3SCUA 3C52A 2Y8VA 3TQPA 4WGXA 3CASA 4E0CA 4DVOA 1JPKA 4MWAA 3NVDA 3N6HA 5DMYA 1XIIA 4OU1A 1UD5A 3CAKA 3CMJA 2VQTA 2QCEA 1VFMA 1NDYA 4X2RA 5EPDA 4JAWA 1CWYA 1QTWA 3TW9A 2NLYA 2E09A 4M29A 2ZUTA 4MIMA 4JTUA 4UWMA 2ZICA 1XCFA 3MTWA 1KM5A 2XVLA 2I5IA 3ARTA 3BQ5A 4H9UA 3I3EA 2A2IA 3OGRA 3H53A 1Q7ZA 3CAVA 3CEUA 2X1TA 4YYCA 1VB9A 3I6RA 1ADOA 4N9EA 4QS5A 1Q6CA 1B90A 1HKKA 3SCSA 1WDWA 4UR9A 2QGYA 4MLJA 4JXCA 1K7XA 4PULA 3EWYA 1W56A 1HVXA 3LTPA 5EL1A 1B1YA 3R7MA 3TP4A 3ZJKA 3SBFA 3WO8A 2OPJA 1UKTA 3KP1A 2F84A 5HINA 4QM1A 2C71A 2P88A 4DNHA 3N15A 1L6SA 2WQDA 1X97A 3NIYA 3W1TA 4JTGA 1JZ8A 3M5YA 1Y5WA 4DZAA 2YCLA 3UPMA 5D30A 3AS2A 4O57A 1QNQA 1TV7A 3K4AA 3G1HA 4DYEA 3OVRA 1UKPA 4M6VA 4J3XA 1S2TA 5AKQA 1M1BA 1XYCA 1BYAA 3KL5A 4H01A 4IGMA 4JZ5A 4DUVA 3HV9A 4F48A 3U2ZA 3TYCA 1AK5A 1DVJA 4ZTYA 1EIXA 4Y8EA 2Z7GA 4JN8A 2BY1A 2KZHA 2BVDA 2DQWA 5I24A 5E9AA 3EBVA 4AMCA 1X6NA 2J75A 3MYPA 4K2SA 3LY0A 2V30A 3NQEA 4WJEA 4QG8A 3Q58A 4QEEA 4QR6A 3KTCA 1DQXA 4W8AA 3EDDA 3L2MA 4A3RA 4D6FA 3VM5A 2WNNA 5F1VA 1TZ9A 3T81A 5H8MA 4LQ1A 2GQ9A 4AZHA 1NEYA 1UHVA 2FZMA 4UNIA 3W2UA 3T6CA 2Z27A 4OUEA 1TSIA 2JIEA 1VZWA 2QCDB 2O7QA 2INEA 5AHNA 4AEEA 4KWVA 1ICQA 3DGRA 3ANYA 1RZMA 3CWOX 4TIMA 1H1NA 3E0WA 1PB0A 1Z42A 3O6YX 2CBVA 2YZ5A 3WLQA 4BI6A 3AYTA 3PWGA 2DT0A 4AZGA 4N6EA 3VGEA 3TVAA 2DUAA 4LPCA 1OB0A 4CNNA 3FAWA 2Q01A 4BK9A 1SO5A 5HMSA 4OV4A 2YBVA 2UY5A 2NV2A 3WUEA 1Q4NX 5FKYA 4DI8A 3L12A 3PBWA 5AC5A 3PZIA 5IRPA 1QMLA 4XX6A 1DJYA 3TN4A 6ALDA 3K5XA 2ZRWA 1RBAA 2GQAA 3ES7A 2ZA3A 1C93A 1ML1A 1OC6A 2CBUA 1CNVA 1W1PA 1W9BM 3DZ1A 5HJYA 3C2RA 2DH2A 1PX8A 4AIUA 4ENLA 2VT0A 3L68A 3LXCA 5KETA 2WVVA 1DWGM 1F3TA 2OWCA 4GRSA 2X7VA 1EHNA 1XGZA 3N9KA 3AU6A 1ZJHA 4S38A 3VOJA 3S8HA 5GNZA 2ZX7A 1R87A 2G41A 1QASA 2JF6A 4GUIA 5LGZA 4AC1X 4AHPA 3RJXA 2OXNA 1J2WA 1YE6A 1VJZA 3R13A 3WFZA 2ZDRA 3WD3A 3M6YA 4W89A 1BKSA 4DLMA 1OADA 3Q4DA 3UWYA 1K3UA 2W62A 3T4CA 2HE8A 3EOEA 4US5A 1W5QA 4JR5A 1KWGA 2CLEA 1NH6A 1EEPA 3VKKA 2VCAA 4J3WA 3BPWA 3TEVA 5BMXA 4YWIA 4NUWA 2VX4A 1OF8A 1JGIA 1KW1A 3R89A 3LCGA 4C60A 2E3ZA 3TDFA 1H41A 4MAVA 1V51A 3UJ2A 3VZXA 3W1QA 4NZ5A 3EYPA 3VNYA 2G37A 4UTHA 3L4ZA 5HMDA 3ZXWA 4JY9A 4XD4A 1KXHA 1EJXC 5LNVA 5D09A 3BAXA 2Z1KA 2QJHA 1H62A 1HTIA 1OSEA 3GDMA 2AGKA 3M43A 3MUY1 3WFLA 2RGLA 3DI1A 3GNRA 7CGTA 2Q3RA 1OIFA 1UPPA 4Q3MA 1TCMA 3OW1A 3F4WA 5FEPA 3LX9A 1JAKA 1ALDA 4AZ6A 4YWSA 1US2A 3N14A 1KFWA 3CNYA 3F2DA 2WMHA 3P82A 4GYPA 2QXWA 1JPMA 4K68A 2W3ZA 4TX9A 3T7VA 3NZ1A 1M68A 2J79A 1T96A 1EQPA 4UMCA 1PTDA 1XM3A 4WDTA 5CPMA 3UR2A 3WDPP 3VTRA 4LJ3A 3NL5A 1DIOA 1VYPX 4CQ8A 2PP0A 4HCDA 3HBLA 2Y4SA 1V3MA 3M7WA 1E0UA 2CLLA 4M7SA 3ORWA 4JGDA 3N73A 2BOFX 1N7KA 4EANA 4MZ8A 1R9XA 4JQ3A 2Z26A 3QJAA 3TW7A 3EXTA 3UWZA 4YCOA 3O63A 2C3ZA 4XKMA 5DLCA 3WN6A 3JU2A 4O13A 2PDHA 3M5ZA 4NI3A 1A5KC 3W00A 4BS0A 1V3LA 2VZTA 4J9JA 2O92A 3W27A 3QV6A 1XIJA 2QYGA 4XAYA 4A4AA 2YFOA 1W9VA 1UWUA 2QUMA 1VYSX 5M3WA 4NF7A 3HG2A 3UQNA 3LHVA 3W38A 4C6PA 4Q6JA 1MUMA 4JYDA 2FPTA 1ZP4A 3QW3A 4XK2A 1DWIM 3AMKA 1A5OC 4B3ZA 5IM51 4MY8A 4O8AA 3ITXA 6REQB 1IGWA 4RPPA 2OWXA 1JCLA 4JTJA 1TVPA 3OP2A 2NX9A 3RG6A 2DU2A 2GVGA 5FOOA 1FDYA 2E77A 2DZSA 1XISA 3HIJA 3RM4A 2WBKA 3TN6A 3OVQA 1XC4A 1M53A 3L0GA 3NR0A 3VA8A 3OVGA 1C7TA 2DV0A 3U2OA 1XINA 4PMJA 2EPKX 1F3EA 1QW8A 2YCEA 2GDVA 5CAHA 4C1NB 1A5LC 3PSWA 3HA1A 2YA2A 3CMGA 1QO2A 4R7WA 3ARXA 2B0MA 1H0IA 1GVQA 3BAIA 2WJEA 2Z1VA 3TYZA 3PBMA 4IMCA 1VGAA 1PAMA 4L1XA 3A13A 4BQ4A 1XDMA 2VFDA 3GWQA 3B8IA 2NSOA 4PCSA 4W9TA 4XZBA 4INFA 4Y9PA 2F9RA 4S3DA 5XIAA 2J66A 4HN8A 1K03A 3KVLA 1IXPA 2DEPA 3B97A 3W7LA 5LIUX 1JVNA 1QBAA 4FLRA 2H90A 1BVNP 1RUSA 1ME8A 2YCKX 4GIYA 2VUNA 3S2JA 1TV4A 1FQ0A 3NQAA 4HNUA 1VRDA 1FHLA 3CH0A 4KBXA 3OLDA 3C0LA 2VDIA 2VVNA 5U7SA 2VGGA 2XFWA 3U3HA 4DIAA 5AC7A 1KBIA 4RE2A 2VEFA 4AXNA 3MV01 1XGEA 1W1IE 1VFUA 4FR6A 2BXYA 3MT1A 3VD3A 4P8UA 3B3DA 2XVKA 4PRTA 1GPFA 2YB4A 3M4HA 3PN8A 4FMVA 4CCEA 3WY1A 1XLJA 2I5QA 1G67A 1PSCA 3DI0A 2OGYA 1UKQA 2PTDA 3LHTA 4QLKA 2Y7EA 2Z2UA 2NUWA 1EA0A 4Z0JA 3BLPX 1F3WA 2YB1A 4D1JA 2PLCA 3TOYA 4BA0A 5FF2A 3CV1A 1PZ2A 3S2CA 1AQMA 7A3HA 1VENA 3OG3A 1JXKA 2O55A 1QI5A 4ZFMA 1Z9AA 4H7ZA 1E3ZA 1LWIA 1MVYA 3PF3A 4MOZA 4YN5A 4KWUA 2ZA2A 2HS6A 1OCJA 4M1BA 3ATYA 3H2CA 2QEZA 1R7AA 3W2KA 2J78A 2FZ9A 1V0KA 3ARSA 3U9IA 3DHPA 1NWRA 2I9UA 1AQFA 1TQJA 4O50A 4ERAA 3QFWA 5A8QA 4HP5A 4LUTB 1G4SA 1XGDA 1J0KA 3W1XA 3NZQA 1XS2A 2YBUA 1AW5A 3GC5A 4Q4QA 4WR3A 8CGTA 2OLHA 4D6DA 1QHPA 3UZZA 4H1ZA 1A53A 1EGZA 5A8PA 4XB3A 2JBMA 4GOAA 1ZY9A 5J04A 3QMRA 3H2NA 2PCQA 1HKIA 3UU0A 3UF9A 4JDYA 3IAQA 1Q7MA 4X9SA 4AIBA 1UR3M 4CCDA 3B9NA 1GW1A 4LT9A 1MDLA 4C6FA 1WDRA 5BXPA 1KCXA 1JZ2A 3M0HA 4KIEA 2VC9A 2J88A 1J6OA 2OODA 1ISWA 4DYJA 1PWMA 4DI9A 1XRSA 1S2VA 4O0ZA 2XGBA 2WKGA 3H2MA 3C5QA 3ALGA 4OTKA 1KCLA 5BXSA 3PY2A 3U7BA 1FHVA 4UQCA 2WXDM 4KEZA 2GGEA 3VOHA 1A0DA 1W9PA 2H3BA 1JCXA 3GNPA 1JCYA 4LXFA 3VDHA 2XZ7A 4X2PA 4NP7A 3CHFA 2WZTA 3S2LA 4LBUA 4IOTA 1GVYA 4Q4RA 3E0FA 3GNOA 3L21A 4FF7A 4F9JA 5C9XA 3TR9A 3MJMA 2HS8A 1QVBA 4HMCA 2NX3A 1XDLA 1KA9F 2HNEA 1F07A 1DXFA 2ISSA 2A4AA 1TWWA 3QR0A 1BF2A 3VCRA 2QULA 3WEMA 3WQDA 4YPJA 1CB2A 2FDSA 4W93A 1KM4A 4N42A 3G1DA 4MNLA 2E6YA 3S9ZA 4LF1A 1GJUA 2Z6IA 3PWIA 3WLRA 2FTWA 4IIDA 4XBKA 4JFTA 3AIUA 4GZ7A 4AY1A 5HNNA 3Q67A 1KO0A 3CTLA 3RFAA 2W67A 5AZ1A 3NG3A 3L67A 1LBMA 3U5YA 5F4SA 1OFAA 3U6WA 3V75A 4GXWA 1VHCA 4PE8A 4J40A 2DSZA 2BOEX 3I7QA 1TJ2A 4UR7A 4WUIA 1ODZA 1TMQA 1R2TA 3HMJG 1IHIA 4C6DA 5K2ZA 3GTHA 4CNPA 1UR0A 4OUIA 4X3ZA 3CXOA 3R8HA 3APYA 6REQA 3KS6A 5CGQA 4A8IA 1X38A 4JYEA 1EFZA 3FYPA 3WK0A 2V5LA 5AHIA 1E55A 3ALFA 3HFTA 3H12A 4Q7BA 1EJTC 3M0MA 1L0PA 1UA7A 3VC6A 3N04A 1TVNA 2Y24A 4PBGA 3RO6A 4G7EA 4IL0A 1HJVA 3AS0A 3MHFA 3N13A 1HX0A 1N82A 2XU2A 3TKFA 1W32A 5CSUA 3P0XA 2PLKA 1LL6A 2PA6A 2X0SA 3IV3A 3MI6A 1UWRA 4IP4A 1NJJA 3CZGA 2D3LA 3G3DA 3M7SA 1RSCA 4PCPA 3EWZA 1DWFM 3ZLGA 4HK6A 4GY7A 4C1NA 1NARA 1D8WA 4MNJA 4QIUA 1DIKA 4QLJA 4YYFA 3ICJA 4LV4A 2JF7A 3WBYA 3KBVA 5DXXA 4FALA 3SADA 2DGAA 4RKAA 4S1FA 1OX5A 3BURA 4FEZA 4HK7A 4ZQCA 3T44A 3ZFHA 3SCOA 4KF1A 2J7HA 1ZCOA 3ITOA 1LT8A 1T5AA 1LJYA 1J93A 1AD4A 3KLKA 3CAQA 3CUIA 2H8XA 1X6UA 4C65A 3E1F1 3UR5A 1J9YA 4PTWA 5C9ZA 1PXGA 3BV7A 4MSSA 1PKNA 3IGHX 3W2LA 4GI4A 2Y70A 4J3SA 1HL8A 2GJPA 2PWVA 1HL9A 3JVAA 3G24A 3WBAA 4QAIA 2XTKA 1MFVA 1OC7A 1AFSA 2KAUC 2V5CA 4HK5A 5K7JA 4DBDA 2PTZA 4PMUA 1X7IA 3N6JA 3TJXA 4JTDA 2ZRUA 4JIPA 5FI8A 4H7VA 4QP0A 1B3OA 3WDQA 2D3NA 5E0FA 2ATSA 5DX7A 4ATLA 3HN3A 5FJTA 1LL7A 2BVWA 2VGFA 1ZL1A 1YNPA 2X41A 1UD8A 2PP1A 1JYVA 2ZXBA 2YJQA 1JZ3A 3P74A 2R91A 2OYMA 4O4VA 4X0NA 2ZZ3A 1SO4A 1B30A 4ZO8A 4PMYA 3WUFA 4GFSA 2XN2A 4N6FA 3AXMA 2EJAA 3ARWA 5HOSA 4GY1A 4MGGA 3FS2A 5T9BG 1KBLA 1B0IA 3ARRA 2GVLA 4G56A 1UP2A 5A8GA 5HANA 3TFCA 4GO8A 4NZFA 3IAPA 1UG6A 1LZOA 3OYXA 2VFIA 1ENUA 1F4HA 3M47A 3K1DA 5EYWA 5EFDA 3NL2A 2HK0A 4R7OA 3A4AA 1JDAA 4LUTA 2OQYA 1NDZA 1PKLA 2V2HA 3CT2A 3UVIA 1EA9C 2J8TA 3P80A 4J27A 5HUOA 3W7IA 4RR4A 4LRSA 2WB5A 2CIPA 2E4TA 3BWWA 3R94A 3U4AA 4NT0A 3VK5A 3B9OA 2R8WA 3OLIA 3ZR5A 2FMOA 4X63A 3HV8A 3II1A 3CHCA 6TIMA 1LWHA 3H22A 4C7DA 5BU6A 1OINA 4NJKA 1UMLA 4DJEC 3IK2A 4AIOA 3L65A 4NAFB 7ODCA 1IEXA 1MEIA 4JTKA 4E3TA 5A6LA 1UPMB 1BYDA 5BXRA 3IUIA 2CESA 2GK1B 3OB8A 4I5RA 1C8QA 4P7LA 3SCRA 4WDXA 3Q65A 3RPTA 3OBKA 4G9PA 1LUCA 3ID7A 1EWEA 2YFNA 4ZGYA 4C6NA 4EPKA 2ZE0A 3CJPA 2XH7A 3PS7A 2VCCA 4HOWA 4RNFA 5A2BA 4GH1A 3AIQA 1NOFA 4A8RA 1F8MA 3WG6A 2V81A 5BZAA 1PTAA 3V4BA 3OHMB 2O4MA 1E70M 1JR1A 4JCLA 3OLEA 3PNZA 4PTNA 1AQ0A 3CZEA 1YTEA 3P5YA 3DECA 3LN3A 1JJKA 1E56A 1ZJBA 4UTKA 4HNCA 1BPLB 1V7YA 5E1QA 1ZSXA 1F6YA 1PPIA 2ZX8A 1HJQA 3G6LA 2Y85A 3GHUA 2VENA 5AN7A 3SQMA 4MWAC 1GKQA 3SCTA 4LUSB 2PPGA 4NQ1A 4O1FA 4AIEA 4HPGA 3DG3A 3V0UA 3BW2A 3URAA 4IIFA 4GVIA 1KQYA 4EACA 3H2OA 2J6VA 2CHOA 4AVOA 4EAMA 3EMCA 4JTTA 1YQ2A 3NPUA 4GINA 4JIQA 1DJWA 4PEEA 1E9LA 2ZUSA 1ISYA 5HNRA 1WXZA 1YPXA 5FF3A 1LYXA 5FJRA 1OFEA 3ZS4A 3GXPA 1AJ0A 3QKZA 2VDGA 3AMDA 4IT1A 1TPFA 1P1XA 2ZZ7A 1XRFA 4W88A 2DSWA 1UBSA 2Y63A 4BWLA 2G5WA 1B3YA 4WY0F 4P5UA 1UOZA 3GG7A 2B81A 5G2IA 1C8YA 2FZBA 4F0RA 1JYWA 3F4CA 3QZAA 3RM9A 3S1XA 4DPQA 1E4LA 3BLDA 3KTSA 3TX9A 1P5BA 2DUXA 3OZPA 5HMFA 3M16A 4AHOA 1QNRA 2G8ZA 3E2SA 4W86A 4NHVA 4QTGA 5BRPA 3DBNA 3F5KA 3ECQA 3SRKA 4CQ9A 4HSNA 2PDUA 2WJFA 3OZOA 3VIFA 1JZ5A 4CU7A 3LNMA 3RIKA 1WDPA 2PURA 3QR3A 2NV1A 1EDTA 1PCKA 4O0QA 1P6WA 5LHFA 3WNPA 5HQLA 1LG1A 4MWAE 2RHGA 1GYMA 4V27A 2FZDA 3UPBA 1RALA 3V1PA 1FH9A 3KL3A 3PJTA 2NQJA 1A5CA 2PDFA 1H61A 2C6QA 3E49A 3W7DA 4JD4A 1B3VA 1XFCA 3AO0A 4MLRA 3T0DA 4B5SA 4CQAA 3TZFA 1BSIA 3R6IA 4MKVA 4PTXA 3NQ6A 2VVSA 3VFLA 3WLOA 3STPA 1MW2A 2BHUA 3A22A 3PZGA 1FWRA 3E2RA 4RX0A 1UKSA 4BI7A 1H5YA 3ZMRA 2D0FA 4UQBA 1RPXA 4L9ZA 1ONRA 4NAEA 1MMFA 1SZNA 3PANA 1RHCA 3SM0A 3UGRA 3QZEA 1ZQ5A 4XZIA 5A6BA 3WQPA 4Q8PA 2QV4A 3VIJA 5A6AA 4N2YA 2BGSA 2QHAA 3FLUA 1X8FA 2FFCA 4DJED 1KRAC 4KH2A 3T0BA 3VKCA 3GM8A 1MI3A 1TV5A 1U1UA 1J6PA 1LTDA 4L6HA 1SW7A 1CGYA 2AL2A 4WSJA 3E74A 1S2UA 3LK6A 5EBUA 1EOKA 1ZS2A 1V03A 1XLMA 4ZZ9A 3H54A 3UERA 4B16A 1E9YB 2XIOA 1O60A 4H6RA 3CPRA 5XIMA 4S3KA 4GLEA 1HKVA 3AYSA 4ES4A 2H8ZA 4LS0A 1DP0A 2Z1BA 4FOKA 3BUVA 1YKWA 5JUVA 2NZLA 2YBTA 5CGTA 1T40A 4WKFA 5M5DA 3LHWA 4OBTA 2Y5EA 1B3WA 1RD5A 4GCXA 3CLWA 3QQ1A 3MPGA 4RNHA 4LSBA 4V33A 4WX2A 2FQIA 2PRLA 1EP1A 4RZ5A 1LLZA 3GBDA 3K2GA 2HVOA 3W7GA 1LRNA 2F6KA 1VBRA 3WD2A 4H7CA 3RCYA 4KPLA 3TTEA 2YA1A 3O0FA 1VIWA 4DUWA 1VFOA 1GEQA 2Y5JA 4M6QA 1XICA 1VKFA 1WB0A 1UP0A 2J27A 4X61A 1J5TA 1GOWA 4LV9A 2Y6ZA 3FJ6A 2X0HA 3WMCA 2HROA 3I68A 2D24A 4NAFA 2HVNA 1J0YA 3NTYA 5A2AA 2AMGA 5D8WA 5H8PA 1RCQA 3PZOA 2A3CA 2WNZA 3F2BA 1EJUC 1XLLA 3F4NA 4LCSA 2GK1A 2WSRA 3G8RA 2AQVA 4DWSA 2XINA 1IIHA 1S2WA 1T8QA 4KFNA 3UG8A 2VX6A 3N17A 5I03A 4DHGA 3LGDA 4OE7A 2ZUNA 5C70A 2OU4A 1H0GA 3WSUA 4TU1A 3W75A 1E43A 4KWSA 5A2CA 4D6EA 4E2BA 1UC4A 4PB4A 4GIEA 2NQ9A 3SUSA 3ATZA 3WYZA 3WJZA 1YDYA 3RCMA 2TODA 5J5DA 1BWKA 4E3VA 4KMQA 2D69A 4QE1A 1M6JA 5C9UA 3T0AA 3SY1A 4CUCA 4WJXA 2X40A 1TPC1 1EF3A 1O66A 2PBOA 5E6YA 3RUBL 3DDMA 3LMYA 3LERA 4C6QA 4YL2A 2HBXA 1JDFA 2ALRA 2NWRA 3RU6A 1DKWA 3VVGA 2YDQA 4AC7C 3NQCA 4Z42C 2FPVA 2PC8A 4KRZA 5IBXA 1YBQB 7PTDA 3LTSA 1E9IA 3OEXA 5G1YA 2XPKA 3AWOA 4NYYA 1ZAJA 3D47A 3QGVA 1P43A 2HDJA 2OZ3A 2QUUA 3L66A 1VFTA 3K30A 3GNDA 5GJPA 1W3JA 3VABA 5LHEA 3LQLA 3SCVA 1Z3NA 2IW0A 5FF7A 2F38A 3HPXA 1VCGA 3N4EA 5I78A 1FCQA 2RDXA 3W81A 4RXGA 1U33A 4Q4MA 1XQLA 3SUTA 4LBSA 5FIPA 3FJNA 1LM1A 1MEWA 2FDMA 4FNQA 3TSMA 2E0PA 2ZC1A 2OCZA 1XIHA 4PR4A 4WSKA 3F03K 3KZSA 3C3NA 1MQQA 4B5TA 1BXNA 2OO0A 4E8DA 2J9YA 1CX9A 4BF7A 1XI3A 3WIJA 2D2GA 4MDPA 3L4XA 3WDIA 3FKKA 3VZYA 3HQPA 4D1IA 4MB4A 3VNJA 1K9DA 3SEPA 3NO1A 4NKCA 2O9RA 4U28A 5I7GA 1DJHA 3POHA 3GKFA 2OZ0A 3WNMA 1EYWA 1V7AA 5EFFA 3A47A 4TMBA 1RPKA 4CGTA 2V2DA 3O9NA 4LC6A 1W91A 1RBOB 4LTSA 3A12A 4YHEA 3V3WA 3B8UA 4AF0B 3WK1A 3HJEA 3NQFA 2B31A 3AHXA 2MANA 2BB0A 3SJNA 1N2VA 1FXPA 3CUGA 2QUTA 4AUBA 2DQXA 5E09A 3W7KA 4WY0B 1ELSA 2QS8A 3IJQA 3QGKC 4X22A 3QYQA 2CBJA 1SVDA 3N34A 4IFKB 3EKGA 4JTLA 1JCNA 1SW0A 5E0KA 4AZCB 1V6XA 6A3HA 3OHIA 1IR2A 3LGEA 4JQ1A 5HNTA 2DZPA 3F5JA 1FWNA 1I2PA 1AQHA 2HPMA 1JDCA 2FHBA 2VFHA 2XIIA 1P6BA 1W1TA 2UWFA 1DOSA 1FFRA 1R86A 3BG5A 1VEMA 1W3HA 3IRSA 3WUGA 5KZEA 1TMHA 2JGYA 2VGIA 3SQLA 5CZSA 1C92A 1T7LA 3H26A 1WX0A 3I4KA 3RLGA 1O5XA 1E4IA 2WHMA 5CPTA 2WNWA 5TNVA 2O9TA 3C61A 4MDOA 2I5GA 3TXVA 3GVVA 3PTMA 3GIQA 5HJLA 4A3HA 3DFOA 3UG4A 1A5AA 3S5NA 2WCGA 3LRKA 3WMLA 4QJ4B 2YL5A 3T55A 4HNVA 2D23A 1C29A 3DERA 5IFTA 1QI4A 2VEPA 1AMKA 2P1FA 1ZGDA 2PDLA 3O6DA 5FEWA 2PWUA 2DT2A 4UR8A 5I0DA 2ZX5A 1Q6DA 2IKGA 4QG9A 1UUOA 4QEHA 4FNPA 2BWGA 5CZJA 4NJGA 1A47A 3H21A 4CEXC 3TCSA 2YXGA 2QJNA 3TQVA 1O7AA 2JK2A 3TA6A 3STFA 1R2SA 4XVDA 1MSSA 5FA5A 3W07A 1ZNNA 2Z25A 2EPNA 4IXXA 4WIWA 1RP8A 2D2HA 2ZWZA 3DXIA 4HNTA 4PTVA 2YX0A 4ORMA 3P14A 3CK5A 2A3LA 1VBGA 1FH7A 2BY0A 4ZOBA 4AD4A 3S1UA 1CGXA 4PUDA 4IIBA 2WSKA 1BQGA 4CNUA 3A23A 3GZAA 1UJQA 3MCMA 2CLHA 5BROA 4WCJA 2CLOA 3XISA 1P0NA 3PM6A 3MV11 4MAZA 3SIMA 2CU0A 1K8XA 4OWGA 2WHJA 2BHZA 2V38A 1EXBA 4HNOA 1PEZA 1XCXA 3KRBA 3QMTA 5TBOA 3UWVA 2VWTA 2R82A 2QDHA 3MKCA 3WF1A 1GT8A 1VLWA 4I5UA 4JCMA 1S5MA 4O15A 1LRQA 2VEIA 4DZHA 4D2JA 4XSLA 1Q63A 1GJWA 3BL3A 1X1OA 4JTQA 1OK4A 3V18A 4F3HA 3CUXA 3S46A 4GA8A 3UA3A 1AL8A 4L4LA 1H50A 4MB3A 3HB9A 2E8ZA 2QVHA 3PUDA 4O53A 1WKFA 2OLSA 3W1NA 2BBFA 4IPLA 5E0CA 5GJNA 1CLKA 1XLIA 2XIQA 3QHNA 1DE6A 4CN4A 3A5VA 3P60A 4HA0A 1DE5A 4RZ6A 3M07A 4I90A 4YVVA 1JYXA 2X1RA 2AQOA 1M7PA 4B2DD 4B5XA 1UZ1A 2VRKA 3USZA 4H9ZA 3KAOA 2EBNA 2QCGA 4CD4A 4AX6A 5BWAA 1V4YA 2FJUB 4HPXA 3RMJA 2HNHA 3MW7A 4TMCA 1FHDA 1MRQA 2AQWA 1VCFA 2W79A 1IEQA 3SCWA 3DFTA 1ICSA 4IHCA 2OQLA 3A3WA 3E0IA 2HWGA 1XIGA 5EMKA 3G1YA 5PTDA 1TPUA 4B9YA 2PLJA 1OABA 3M0XA 1BHGA 3W0KA 4NU7A 3CU2A 4JTSA 2ZRYA 2E6AA 1S5TA 4FIRA 2BASA 2I7GA 5JMUA 4AY7A 2PD9A 3H7UA 3ZSTA 3NA8A 2CHNA 3SCQA 2V63A 3FGCB 1TCDA 2P0IA 4L65A 3REQB 3S0CA 4D8ZA 2QMKA 3GUWA 1X98A 2GJLA 3PTDA 4W5ZA 2FZNA 5M2FX 3AIBA 1XYZA 4YTUA 4J28A 1VBJA 2ZTKA 3CV6A 2EPOA 5GQBA 3UJFA 1A3XA 3NQ2A 1ZP3A 1HJUA 4GQBA 3GH7A 4C5YA 1XW8A 3FEQA 4G6CA 4P8XA 3G18A 2GOUA 2WW5A 3TZNA 1CGTA 4B92A 1QPOA 3N2TA 1NQKA 4Z2KA 1AODA 3O8AA 2PRHA 1DPMA 5JU6A 3JUGA 4WOZA 1P0EA 4OBSA 5ENLA 5K3VA 2FZ8A 1XLGA 2BS9A 4FA3A 3EX2A 3FCPA 1L6WA 3NGFA 2XDFA 2NXIA 3GU9A 3N29A 4JTEA 4LY8A 1MZHA 2PDBA 3M0LA 3H4XA 2GGJA 1XPYA 2DVTA 3AWNA 3PTKA 3C8FA 3LU2A 2HXTA 3VMPA 3T1GA 1VCVA 1CXKA 1UZDA 2JQXA 3CEPA 4GVFA 4JYFA 5CXPA 1PKYA 3W84A 4JIRA 3TWAA 3ITVA 5TAOA 1G9HA 3PUEA 4WLCA 1QXLA 3PNUA 2VYOA 2F6XA 4K7VA 4XAFA 2ZRXA 2F2HA 4HTYA 3ARUA 4AF0A 3DFHA 5JH1A 1EP3A 5HQEA 4AYGA 3OOQA 2ZC8A 5CZ0A 1SSGA 4HQVA 2Z24A 4WY0A 2CETA 4NJIA 1QPRA 3AFBA 1C91A 3MDUA 2QT3A 1K6WA 5D9OA 2YOCA 5M17A 5BOEA 1VC4A 2C1HA 2BSLA 3QN3A 4AZCA 3OYZA 3QOMA 3T0CA 4PH6A 1W3IA 2BP1A 1NELA 1QW9A 2Q8XA 4U3CA 2EPMX 3TYAA 3KL0A 1GEHA 2QMJA 3IJ7A 4ML9A 2A3BA 1Q6OA 1Q3NA 2XH0A 4TTGA 3DFNA 1V6TA 2PDXA 2XVPA 4QGCA 4IMAA 4LY4A 3U48A 2FFIA 1KD0A 4YS1A 4UQ9A 1WOAA 2BNJA 4LYQA 4LX4A 2E5CA 2YCJA 3AXXA 3WJWA 1TJ0A 1XSKA 3WQGA 3D46A 4CD8A 3F2CA 2OVLA 1MZRA 3LI1A 3AIVA 1ONWA 2OTDA 3EOLA 1W5MA 3E9AA 4NIRA 4XD5A 3WLLA 1PX3A 3E38A 3UXLA 4TUFA 1YW1A 2J6XA 4JTAA 3KOFA 2VCBA 2CLKA 5KTLA 1CGVA 1XHGA 4H9MA 2VX7A 2PFHA 1H2JA 4MJ2A 1O95A 2V6AA 4AQLA 3DOPA 3MHUA 2AKZA 3WZ0E 1E0TA 4JFUA 3TV8A 1Q8JA 3W2JA 1JCMP 3E96A 3T40A 1UA3A 4R33A 2P10A 4B5VA 1U2YA 3TA9A 1FUYA 3FY1A 3ARZA 4RDZA 1YNQA 4A6GA 4EVZA 3FKRA 5CEWA 1XXXA 2GUYA 3BZJA 4QJ3B 2TMDA 1EH9A 2Q71A 3CZ8A 1JULA 4OECA 3DC0A 3L4UA 3ITLA 4C7GA 4DQWA 2EXOA 2TYSA 3R5EA 4NVTA 4ZFCA 5HK4A 1XQKA 4LOCA 2CBIA 3QZ6A 5HWMA 3KOYA 2G97A 2I57A 3NQVA 1ZB5A 3UVAA 3E5BA 1XLDA 4RDYA 4ERIA 4IMGA 2PDGA 2XGZA 3AZTA 3R8RA 1EXPA 5CCZA 2BHYA 1JUBA 3NOEA 1VR6A 1QAPA 2VKZG 1Q4WA 4AYSA 2RDWA 2VURA 2ZUUA 3KBJA 5RUBA 4LVFA 3WF3A 2QCLA 4LAMA 1TKKA 4HJFA 1W8SA 5EB8A 1B4EA 1RBLA 3VX0A 1V02A 3L23A 3NQ8A 1E6RA 2WC7A 4IPJA 3PZUA 4IM4A 3UR8A 2ABBA 1W6TA 4LYRA 2I56A 2EGZA 1RQBA 3UR7A 5KMYA 2B7OA 1E51A 5LXXA 5CG7A 2UY3A 1BXCA 1B9ZA 1WZKA 4CCZA 4L64A 4ASTA 2QCMA 1RR2A 1S5WA 2ZOXA 3MO7A 3B0PA 1QU4A 2Z00A 1SFSA 5C2GA 1V3JA 1V79A 5TQLA 4JTCA 1HKJA 3CL8A 1U5VA 1KM3A 4LVDA 4C1LA 4D72A 1GW9A 3RLUA 3TYUA 3NWRA 3M0YA 1P4CA 2GPTA 4I9JA 5LNWA 4LH8A 4AH7A 1SR0A 5DEZA 3GDBA 3ITYA 3LCHA 3ZIZA 4WOQA 4LALA 3NZGA 3TLLA 2FB3A 3AJ7A 1LROA 1SZEA 3SUUA 1UJPA 2E68A 4GXPA 1FWIC 4IJRA 4IH3A 5HNUA 1FH8A 3UG3A 1M03A 2E9MA 1FP8A 3W7NA 5JBDA 3QOKA 3DUGA 3REQA 3KDNA 4R53A 1GHRA 1UR9A 3NSMA 1E40A 2R1KA 4CNTA 3VOGA 4NX0A 4RJEA 1UD6A 5T91A 4HBKA 5SWUA 4GE8A 1AUSL 4PGLA 1M5WA 2D73A 3DN5A 1UWAA 1I0DA 3EKLA 4I8YA 1GONA 1YXYA 1XKJA 4XZ9A 3BSGA 1E3XA 1UCWA 4MF4A 4BFAA 4XBSA 1MUCA 3TONA 1XV8A 3GB6A 4C6KA 3VKAA 2BLEA 1RLCL 5A69A 1KQZA 1OX4B 1V08A 2G4FA 1JAEA 3N12A 1H7NA 4G1KA 3LYEA 4EWJA 1BVWA 1WAWA 4Q7IA 2E28A 3E6EA 7TAAA 1F76A 1REQA 5C6MA 3N9SA 4LFYA 3VNDA 5D9MA 2G3JA 3ABSA 3IJ6A 3TWBA 4BWLC 4AX7A 2E6DA 2XSXA 2YYTA 3LI0A 2A3AA 4F4RA 1T6MA 1LL4A 3C0SA 4K8GA 3LRMA 5IHSA 3G1VA 1GYNA 2CC0A 4YTTA 2BVTA 4TQTA 2WSPA 1IIGA 2GWNA 1KFCA 5AYIA 5BYWA 5HUPA 2DJLA 3W24A 4ICMA 4BZYA 4GK8A 3BCFA 3U0HA 3R0UA 3P0WA 2ZRVA 3HFYA 4DJDD 3BMWA 1J0IA 1N55A 4O11A 3M64A 5DFAA 3RCNA 2Z7KA 3WNKA 2WCSA 4QQUA 2WWDA 3RLHA 3K8LA 3ES8A 1IZKA 4QRNA 3NFUA 3CWHA 3WF0A 1B5TA 3CS2A 1V93A 4HYVA 3ITCA 4M5PA 2QPUA 2OX1A 1OJXA 4WKAA 4LYKA 1DL3A 2ZIDA 1XIMA 2D2OA 5D03A 1EZWA 2GL5A 3S83A 4XWUA 2ZTJA 4ZQNA 4OV9A 2BGQA 3NQDA 1E6PA 4O16A 2JEQA 3CIVA 4MJ4A 2PWDA 1KGXA 2YCIX 3W76A 1YXCA 4L4MA 3WH5A 2WWCA 3HGOA 2H9AB 3WF4A 3D6NA 3HURA 4W85A 4WF7A 1AZ1A 3R0DA 3W7PA 5CPQA 2DW6A 4U31A 3UYCA 2BGNE 1DIEA 3T07A 4LVAA 1F61A 4LGXA 5I79A 1TV8A 4V2XA 2PRMA 3P81A 4YVPA 1O5RA 1MQPA 2WHKA 3M9YA 1CYGA 3KZPA 2HTMA 4FLOA 2GQ3A 1ZAHA 1UD4A 3AXIA 1J0HA 4LU0A 2GOKA 1Z89A