2ISFA

Crystal structure of c298a w219y aldose reductase complexed with phenylacetic acid
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
314
structure length
314
Chain Sequence
SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and thermodynamic studies of simple aldose reductase-inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 100
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2006-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2isfA00
3LQLA 4WGHA 3LN3A 4H7CA 3RX2A 1EL3A 4H8NA 4EXAA 4Q3MA 1A80A 2PDGA 3V36A 4GQGA 3B3DA 1XF0A 3EAUA 1PZ0A 3QKZA 4LB3A 3R94A 4DBUA 1MRQA 3H7UA 4JIIX 3O0KA 1AH4A 3ERPA 4ZFCA 2PDBA 4YU1A 2ACUA 2IKHA 2IS7A 4FA3A 3T42A 3CASA 3M4HA 4XZLX 5DANA 4GIEA 4Q7BA 3R6IA 3G5EA 4JQ2A 2DUZA 3KRBA 3Q65A 1ADSA 1S1RA 4RPQA 3BURA 5AZ1A 2FZBA 4I5XA 2IQDA 3CV6A 2QXWA 2HV5A 4JTDA 4WDWA 1X98A 4R9OA 3UZYA 4FZIA 3V0TA 1PWMA 1AH0A 4PRTA 3U2CA 3UG8A 1RY0A 5AZ0A 2HE8A 2INEA 4JQ3A 3P2VA 5JH1A 3UWEA 2PDWA 3LZ3A 4LBSA 2NVCA 3DOPA 4YVVA 4QXIA 4DBSA 2R24A 3R43A 2WZMA 4ICCX 3LUTA 1EKOA 4QR6A 4JQ1A 3DN5A 3O3RA 4WDXA 4XAPA 5JH2A 5M2FX 2I17A 2HE5A 3FJNA 4OTKA 4QX4A 2ACSA 4JTCA 2PD9A 1X96A 3V0UA 1MZRA 3LQGA 3VXGA 1YNQA 3LD5A 1SM9A 4XZHA 3BUVA 3UFYA 3COTA 1EF3A 3R58A 2F38A 4PUUA 4EXBA 1IHIA 4XZNX 4GQ0A 3M64A 4LBRA 4AUBA 1T40A 2FZ8A 3H7RA 3EB3A 4XVEA 2FVLA 4PUWA 1S1PA 3LEPA 4WEVX 2PDPA 4DZ5A 2PDUA 2PDJA 1LWIA 4QBXA 3GUGA 1J96A 2FGBA 2PDNA 4GCAA 2NVDA 2ACQA 1AZ1A 2IQ0A 3FX4A 4XO6A 3WCZA 2DV0A 4MHBA 1IEIA 1PYFA 3LZ5A 3BCJA 2I16A 2R9RA 1LQAA 2FZ9A 3CAQA 3UZWA 4HBKA 4HMNA 4L1WA 2PDYA 1GVEA 3LBOA 4JQAA 3H4GA 2IPGA 4IGSA 2PDXA 1PWLA 2C91A 2IPJA 2ALRA 3LNMA 5LIKX 3WBYA 1US0A 1Z3NA 1EXBA 4WDUA 4ASTA 5KETA 4GACA 1HW6A 1ZGDA 1AFSA 2P5NA 4FALA 4JTRA 2PDCA 1VP5A 2HVNA 1S2AA 3Q67A 3ONBA 3R8GA 3F7JA 2WZTA 1Z8AA 4DBWA 3M0IA 2PFHA 3LENA 3C3UA 1M9HA 3UGRA 2PEVA 2FZDA 1UR3M 1X97A 4IJCA 5HA7A 4WRHA 4LAZA 2A79A 2ACRA 3CV7A 3EB4A 4PR4A 3MB9A 3R7MA 2PDIA 3ONCA 4XO7A 2HEJA 4JQ4A 4PMJA 2PZNA 2BGQA 4G5DA 4YVXA 5LIXX 2BGSA 4XZMX 2BP1A 2HVOA 3G1RA 3RX3A 4NKCA 1RY8A 1QRQA 4F40A 1ZQ5A 2PDQA 1AH3A 3NTYA 1T41A 1YNPA 4JIHA 1JEZA 1OG6A 3V35A 2INZA 3WBXA 1Q5MA 4GABA 4YS1A 2HDJA 2PF8A 1Z89A 1ZUAX 1Z9AA 2PDMA 4XK2A 5HNUA 4YVPA 2PDKA 1QWKA 1VBJA 1YE6A 1XJBA 2PDHA 3RX4A 2CLPA 2IPFA 3N6QA 3D3FA 4GA8A 1HQTA 4JTQA 5LIYX 3BV7A 1FRBA 4PRRA 2J8TA 1MI3A 1R38A 3V0SA 4XZIA 3N2TA 3GHRA 1S2CA 5LIWX 2DUXA 1AZ2A 3UP8A 5C7HA 1K8CA 3WG6A 3GHTA 1C9WA 3S3GA 4JIRA 1ZSXA 3WBWA 1Q13A 4LAUA 3GHSA 2PDLA 4XVDA 4IJRA 2PDFA 4WDTA 3CAVA 3R8HA 2F2KA 4L1XA 3UZZA 1XGDA 2IKJA 2IKIA 2VDGA 4JTAA 4FAMA 3UZXA 3CMFA 2IPWA 2AGTA 5LIUX 1YE4A 4LB4A 2ISFA 3GHUA 3MC5A 5HNTA 2IKGA 3UYIA 1PZ1A 1RALA 2PD5A
chains in the Genus database with same CATH superfamily
3P8IA 2E09A 1L2UA 1FCQA 3RX2A 2Y2WA 4EXAA 2MANA 5FF7A 1US3A 4QQ3A 3W7GA 3SIMA 4ROQA 3F1QA 2GGHA 5GJNA 1MUMA 3NZQA 3MPGA 1POKA 4ZFCA 2PDBA 3VNYA 1HJQA 3GU9A 5FF3A 2X30A 4UR9A 3IUDA 4P61A 3TK7A 3ARUA 4ATLA 1RLCL 2C0AA 3E74A 3LHUA 1YYAA 3W82A 3A12A 1CGXA 4MWAE 1XYZA 4V33A 4L4PA 4HYRA 3S2CA 2C0HA 1EP3A 3MTWA 4DUVA 4JQ3A 3P2VA 1DJIA 1LLWA 3LZ3A 1SVDA 2WJDA 3UWZA 1HF6A 4QISA 1XIJA 4C1KA 4RE0A 2ZADA 4DJED 3S1GA 2PP3A 3LSBA 1PZ3A 1CLXA 4HNOA 2GDQA 2POZA 4G1KA 4JDBA 3REQA 1XV8A 3QGAC 1EJXC 3JUGA 1ZALA 1JCXA 7CGTA 4U33A 5DY2A 1LM1A 2DVTA 4AISA 2XU2A 4O0KA 1WDWA 3DN5A 1MQRA 2AMXA 3W1UA 4I6KA 4WDXA 2WSQA 1AL7A 1H63A 4I7WA 3NOYA 5M2FX 2Q09A 3LRKA 1KGUA 3KOZA 3EXSA 1B4KA 1CXFA 4XZHA 4AU0A 1CXIA 4TVCA 2WHJA 1KM1A 1OHLA 3WMLA 4NILA 1M53A 4Y90A 3SY5A 1W1TA 3KVMA 4LS2A 3OVQA 2W67A 2ABAA 5I3KA 4LSBA 1TV4A 4HZ7A 3TYZA 3LG3A 1L6FA 2JE8A 4DLMA 1TWWA 4MKSA 4F48A 2R1LA 2VELA 3W37A 2ZKMX 1BXBA 1KXQA 4EAMA 4DQWA 3WYZA 4H7VA 1GYMA 3TTOA 2PBOA 4PCSA 1JDEA 4GINA 4L9XA 3WLJA 2FDSA 3PHAA 3IANA 4GUGA 2ISSA 2A85A 4UCFA 4QNEA 3UWYA 3WQVA 4AD3A 5DMNA 3BWWA 1PYFA 4IPLA 1E4LA 3EWCA 2I16A 2X2YA 3GDLA 3RHGA 2FTWA 3ANUA 4ML4A 1WKEA 4OGZA 5FJUA 3A9BA 1HP4A 1QBBA 4OECA 1XC4A 1GZ1A 1N2VA 2XIJA 4ZO7A 3W1QA 4KWUA 1S2VA 2CW6A 2D2JA 3MJYA 2LLEA 2IPGA 2WCGA 1PWLA 5DCBA 4A2SA 2C91A 1TKKA 1TTQA 4PB4A 2B7QA 5D4YA 3WFZA 3LXCA 1OGBA 2QAPA 3HGOA 1E9ZB 3F5LA 2DVXA 5JMUA 3MP3A 4PMYA 2WNZA 4WF7A 1TUFA 4TO8A 4OFCA 1PL9A 6REQA 2W0UA 3BJTA 1TPH1 4Q8TA 2P8BA 2YB1A 3G1HA 3IJ6A 4PTNA 1EP1A 5KZMA 4XD6A 4G8TA 3ITTA 1DQXA 2OG9A 2FHFA 3QOMA 3AXKA 4F9DA 1QUMA 1XR2A 3WD3A 3NQCA 4O12A 3DYOA 4CCCA 3VIGA 5D03A 2WQPA 1JD9A 2HCVA 2IMRA 3VE9A 4BA0A 3N4AA 4GMEA 3II1A 1W5PA 4OV4A 1MSSA 4IQLA 4PR4A 2PDIA 1U1UA 3SM0A 3EX4A 1EHAA 1QMLA 4HPHA 1L8NA 2BGQA 3PPHA 1FQ0A 3F03K 3HG2A 4GI6A 2PAJA 4PMZA 3FOKA 4RXGA 1P0BA 1QRQA 1X1OA 4DXXA 2VEGA 4ATDA 1I2PA 2ATSA 3HU7A 3TLLA 4D6JA 4DI8A 4CQCA 1T41A 4J28A 3N11A 3OG3A 3UNTA 2NQ9A 1EBGA 2R1MA 5DX7A 4HHHA 2PURA 2CZEA 1ME7A 2P88A 3GY1A 4FMVA 3SIZA 4MB3A 5DY3A 5XIMA 4YS1A 3XIMA 4FPSA 2PTYA 4KS0A 2KAUC 1MXDA 4KFPA 2WCAA 3SCSA 2WMKA 1GT8A 3VOHA 4P8UA 1QWKA 3CL6A 2PDHA 1UMLA 4V27A 3D3FA 3NQ6A 2RFGA 1JFHA 4GIRA 2B31A 3CQIA 1BGAA 5BZAA 1FRBA 3ZO9A 2R14A 4AZHA 3P14A 3DGBA 4QG8A 3NWRA 5CPQA 1I1WA 3GG0A 2NXGA 5TF0A 1Q4WA 4LALA 3EWBX 2WC7A 4J27A 1Y5XA 1M68A 4LAUA 4BI6A 1JPDX 5A6TC 4B4HA 4S3BA 4XD3A 2IKIA 1BTCA 3NCOA 2A2IA 2CETA 3O16A 2VCBA 3FYPA 4YPJA 3U6WA 3GBEA 4LB4A 5FAJA 3HPZA 3NQ8A 4NXSA 3NM3A 4AYGA 3ME3A 4C6PA 2WW5A 2BY1A 2REQA 2ZX6A 1W3TA 3O05A 1TPVA 3THCA 2VEMA 3MDUA 2WK2A 1BG9A 2JEPA 3TW7A 3M6YA 3SBFA 4WKFA 3W1NA 3BLKA 5J8LA 2V5BA 4JX4A 5BXPA 1TMQA 3HV9A 2DT2A 4HN4A 1QATA 2IUZA 4DX3A 4B4FA 3B4YA 3AIWA 4J3WA 2OLHA 1EF2A 1HNYA 4ZGYA 2FPVA 4C5ZA 2DUZA 4GNVA 3QFEA 1XISA 1O1ZA 2YBVA 1VRDA 1W17A 2E7FA 4I5XA 4A22A 1TIWA 3I7QA 4ZOAA 3CYJA 1UR1A 1VFTA 2NUXA 3C3NA 2Z7KA 5DRCA 2GVGA 2OOFA 2XH0A 4AIOA 3KX6A 1RY0A 2V81A 2WMJA 3AXMA 4INFA 2W5FA 4GH3A 1SPQA 4BQ3A 1OINA 5FSDC 2W66A 2D23A 4S3FA 4P8VA 3U4FA 1L6GA 2QEZA 3FNDA 3B8WA 2HBXA 3BSGA 4MDOA 3VNLA 4JAWA 4DY1A 2VGIA 2FPTA 2F9RA 1ZLPA 3EDEA 3UR8A 4ICCX 3IPWA 2BS9A 2WQDA 1J01A 1KKRA 1OFDA 3BJSA 3NQFA 1YDOA 4DUWA 1UJQA 2G3IA 2YCLA 1JR1A 1TQXA 1SMAA 4LUYA 3NIYA 1OX5A 4M6QA 2ESCA 1SU5A 5M5DA 2WXDM 3N25A 4WIWA 3COTA 3DG3A 3THQA 4R7OA 3R89A 1GQLA 4PUJA 3HG3A 2ZQ0A 1FWRA 1EDQA 1XBZA 3OBAA 1K3UA 3SCRA 1MNSA 2I14A 3E49A 3G6LA 3BW2A 3ZJKA 1V0KA 3THDA 4PA8A 3PZUA 1T8QA 4AC1X 1C7TA 2R6OA 3VGGA 4NG3A 1J0YA 4JKLA 1VAHA 4MFDA 2X0YA 3PWGA 1U5VA 2UY2A 5LHEA 2XH4A 3QR1A 4BFAA 1FH8A 4JGDA 3WQOA 2PDNA 3I3DA 1BWLA 2DVUA 1UYQA 2ACQA 4V1XA 4GYJA 4CLMA 3ZVHB 1AZ1A 4DYKA 2PCEA 3BL3A 3UESA 1ZL1A 1NY1A 4ORMA 1DE5A 2EJ1A 4NAFB 3U4AA 1BWVA 3VU2A 3NZ1A 4DAFA 1E9YB 1ZP4A 1O12A 1OIMA 3IIVA 1QNRA 3LYEA 1MDLA 4F3HA 1VFSA 4D71A 5EMJA 4LYPA 1W1B1 1PSCA 3GR7A 3L4VA 1AMYA 3M5YA 5JUVA 4L56A 1Q6DA 1IZCA 4YHEA 3S2NA 4UB9A 2ZWYA 3L23A 2D2GA 1WDPA 4LW7A 3MCMA 3LNMA 4HCLA 4ZENA 1RHCA 1V0MA 5IDIA 3HQPA 3KP1A 5G2WA 4B91A 3N2MA 5CAKA 4WSHA 1UCWA 3UY7A 1F05A 5EMKA 2B0MA 1AVAA 4ZQOA 1KFBA 2YL8A 2VFEA 3PJXA 4NNCA 7ODCA 5FIPA 1KM2A 3G8RA 1NTHA 2G50A 5ABHA 2PU1A 5AYXA 3L2LA 1NDYA 3POHA 2G0WA 1JXKA 2E6AA 4JFVA 1E0UA 4A4AA 3PSWA 3NNTA 3EXTA 1JI2A 4XBSA 2F61A 3T7VA 3K1GA 1OZQA 4C7DA 3GE7A 3T0DA 4WRHA 5I3GA 1EX1A 2XDFA 1UP2A 1PPIA 3MB9A 3U2EA 1Y7VA 2INFA 4O8AA 4K2SA 3DESA 2Z24A 4C1LA 1TRDA 3IRDA 2OQHA 4DJDD 1O5RA 1QK0A 4L65A 3NGJA 4PMJA 5CBIA 5HR6A 2BGSA 5KSWA 4JPGA 4GX9A 3DFOA 1KO0A 2DZWA 1A3HA 4ZEPA 4GYPA 1UROA 2VVNA 2Y89A 2VZTA 4JHZA 4HOXA 1Q7QA 3LSCA 1LLOA 4NT0A 2EPLX 3EEGA 1IT7A 3IJLA 4AD4A 4D8LA 2WHLA 2YA0A 4KEMA 3SUSA 4ES4A 3AWOA 3VCRA 2WCSA 2EPNA 3ZQ9A 3QY7A 4LUIA 3RITA 1ZUAX 3C52A 2OSXA 1P0KA 1NOFA 4AIEA 1H7NA 1JCJA 5T9BG 4HNNA 1XI3A 2RH9A 1QU4A 3CQHA 2E9MA 1PE1A 2TRSA 4GA8A 2OWWA 4O52A 2XGBA 2X41A 4QFUA 3CWOX 5KZEA 3K8LA 3FA3A 4XX6A 5HWJA 3VD5A 4TVDA 3ARYA 4TIMA 1TZ9A 2V5KA 3RLUA 4GH1A 3R1ZA 2X1SA 1ITCA 3N9RA 2YXXA 1XBYA 1C90A 3MHGA 2OQLA 2AAMA 2WZHA 3AWNA 1W1YA 2FZMA 3PP7A 2Y5EA 4L1XA 5DRIA 3S1WA 4QJ4B 4XD5A 5AN7A 1VB9A 2ZX5A 3WQ5A 1LG2A 4GKTA 3GW0A 3L66A 3AXXA 1R2TA 3VABA 3GKAA 1GPWA 3FGCB 3WSUA 2OYKA 3WNNA 4JCLA 4L1GA 3UEQA 2XH2A 3NQGA 3LQLA 4HHPA 4QCEA 4PCTA 3UWUA 3RF9A 2FKPA 3TSDA 4GGHA 3QSRA 3IJ9A 1TMHA 3VK5A 1FWJC 1CWYA 1NF7A 3VPLA 5DMLA 3TZFA 4W8BA 4PMRA 1BSLA 5XIAA 3AS3A 3CWHA 3KL3A 4TMBA 1N82A 2W27A 3JVAA 3R6IA 1CDGA 3PZNA 3FV9A 4J3ZA 4N7QA 2ZUMA 3WDJA 3V18A 3FGCA 4NU7A 4NY2A 2JIWA 2CLFA 4IICA 1XD1A 3PN8A 4AAJA 5H8MA 3CV6A 1WPCA 1VFMA 4WDWA 5EMLA 1UH2A 1VBGA 2ZXAA 1XRSA 3BQ6A 4GUFA 4XUGA 1EYEA 2HZGA 2W61A 3PZGA 4W7UA 2ISVA 1DQWA 4FX8A 2OB3A 3HA1A 3GU1A 5I09A 1TWSA 3U7VA 3QJAA 2F6UA 1R47A 2VL4A 4O13A 2WZMA 1J79A 1ELSA 3VNMA 3W24A 1WCGA 3DIPA 2CZFA 5DMMA 2ZC1A 4V1YA 4NI8A 4NJHA 1TTPA 2E6FA 1OZMA 4N0RA 1W9BM 3FJNA 1LOSA 4TQTA 3E5PA 3AHYA 3SUVA 1R9XA 3LCGA 3NQAA 4M6PA 1YW1A 1T0OA 4KESA 1HJWA 2J13A 1I1XA 2G95A 4EAYA 3NYDA 4MWAB 1WXZA 3OYXA 4JN8A 3BO9A 1BFNA 4HA1A 1AUSL 2XSBA 3QQWA 3Q4DA 4NIRA 2PTXA 2ZZ7A 4RK8A 4QLLA 3O2LA 1HVXA 4HHLA 3AYVA 4NASA 4PTDA 1FWHC 1UKOA 2BODX 4TVUA 3CYVA 1HG3A 2HS6A 1UWUA 3MVTA 1OFAA 2FGBA 2O92A 3PC0A 3PZ9A 1DHPA 3LPPA 3J7HA 4LJ3A 1KM6A 3TTEA 2YLAA 1GHSA 3UZ5A 1J93A 3C0LA 3TZNA 3NQ2A 4HCDA 2X7VA 4MYAA 3QZEA 3GK0A 2HJPA 3VMNA 4P7OA 3LXBA 1DXIA 3W1LA 2C15A 3H21A 1BKHA 1SR0A 3A5VA 2OTDA 1H1YA 3S83A 2QAFA 2ZDRA 1JF6A 4IMCA 3M07A 3NZRA 4ZO6A 1EBHA 3NAVA 1QK2A 2DZPA 3H4GA 2XVLA 5I3JA 5DCDA 1OIFA 3ZSTA 1H3GA 1ODZA 1K6WA 3DAQA 3P80A 1DOSA 3P93A 5LNSA 4WLCA 3PUGA 3AHVA 3REQB 1BQCA 3HQNA 3OQ8A 3KLKA 1F3XA 4TMCA 4WDUA 4C6BA 1HW6A 1B90A 2P5NA 1K03A 1CNVA 1LCOA 3OGRA 4HA4A 4NHVA 1UUOA 2QDGA 3H8AA 3R0KA 1UBPC 2Z2AA 2ZTKA 3MANA 2I56A 2HVNA 1RBOB 1JDDA 5B7YA 3PBWA 5FCZA 4Z1AA 2WZTA 1E6PA 2JK2A 3BLEA 2OSWA 4DBWA 3D6NA 1SW7A 3HGJA 3H2EA 2Q8LA 1ZS2A 4R7WA 3STEA 3EOUA 4V28A 2EQDA 2FZDA 3I7RA 1K7XA 3CO8A 1DIEA 5K4ZA 2QF8A 3RXZA 4IM4A 1LTDA 2CCRA 2VUYA 3MQTA 5HA7A 3NL6A 4JOMA 2HK0A 4IGNA 3OO2A 1I0DA 1S46A 1VEOA 1XDMA 4W85A 4UFKA 1JZ5A 1HIZA 3VDAA 3QEZA 3DBNA 2A7PA 3DHDA 1YIXA 1E55A 2HVOA 3MU7A 1DJGA 1OGSA 4NKCA 4MNJA 3FYOA 3OZMA 1AJ0A 4GIAA 3I3BA 5CSYA 2V3FA 1LL6A 1S3HA 2VOTA 4KIRA 4ZODA 2J79A 3BARA 4JTTA 5LXEA 4HKPA 5CCZA 4MGGA 4JNYA 3ZR4A 2YSWA 2WMIA 5A2BA 4JTKA 3RLHA 4ZA0A 2QCCA 1MYRA 1W3KA 2VCAA 5BRQA 3ICJA 3KZPA 2XFFA 1U1HA 2O9RA 3PM6A 5HQMA 3AIEA 1Z9AA 5DBTA 1TUXA 3W2UA 1WKYA 3K4DA 3QW4B 1PKLA 3UF9A 4RNIA 2IPFA 5DBUA 3U5YA 3N34A 4CNPA 2NVAA 3W4RA 1SZNA 1UD4A 1MI3A 1R38A 5AHIA 2PGRA 1H0GA 3EKZA 4LY4A 1PIGA 2VR2A 3GHRA 3H70A 5BOFA 4O8RA 3FSUA 3G1XA 2XYLA 4G1NA 2VFFA 5CC3A 4YTRA 4MJ2A 4ECLA 5CPSA 3ARWA 1A5NC 1XINA 3T0AA 1KLYA 3P5ZA 3HGSA 3TTYA 4QLJA 3BAYA 3UZZA 1XLKA 4JTAA 4MG4A 3UZXA 5AVHA 3EX3A 2EXOA 2O9PA 1E1CB 1NDZA 1W1IE 1HT6A 4RPPA 5HK4A 4F4RA 3ES7A 2WBKA 4D6EA 3L21A 2Z6JA 4KKXA 2FHCA 1EL3A 1VKFA 2FGZA 2PDGA 4F0SA 4H6RA 1DTNA 5L6UA 4UZUA 3A24A 3PF3A 5CKSA 4UCGA 1JD7A 5A8OA 3AHTA 1YXCA 2PTZA 4JTFA 4HZ8A 1VF8A 4LX4A 3NFUA 3S5OA 4JN6A 2ATMA 1GOQA 2IKHA 3CPUA 4LUSA 1T7LA 5D2TA 3N1AA 1BYCA 2G4FA 4ZCWA 3IIZA 4XZBA 1M5WA 1EIXA 1X7IA 4K1WA 5BROA 3KRBA 1ITQA 3S1XA 1XCXA 4TV5A 2JALA 2NXIA 3HTWA 2Z0IA 5D9MA 3APGA 2V67A 4QE4A 4BF7A 2CC0A 2R1NA 1IZKA 2VDIA 1LF1A 3RCYA 4UFIA 3W7EA 1CI1A 3P0XA 4LUTB 1FWEC 5FEWA 2QCEA 5T9CE 1CLVA 2C18A 4GY7A 4O11A 2YL9A 3QLLA 5AZ0A 1C8YA 5JH1A 1SO5A 5D30A 3B8TA 3LTYA 3WLTA 2H3DA 4LBSA 1YMYA 2OWXA 4UMAA 4GJJA 1EH9A 2VC5A 1TVNA 3T07A 4DJFD 3INPA 4P7QA 5A6LA 4I7UA 2DSVA 4O4VA 2OLSA 1RV8A 4GOAA 2Z7GA 1E6RA 3PBUA 1ZCOA 1JJKA 4QG6A 3TMLA 3OHIA 1A0DA 1LBMA 4S1FA 2ZUVA 4BI7A 4QEEA 6CGTA 1Q66A 4O15A 1WDRA 3ARRA 4JTCA 1C7SA 4LCQA 1TCDA 1A5LC 1WZMA 2NQJA 1JNDA 3NZGA 3UFYA 1UWTA 3LI0A 4J40A 3L0NA 2VNCA 4RZ5A 5SWUA 1W3LA 4EXBA 1E9LA 4C6JA 1VFOA 4S23A 3W2NA 4QE5A 4PMOA 1B5TA 3CQJA 3OQEA 2HXTA 1T40A 4B90A 2X0SA 3T81A 3THUA 1RD6A 1F2JA 4XVEA 2GOUA 4IUOA 1KB3A 4L64A 3E2RA 4ZQNA 3DC8A 1ME8A 3GZAA 5HWMA 5I3IA 5FEZA 2PDJA 2BVDA 3OIHA 4PL1A 5GNZA 3GUWA 3E5BA 3JW7A 3UVIA 5E6ZA 3ZT6A 1VC4A 1G7UA 3QQ1A 2NT1A 3LCHA 3E1F1 4BS0A 1QW8A 4AIBA 3GTHA 2J27A 3LZ5A 4AWUA 1QPQA 1LT7A 2XFYA 4XSMA 3MA8A 3M16A 1I45A 2FFIA 1KCZA 1GGOA 5HUPA 4DPQA 1HVQA 5D05A 5AB3A 3SUWA 4LUJA 2QYGA 3QGKC 4Q8OA 5CBBA 1XIEA 1XL9A 5A3HA 3CUIA 4YL2A 3LBOA 3IVTA 4RV8A 2HPIA 2YFOA 2Q8ZA 4FX7A 4DYEA 3FKRA 1HKWA 1GEQA 3AFBA 1MFVA 4KFNA 3VX1A 3MMWA 1UC4A 1ESWA 3DHUA 1EXBA 1AG1O 2VGBA 3GG1A 4C6LA 4ZOCA 3KAOA 4FALA 2RDTA 4LTSA 2CPUA 2YDQA 1KQYA 2H9AB 4GZIA 5FEPA 3Q67A 3QPZA 4H4IA 3KHDA 4XAZA 4QP0A 1XXXA 1Q7ZA 3KOFA 4I9JA 1X39A 4B92A 4CCEA 5G5IA 2FVMA 3TSBA 3C4UA 1QI2A 1SO6A 4NZJA 4W5ZA 3SGUA 4LC6A 3WMSA 4BR1A 1SFJA 3BANA 1MEHA 1ICQA 4PFMA 4KRUA 2A79A 3WF4A 5ABTA 4KMQA 3QR3A 3AU2A 4M6VA 4F0HA 9XIMA 1FFQA 3OGSA 1NH6A 4XQ6A 4H9UA 4RKAA 4PUMA 5EU9A 2HEJA 2VD8A 1TJ2A 2HK1A 3PPFA 3ITOA 4QHRA 4XZMX 1C8XA 2O9TA 5E70A 3N9SA 2ZX8A 5B7ZA 1WP6A 1I75A 3BAXA 1FWWA 2X09A 5C5YA 4WY0A 3G0UA 3R2GA 3URAA 3NSXA 4MF4A 1JEZA 1F7BA 3ZFHA 4URIA 3WMBA 3RMEA 4D6DA 4FIQA 3WBXA 1X6LA 4NZ1A 4PBEA 3QM3A 5BXTA 1FBAA 3VE7A 3M0ZA 1O60A 3CQ0A 1E15A 5I3HA 2J7HA 3FXYA 3IAQA 1XYFA 1BSIA 5FESA 1G1YA 1C91A 1XH2A 2YA2A 5CZ0A 3RFAA 3P81A 5C8BB 1FWSA 5I0DA 1DV7A 4ZQMA 1XLHA 3UJEA 1V51A 1UPMB 1TCMA 2AAAA 3RYSA 1PCKA 3C0QA 4R33A 1I4NA 2G3FA 3PZOA 3VIOA 3HPFA 1EJ7L 1OEPA 3A3WA 3BK0A 4E4PA 3GKFA 2DUXA 2WM1A 1W9UA 3GXFA 4OZOA 4HA3A 3IEBA 3T9PA 1C9WA 4YCPA 2QCGA 5AC7A 2ISDA 1D3HA 3WBWA 1IIGA 3ENLA 4XVDA 1XGEA 2CZ5A 1SW0A 1ZENA 2NXHA 1JFXA 1UWAA 4FAMA 3U8GA 3AAMA 4G9PA 3TFXA 3CMFA 3LPGA 3F2CA 1NIUA 3P67A 4JDYA 1EJUC 3DG6A 3JS3A 1RALA 3NJ3A 3GVRA 4CGTA 2VCCA 4K8HA 1D3GA 2WV8A 2HRWA 4B5NA 1FUYA 1O5QA 2Z1VA 1JUBA 2YL6A 4G7FA 3R13A 4HJWA 3EGJA 4UQAA 2CU0A 4M29A 4B3LA 1XPGA 3B8VA 5KZDA 3WN6A 3VFCA 2P0IA 1QI3A 3MT1A 4OVXA 4QAIA 3RCNA 3W2MA 2DIKA 5CC7A 1Q6GA 1K4GA 3DFSA 4XZLX 3VOJA 1KM5A 3M0LA 2B7PA 3G3DA 1TRIA 4IL0A 3Q65A 2A4AA 3N3TA 3TAKA 2P76A 4BCEA 4WK9A 4RPQA 4J1OA 3KXQA 3N3MA 1Y0EA 3GXNA 1K8ZA 1ZCCA 2WMHA 1XKJA 3O7UA 2BHZA 2HTMA 5AHFA 1KCLA 4K1GA 4F79A 1UZ1A 2VX5A 4GNKB 2OFJA 5D9NA 4HIBA 3VGDA 4HOWA 2ANUA 1PO9A 1MDRA 3QLDA 1H7OA 4A6GA 4JHMA 5C9XA 3EWDA 3U2CA 1GOMA 3A47A 1PX3A 1SYTA 1NWUA 1TV3A 4J4KA 2J9YA 3APYA 1KFJA 3E3HA 1QFEA 3PBMA 3MI3A 1RXOB 3W28A 3TDFA 2Z27A 4O57A 2I57A 2BGNE 1HKJA 2CERA 5CG7A 2C7FA 3SECA 3OEXA 2XVGA 1ICPA 3ZJ6A 3IIPA 4ZSUA 3GVVA 1OC6A 1JPHA 1EKOA 2HNEA 4ACZB 3U48A 1VLWA 1YKWA 3B9EA 3BLFA 1QI5A 4XZ9A 4X2RA 4E38A 1C29A 3L4UA 2A21A 2ZVIA 1FHLA 1GKQA 2G96A 4QX4A 2OR2A 3IJ8A 5HQLA 1R3WA 4RE3A 4AB4A 2B4GA 3EOSA 3S4TA 1S38A 3SRFA 4M24A 1Y65A 3BV4A 2OEMA 4RZBA 3F2DA 3A3HA 3H4WA 4JTLA 2O7SA 5DXYA 5EMMA 5AYYA 4EKJA 1TQJA 1VJIA 3CPGA 3UJ2A 4GC3A 3HF3A 1Q8JA 1E6QM 3VM5A 1SR9A 1VYSX 1T8XA 1IEWA 2VGGA 1ECQA 4AD0A 2AMGA 3FLUA 1BXNA 4HP5A 3OZOA 1B31A 4E6MA 4K68A 4LUTA 3TFCA 2YJQA 3MKKA 4X9YA 1ITUA 2V0TA 4UWMA 4V2XA 5I3FA 3SCPA 1JYWA 2DV0A 3HM7A 4LOCA 1KXTA 3B04A 1FXPA 1GG1A 2R9RA 4LVAA 3CC1A 4QS5A 3UZWA 2P3ZA 3DZ1A 3CNYA 2XIQA 4Z1CA 4QSFA 3ARTA 4JTHA 2PWVA 2ZRXA 1RVGA 4EF9A 5G2HA 2GVJA 5GJMA 3R10A 3DKJA 4PUEA 3B8DA 1C8VA 3WLPA 2RGMA 1GVRA 4PTVA 1S5MA 4DJEA 2OYMA 2CHNA 3HQOA 2PDXA 1ZJHA 3PAOA 3VIKA 3RJYA 1W1A1 2XN0A 1G4SA 4LYQA 3WH7A 1G9HA 4ZVJA 4E2BA 2UBPC 1TZZA 4AF0B 3SGGA 4ADUA 3ABXA 2FFCA 5KETA 3N12A 3WLQA 4PMNA 4HOZA 4JTIA 5H91A 3WD2A 4CKQA 3WUEA 1EGVA 3U57A 4LEFA 1UKPA 2I5QA 4RJEA 1TJRA 2DT3A 4GXMA 3WQWA 4G7EB 2VFGA 2A3CA 4O0ZA 3S9IA 1A49A 2DGAA 3M0IA 4REQA 2V2HA 3TA9A 2D24A 2IQTA 3RIKA 4LUSB 2GL5A 3CV1A 3UGRA 4S3DA 1HKIA 1AQMA 3T78A 4CCDA 4QTGA 4TR9A 1QCWA 1E0VA 2YKKA 2Y8UA 1PBGA 3HG4A 3NA8A 5CLTA 4GO8A 1CB7B 2UY5A 5BCAA 3QKEA 2PRMA 3FVMA 3UXKA 4PSPA 5D09A 1XIDA 2E67A 1W54A 4A8LA 2BSLA 1US2A 3W1PA 3AMDA 1NJJA 3IK2A 3UERA 4UTLA 1J18A 1RY8A 2FPYA 5C2XA 3MZNA 3BGAA 3F2BA 4AEEA 2D0GA 2VVSA 3U0HA 3TV8A 3F5KA 4PTWA 1CX9A 3JZUA 5J04A 2VTFA 3V1PA 6ALDA 4XWUA 1PIFA 2AQVA 4ADTA 3WLRA 3PB2A 3MYPA 4XBKA 3L4TA 1RVKA 1TIMA 4CUCA 3BGJA 3DI1A 3VAVA 4US6A 3G1AA 2PWHA 2VWTA 3BAIA 2YBTA 1GQJA 1EEPA 3NQBA 4Q4QA 4EK7A 1JVNA 4JHOA 2QIIA 3R0UA 4A35A 3TJXA 2DW6A 3L9CA 1TPB1 2NLIA 1S3TC 3W86A 3HPAA 3E0WA 3AOFA 3PJWA 3UG3A 4Q8UA 4EPEC 1UD8A 1F74A 4QRNA 3WEOA 1L6SA 4IIEA 3AI0A 1IZJA 4W86A 1YDYA 4LT9A 3OBKA 4XTIA 1P1XA 3GXDA 5IRPA 1JPMA 3GQYA 4QGCA 3WFLA 3VDBA 2GVYA 1LQ2A 1HXJA 4GVIA 2J7GA 4FP1A 1YE4A 1CGYA 2H8ZA 2YCIX 4Y9AA 4HNCA 5HNTA 4IIFA 4CNUA 1XUUA 2JIEA 2BASA 2PD5A 3TROA 3U5UA 1FP9A 1DXFA 1A80A 5A8NA 1R3VA 3AIUA 4DUXA 2ZZ2A 1IGWA 3NYZA 3W6MA 1ZY9A 1V3IA 3WEZA 2VR4A 3N2BA 4Q4SA 4GKLA 2FH6A 2OVLA 3TAOA 1XIBA 4C65A 2BY3A 1HJVA 4GIEA 3WLOA 3VMPA 3L5AA 3CTLA 3W84A 1TTIA 1DXEA 3KOYA 3QY8A 2ZUTA 2QULA 3DUGA 5LGZA 5BU9A 1W37A 5FJPA 3EBVA 1KGWA 4HK5A 5CJNA 3KZSA 4NF7A 3LX9A 4H41A 4J3VA 5C2GA 2AKZA 3K2GA 5JIWA 2Q01A 1V3LA 4BWLC 4MADA 1CCWB 2P1FA 3SDOA 3H55A 3IUIA 5C7VA 3EWUA 5AY7A 4E0CA 3CQKA 3S2JA 1UKSA 5I00A 1TWIA 4PMDA 1FWDC 5XINA 3W7PA 2GQAA 2WSPA 4JEQA 1QDSA 3VVGA 5D2VA 3FY1A 1YPXA 4C90A 4HU8A 1JCNA 3F4NA 1UASA 2PC8A 4HYWA 2ASHA 1RQBA 2TMDA 4UOQA 1VGAA 4ORIA 3ITCA 3PAJA 3AYRA 3G0XA 3TMQA 4EX4A 4EACA 3PANA 3WF1A 2I17A 4OTKA 2WKLA 2GYIA 3WLKX 3MW7A 1GPFA 3DYPA 4R88A 2QJGA 1Q45A 2G41A 2GVLA 4GY0A 5LNVA 1MVYA 1K9DA 4DM1A 5C2CA 1JCMP 3ABSA 5A6BA 3CLWA 4KWVA 1UWIA 1VBUA 4ENLA 3VYLA 1T5AA 5ECUA 2PMQA 2JKPA 1FP8A 1F3TA 3LLXA 1UR4A 3T44A 3AQUA 5ABFB 1QI0A 2VFDA 4GZJA 2ZRZA 4AVOA 3ZM8A 5K3VA 1OF6A 3ZR6A 3NUKA 4WJXA 3C6CA 1EHNA 1MUWA 4NJGA 2GJLA 1DJWA 2CYGA 3GUGA 3ZSSA 5E6YA 2Z28A 1A0CA 1TPEA 2BHYA 5AHNA 2J7EA 3N04A 1Q8AA 5D9PA 2GJPA 1J9YA 1E5NA 1UWSA 1IEIA 1Z32X 4O14A 3SCQA 2P0OA 3VC6A 2QF7A 3WH9A 3NDZA 1IYXA 5T8GA 1TTJA 4AWTA 4TOQA 1SO3A 3KVJA 1KBKA 3W53A 3IJIA 1RA5A 1XUZA 3FEMA 3QYSA 1MXSA 4H6EA 3RUBL 2PGEA 4FNUA 2VEKA 5CQ1A 3I3EA 4UTWA 1PUDA 4XAGA 4HMNA 4CN1A 1W2PA 1EA0A 2XWDA 4Z2IA 3VI2A 3GXIA 5HBFA 3WD0A 5T91A 1XLIA 4FNRA 1U30A 2GK1A 2WZEA 4FXJA 1A0EA 1XYCA 4Q8NA 3RRAA 3FEQA 4AZBA 4GCXA 4EP8C 1VFLA 4XV0A 5KZ6A 4XD4A 1WUFA 1ZGDA 5BU6A 1XRTA 4H9TA 3EOEA 3ALGA 3IIOA 1WX0A 2X7WA 2PWEA 3W85A 4LVDA 2D22A 5CJMA 4FHAA 3WLHA 1XG4A 3ONBA 3DXIA 1B3YA 1Z8AA 4MY8A 4MVAA 2X42A 1B1YA 1PDZA 2FYMA 1VJZA 1VIZA 3BTNA 5F2IA 4QJ3B 2V3EA 1QJWA 6PTDA 1WNOA 3FHQA 1F6YA 3AHZA 3M0VA 1F4HA 2XSAA 1SSGA 3VIHA 3GRIA 4HB7A 4LAZA 2WWDA 3AO0A 4PEKA 1UP3A 3LERA 4E4UA 4NXKA 4H01A 3A9IA 4LGXA 4X61A 1O5KA 3GSMA 3SJNA 3TR2A 5HMEA 1CW2A 3WLLA 4WR3A 1ZNNA 4KRTA 4O1BA 5FJIA 4DIAA 1DWIM 2V9DA 3RX3A 4PCFA 1R3RA 3Q45A 1ISXA 2ICSA 4O28A 1PDYA 4DO6A 4TX6A 4AH7A 3QQ0A 1PV8A 3NTYA 3T1GA 3HG5A 5GJPA 1R3TA 2BDQA 1TR1A 1G5AA 2NQLA 5H2ZA 1QOQA 1FWTA 1R7OA 4UR7A 2VJXA 4IH3A 3L5MA 5CZJA 4ROPA 2XFWA 1M41A 3WK0A 3FDGA 1QO5A 2V2CA 3WJZA 3ZOAA 1K02A 3NQVA 1HO4A 1TFVA 1JZ4A 1EFZA 1GOWA 4PFHA 3T08A 1NM9A 3GFYA 5F4WA 3L12A 1XJBA 2VDHA 3LRLA 2TPSA 1DJQA 3UU0A 5LIYX 4E2DA 3MUIA 4UTJA 4LVBA 2GJXB 2J62A 4GQQA 3S47A 4GK8A 1NWSA 1GJPA 4IPJA 1SZEA 5F2GA 3T40A 1V02E 1V3MA 3QC3A 4U28A 3OVGA 4Z2KA 3KS6A 3LCFA 1QW9A 1LWJA 3FCPA 3XINA 4JIRA 3OTRA 3EB2A 2E68A 4PMVA 4IPIA 2PDFA 3CAVA 5EKYA 5HJXA 4R34A 1RQHA 1S2WA 1EYWA 3GVGA 4GZEA 1Z69A 1O68A 4LC8A 2ODOA 3DFHA 3S5YA 3EX1A 4UTUA 1HJUA 4ZOEA 4NSBA 1V6XA 2F6KA 5H8UA 3AUOA 4DVOA 4C6CA 5KITA 1UD2A 2OQYA 3GYEA 2JGQA 1KCKA 1M04A 3QHMA 3VD4A 2OWCA 3WENA 1KA9F 5E1QA 3K4AA 3QKZA 4ZOBA 2GGIA 3W74A 4AD1A 3RPMA 4DO7A 4WGXA 1AH4A 2QUMA 4Y9MA 4H7ZA 1ZAHA 1P0DA 5LXXA 1UQYA 2WJZA 3CL7A 3K46A 4RL3A 5CPOA 2XWEA 4C6OA 1B3ZA 7REQB 1SMDA 3JR2A 1FX6A 1JZ8A 3AMKA 4LAMA 5CC5A 1E9IA 4FZIA 2EGZA 1MW2A 3PJUA 4Q22A 5G4EA 3V0TA 4YTQA 1M7OA 2HE8A 3BMWA 2WLYA 4O1AA 3KS5A 2XPKA 3VIPA 1KFWA 1EPVA 4GUHA 4HSOA 2ZA2A 1REQB 2VFHA 4G7EA 4DM2A 4M7TA 1UOKA 3PZTA 2PGFA 2CLLA 4PBGA 1AK5A 1X1ZA 3B0PA 5LYRA 1A47A 5IBXA 1LRNA 3I6RA 3UR2A 5FL0A 1OCNA 3K30A 1MW3A 1PCWA 4OIFA 1JDCA 3C2OA 4KBXA 4PC8A 1VHCA 3O3RA 3SCNA 3IVUA 4RZ6A 2BOEX 4O1FA 4PMQA 2HE5A 1XS2A 3C2RA 4JYEA 4P2VA 4ZXOA 1MQPA 3SFKA 4EF8A 1OCBA 3BXWA 4YJ5A 3VXGA 3CT7A 3I6EA 1VBHA 1GOXA 3N18A 2HS8A 1UR9A 1Q6EA 4YTTA 3V4BA 4KT2A 3GTIA 2EHHA 3G2GA 4WJEA 4RNHA 4GHRA 3WDQA 4AUBA 3DBPA 1RCXB 1V3JA 3L4ZA 1YTKA 1F76A 2ZZ3A 4UMCA 3MMTA 3A23A 4PUWA 3EYPA 1Q6FA 4MKVA 4QG9A 4LCRA 1UIPA 3W9ZA 2VC9A 1YQ2A 3MS8A 2DZUA 3P61A 4L6HA 5HANA 3FYYA 1R87A 1EA9C 4XIMA 4RNJA 4AXNA 3VKCA 1XLEA 3VX0A 2WC4A 4C6IA 3SQLA 5AC6A 2XVPA 3OP2A 3KRUA 1OYAA 4DHGA 4JY9A 2IW0A 2PBGA 3H26A 3Q94A 1ZHAA 3W72A 1EDGA 4YTSA 1E0WA 1WXYA 4L4OA 3TSMA 4HGXA 5CSRA 3QPEA 3FDKA 1VPQA 4L1WA 2Y24A 1XKYA 1JAEA 2YA1A 3CHCA 4JL1A 4JQAA 3CO4A 1ML1A 1RCQA 1XSKA 2QGYA 4Q4KA 3EX6A 2TSYA 1OC7A 3TNOA 2XFRA 1HJXA 1HJSA 3O6CA 3AXIA 1XIIA 4MB5A 3S6TA 4PE8A 4JTUA 2VZOA 3WJYA 1JAKA 1V6WA 1XFCA 4RCXA 5M03A 2XZ9A 2CNCA 4FLOA 2QCFA 2PTWA 2QHAA 4YN5A 3EA3A 3LBMA 3NPVA 5K4XA 4FLSA 1FWIC 1TV2A 4XZWA 2G8ZA 5TIMA 2PRLA 4HMCA 4DJDA 3M5XA 4M6UA 2WHKA 5HATA 1Q6LA 3F4DA 3KTSA 2ZFAA 1EX5A 1GZGA 1B9BA 4XKYB 1KFKA 1XLJA 1TPFA 4ZFMA 1F73A 3GTXA 3WDPP 1DYSA 3CHEA 2G37A 3RNDA 3K1DA 5DEZA 1NP0A 2R91A 1IXNA 2CZDA 2VX6A 5FJRA 3OG2A 5JBEA 2DJXA 3K8MA 2WVSA 5A69A 3BG5A 4NZFA 5HINA 5G1YA 1ISWA 2NWSA 2PZNA 2XGZA 2BB0A 3S46A 2RJGA 1UZHA 4D6HA 2Y8KA 2Z1XA 4Z2HA 1ZQ5A 5CSSA 5IHRA 4ZSTA 3T8QA 3UYCA 4B5SA 2J88A 4B5TA 3ZJ8A 3OODA 3CGTA 4JX6A 1F61A 5REQB 4C6NA 2CWNA 1NOUA 4QJ1A 1PS9A 3W7OA 3DU0A 3CIVA 4C60A 1XYAA 2INZA 3S1VA 3S5ZA 3CTTA 3SADA 1UKTA 2TYSA 3RK8A 3GTFA 2Z2UA 5GNXA 4IIHA 1CENA 2HDJA 3WD4A 3B97A 1Z89A 4KETA 2GWNA 4PUDA 3VOGA 2CIPA 3BMXA 3B9OA 1CXEA 2XUCA 2QDDA 3BSMA 1UHVA 4O10A 2CLPA 3N6QA 2QQ6A 4Q6JA 3S6OA 3H2MA 1N8WA 3PG8A 2CBUA 1OD0A 1V08A 3GZ3A 2E8YA 2CEQA 5CJ5A 4M19A 4DYJA 4XZIA 3N17A 2YB4A 3IGSA 3VNZA 4FF7A 2YL5A 3G1YA 1S2CA 4MAZA 1EO5A 2VEPA 1KTCA 2Y62A 1FVPA 3DGRA 3VMOA 2Y88A 3HGRA 1UD6A 2P10A 3RGTA 2GFTA 3CZJA 3TC3A 1IEVA 1QNSA 4B9ZA 1Q13A 3OU8A 3DCPA 4O1CA 2BVWA 5E0KA 3UQNA 4IFKA 3KCJA 1FKXA 2A6LA 4WZHA 5I3DA 3W00A 4O4WA 1LDCA 2X1RA 5EPDA 1KV8A 1W8GA 3CHFA 2XM2A 3TJIA 1GONA 3BG9A 2X16A 2O0TA 5LKYA 3UYIA 3KBMA 1L6YA 1ZBCA 4JTEA 1PVNA 4H8NA 4H9MA 3CLMA 3VKKA 4OBSA 4CVWA 1NWRA 4LS1A 4BI5A 3VDCA 4F2BA 4FOKA 4L6DA 5C9RA 3UPBA 4IHCA 5IFPA 1C3FA 3AMCA 2Y1HA 3MWAA 4DELA 5M1TA 2NUYA 1ISZA 2E40A 3EWYA 5ABFA 2F7FA 2BHUA 3U2ZA 1W3JA 1V6YA 3CB3A 4MLJA 3W7RA 4HSHA 1AD1A 4RUBA 1H7RA 1MRAA 1WDQA 4CQ8A 4IP7A 5FJOA 1EXPA 4Y8EA 3MCNA 2QJMA 1GOIA 1OK6A 3BAKA 4REQB 4JFSA 1J0HA 4MWAA 4A05A 1BYBA 4V15A 1OFBA 2RDXA 1YTDA 2OCZA 5LHFA 2FLIA 2YIHA 3N4FA 4OUIA 3DI0A 4MUPA 3TN3A 5BOOA 1EC9A 3OLGA 1BVWA 4HTYA 3GNNA 5BOEA 2C1HA 1Z7AA 5I5RA 4MKNA 1K7EA 5HNRA 4UNIA 3WLSA 1XCWA 4AD5A 4JY8A 4FLRA 2DZVA 3CZEA 2PUZA 3GS6A 1SJBA 2BNJA 3TUUA 5HULA 1YDNA 2WMGA 1NDWA 3IGUA 3BPWA 2RUSA 3T2PA 2JFEX 1W3NA 3ISIX 5AVNA 4DUOA 3HPXA 1UUMA 3SURA 2PD9A 2R1PA 3DC0A 1SM9A 3QW3A 1A5AA 3JRKA 2FDMA 1A5BA 3WJWA 1IHIA 3APTA 4YNGA 4IX0A 3W87A 2HNHA 2XG9A 3PB0A 2W79A 4UFMA 5CXPA 2BX7A 4WX2A 4OOUA 1XM3A 4YXGA 2C1GA 3O9NA 1V8EA 3M7SA 2GDVA 1GEHA 2FVKA 1V4YA 1S1PA 4QJ5B 1ECEA 3UJRA 5JVLA 1FTXA 3UWQA 1O6IA 2H90A 2I9UA 4CQDA 2J25A 1LWIA 1UH4A 3DERA 2P53A 5HPOA 1VPXA 4A3YA 2JEQA 3MJMA 4US5A 3R79A 1KD0A 5CGTA 3TTSA 1B3XA 4MHBA 3CT2A 5FA5A 3N6HA 4MZ8A 4GC4A 1Z44A 4W5UA 4M56A 2D3NA 1GYNA 1REQA 4Z0JA 2D73A 1BPLB 1K7FA 1ZU8A 2OLAA 5HMDA 2DORA 2OEJA 3H24A 3GTNA 2QPSA 3KBWA 1TE1A 4IOTA 1R86A 1MXGA 3I65A 2MNRA 4M0XA 1A3WA 3QOKA 3M41A 2PU0A 2RDWA 2CWXA 1V3KA 2JF6A 4WQ6A 4L6OA 4L9YA 1FWBC 4K8GA 1US0A 2Q8XA 3NOEA 1N8FA 4GACA 3RRXA 2BVTA 1EQCA 3VIFA 4A3HA 1E43A 1BAGA 3SCWA 1ENUA 4CNTA 1MNZA 3MMDA 2DW7A 1M7JA 3PUEA 3KVLA 1IXQA 1XQLA 1SFTA 2J7BA 2BZNA 3P60A 1CECA 2VD9A 3VZZA 1W56A 4ZXLA 4CVUA 5I03A 1ZPTA 3D46A 5C6MA 1BF2A 3WZ0E 1X97A 2JKEA 3STFA 3P0WA 1NDVA 5H1WA 2QCNA 3IJQA 1XIMA 2NT0A 4UQDA 3W22A 3ZXWA 5K9XA 4IPPA 3TYAA 6TAAA 3KOWA 4F0LA 4NYYA 4E3TA 5DO8A 5A2AA 4GISA 2OSYA 3C61A 4C6FA 1AODA 2NW0A 4NAEB 1QAPA 1YNPA 4AIUA 1ZJBA 3TX9A 4HJFA 4OWGA 3P62A 5HQEA 3SCVA 1EWEA 3I68A 3SQSA 4B16A 1I2NA 4Y6GA 1A5KC 4FO4A 2XZ7A 3F4CA 4HNUA 1YBQB 4H9VA 1R7AA 1WDSA 3MUZ1 4QSHA 1DJXA 2D1ZA 1S39A 4XB3A 3W75A 4LYKA 2PDMA 4O53A 1KW1A 3C2FA 4AG0A 4HU3A 2NV1A 3RX4A 3R5EA 2V6AA 5G1MA 1J4EA 1OFQA 1UA7A 2DFAA 5C70A 3G3MA 3BICA 4BF5A 1Z48A 2BLEA 3M9YA 3LHTA 2OT0A 2PTDA 3IARA 4I9AA 1C92A 2ZICA 3QF0A 1OCQA 2XINA 4GJ1A 3R4IA 1CTNA 1FWNA 4TU1A 2QCHA 1J0IA 3ORWA 4QDMA 4CU7A 3CHVA 3VIJA 1ZSXA 3ZVHA 4M1BA 5A5WA 2QR6A 4AD2A 3VM7A 4BY3A 2GSHA 1LRTA 5CEWA 1XGDA 3RM4A 2MUCA 3ITXA 2AGTA 5FSEC 3BW4A 3HOJA 4MYXA 2ON3A 2RHGA 3KM8A 4I3GA 2B81A 1NP2A 4MIMA 3VKBA 1HGWA 2IKGA 3OGVA 1W5OA 1V6TA 3TWAA 4WGHA 4H7CA 1FA2A 1QNPA 2CITA 1JG9A 4N9CA 1LQ0A 1GCYA 4UTMA 1LLZA 3B3DA 3GD6A 2GUUA 5I79A 5F1VA 3R94A 1Q6CA 4DBUA 3HIJA 1MRQA 1XD0A 4L9ZA 4JIIX 1RJRA 2PWFA 1SQ7A 2ZA3A 1YPFA 2ZZ1A 5ENLA 3W0KA 1XLLA 2NX1A 3LHWA 3BZJA 4FR6A 1YADA 3S1UA 3WF2A 4GQRA 2AOSA 3G5EA 4KGLA 2UWFA 1B2YA 1ADSA 1XYMA 4Q7IA 3TVAA 1UC5A 3QSTA 3UGVA 3ZWSA 2CFFA 4E3VA 4PBFA 3T0TA 3D0CA 3WUBA 1V02A 3TQ0A 3EKGA 6A3HA 1Q63A 2INEA 3UXDA 2XM1A 2E5CA 1HTIA 3L68A 5C0QA 1KTNA 1EOMA 1J0JA 2P8CA 4RDVA 4G56A 2W4XA 3WH8A 8TIMA 3NQ7A 3UETA 1Y5WA 1L2QA 3SRDA 4UTTC 3N15A 4UZSA 3OVRA 6XIMA 4DBSA 3VNDA 3AUJA 2NUWA 1JZ2A 7TAAA 3W29A 2PLCA 3KW3A 4OBTA 4MJZA 1YLVA 3PG9A 3L4WA 1PIIA 1F3EA 1OVDA 2ZXDA 3A4AA 3GH4A 1WKFA 5EY5A 3GXMA 2EKCA 1AW1A 3OB8A 4RV3A 4EVZA 2ONEA 2VKZG 4KQNA 1HFBA 3GIQA 4IQEA 1NFGA 3BUVA 1ONEA 2Y7FA 3O6DA 4LU0A 4AWEA 2P50A 1KLZA 2NSXA 4B2DD 4UTWC 3V1HA 2PLKA 2D2OA 3PFRA 3VO0A 3WL0A 2Y5SA 1GG0A 2OX1A 1RUSA 2XN1A 2L5HA 4U4MA 4HVXA 2FZ8A 2OZ0A 2A3HA 3AROA 2BXYA 1YNYA 1OX6A 3N2CA 3QN3A 4RE4A 2OXNA 2PLMA 2VRKA 3S8HA 3H2FA 3T0BA 4L80A 5JBFA 3AHXA 2DSWA 1LUCB 1RJQA 3KTCA 1H4PA 3P7YA 4N4PA 2OX4A 1R3QA 1IIHA 3OOQA 1RAKA 2C13A 4KCUA 5GPRA 5RUBA 3C5QA 2V3GA 1W0MA 3G1DA 1P0EA 1UR0A 1P4CA 1MMFA 3PBYA 1H41A 3RR4A 2UY3A 2Q3OA 4RDYA 4X9SA 3VC5A 3T55A 4PB5A 3NO1A 2HBVA 1R9ZA 5HWNA 4LFYA 2VI0A 3CIXA 3NEVA 3HFTA 4HPGA 1EJRC 3TU9A 1LJYA 2DQWA 2ZA1A 5AHLA 3L0GA 3E2SA 4W7VA 1OSEA 3DHPA 1IT8A 3WLIA 4RXFA 1WZAA 2TODA 1ONWA 2GGEA 4J3XA 5GVJA 4LYRA 5A1AA 1O66A 3W38A 1X7FA 3W88A 1W5NA 4XG1A 3WH6A 1JCYA 2C16A 4R27A 5D02A 1B4EA 3FHAA 3SCUA 4EWJA 2Z1KA 3OLDA 2NX9A 3D5HA 4R85A 3SUUA 4AC7C 3VGHA 3CZLA 3VUPA 4J3SA 1NVMA 4C1NA 1Q6OA 2WB5A 3ECQA 2RDUA 4UR8A 5BYWA 1CT5A 3B9DA 3DHFA 3VDHA 3R8GA 3OZYA 3MZ2A 1LL4A 2E5BA 4MJ4A 5EFDA 5I06A 2V69A 4EPKA 3VOCA 3C3UA 3P74A 4ZO9A 1YPIA 3L4XA 3MWCA 5I78A 1ZP3A 1B9ZA 5F2MA 3NEHA 1H09A 4CEUC 2H8XA 3M0JA 2DZAA 3MP5A 1RZMA 2D69A 4B15A 3QFWA 2EJAA 3R7MA 3FAWA 1HKVA 4IISA 3A4XA 2ZYFA 4OKDA 3S42A 1E71M 2VURA 4N02A 4W9TA 1LYXA 3WJSA 4RX0A 4HT3A 4ILSA 1Q6QA 2QIWA 4I8YA 3LMZA 2V2DA 4F40A 3LRMA 3SCOA 4XIAA 1K9EA 4DAIA 3A22A 4M7SA 5MF5A 5AC4A 3IJ7A 1QASA 2D0FA 4IP5A 1NSJA 3TYEA 3ARSA 4WVXA 2VWSA 2G5WA 1Q5MA 3O63A 1U1JA 3W83A 1R85A 1OFEA 3UD6A 1KR0A 2B7NA 3H6OA 1XG3A 4J3UA 4WKHA 2WSKA 4KCWA 4FIRA 1UUQA 4DWSB 3LDVA 3WK2A 1C8QA 1I8JA 4BQ4A 2WSRA 1I9CB 3SUTA 2RGLA 1R5YA 3E2VA 3STPA 1E73M 3BVJA 3M5ZA 3M0YA 2OZ8A 3EA1A 3HN3A 3UNDA 1DWAM 5DN1A 2YLLA 1OK4A 7TIMA 4MY1A 3VIMA 4X2PA 5K9CA 1D8WA 1F4AA 3KEHA 3IVSA 1FDJA 3UWVA 3VTRA 6REQB 2QJJA 1F6KA 3HMJG 3KBJA 5C7HA 4ERIA 1K8CA 4AMAA 3MBDA 3K5XA 5C55A 3S3GA 1DJYA 3NXLA 1TR9A 4D6FA 3VOFA 4XISA 5IOBA 5A8MA 2SFPA 2V5JA 4A2RA 1O94A 2YZRA 3C2YA 3RLGA 3WUFA 3A5FA 3MC5A 4F8XA 4JTGA 4BF9A 1VENA 1OB0A 1DHKA 4NAEA 4L4LA 4ZTYA 5A8QA 1UZDA 3IWPA 3W7CA 2ISWA 4Y8FA 3VKDA 5LGXA 3L0KA 3O0KA 1XPYA 2XHYA 4M80A 5BRPA 1GVIA 4U10A 3UA4A 2ZE3A 3T42A 1C93A 3QPYA 4X60A 1RP8A 2HMCA 1VEPA 2J9ZA 3MY9A 4D1IA 3BURA 3NL2A 4GO9A 4B5XA 1W5MA 2JKAA 3VIIA 4IGHA 2ABBA 3M44A 4LWWA 1MW1A 3AXHA 3KBNA 4O19A 3QTPA 3UZYA 3Q2DA 3LNPA 3RPTA 2OEKA 4PRTA 2FZNA 4GXPA 4ATWA 4RLIA 3RO8A 4E2VA 1SFLA 3IIXA 3V5OA 3UWEA 5G2IA 3FA4A 2DT0A 1JUKA 4DBDA 5ABGA 3ZWTA 5D2XA 3KRSA 2I1OA 2YW4A 1TVPA 4HZ6A 3UCCA 1EB3A 1IEQA 4LF1A 4LRSA 2YXGA 5LZLA 4ZB2A 4AHQA 9RUBA 4HMEA 2ZUWA 4PYSA 1JUEA 2BY0A 5I23A 5JH2A 4MZYA 1MO0A 4H8HA 2NWRA 4NL1A 5CPMA 1XLMA 1YNQA 1BLIA 3TC6A 3WQ4A 1HUVA 3HQ1A 3GC2A 3RJXA 3E38A 2Y7DA 1H51A 2A3AA 2W3ZA 3R58A 1EGZA 4PUUA 4CNNA 3GH7A 4XZNX 4GQ0A 2PA6A 2CXGA 3EX2A 4G6CA 3V16A 4K38A 4WJ8A 4S2CA 4GJIA 1J2BA 4IXXA 3PZIA 3AJXA 1V79A 4A8RA 2XH7A 2FB2A 1VRXA 2QJNA 1M1BA 2QVHA 4D1JA 5CAHA 3PTMA 2YCEA 4I9TA 1SW3A 4WEVX 5JU6A 1E70M 4IJBA 3M5VA 4YHGA 1E1CA 1Q85A 3T09A 3EOOA 1J96A 5D38A 4IF2A 3TNBA 3W02A 4F2TA 4AY7A 1F5ZA 1PTAA 4J9JA 1LRQA 4ONVA 3FX4A 4XO6A 2VXNA 3KHJA 3W1RA 4W87A 1CGUA 4ACYA 4YYCA 3TYUA 2YCLB 2FGLA 1DWJM 2J9XA 4Q32A 4XKMA 2FZ9A 1MW0A 5HR7A 4H9XA 3PNUA 5AYIA 3UBPC 3WUGA 3M43A 3TE9A 3R12A 2A7RA 5B80A 1DBTA 3U2OA 2C71A 2OMAA 7A3HA 3KVKA 4LS0A 3VCNA 1GVEA 5HOSA 1DWFM 1EP2A 4GBDA 4HQVA 1I2QA 4O1EA 3LA4A 2E0PA 4NI3A 1P0NA 3QV6A 4QS6A 5DCEA 1UBSA 3SFWA 1RPKA 2CKRA 3TOPA 2ALRA 3YPIA 1G4TA 1IF2A 4NJIA 1TV8A 1XIFA 2QT3A 3CJPA 1GYLA 3FSTA 3QMRA 4ASTA 1HZYA 3W6YA 2J8FA 3GC4A 2ZCGA 1XH1A 1AFSA 2Z29A 2DP3A 1DVJA 4NX5A 3BAJA 1UG6A 2CHRA 4I5RA 4P8XA 5J5DA 3QH2A 2VENA 3B9AA 4W7WA 3F7JA 5ABEA 4ZQCA 3OYZA 3GDMA 4Q4PA 3ZT7A 1TV7A 1N7KA 3WX7A 3W7JA 1E3ZA 2HISA 4LANA 4HPXA 4ALDA 4OE7A 3TYCA 4GXWA 2Y63A 4IMAA 5CC6A 3LCIA 5A95A 4CD6A 1QWGA 3G8EA 3LPFA 3W25A 3H2CA 3GFXA 1EJSC 1GNXA 3LY0A 1JZ3A 4IXHA 4C1NB 1VR6A 1QPRA 3QV8A 3WEMA 2RKXA 4YCOA 1WZKA 4IGMA 3MI6A 2ZOXA 1LT8A 4POCA 1J11A 2XSXA 2WJEA 5L9FA 7XIMA 4BQ2A 1IR2A 3IV3A 5E0FA 4C6EA 4H04A 4EIVA 3GX9A 1GKRA 3SQMA 1M7XA 3QV7A 4FXRA 1QPOA 3W71A 1TJPA 4DB7A 2XN2A 1RCOB 3QMSA 1P6BA 1Z6KA 4GABA 1JYVA 4NZ3A 3WNLA 1V77A 1XSJA 2DSZA 1DP0A 4QIUA 2DQXA 4JTSA 1AQHA 1SZRA 4MNMA 1JRCA 2ZUSA 4I9MA 5HNUA 2J7CA 4OJYA 2J7DA 3W7NA 3CK5A 1YXYA 3DYMA 2E1WA 4KPLA 4YYFA 3EWZA 5EA9A 3GVWA 4ZL1A 3PS7A 3CM4A 2REQB 1E40A 1HQTA 3ANVA 1NU5A 5HNNA 3R0DA 4DXKA 4PRRA 3PULA 4FF5A 4JZ5A 1JPIA 3WDRA 3C0JA 3DECA 3N2TA 3EA2A 5I7GA 4M3PA 1RBAA 3OJGA 4RW3A 1KGXA 3NG3A 4UC5A 3VUSA 2PSNA 3HFYA 1KNWA 2AQWA 4J5NA 3B03A 4IJRA 3SR7A 3DH7A 2GVEA 5EL1A 4FOUA 3MCOA 4ZB0A 1EO7A 5C71A 1ZJAA 3NDOA 4D6CA 4DN1A 4Z1DA 4DWDA 1AW2A 1PZ1A 3SN1A 5HMFA 1CIUA 3EOLA 2R94A 5EMYA 3HO8A 2NSOA 4N6FA 3NVDA 2JGYA 2ZZ4A 1LOLA 2XIMA 2X05A 4X0NA 4DF0A 1HKMA 4M5PA 4Q8PA 1XRVA 1WYIA 4B2DA 1N55A 2D3LA 1LP6A 2DZSA 1O5XA 2A3EA 5FEXA 2ACUA 4IG2A 2WM0A 4GLEA 3WF0A 4FA3A 2WJFA 3UCDA 4E8GA 4NYUA 1VLIA 4Z42C 4CU8A 5AZ1A 3VZYA 1J10A 3L5LA 1QVBA 4U2YA 5HJLA 1EDTA 5I77A 4FR1A 3SN4A 2QUTA 1KTBA 4JYDA 2A3LA 4OBRA 3G18A 4JTDA 2CLMA 1X98A 4H2CA 3ITVA 4DEFA 4UFHA 1BTMA 1XYLA 1PWMA 1CLKA 3H12A 3CZ8A 3NL5A 3AZTA 1FY6A 4C7GA 2DSKA 1SJAA 3DFYA 1OBAA 2WSYA 2YFNA 1ZZMA 2R24A 3TXVA 2PP0A 2QV5A 1F07A 1THFD 3AALA 2O55A 2V82A 3E0FA 3BMVA 1TPC1 3CUJA 1PKYA 3IRSA 1GZJA 3DFQA 4U3AA 1B54A 1CGTA 3O15A 5HDRA 4GZ7A 4ZTXA 1OT2A 2YDAA 2E6DA 3VCCA 3I4KA 4TXEA 4LH8A 1KCXA 1TPUA 5LNWA 4P8WA 3TYDA 5AYZA 3CB8A 1GW1A 1UH3A 4JTJA 4F66A 3FVDA 2Y85A 3LQGA 4D6GA 3LD5A 4GNJA 3VNKA 3UR5A 3BC9A 2VYOA 3SW6A 1JIBA 1S5NA 2HROA 3M64A 1QW7A 2OT1A 4GVFA 3P6LA 2X1UA 2VO5A 3UY8A 3O07A 1RR2A 1SUXA 1GUVA 3NXFA 4JEJA 1XCFA 3UZJA 3TIMA 4H9ZA 2PDUA 3O1NA 2C79A 2WNWA 3MUAA 2ZUUA 5EB8A 5HMSA 4GCAA 2DJLA 3E2QA 5U7SA 1HGYA 2DPEA 3LHZA 3R25A 1Q7MA 3B8IA 3LBCA 5A6BD 2V3DA 4NNBA 2PWGA 3VFLA 4MTVA 1LQAA 2X1TA 1GTEA 1X6UA 2NQHA 3CAQA 3PTQA 5BMWA 3UG4A 3UT0A 4D6IA 4H8UA 2VFIA 3M6DA 4HBKA 1TPDA 2QS8A 4DF1A 1WBHA 4AZCB 1J0KA 1QBAA 1B0IA 2HPMA 5I6SA 1BVZA 2DT1A 1D7FA 4KEZA 4OQVA 3SSJA 1ZBVA 1IXOA 4AF0A 4J2MA 2DZBA 5FI8A 1OABA 2OKOA 4KWOA 1TELA 1SZFA 2VM8A 2IPJA 3E02A 4CEXC 5HPCA 1UOZA 2PPGA 4HZMA 5D8WA 1EUNA 8A3HA 3ZJ7A 1Y8BA 1BG4A 1ZTVA 4GRSA 3WDIA 5IHSA 2DIJA 3V3WA 1S2TA 3GVQA 3KRZA 3GNXA 3W27A 1PXGA 2CBVA 2PDCA 3CAKA 4WKAA 3UXAA 2Z4GA 1AQFA 1EPXA 1KBLA 3L2IA 2QCMA 1U5HA 2WNNA 4R9XA 4AX7A 1PAMA 3RLVA 1UZ4A 5CPTA 2PFHA 4A21A 3LK6A 2ZUNA 1XIHA 4K7YA 4LNYA 4JXCA 5AC8A 5JIPA 2GDUA 1K70A 1M3UA 1M6JA 3H2AA 3IV8A 1AD4A 1KM0A 1PJ9A 3FN9A 2AQOA 3TONA 2ACRA 3EB4A 3UG5A 3G77A 4IPNB 4IMEA 3PWAA 3IJDA 4Z2JA 1G4EA 1TE6A 3DG7A 2GLKA 3DDMA 1D7KA 3L67A 2VR5A 2CKSA 4RNFA 1FHDA 4YVXA 1V0LA 4ICNA 4FEZA 3EPMA 4EWND 5IXEA 2BP1A 5FAGA 3OLIA 3OBEA 3C2EA 3MKVA 2E9LA 3SI9A 4UBPC 2QGHA 3UVAA 4UQCA 4WUIA 1AH3A 1R3YA 2Y61A 1JNEA 1GJWA 5CSUA 4DRSA 1FWAC 5F4XA 4I8DA 1F9CA 2CESA 1VFFA 2Z26A 4IFRA 1TWZA 2J7FA 1O1HA 4Q4OA 1XH0A 4P7LA 4Q6XA 1H49A 1QR7A 2PODA 4W4QA 1XYBA 3SRKA 1BQGA 4ML9A 3WFAA 3CIWA 4MNLA 3GM8A 4W84A 4DJDC 5C9UA 1OFPA 3NM1A 3ARPA 1F6PA 4IIDA 4YVPA 2PDKA 1CBGA 1Q3NA 1GVFA 1GVQA 1N8IA 3N4EA 4YMZA 1OCJA 2BXVA 3LM3A 4FI4A 3PTDA 5C9WA 3O0FA 4U2ZA 1LORA 3N14A 3GIPA 3RPDA 3TJ4A 4GUJA 4NVTA 3MMUA 3HJZA 2WOQA 4GWEA 4F0MA 5JXQA 1RJPA 4HPNA 4KW2A 4JYFA 2JF7A 3TCSA 5E9XA 1W9XA 3I4EA 2O4QA 1OF8A 1UWRA 8CGTA 3M0MA 5FF4A 2PWDA 4ZQRA 3GHSA 1XW8A 2I9EA 3USZA 1XBVA 4Y7EA 2EPHA 4QCFA 2QCLA 1H62A 4TX9A 4X0VA 1NQ6A 2TAAA 5D8ZA 5TQLA 2FB3A 3UJSA 5I07A 4Y9PA 2GQ9A 2QZRA 3ES8A 3TN5A 1VPYA 3SCTA 4MLRA 4Q8VA 3WQCA 1IXPA 4DO5A 1A4MA 1QHOA 2WC3A 1P48A 4A3RA 4DJEC 1E56A 4Q3MA 4HCHA 2FQIA 5DF0A 3TQPA 3V36A 3B0VC 4KIEA 1H7XA 3GWQA 1UPPA 2FMOA 3C2VA 4B5VA 3JZEA 1VS1A 1ADDA 1KQZA 2GGJA 3I10A 3UCQA 3GU2A 1OADA 3GBDA 1R8LA 3GB6A 1GVSA 3L65A 4S3JA 5DANA 5G4HC 4DLFA 4PODA 4JQ2A 5BWAA 3PSVA 4EOUA 4IMGA 4OU1A 1VCFA 3TQVA 1TPWA 3BLOA 1JXJA 2IQDA 1SJCA 2WPBA 3HPSA 1FH9A 5IFTA 3NSNA 2WKJA 4L7ZA 2VC7A 4R9OA 4S38A 3USBA 2O56A 4WSKA 3MSDA 3KOXA 2EG6A 3BH4A 3STCA 2BY2A 3W2JA 3B0XA 5H6HA 1A3XA 1TA3A 3CS2A 1CEOA 2XVKA 5D9OA 2NZLA 4JD4A 2DSUA 1W91A 3P5YA 3DOPA 4QXIA 1YRRA 4UMBA 3S9ZA 5IBXC 3QZ6A 1BVNP 1B3OA 3RAOA 1TWDA 3BSHA 2QUNA 5K2ZA 4Z2LA 4H83A 1I2OA 2YDRA 3ITGA 1G6CA 3EWXA 4DO4A 5BMXA 3M47A 4MMWA 4YIWA 1X96A 3QTGA 4UQBA 1PKMA 1MFUA 3WBEA 3DFTA 3ABQA 3OLEA 2OGYA 5CGQA 4WY0B 3UXLA 1ZRQA 1SFSA 2QCDA 1FKWA 3G1SA 1DEDA 3RG6A 3P8JA 3EDFA 3SB0A 3M46A 2FH8A 2EBNA 1GHRA 3NDYA 3W07A 1PHWA 4IL2A 1U83A 2VOMA 4O16A 3ZZ1A 3UPMA 1B30A 4Y9NA 1LWHA 4YWSA 5BW6A 5D32A 1LROA 4LQ1A 4NP7A 3GNOA 1T6MA 2WBGA 2CLHA 1TG7A 2F6XA 3BCDA 3AZSA 1GVYA 1W5QA 1MUCA 3BCJA 4Q33A 1XLGA 2Q6ZA 1E6ZA 5BWFA 5AHMA 1Q2RA 3TQKA 1RSCA 3DKLA 5F2LA 4K36A 2YPIA 5DLCA 3WMCA 3GFZA 3Q37A 3LXAA 3NR0A 2Z1SA 4UOZA 2WMFA 2VQTA 4TTGA 5K9DA 1XDJA 3WIJA 4R5EA 1MZHA 3QXBA 2OU4A 3E0VA 4GBUA 4GQBA 4A3QA 3T8LA 3WH5A 1Z3NA 2AKMA 3QGVA 2R1KA 2QVNA 1IWPA 2FHBA 4QNWA 3LLDA 5KEZA 1HKKA 4PMUA 3EMQA 4JTRA 2OPJA 3PWIA 4FNQA 3MO4A 2OZTA 1VCGA 3PZMA 3UW6A 3O6YX 1XWYA 1K8YA 1BEUA 3P84A 3V7PA 1UIOA 3FAXA 4JNMA 2D20A 3CUXA 3URQA 2PEVA 3AIRA 3OIXA 5AECA 4AQLA 2CLKA 4XAYA 3VKAA 1CYGA 5LSMA 4N9BA 4C91A 3TOYA 1TJ0A 3S5NA 1PHQA 1QOXA 5G1TA 3GDKA 4IFKB 2PP1A 1ZB5A 4Y9OA 3CWNA 3ONCA 4DNHA 2UV8G 4WOQA 5DMYA 2C14A 4QEHA 1A5CA 2V30A 4CN4A 4UTIA 3POCA 1ISVA 2QNEA 4US5D 2GJRA 3E96A 5TNVA 3WLMA 2OODA 3VDGA 1A53A 2V5CA 3U9IA 5FJJA 3OZPA 1JQVA 3AS1A 3TW9A 1SO4A 3WLNA 3ARXA 3TCEA 3GDRA 1G94A 2W6RA 3G1VA 4JIQA 2DH2A 2BTMA 2DEPA 4NJKA 1S2UA 4O18A 3JU2A 3KUMA 2OGJA 4CN6A 3LI1A 1HP5A 5BNKA 1BWKA 3BOLA 4ICMA 1SSDA 3RU8X 2QJIA 4X3ZA 1QI4A 2V38A 1KFLA 2NQZA 1UR8A 1FWFC 2PGWA 1NF0A 5A6JA 1XLBA 1EGMA 3ABOA 4PTXA 4WD0A 1A5UA 3V0SA 2V5LA 1JULA 2GOKA 1H5VA 3D47A 5AFDA 1JDFA 2GUBA 3LTPA 3M0HA 1TX0A 3TN4A 4CD4A 1WDDA 3K8KA 3O8AA 1MEIA 4I6VA 1RK5A 3G22A 1XIGA 3LV6A 2H9AA 4H3DA 5A6SA 2Z25A 3S2LA 5A94A 1DQUA 4BZYA 1XFBA 2YXOA 2NV9A 4MUZA 2GK1B 1BGGA 2BWGA 1TZ7A 1WQ5A 3GNPA 4JL2A 1R2RA 2G3JA 5IM51 4L4MA 1DJZA 2GGGA 4C6QA 4RDZA 1IR1A 5E0CA 3PBGA 4AZ6A 1K77A 4JKMA 4WXYA 3BG3A 1R9YA 1GJUA 5CZSA 3AICA 3GO2A 3LN3A 3A64A 3UA3A 3PZQA 2BOGX 1QTWA 5FACA 1W9PA 1S5WA 3NSMA 4GY1A 4GQGA 4OOZA 3AIVA 3EPOA 3EAUA 4LAOA 3BGGA 4MNKA 4N9EA 2QPUA 2R8WA 9XIAA 2W9MA 1YTEA 3WDHA 1E4MM 4DWSC 4WOZA 4GYPC 5DELA 3TXZA 3VGBA 1EC7A 1UW9A 1CZ1A 2E9BA 4Q7BA 3RM9A 1U5JA 4UNKA 3PNZA 3QYQA 3PPCA 1S1RA 3PFMA 3EXRA 3GAKA 1V7YA 2VRQA 1I0BA 3KBVA 4JN7A 4X22A 1AJZA 4E8CA 4ZO8A 4L5ZA 1AH0A 4LPCA 5GNYA 1TMLA 4Z17A 1FXQA 5LNRA 4QQUA 1P1MA 2BV9A 2Y7GA 3W70A 3TW6A 4DJFC 2Y8VA 2WVVB 2DH3A 5F4SA 3V75A 1OG0A 3GH5A 4H2HA 2YW3A 3BJFA 2EPKX 4HHMA 3EEZA 1TA3B 1KFEA 1Z41A 4XUYA 1JDAA 1G4PA 1KWKA 1GOKA 1HO1A 3D3AA 4K6AA 1OT1A 4UTTA 4JQ1A 4TX8A 1XQKA 1UB3A 2J8GA 4E5TA 3MV11 1Q2SA 3MVIA 2BG5A 4HN8A 4S3KA 1IGSA 4XAPA 3DFPA 2XTKA 4BWLA 2E6YA 4G2DA 1GW9A 1UD5A 2ACSA 5MKGA 4M8UA 1MQQA 5E9AA 3H23A 1J5TA 4EANA 3NPUA 4LY8A 1RH9A 3PZVA 2F38A 1QT1A 2NQ5A 1OD8A 3H4XA 3AIBA 1BKSA 4BHYA 3KBSA 1LZOA 4LBRA 5I24A 3CAWA 3BOFA 2ZDSA 3NQMA 1E3XA 3H7RA 2YDSA 3EB3A 4S3CA 2FVLA 3KDOA 3MDWA 3VGFA 5ECVA 4FX6M 3B9NA 3XISA 4GX8A 4DZ5A 3CH9A 1J12A 2GSJA 1YXDA 5MKGB 2YX0A 5DT5A 8XIAA 1NELA 2CLOA 1IT0A 3HJEA 1E5JA 5BRBA 1JGIA 3MHUA 2EPMX 3KE0A 3LU2A 4NRRA 2GZXA 4IUGA 3E0IA 2Q02A 2YOCA 3DFNA 2DZTA 1WAWA 2Q71A 1AJ2A 2KX9A 1JZ6A 4BJHA 4FNPA 2VGFA 1KRBC 2VEFA 3S0CA 3E12A 3WNPA 1A5MC 3C86A 4NJJA 3MUY1 4Q8QA 1XBXA 1XC6A 4ZE4A 1V03A 1FCUA 4W89A 1P6CA 3KWSA 2E4TA 4LV4A 3CMGA 1JPKA 4XKYA 7REQA 2I5GA 4CQ9A 3GDBA 1ODUA 1DE6A 1EQPA 3GNDA 4HMDA 1JI1A 2W92A 1XLAA 2IXVA 4HU4A 4CQBA 4Q7NA 3W6LA 1W3IA 4I5UA 1VYPX 3THAA 1K8XA 1EJWC 2XIBA 1KFCA 3TJLA 1DWHM 3WBAA 2GQ3A 3H22A 3N2XA 3MI2A 3PY2A 6ENLA 4CD5A 2C19A 1DPMA 4GVGA 3ITYA 4FXFA 1L0PA 1O7AA 3CU2A 2VHLA 3WL1A 4ERGA 1M9HA 1HL9A 2A7NA 3QBUA 3T2OA 5CGMA 1KC7A 2ZVRA 4ZBCA 2J77A 3SN0A 2VZUA 2ZWZA 1P6WA 1Q6RA 2CBIA 3RN6A 4AZCA 1IEXA 2WWCA 2DY3A 3GLCA 1E51A 1I2RA 4KERA 3TC7A 3UWWA 4JFWA 4OHQA 1YDVA 1OQFA 1GK8A 2ZIDA 5D2YA 2ZZ5A 4N4QA 2GWGA 4DZHA 3MKCA 1OX4B 4DJFA 1IWAA 4UTKA 4ZR8A 4Z0SA 1LG1A 1H2JA 1JQXA 4GIYA 3NZPA 3BLLA 3W73A 2PDQA 2UY4A 5JBDA 1ADOA 4KWSA 3QC0A 4LBUA 4MB4A 1A50A 2A3BA 3A6OA 4JIHA 1E4NA 1A4LA 1FFRA 4CD8A 3VINA 1KRMA 1EZ2A 3V35A 2C8NA 4GYFA 4AY8A 5EBAA 2HSAA 1V5XA 2WNQA 4IWWA 1ZAIA 3LM7A 1EIBA 1UQZA 1JZ7A 4NAFA 1BRLA 1PX8A 2B7OA 3ZYZA 2PF8A 3T05A 2C1IA 3F5JA 3BOXA 1FOBA 1HN1A 5A8GA 4AVNA 1VH7A 1JGMA 1VBJA 2X0HA 3S9YA 4GI4A 4DWSA 1HL2A 3RR1A 1YHTA 4JTQA 2Y70A 5LA2A 3W01A 3WY1A 3B0UX 4O50A 3CUZA 4UQEA 2EEXA 3EMCA 3DEQA 1IWBA 4DNMA 3K4WA 4HU0A 2OYLA 3EWWA 4JFUA 1W1VA 2GJXA 3BLDA 3UP8A 3DENA 4KH2A 1RK6A 2Y4SA 3QMTA 1WOAA 2RAGA 1W1PA 1L8PA 3W7HA 3TP4A 3M0XA 3B06A 4UFLA 1W9VA 3WO8A 1T99A 2CBJA 2VZVA 3LMYA 2F2KA 2IKJA 4JR5A 3ZS4A 1NAL1 3NQEA 3WNOA 4W93A 3R11A 2JQXA 2ALDA 4PL2A 3TWBA 1QNVA 3T6CA 2VRJA 1KKOA 3CEUA 1P7TB 3AC0A 1WE5A 1V3HA 1LL7A 1Y5VA 4HYVA 3NL3A 4PGLA 5A6MA 1XDLA 1XICA 2VEIA 3M1ZA 4ERAA 3FIGA 1VHNA 5DT7A 4WHBA 3W1XA 1WV2A 4H00A 2G4JA 1GQIA 1OFRA 3BQ5A 3U3HA 2V68A 3E6EA 3SY1A 4IT1A 3M4HA 1V93A 4MJMA 1P5BA 3IGXA 3L4YA 3W7DA 4DZIA 1W3HA 2POTA 3S5SA 3KTXA 4LNCA 1JYNA 1FH7A 8XIMA 2H6RA 4MPKA 4WXZA 2WZIA 5F1UA 2GQ8A 4ACZA 5E93A 2VC6A 2QXWA 4H19A 5AC5A 3WK3A 1OGGA 2ZRYA 3IUHA 2W62A 1WOBA 3F4WA 3SJ3A 3GIYA 2NV2A 2PS2A 1YBQA 2OOGA 2PDWA 3ATYA 1FHUA 2V8ZA 2IXUA 1QHPA 2OO0A 4JX5A 3MUXA 3HMCA 3NPWA 3C0SA 2ZZ6A 4MB1A 4H1ZA 4YVVA 1RP9A 1O95A 3VGEA 3W2KA 3QR0A 4PSRA 5A6KA 4LV9A 3OA5A 4L61A 3FJ4A 3KCLA 1LOQA 3EPNA 2YBUA 3AJ7A 4Q8WA 1KRAC 4QROA 1EEXA 4MFEA 3VD7A 1PYMA 4MM1A 4B9YA 1JL8A 5REQA 3LTSA 4MWAC 4Z1YA 1MZRA 2BXZA 4D9PA 4KF1A 3GW3A 1V6UA 2Y5JA 1NOWA 1PZ2A 2ZRVA 1WB0A 1Q4NX 4A8IA 4KEUA 2Y6ZA 6TIMA 2J4GA 3I6TA 1TJ1A 3URBA 4IZGA 2Z6IA 1SZGA 4FLQA 2WKGA 4UUIA 2GPTA 4O54A 1RLDA 3RCMA 4UFJA 1GTHA 2G3NA 1NWTA 3A4JA 3F4VA 4ZE5A 4CNOA 4C7FA 1D8CA 2G97A 3IAPA 4FXSA 3W1AA 4C6DA 2GUYA 2EG8A 3WQ8A 3ABZA 1XGZA 2J24A 2WLZA 5F7UA 1BXCA 1TYGA 4NZ4A 3RILA 4GE8A 4GUIA 1AW5A 1BHGA 2FIQA 3OW1A 3NPXA 5AOUA 3IGHX 1ONXA 2DIEA 3MP4A 2PF0A 4A8NA 5AHEA 1XLFA 1TO3A 3MO7A 4C6KA 4HPJA 3B40A 1IV8A 2R82A 2ZE0A 2QDHA 2F2HA 1V7AA 1X6NA 1VCVA 3EMZA 2C3ZA 4XSLA 2CZVA 3AS0A 4QITA 3HB9A 4PUKA 4AZGA 3QHNA 4AHPA 1AQ0A 2V5DA 3LV5A 2V63A 4OUEA 4QAWA 1FDYA 1KXHA 1X8CA 3ZLHA 4GGBA 2GSEA 4YTUA 2PLJA 3WBYA 1GKPA 5LA1A 4MDPA 2YGYA 1BYDA 2QDEA 2PE4A 4BQ5A 4R7JA 3A13A 3DX5A 3LB0A 3FKKA 3OPSA 4C6MA 3A3XA 4UIOA 5I02A 5CPNA 2BVYA 2WVUA 4UQ9A 3TLQA 1OC5A 2F8QA 2VZSA 1VP5A 4FSAA 4FK9A 3RMJA 1S2AA 1CPUA 2XVNA 3ELFA 2PB1A 1CB2A 4N9DA 4JS3A 1NEYA 1IQ8A 2YCKX 4KCVA 4Q4MA 4RDWA 3ATZA 3MHFA 1X8FA 4K3ZA 3VNJA 1W31A 2PI6A 1CGVA 5J5RA 1E6XM 2EG7A 1J2WA 2ZXQA 1M01A 3PVFA 1TSIA 1W2VA 4O17A 2EF9A 4CNSA 1QOPA 1UR2A 3QVQA 5EMUA 1JYXA 3BAWA 1E4IA 4EPBC 4R53A 4JQ4A 4K37A 3LGDA 4G5DA 2AGKA 4GD0A 3MSRA 4Y96A 1KR1A 4B3ZA 5D33A 4H6QA 5IDZA 3G1RA 2Z1BA 3W7KA 3PTKA 2ZX9A 5MHBA 4W88A 2VUNA 2QJHA 3KL0A 1H11A 3WQGA 1K1DA 1OG6A 1LBFA 4P5UA 4D8AA 4XAFA 1B57A 5FL1A 2Y0FA 2E3ZA 1A5OC 1PX4A 4TUFA 3ARQA 3LCLA 2QPXA 3TH6A 2XJ7A 1KM4A 3BW3A 1WA3A 3KL5A 2Z00A 4XK2A 3G6MA 3G24A 3T4CA 3E9AA 5DXXA 1DIDA 3PUDA 1YE6A 2PRHA 3RDKA 1R6WA 1PKNA 1ZJIA 3Q58A 4I7VA 3N13A 3C8NA 4AZIA 4PZVA 5H8PA 1Z42A 3OA3A 1U22A 3HV8A 5LIWX 4N6EA 4AHOA 3UPWA 1AZ2A 4GI9A 5JQ9A 3NVTA 3WG6A 4D72A 1PEZA 3UJFA 4IQDA 4LXFA 1ZBWA 2ZXBA 4WDTA 3R8HA 4UTHA 4PUNA 4CD7A 1E0XA 3CBWA 1VJSA 1NARA 3AMLA 3AYTA 4F9JA 3N19B 3GHUA 4IQJA 4S3AA 1H7PA 3WQPA 3ARZA 4EXQA 1OFOA 1RPXA 4M82A 4NUW<