2ISFA

Crystal structure of c298a w219y aldose reductase complexed with phenylacetic acid
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
314
structure length
314
Chain Sequence
b'SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Structural and thermodynamic studies of simple aldose reductase-inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 100
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2006-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2isfA00
1T40A 3CV7A 2HEJA 4L1WA 1S2CA 3ERPA 1VP5A 4F40A 2FZ9A 3EB3A 4LB3A 1T41A 1YNQA 4FZIA 2J8TA 1ZQ5A 4QBXA 2PDUA 3R7MA 4XO7A 3GHRA 4WDXA 1US0A 1Z3NA 2R9RA 1Z9AA 3EAUA 1Q13A 3BCJA 3RX2A 3WCZA 4AUBA 2IQ0A 1J96A 2PDPA 3Q67A 4JTRA 4OTKA 3LQGA 4WGHA 5AZ1A 3LD5A 4YS1A 4PRTA 2PDCA 4YVXA 3R6IA 4IJCA 2PDMA 3H7RA 1FRBA 2IPGA 2IS7A 3MC5A 4PR4A 3F7JA 4Q3MA 3KRBA 2IKGA 2PDIA 3FX4A 3LQLA 2BP1A 1XJBA 2I17A 4FALA 4YVVA 3UFYA 2PDGA 2DV0A 5HNUA 1YE6A 3WBWA 2ACRA 4WDWA 2PDLA 4JTAA 4FA3A 2PDJA 1HW6A 2ALRA 4GABA 2AGTA 4DBSA 3ONBA 4QX4A 1ZSXA 1S1PA 4Q7BA 4XAPA 3CASA 1EXBA 3T42A 4XZIA 1Z89A 3LBOA 3H4GA 1MZRA 4PMJA 4WEVX 2IPWA 1IEIA 4LB4A 4JTDA 4DZ5A 3RX4A 1EF3A 5LIUX 3CMFA 4ASTA 1OG6A 3UZYA 1HQTA 2WZTA 4ZFCA 1AZ1A 2PDQA 2QXWA 1R38A 3LN3A 4IGSA 2IKIA 2PD5A 4LAZA 2PDHA 1QRQA 1K8CA 4GCAA 3LEPA 4YU1A 5M2FX 2I16A 3R58A 3R8GA 3CAQA 3CAVA 3BUVA 3LZ5A 3GHSA 4WDTA 1ZGDA 4GIEA 2INEA 1AH4A 2NVDA 1XGDA 1SM9A 3N2TA 4IJRA 3UG8A 5HA7A 2F38A 1AFSA 3R43A 4JIIX 2IKJA 1RY0A 1PZ1A 3CV6A 1X97A 1PWLA 2HE8A 5KETA 4I5XA 3WBYA 2VDGA 4XVDA 1YNPA 2HVOA 2FZBA 2FVLA 4XZMX 3O0KA 4EXAA 4JQ4A 4DBUA 4H8NA 1Z8AA 1ZUAX 3V36A 4JQ2A 2IKHA 3WG6A 4FAMA 1M9HA 4YVPA 2ISFA 3UP8A 2F2KA 1EL3A 3UYIA 4EXBA 3MB9A 2HV5A 4QXIA 2CLPA 3WBXA 1MRQA 2PDXA 3C3UA 4JIHA 3UZXA 3V0SA 2R24A 3ONCA 2PD9A 2P5NA 4JIRA 1C9WA 4DBWA 3UZZA 5LIXX 3M64A 4JQ1A 3V0UA 1LQAA 4NKCA 1X96A 2C91A 3H7UA 4JTQA 2PDWA 3M0IA 3VXGA 4G5DA 1Q5MA 4WDUA 3O3RA 2DUXA 4MHBA 5HNTA 2ACUA 1YE4A 1S2AA 3LUTA 3EB4A 1A80A 4XZLX 5JH2A 1AH3A 4PUWA 4H7CA 2PDNA 2FZ8A 3V35A 4GQGA 3R8HA 5AZ0A 2INZA 4HBKA 1PWMA 2FGBA 1RALA 2NVCA 3Q65A 4XK2A 1UR3M 4XZNX 2WZMA 3G5EA 2IPFA 1VBJA 2PDYA 5LIWX 4PUUA 2PDBA 1XF0A 3B3DA 1S1RA 3S3GA 3UZWA 3N6QA 2PDKA 2FZDA 2IPJA 3R94A 5DANA 4GACA 1LWIA 4HMNA 3M4HA 3G1RA 2A79A 2ACQA 1X98A 3DN5A 1GVEA 4LBRA 3RX3A 4QR6A 1AH0A 3LENA 4LAUA 3GHTA 4JQAA 1IHIA 2HVNA 5LIYX 4WRHA 4GA8A 5JH1A 3GHUA 2BGSA 1QWKA 3DOPA 1AZ2A 3UGRA 3LZ3A 4R9OA 4GQ0A 4JQ3A 3BURA 2BGQA 3GUGA 3FJNA 4ICCX 4LBSA 1MI3A 5LIKX 1PYFA 2IQDA 3QKZA 3P2VA 4XO6A 3V0TA 4L1XA 2PZNA 2PFHA 4XZHA 3LNMA 2HDJA 1JEZA 1PZ0A 3D3FA 2ACSA 2PEVA 2DUZA 4JTCA 2PDFA 3NTYA 1ADSA 1EKOA 3UWEA 3BV7A 2PF8A 4PRRA 1RY8A 3U2CA 4XVEA 2HE5A 4RPQA 5C7HA 3COTA
chains in the Genus database with same CATH superfamily
2OOGA 3WQWA 4JDYA 2WMIA 3B0VC 1XDMA 4QCFA 3WBAA 1V02A 4F40A 4A3YA 1A5MC 2QUTA 2BOEX 4KS0A 2QPSA 2I5QA 2YB4A 3B9DA 4QBXA 2PDUA 1RVKA 2GDQA 3AHTA 4X9YA 3OO2A 4GO9A 4H00A 4WXYA 3LCIA 4NX5A 4C6IA 1BSIA 3PFRA 4KKXA 4CD4A 4JR5A 3DH7A 4MIMA 1B54A 4J5NA 5G2WA 1J96A 2ZX6A 3VO0A 3SN1A 3NURA 2WJZA 2QCCA 3VFLA 3CL7A 1E73M 1R3SA 4FSAA 6REQA 1QNOA 2ZUTA 3MO4A 4NAEA 2VRJA 5DMNA 2W3ZA 3E02A 2ZA1A 5DF0A 1U2YA 1MDLA 5FESA 1R3QA 5I3FA 3TFXA 3U7VA 5D2VA 5I78A 3SY1A 3TXVA 2WMHA 3BARA 3ARTA 4K1WA 1A3HA 1R7AA 3QC0A 1WDRA 1VBGA 1HT6A 4IGHA 4I9AA 4FIRA 1YDOA 4LVAA 4PMRA 2OT0A 5KITA 4H8HA 3ZWTA 4XG1A 3ZWSA 3RCMA 1JPHA 2O9PA 2WHMA 2VVNA 2UY5A 4CD8A 1K4GA 3AZRA 2OQHA 2Q6ZA 1RP9A 3ZVHB 2OT1A 1W8GA 4MZ1A 4EK7A 5HINA 3BAKA 4AVOA 4XAPA 2I9EA 1VIWA 1F6YA 3KOZA 4IGMA 4YNGA 3ZT7A 3W7MA 3MP5A 1MEHA 3H4GA 3GAKA 4KT2A 4PMJA 1DTNA 2P88A 2NQHA 1PPIA 5D8WA 1B0IA 4M7SA 1NIUA 3CT2A 4OU1A 3BQ6A 2HSAA 4QDWA 5LIUX 1GVYA 3HQNA 1CNVA 4WF7A 2HS8A 3M6YA 2ZUNA 5BW6A 2WWDA 1PX4A 4AY8A 2ZX9A 4MFEA 3UERA 4V2XA 1Z7AA 1Q2SA 3RUBL 3MHGA 3L7RA 4JFVA 3K8MA 1EWDA 2PS2A 3HBLA 4O28A 4A8RA 3NQ2A 1LUCA 4GZEA 2AGKA 1O6IA 1QHOA 3KUMA 2F9RA 1OFBA 3AXXA 3GLCA 3FS2A 3TN6A 4RX0A 5AYZA 5BMWA 5J04A 1TTPA 2INEA 1UR2A 2E9BA 2O92A 1I6NA 4L5ZA 4M1BA 4QQUA 2E6AA 4QG9A 4QG8A 4US5A 3S2LA 3DESA 5LKYA 4O10A 3AU6A 4LNYA 4R3UA 4AYSA 3AZSA 1TPVA 1ALDA 5AOUA 4KETA 2HE8A 1R87A 5F7UA 1JYNA 2ZVIA 4QISA 4ML4A 1VYPX 3FGCB 3UG3A 4FLRA 1NWRA 3A5FA 5A6SA 3GXMA 2OG9A 1FDYA 1KM6A 2YDQA 3UU0A 5LA0A 4JQ4A 3O0FA 5F2MA 4QE1A 1Z8AA 1G4TA 3H55A 4LJ3A 3KBJA 4JTLA 1EJXC 3M0VA 1M65A 4QNEA 1XD1A 5I24A 1SO4A 3O6YX 3D46A 1A5KC 2F84A 3OHMB 4NHVA 4QXIA 2XZ7A 3QW3A 3C3NA 4DHGA 4JIRA 3UZZA 5G1MA 4JY8A 1FY6A 4L6DA 1JNDA 3QLDA 2Y5EA 1JDFA 4UUIA 4XSLA 3TEVA 4IIFA 3M0HA 1I0DA 1TWIA 2G4JA 4JTQA 1MXDA 2YA2A 3BAYA 3EYPA 1US3A 1ZPTA 6TAAA 1OC7A 2VZOA 1QI2A 2CZFA 5BRQA 4WDUA 1Q5MA 1TWSA 3SQSA 1ZBWA 2DUXA 2CZDA 1ZY9A 5TAOA 1P5BA 2OSXA 1A80A 1GYNA 3BG9A 1ZAIA 2RJGA 1CB2A 1X1NA 2CYGA 3GVRA 3DERA 3W38A 4IXXA 1NF0A 1CGUA 1U33A 4QEEA 5L6UA 2Z1KA 1H1ZA 5CBIA 3QSRA 2OEMA 1S5WA 4MKNA 3DXIA 5C54A 1X7IA 3C0QA 2Y5SA 2DFAA 2PTDA 4K37A 4DLMA 4MKVA 5JBDA 1MUMA 4LAOA 4N4QA 3WLKX 2OSWA 4IX2A 4GZIA 3PHAA 5DANA 1R2RA 1VR6A 3M07A 3IIXA 4EE9A 3OP2A 3PPHA 1LUCB 1XH2A 1R3RA 4EWND 2XIJA 1PJ9A 3EZ4A 4M0XA 1AJZA 1B57A 1VPXA 3GHTA 3PJWA 5D8ZA 5EL1A 5JH1A 1W5QA 4AD3A 4DAIA 2VXNA 3DFSA 5KINA 4XBKA 3REQB 2OU4A 2QW5A 4OWGA 3AZTA 3UXAA 1I1XA 2HQAA 6ALDA 3DFQA 1NP2A 3JU2A 1FWFC 3TW9A 1J79A 2ON3A 3GO2A 3GDMA 4OHQA 3OZOA 1AVAA 2XISA 1UHVA 4WD0A 1X6LA 4UFHA 1BWKA 2AL2B 3WLRA 1D2KA 3BCFA 3EKLA 3P84A 4MGGA 1E4MM 2W62A 3VGEA 2GUUA 1NAL1 4I9JA 2Y6ZA 4IPPA 3G24A 3RR4A 3VNYA 4K7YA 3W2LA 4NZ4A 2VEKA 1E5NA 2Z2UA 1XRSA 2GQ9A 3W87A 3TYZA 1NFPA 1OYCA 3WELA 2Y7GA 3G8EA 1RLCL 2XSXA 3N6HA 1TO3A 5EMYA 2VWTA 3DFOA 1PBGA 1QW8A 1E9ZB 1KKOA 1VEPA 1W3NA 2RH9A 5CPLA 3FAWA 2GZXA 2PRMA 2XG9A 3KZPA 4PBFA 1DKWA 3RFAA 3ZO9A 1ECQA 4GY0A 1DBTA 4Q4SA 4MWAA 3GHRA 2WOQA 4PMDA 1J5TA 4XB3A 5FF2A 1THFD 1GPFA 5GJPA 3PBWA 2Q09A 3QZEA 1LL7A 3W7EA 4AD2A 3AIQA 3BCJA 3RX2A 1EC8A 2OVLA 4RE4A 3S1UA 3BQ5A 3CIWA 3CZJA 5FAGA 4AX7A 2ISVA 4RNIA 3FYOA 1VFUA 1CX9A 1W37A 4YS1A 2VD9A 1GZ1A 1XX1A 4AZGA 4IJCA 4UIOA 2PWDA 1SFSA 1V0NA 7ODCA 2DT2A 4S39A 1D3GA 1B5TA 3GVVA 3II1A 3NL2A 1UUQA 4MNLA 1KO0A 1NFGA 4A22A 2BODX 4OIFA 2WB5A 3WLSA 3QY8A 5KTLA 4E2VA 5I3KA 3DFNA 1WDSA 1EJTC 3AALA 3VIMA 3M0LA 4KPLA 1UKQA 5D9MA 3VDGA 3TH6A 1O5QA 4W9TA 4NVTA 2NV1A 3DFHA 4MVAA 4GI6A 4MLRA 1UW9A 4AD4A 4N9DA 1DE5A 1PX8A 2ZICA 2OLHA 1NDZA 2OWWA 2FMNA 5FACA 3ZSTA 5G4HC 2XSAA 1S1PA 5HATA 1OCJA 1W5PA 2VUYA 1PDZA 3EDKA 2FHBA 1GOQA 4CN6A 5E09A 1GTEA 1MZRA 1TWWA 4ES4A 4ZCWA 1LDCA 2E7FA 4LB4A 1UOZA 4ZL1A 3RYSA 3O16A 4ZO9A 1X8FA 1RA5A 1E9IA 1OG6A 5CJMA 1CGXA 3BLDA 5BRBA 2OZTA 2QXWA 3LMYA 2CETA 3HQPA 4AIEA 2JKAA 4Y96A 2LLEA 2PD5A 4AY7A 2REQB 2GQAA 1K7EA 1OGGA 1P7TA 4ORMA 1X39A 2DW6A 1C7TA 4H7ZA 1CXFA 4W85A 5M5DA 3W85A 3GHSA 4MNKA 2VC7A 4WJEA 3JRKA 5IFTA 3F4CA 1SM9A 2Z00A 2XVKA 1G6CA 1KM3A 3GIQA 1K9TA 3R43A 3PPGA 1V6YA 3BLPX 1HFBA 1GOWA 4UMCA 3PTDA 2PI6A 1BG9A 3FKRA 4U28A 3DBNA 5AB3A 1Q3NA 5CH9A 4OV4A 3BE7A 3TSBA 4RL3A 5D05A 5BRPA 2VZVA 5HNNA 3VE7A 1XP3A 2E8YA 3QM3A 4DBUA 4F3HA 1H09A 1I75A 4Y8EA 3ZR4A 2BXVA 4FAMA 4GBUA 2ISFA 1LT7A 3KP1A 3GK0A 3W2UA 3MB9A 2PDXA 5FF4A 3IARA 4MLJA 2V8ZA 4ZBCA 3ANUA 2QR6A 2YDAA 3NDYA 2WMJA 4R7JA 3A3HA 4MB5A 1H61A 3M64A 3TOYA 2NVAA 1W3JA 4MY8A 1LG1A 4IFRA 3L2IA 3E49A 3H8AA 3AXIA 3CPRA 3P5ZA 3FNDA 5GJNA 4WKHA 1XG4A 3IV8A 3M44A 3EMZA 4MHBA 3MMWA 3RRXA 5HNTA 1QI4A 1RUSA 1MW2A 5KMYA 4H7CA 1QOXA 4J3UA 4X3ZA 3S8HA 2JFEX 1JR1A 3LHWA 2OYLA 5DCBA 3M0YA 1ITQA 2FGBA 4JFTA 3UF9A 1GOIA 1VJIA 1J18A 1X1ZA 3IK2A 4LRTA 3E0VA 2NQLA 1RP8A 2E1WA 1AD1A 1XF0A 1E71M 2C15A 2ZZ2A 3PY2A 5HANA 4C6LA 3FFSA 2PDKA 3R94A 4C6BA 3AFBA 3SGZA 3WLPA 5ENLA 1POKA 3NR0A 3C2RA 3TYEA 1JPKA 1QASA 3WDJA 1OT1A 3U4FA 1IEQA 1UWTA 2FDSA 4Q8OA 4G1NA 3H26A 3VUSA 4NXKA 4WRHA 1XDJA 2GJNA 3CYJA 4XSMA 1OWQA 3ZMRA 1XLMA 3FYYA 1IEWA 2UY4A 3QKEA 3LZ3A 3CEPA 5EBAA 4NF7A 1JZ6A 4XQ6A 1CI1A 4NUWA 3H23A 4ZE4A 1KNWA 4Q4PA 3QPZA 2OKOA 3I68A 4ZENA 1N2VA 3NDOA 2AKMA 5LIKX 4Q8UA 2YCIX 3PJUA 3WH8A 1A0EA 1CXLA 3VKDA 1LORA 3PPCA 1UD2A 3IJDA 4K39A 4I6VA 1W3IA 4NU7A 4UTTC 3TNOA 4BK9A 4PRWA 4JIQA 2PF8A 1E0TA 2BXYA 3C2EA 2QUMA 2WSQA 4M5PA 3GW3A 1VRXA 5EMUA 3GW0A 3AHYA 1VHCA 1Q7ZA 5LHEA 1RVGA 4LS0A 4QS6A 1VP5A 4TV5A 3W7QA 4OOUA 4FNTA 2W9MA 2TSYA 4LCSA 3CC1A 3TONA 4FP1A 4C1NA 1KFCA 4AIOA 1LLZA 1XI3A 4JEJA 4X60A 3RPDA 1FX6A 4GNVA 5F1VA 3RLUA 2Z1VA 3S5SA 2QVNA 3W82A 1T8XA 3EB2A 4Y9OA 1O68A 2D0HA 4PRTA 2FTPA 4C6FA 4UFIA 1OFOA 4PE8A 3GX9A 4GYFA 4NILA 1HO1A 2V5JA 1XLLA 4IMGA 5JIWA 3MHFA 3LPGA 3MMTA 5FF7A 1XIEA 1V93A 2ZE3A 3QPEA 1OZMA 4BKNA 4HYWA 3IUIA 3FXYA 4PBEA 2GDVA 4NZFA 1KFEA 4IG2A 1OT2A 4PTVA 2X05A 4KGLA 4LYKA 3WF0A 2OJPA 1NELA 4CKQA 3UR7A 1YADA 4WXZA 3WDIA 3GC2A 3KHJA 1QU4A 3N9RA 4RE0A 4UNIA 2VQUA 2O55A 4LAMA 4O1DA 2VC6A 3W7NA 4DPPA 5XINA 3ZR6A 2OO0A 1JZ7A 2X40A 4D6IA 1REQB 4H3DA 1I4NA 4U3AA 3KXQA 3LTYA 2Z2BA 1NARA 2VOMA 3AU2A 3LXCA 1QI0A 2OR2A 5FIPA 3VIJA 1W9VA 4QAWA 2TPSA 1TJ2A 1NDVA 2CHNA 4ASTA 7PTDA 4BEUA 3WEMA 1EX1A 4WOQA 2E9MA 2VP8A 1GJWA 2E67A 1TWZA 4M81A 1MNZA 2C13A 3DKLA 3WFZA 5HMFA 2J7EA 1TJPA 3LU2A 2X2YA 1W9UA 1GVQA 2ZRYA 3GM8A 4FLOA 2FH8A 1QRQA 4MZYA 3RU8X 4ICNA 1A0CA 5FKYA 4MF4A 1Q6LA 3GNOA 2YCKX 3VM7A 4H19A 1MDRA 1ZGDA 3DI0A 3R79A 2FKPA 2R1LA 1ZU8A 1KTNA 3T44A 2WBGA 1RBOB 3NQDA 3W7CA 5DXXA 4EAYA 3PBMA 4KEVA 3BJSA 5C9RA 1DQUA 2Z6JA 1FHDA 4HJFA 5AC4A 3FSUA 1LOLA 2PF0A 2DZXA 3AHZA 1CIUA 1KWGA 4A3RA 4BF5A 4LVFA 3DC0A 1QNRA 2OMAA 3CUXA 2A85A 4FF7A 4C1NB 3UD6A 4DPQA 3B8DA 1N8WA 1HJWA 4JD4A 1QPOA 2ZZ5A 1AG1O 4NJIA 2FVMA 3JS3A 4DYJA 4G7FA 1K7FA 1OD8A 1EZ2A 1HIZA 1IGSA 5BCAA 3TZFA 4G7EB 2BHZA 1W31A 3EWBX 3SGUA 4E38A 4PL1A 7ENLA 4HOXA 1FUYA 1WV2A 3KLKA 3SRFA 1XGZA 4MAVA 4C7DA 1HL9A 1XQKA 4DBWA 2QDEA 3ITOA 1AJ2A 1J0JA 2YW4A 1JF6A 3V16A 2V30A 4JQ1A 3WD1A 1E15A 4DWSD 1RBLA 4HCHA 1GHSA 1WKFA 4ROQA 1L6GA 4QG6A 4M19A 2QMKA 2PCQA 3WF3A 1SO3A 1O5RA 5A6BD 2E09A 4A8LA 3T0BA 1F3EA 1NDYA 1E1EA 1RSCA 5BOEA 2EEXA 3BW4A 3DKJA 3B9EA 4H8UA 3EB4A 2F6XA 4GVHA 4QGCA 2VR2A 3TXZA 4QLKA 5DMYA 3VKJA 4UQCA 1RQBA 4HPJA 4MJMA 5CKSA 3MCMA 1E51A 4H9XA 3MMUA 1WOBA 3WQOA 4H9VA 1XRVA 3NQMA 4ZE5A 1YLVA 3AYVA 3O6CA 1PDYA 4LV4A 4OV9A 1S2TA 1J0IA 2DT0A 4MNJA 2PDBA 5C9WA 2OCZA 1LRTA 1UD5A 2GVGA 4RZ6A 2DZVA 3FVDA 3OBKA 3BPWA 4BI6A 1MEIA 2CWXA 3C0SA 2G3FA 1OVDA 3WNMA 4UTIA 4WY0A 3PZGA 5D2TA 5AYIA 2RUSA 1BYBA 3CHDA 3AUOA 4RW3A 4BQ3A 3ARSA 2FFIA 4HPGA 1S5MA 2BB0A 4JTIA 5LSMA 3GNNA 2QCDB 1KW1A 3WD2A 3TW7A 1UPPA 4HNCA 3TROA 1KBJA 2GSHA 1DQXA 3VNDA 3GAYA 4NJJA 4Q4OA 3TQ0A 4CN1A 3FJNA 4O54A 4GJIA 1R30A 4FNSA 4DI9A 3KL3A 3WQ4A 1UMLA 3VOCA 4RDVA 4EPBC 4XO6A 2ZKMX 2XVLA 3OTRA 3IIPA 1V3KA 4ZQNA 3HPXA 1I2OA 2Z7KA 1V6TA 2BSLA 1R3WA 3FIGA 1HKKA 3TDFA 4IQLA 5XIMA 2XVPA 1GVSA 3HGOA 2HXTA 3WQVA 3IK4A 1DHPA 1AUSL 4QDPA 2J13A 3FN9A 1GYLA 2QGHA 4POCA 4S3EA 4DBDA 5C7HA 1EPVA 4ONVA 4Y9PA 1VJSA 4RNHA 3KVMA 5DCEA 1CYGA 1A3XA 1LQ2A 4DZIA 3E38A 4ALDA 5KZDA 5MKGA 3RILA 1TMHA 2FZ9A 3EB3A 3URAA 1NVMA 3HV8A 4KWOA 5FJIA 4JAWA 1FVPA 4GH1A 1G5AA 3ZSSA 2XIMA 2ONEA 5GNZA 2YBVA 1BVNP 4D6FA 4N9CA 3T4WA 3L67A 3WMSA 1YHTA 3GD6A 3GZ3A 1OIMA 3EAUA 5M17A 1XG3A 1DJZA 3BC9A 3ZT6A 3Q67A 4JTRA 2V9DA 2WLYA 1EZWA 1FH8A 1E0UA 3M0JA 5I3HA 1AODA 3I7QA 4D8LA 3WJYA 1YIXA 4P8XA 5FJUA 4LXFA 3S6DA 2HMCA 2R82A 5C9XA 1CXEA 1TX0A 4Q33A 2PDCA 2HK1A 2PDMA 4DB7A 3IEBA 4FB7A 1R2SA 1ZLPA 5I00A 4FOJA 3G0SA 3HGJA 3CTLA 4R34A 3CHCA 4M7TA 1AL7A 5JIPA 4K8GA 1WE5A 3OGSA 3NM3A 2J6VA 2E8ZA 4IH3A 2WHJA 1YQ2A 3LERA 4L4LA 1VLIA 4LEFA 1PS9A 4L61A 3CU2A 4YL2A 3VD9A 3UFYA 2XVNA 1TKKA 4IPNB 3GB6A 5FF3A 1EC7A 4WY0B 5EMJA 4A35A 2GSJA 1Q6OA 1HXJA 1FWWA 3VNKA 3WEOA 3WO8A 2AGTA 4UQEA 2DZSA 1PHQA 3CUHA 2XPKA 2XYLA 1MWOA 3G3MA 2PMQA 3FVMA 1CGVA 3H4XA 3NVTA 3RO6A 4WEVX 2ISDA 3OPSA 1WCGA 3VYLA 3FHQA 3H6OA 3UEQA 1DJHA 2J25A 4AAJA 3S1VA 4DUXA 4XX6A 1KB3A 3TQVA 2VX4A 4ZFCA 3MT1A 1JI1A 4GNKB 3PVFA 3RAOA 4ZO7A 3VD3A 2XGBA 3VNMA 3L12A 3L66A 3O6DA 4O14A 5HR7A 1XYMA 2PDHA 4GRSA 4UOZA 3T2QA 3WJXA 3PB0A 2PPGA 3S6TA 1E5JA 4C5YA 2CZVA 3RRAA 2PA6A 1BD0A 2F38A 4MWAC 4N9BA 3SCWA 4AXKA 5D9NA 5CGMA 2C1IA 3LLDA 1XYLA 3ALFA 1UWAA 3EWYA 1QVBA 1UB3A 3W53A 2JF7A 4X2RA 3MUXA 1XH0A 4BZYA 3WUFA 2DVUA 1PX3A 3B0YA 3VK5A 2QYGA 3DUGA 4WUIA 1SJCA 1LCOA 5EPDA 1ISWA 3ES8A 2HPIA 4LSBA 3N2OA 4FNPA 2H9AA 3CO4A 5CC5A 1H1YA 2F2KA 1C8QA 1KFJA 3LA4A 3BWWA 3GVWA 1MRQA 3VE9A 3KVLA 3CMJA 3DCPA 1V0MA 2JIEA 3BAJA 2X7VA 1JIBA 2ZCGA 1UA3A 1L2UA 4V15A 3GBEA 1J9YA 2QV5A 1L8NA 4C6JA 2EJ1A 4UMAA 4WSHA 3B8VA 5BXTA 4N2YA 2GGEA 2CLKA 2XH0A 2VX7A 1UD6A 1J93A 4Q8WA 2DH3A 3PAJA 2XSBA 4ENLA 3SO7A 1O60A 1LRNA 3W4RA 3S2MA 1L2QA 3LUTA 3LYEA 4BQ5A 2ZTJA 3I3EA 3B8TA 4I7UA 3BAWA 1GPWA 3MMDA 4AZCA 2WXDM 3VIIA 5MF5A 1JZ5A 2XIOA 1H50A 1LWHA 2EPOA 1HF6A 3BSHA 1VBJA 2ZC1A 1I2RA 1K9EA 1DXIA 2RDXA 1UH3A 3H2NA 3UY8A 3NQFA 5A94A 1CB7B 3S5ZA 3A4JA 2OB3A 2VFDA 4M56A 1VF8A 1LWIA 3HG4A 3PJTA 2EPHA 1E3XA 2F6KA 4JX4A 2VCBA 3AAMA 2A3LA 3TCSA 1BRLA 3CYVA 2CEQA 2JGYA 1EX5A 4ZB2A 3QGVA 3RJXA 2XVGA 1CTNA 1BGAA 2DSUA 3RXZA 4L9YA 4AY1A 2QCFA 3NYDA 1OGSA 5CSRA 3E74A 1TQXA 3ZLFA 5EA9A 3IGHX 3W6MA 4LW7A 4GLEA 3APGA 3H2OA 2YGYA 3AMDA 1MQPA 3R11A 2A2IA 3EOOA 1VHNA 1FHVA 3M41A 4ADTA 1VFSA 1XFCA 1TPWA 2D1ZA 4IOTA 1QAPA 3TSMA 3S5NA 1VPYA 2DVXA 3WMLA 1OYBA 5D09A 4PB4A 4DF1A 3RPMA 1ME9A 4QDMA 2C0HA 1NEYA 4Z1DA 5D04C 5A95A 2VDHA 4RPQA 2QDGA 1MYRA 4B4FA 3B0XA 1TV2A 1DJXA 4L1WA 4KERA 3LDVA 2ZC8A 1A5SA 2YBTA 1WDQA 4K6AA 2DT3A 1XSIA 4ZQRA 4GVFA 5GNYA 3R7MA 1I9CB 2JIWA 2YOCA 4AEOA 1JGMA 3R4IA 5EMLA 5M03A 4E4UA 3WQPA 1R47A 1IWAA 2P0IA 1ZCOA 4H9YA 1FWHC 1WX0A 1SU5A 4H04A 1JFXA 3CTTA 5A3HA 1ML1A 4LTSA 3Q58A 2OOFA 3CEUA 5T26A 4UNLA 1XR2A 4PL2A 3W1UA 2WMFA 2B4GA 1OHLA 2Q8LA 3R0DA 1S2UA 4NP7A 4WHBA 1AJ0A 3L65A 1DYSA 1F4HA 3VABA 2WM1A 5CPSA 4A2RA 3B9OA 2WCGA 4MB1A 3GNPA 2FHCA 4AB4A 2IKGA 1XLEA 3VZYA 3QR1A 1DE6A 1S2VA 2AAAA 4HZMA 3SECA 3BTNA 4DNMA 3W70A 3STCA 1J0KA 2ACRA 4ACZA 2BLEA 4HT3A 3WK1A 3A4XA 4JTAA 4FA3A 4L64A 7CGTA 2J6XA 3LCHA 4A8NA 2WJFA 2EG6A 2VCCA 3B9AA 3YPIA 4IMAA 4FNRA 3SBFA 2FYMA 4OBRA 5TIMA 4LC8A 3I10A 3G0UA 4KCTA 5T91A 3MTWA 4EVZA 4XD4A 4J3VA 3OGRA 3LCLA 1E0VA 5IDIA 3WK2A 1SQ7A 1UKOA 4CD6A 1W1B1 3CZLA 3ZFHA 3WFLA 3EKGA 2ZUUA 2VURA 4RUBA 2PZ0A 3GNRA 4DZ5A 3DYOA 2B31A 5HPCA 4S38A 3NQVA 2GUBA 2RFGA 4HU0A 3DG6A 4LCQA 5E0KA 1GEHA 4X0VA 5AC8A 2O56A 3LV5A 1TJ0A 3ANVA 5BXSA 3PZMA 3S42A 1PIFA 1JD9A 4MMWA 1WUEA 3VCNA 3ABOA 3LN3A 4PUKA 4UTFA 1BFNA 3B8IA 1Q66A 3L2LA 1P48A 2QJGA 3QPYA 3UQNA 4AG0A 3GWQA 1T99A 2Y8VA 3EMQA 4GE8A 4Z1CA 2A3AA 3MUAA 3WUEA 1MFVA 4MNMA 4C1LA 3UCCA 2X0HA 3N9SA 5KZEA 1KCKA 2OKTA 3BANA 3I6EA 2F6UA 3BV4A 4H4IA 4ZXLA 2HVMA 2VGFA 5LA2A 1SZEA 1BG4A 2P76A 3ARYA 4GJJA 3G0XA 3QH2A 4CCCA 1IZCA 3C2VA 1A4MA 2X09A 2WVVB 3MI3A 3SI9A 5BMXA 4HU4A 4NI3A 3OLDA 3E3HA 1HKWA 2BHUA 1V4YA 3CO8A 4XVDA 2Q3RA 3MWAA 5FJPA 5B7ZA 3OQEA 1PZ3A 2PU0A 1GONA 1KXQA 1TFVA 3CV1A 3F4VA 3JR2A 3W71A 1BHGA 2G37A 4C7FA 1OK6A 3V36A 4CNNA 4IIEA 2IKHA 5IHSA 1U1UA 3TIMA 1KLYA 4GNJA 3DZ1A 1AW1A 1JDAA 4AWEA 1LLWA 3W7IA 1NM9A 5G1YA 2PD9A 4QEHA 3UZ5A 4TVCA 1V02E 1FHUA 4TUFA 3RM9A 4O53A 2XM1A 1QHPA 3GDRA 3B04A 1QR7A 2ZWYA 4MM1A 3VKCA 4IF2A 1J4EA 2A7RA 3SCSA 1WZMA 2PP3A 2FPYA 5B80A 2YCLA 3OG2A 2E6FA 3RCNA 2PODA 3NQ6A 3R8RA 1RK6A 1Q6QA 4IIHA 3OHIA 1A47A 2EGZA 1YPIA 4PUWA 4DWSB 3KCJA 3KLLA 3MKVA 1M5WA 2FFCA 1KQZA 1UP0A 2NLIA 2NVCA 1TVNA 1UKTA 5FJRA 2ZQ0A 4YTTA 2MUCA 2F61A 1ZS2A 3W83A 5K2ZA 1EP1A 1C8VA 3BVJA 4FXJA 2ODOA 1TSIA 3DFTA 1VH7A 2PLJA 4LF1A 3TQKA 5EGRA 3GXPA 3SCPA 4CVWA 3AIBA 4E2BA 4GACA 1R7OA 1UR1A 3OU8A 4IMDA 4HGXA 2Y89A 5K9CA 2G3MA 4PEEA 3LENA 3QGAC 3RM8A 3MV11 1Z69A 3MPGA 2DSVA 4KRUA 2D24A 2D2OA 3JZEA 2D0GA 3TR2A 1I2PA 3T0CA 2QVHA 1YNYA 1J11A 2GSEA 3N29A 5HAOA 3Q4DA 3W0KA 3WMCA 3UBPC 3BURA 2YXOA 2OX1A 3G1HA 3HJZA 3LHZA 4D6HA 4X0NA 4DXXA 4X9SA 4WVXA 1CGYA 1DWGM 4JEQA 1MI3A 1RV8A 2WVTA 2DY3A 1UJQA 4A3HA 4IWWA 3ARRA 3KRZA 3M7WA 4J2MA 4A6GA 5KZ6A 2FHFA 3LNMA 2VT0A 3RU6A 8TIMA 3EDEA 3TC7A 2OGJA 4UR8A 4QNWA 2XWDA 4GX8A 4M8UA 2WC7A 1XCWA 4HPHA 4OBTA 3WN6A 4CN4A 2B81A 4CD7A 3QJAA 3PZOA 3WQFA 2DJXA 1W1ZA 3JVAA 5CSUA 3U2OA 5FOOA 5HBFA 1ZL1A 4NIRA 5G2IA 2G97A 1NH6A 2NQ5A 4PMXA 5D38A 3U48A 1S3TC 5H2ZA 1NDWA 4UTLA 4IP5A 2V63A 1ONWA 2ZUSA 4LGXA 4RZBA 5MHBA 1E72M 4WDXA 1US0A 4M6VA 3MZNA 2NQ9A 2QT3A 3DGBA 3PZUA 2WJEA 3KAOA 4CEUC 4FX7A 1C9DA 1Q4WA 2ZX7A 5D2YA 3WCZA 1HG3A 2PDPA 3BGJA 2PCEA 2PWVA 1TREA 3ITTA 3VCCA 3RLVA 3LQGA 4Q4QA 1Z44A 2YA0A 5AZ1A 2EQDA 3AS3A 1FDZA 2VWSA 1AQMA 1PV8A 3L5AA 1QK0A 5BOOA 1B30A 2CBIA 4Q8PA 3LMZA 4GC3A 3ITGA 2YZ5A 3BO9A 4ZQOA 1JQVA 1LOQA 2WZIA 2Z27A 3MSGA 1TA3B 4XWUA 4HSOA 4PMZA 4JFUA 1C3FA 2QIIA 4J3ZA 1EQPA 2XFFA 5CAKA 2ZUVA 3GG8A 3FA3A 2VGGA 3NZRA 1E6QM 2GJXA 2Q02A 3CPUA 4PBGA 4PMVA 3K30A 1J2WA 2YFOA 2ZX8A 2PDLA 1PO9A 3NEVA 3P8IA 1KTCA 2VTFA 3VM5A 4HA0A 2Z26A 3SADA 3SM0A 3W2NA 2DIJA 2XHYA 3Q45A 1FWCC 2E0PA 4H83A 4Q7BA 1PZ2A 5HDRA 1XINA 5H8UA 5K3VA 4JS3A 2YKKA 3DDMA 1YYAA 3T42A 4XZIA 3WQGA 3SSJA 4G6CA 1J0HA 3SR7A 1QPRA 2JBMA 1N7KA 1VBUA 1EF3A 2XWEA 4AIUA 1UWUA 1JFHA 4D72A 1W6TA 3IJLA 1FBAA 1W9DM 1A5LC 5A8GA 3WNLA 1H63A 3VC5A 3LBMA 1A50A 3FK4A 2ZXDA 6CGTA 4X63A 1XYBA 4GH3A 2H90A 2XN0A 3PTQA 4YU1A 2ZA2A 1UZ4A 3MS8A 3R58A 3CAVA 1AQ0A 3O05A 3BUVA 2J7GA 3KFTA 1DJGA 1WKYA 4OVXA 4WDTA 2VFEA 2Z29A 4BJHA 2V5LA 3IANA 4H7VA 1B1YA 1BTMA 1KM5A 3LLFA 1H11A 1ME8A 3GE7A 3AIWA 4W89A 1JD7A 1UD8A 2BS9A 3W7RA 2ISSA 3VKBA 4US5D 3WDHA 3VUPA 1M53A 2W91A 3LNPA 4U3CA 3NQAA 1E1FA 4O13A 3IGXA 4AXNA 1HNYA 2RDUA 3T8QA 3TSDA 4K36A 3WLJA 2W5FA 4MY9A 4DZHA 1TTQA 3P6LA 1P6CA 4ZO8A 4LUSA 3QZ6A 4YHGA 4HA4A 3KCOA 3QQ1A 5E70A 4P7QA 1PHWA 3ID7A 2ZRVA 2J24A 3SUVA 3W76A 1M9HA 1C8XA 3NQCA 2E5CA 2WSYA 4L7ZA 1GVIA 1UKPA 3GXFA 4GC4A 3TLQA 3ELFA 4DQWA 3TAOA 3FY1A 3MW7A 3SCRA 4GISA 4LC6A 1O5KA 4GQRA 4ACYA 3VGHA 4ZSUA 3N14A 2WNQA 4GGHA 1DWIM 3UYCA 4KQNA 4N4PA 2C6QA 4E5TA 1ITUA 1EB3A 1CECA 2GWGA 4QITA 1GJUA 4Q4MA 2GK1A 3PN8A 5H8MA 2BY3A 1K9FA 3W1AA 1V51A 2CXGA 1MNSA 2BY0A 2YDSA 2Z24A 3SIZA 4DEFA 4OE7A 5AYYA 4XZLX 3WDRA 3AJ7A 3VCRA 4EOUA 1W9BM 2ZIDA 3BK0A 1FA2A 3C4UA 1JG9A 1BQGA 4GQGA 5I3DA 3FEMA 2WCAA 4PMUA 4X61A 3QGKC 4UXDA 3W7JA 1ZJHA 4U10A 1RJQA 5EFFA 3VVGA 3SUUA 1LJYA 1CGTA 2DZWA 2CBVA 2G4FA 3VIHA 3KM8A 1TZ9A 1AW2A 2VX6A 2FZNA 2C1GA 4MUZA 1UR4A 4HNUA 4UZSA 1UC5A 2CLIA 1SSDA 4CNUA 3S6OA 3VU2A 4LCRA 3A3WA 4W7UA 3GTFA 3G1RA 2A79A 2VDIA 3QOKA 1ZHAA 1GVEA 4H6RA 2TYSA 4Y6GA 5ABFA 5D32A 4A8IA 4RNFA 1H62A 3NNTA 4O57A 4GUJA 1YRRA 1CEOA 1R3YA 3TQPA 1MUWA 1VBHA 1RQHA 1MW1A 3W7KA 4LOCA 3A47A 3T81A 3BMXA 1O12A 4CEXC 3MANA 4JIEA 1SJBA 4WSKA 3A5VA 5DY2A 5HPOA 1DWFM 2HBXA 3KBVA 4RR4A 4R33A 1U5VA 1AW5A 3GFZA 8XIMA 4H9ZA 1J6PA 4B90A 4N6FA 1H3GA 1HVQA 3PBUA 1PZ0A 3V75A 5I2UA 4ZFMA 2YIHA 5FJTA 1GKQA 2Y24A 3CMGA 3IJ9A 9XIAA 1ADSA 2YJQA 4ZOBA 1JZ3A 4YHEA 1HGYA 4HU8A 4PRRA 2PBOA 5A6KA 2Z1SA 4XKYB 3ABQA 4GYKA 4JXCA 3M7SA 3NL6A 1BEUA 2J88A 3TN4A 3R89A 2HROA 1QO2A 4P61A 2PC8A 3GU9A 2CNCA 3WQ8A 3VGFA 4G56A 1B3XA 5AYBA 5A8OA 4ZOEA 1K03A 1M7OA 4LB3A 2WW5A 1JPMA 1QK2A 1ISYA 3WL0A 1A5BA 4Z08A 4JTTA 5GPRA 3CT7A 5G4EA 3QR0A 5T9CE 4PC8A 4UCGA 4TX6A 5DMMA 2RKXA 3IRDA 4HNOA 4PMYA 3DHFA 1C92A 2GL5A 3PP7A 5T8GA 1R0MA 5KZMA 1UH4A 4IPLA 1SR0A 4UB9A 4C60A 2ALDA 3EA2A 2VFGA 4WGHA 1OABA 2YCEA 2UV8G 4BA0A 4LAKA 1MSSA 3UVAA 4HN8A 2YBUA 2V5DA 3AIRA 2XDFA 1MEWA 1XKJA 1HKMA 4FLQA 3BJTA 3W1RA 4CNTA 1MMFA 5I23A 1V6UA 3ZOAA 3K8KA 2D22A 3G3DA 3CB3A 1MW3A 5DXYA 3UXLA 2Y85A 4NNBA 3CGTA 3GR7A 3D0CA 2BGNE 3BMVA 2VR4A 1XJBA 1UP3A 4RDYA 5DEZA 2GLKA 1WZLA 1XRFA 2CWNA 5C70A 4REQA 2HZGA 4XZ9A 1EJ7L 2BTMA 4GOAA 3C8NA 1CWYA 5ABFB 4UQAA 4GABA 4YTUA 1U30A 4XAFA 4BF9A 1FKXA 2WQDA 4S3CA 4E4PA 2G8ZA 3ONBA 2P50A 1JRCA 2RGLA 4D1JA 4GY7A 3N2MA 3LRLA 4XD3A 2O7QA 4UQ9A 4RPPA 5B7YA 3QR3A 1KM1A 1S39A 5TQLA 1VFFA 1RXOB 3FCPA 3C61A 1OJXA 3WLHA 3AHVA 4X22A 1QUMA 4A2SA 4JKKA 1I2NA 2VNCA 3RLGA 2V5KA 1UR8A 3LHYA 1QI3A 3TMLA 3PBYA 4Q32A 3SCNA 3WF4A 1WQ5A 3M43A 2G5WA 3TJXA 3TR9A 4AC1X 1ZBCA 3E9AA 3B0UX 1PKNA 2C3ZA 3IUDA 3JW7A 3WLOA 4ML9A 3IJQA 5C2CA 3H2MA 4Z42C 1XDLA 3VMNA 5A8NA 3L0GA 4P5UA 1DPMA 2O0TA 2W61A 1LOSA 2NVDA 4JICA 3N1AA 3AO0A 1K02A 3U7BA 4W86A 1JDDA 1FOBA 3BLFA 1BWLA 3P8JA 4O50A 3W2MA 4S23A 2GPTA 1LLOA 4Q8TA 3WZ0E 3BOFA 4IIGA 3IJ7A 2G41A 4FS9A 2DW7A 1QBAA 3S46A 4DWDA 2JGQA 4BWLC 1FKWA 1KRMA 2ZZ6A 4B5NA 1B3WA 1YNPA 3PTMA 3KS5A 2Y62A 2Z1BA 4QIUA 1QO5A 2VEGA 3LOTA 5HWJA 4HNTA 1H0GA 2ZDRA 2WNNA 1L6YA 1ZUAX 4LV9A 2QEZA 5GQBA 4B9YA 2HWGA 6XIMA 4YVPA 1SZRA 1UD4A 3UYIA 1T0OA 1DWAM 5CZSA 4LYRA 2ABAA 4B2DA 3H7VA 5CQ1A 1FFRA 4RLIA 4R88A 1S3HA 4HK6A 3T0TA 1XYAA 3L4VA 5FEPA 4F2TA 3W7LA 2QAPA 3ICJA 3CM4A 3EDDA 4E8GA 2EG7A 4O0KA 3B8UA 4JYEA 1S5TA 4J3SA 1MQRA 4O1AA 3IJIA 4REQB 4C6KA 3RHGA 1G4PA 3NGJA 3QY7A 1E43A 3ZR5A 1XBXA 1VEMA 1K6AA 3TX9A 2XIIA 1Q45A 5KSWA 1G4SA 3OLIA 4MUPA 2CU0A 4Y90A 3PWAA 3UXDA 3UVIA 1OFDA 1BVZA 3LRMA 4GYPA 2A1YA 1MXGA 3W27A 1UR3M 4WOZA 3APTA 3KCLA 3S9IA 4ZA0A 1JCTA 3ECQA 4GBDA 4TTUA 1ME7A 4PUUA 3BOXA 1JCNA 1VGAA 3SY8A 1H41A 3AXHA 3GG1A 4PTNA 4NT0A 3CH0A 1Q6RA 1H60A 1UG6A 4GFIA 1W1IE 1OBAA 5CZJA 4F0LA 1SFJA 1M7XA 2Z1WA 4N6EA 5CSYA 5JBEA 1TPH1 2GFTA 1X98A 1X38A 3DN5A 3HMJG 4ZVJA 3IV3A 3TMQA 3BLIA 2VI0A 3NUKA 3OGVA 3M5ZA 2IUZA 3W02A 1UP2A 3ATZA 1P0KA 1S38A 1EF2A 5F4WA 3FJ4A 3GG7A 3UGRA 1X8CA 3GUWA 4TR9A 4HD5A 3TTSA 1TYGA 2NZLA 4PMQA 4FXRA 1ELSA 3SB0A 3W7DA 3WEZA 1V3IA 1R86A 5K7JA 3QVQA 3RLHA 2DZUA 4JFWA 1JAKA 1TUFA 2HDJA 3WDQA 1UJPA 1FWAC 4GPNA 5A6BA 3M47A 1E4NA 1EEXA 4QP0A 4C90A 3BV7A 4B91A 1V03A 3SQMA 1RJRA 3STGA 4NZ5A 1Q65A 5K4XA 2YA1A 1HGWA 1NSJA 3ARPA 1OY0A 1TPFA 4AF0A 1Q6FA 1SFTA 1HKIA 3BLKA 4WK9A 3NM1A 2YZRA 4IQDA 2X30A 3EOUA 2H3BA 3S9ZA 1TR9A 4KEZA 1R46A 2A6NA 1E3ZA 4YTQA 1VFMA 3KOXA 4XO7A 1HJSA 3ZZ1A 3WQCA 4FNUA 2VX5A 3M5XA 3W2KA 4UTMA 4E6MA 1JZ4A 3U8GA 3ZLGA 2OSYA 3OEXA 3V5FA 4Q8QA 3ME3A 3WLTA 2WMIB 4HZ7A 3W29A 3LD5A 3ABSA 2G95A 2QNEA 1F4AA 3V1HA 5HR6A 5CPQA 4UTWA 4GI9A 4GVGA 4Q7IA 4EF8A 1B2YA 5C8BB 2VZSA 3MC5A 5A8QA 5I3IA 1XLIA 4JN8A 4WKFA 3TYCA 4Q3MA 3KRBA 2OWXA 1EUNA 2CLLA 3MUIA 2V3EA 2BP1A 1K8YA 3R5EA 3GZAA 1TRIA 2FQIA 1A5CA 3C86A 4YVVA 2PDGA 1YXYA 4K7VA 1J10A 1V79A 1D8WA 1P0BA 1UBSA 3W7PA 4UTHA 4WDWA 3VMOA 4FEZA 3DFPA 1FWTA 3AIEA 6REQB 1YPFA 4NAEB 5LNSA 1EYWA 3PZVA 3NCOA 2ALRA 5CZ0A 1VB9A 4IM4A 1F76A 2Y8KA 2FTYA 2DIEA 2G3JA 1ZSXA 4DJDC 1HP5A 1J2BA 1V3JA 3CASA 1EOMA 3SUTA 1VD6A 1EXBA 3EWZA 4KCVA 3IACA 1JJKA 5BWFA 3N2XA 3KDNA 2ADAA 3QC3A 1GQJA 3A24A 2VL4A 4JPGA 3WQ5A 3RMJA 2O9RA 3UWZA 3UR5A 4KBXA 4RJEA 4I9MA 3HO8A 2NUXA 1OFEA 1UZ1A 1EJSC 3E0LA 4LPCA 3PUEA 2WPGA 3V5CA 1R38A 4O15A 4B5SA 1RZMA 1UZDA 4JFSA 7XIMA 2BVWA 4UR9A 3BW3A 1PCWA 2D2GA 1LT8A 4L6OA 4EPKA 4AW7A 3HOJA 4B5TA 4EACA 4HSNA 2QJIA 3NSXA 3ES7A 2OLAA 4UFLA 4Z0SA 4PN2A 1UUOA 1RCXB 2CW6A 1QNVA 5FEWA 3NZ1A 3WYZA 3SUSA 4IJRA 1XYZA 5ECUA 4HQVA 2P1FA 1NJJA 3KS6A 1U22A 4JIIX 1POJA 3W22A 1FP9A 2JEPA 4GWEA 2IKJA 3PZ9A 4ZZ9A 4BQ4A 1S2WA 3KBNA 1F3TA 4ZODA 3PBGA 1YDYA 3VX0A 3IIVA 5D9PA 2ZVRA 2X1TA 3AMLA 1UKSA 2V6AA 1KGWA 2Q01A 4GO8A 1K77A 4N7QA 4GXPA 3QV6A 2W67A 2EHHA 5ABTA 5D30A 3VIFA 4A4AA 3CZEA 1JCYA 1VIZA 3F5KA 1IWBA 3UP8A 4TU1A 2WV8A 5CZTA 2P8CA 1LBFA 3WNNA 3EPMA 3RK8A 2CLPA 3CBWA 1IXOA 2C1HA 3N4FA 1K8ZA 4JL2A 4DVOA 2NV9A 3QOMA 3S2NA 1SJDA 3EX4A 3CUJA 2IMRA 5G4WA 4QS5A 5I0DA 2BZNA 2O4MA 3GVQA 1XLFA 1FTXA 3WBEA 1PKMA 3CQIA 3GDTA 2VD8A 2X2GA 3S1GA 1SW0A 5JMUA 4MDOA 3MA8A 1FWJC 1DIOA 1VKFA 2ZADA 4DJED 4PSRA 1DJIA 3PZQA 1ZJAA 4LVDA 1YMYA 3CB8A 4U33A 1XICA 2PDNA 2QQ6A 2VZTA 4GINA 3V35A 5BNKA 5DFAA 1N8FA 1KCZA 4HBKA 4V28A 4LUJA 3Q65A 3QY6A 4XK2A 3W37A 3W1LA 3POHA 4XZNX 4GQQA 1A5AA 4IT1A 1Q8JA 1AMYA 2XUCA 3E1F1 2E3ZA 1XRTA 3I4KA 5CCZA 4Z2LA 4HYRA 2OELA 5E6ZA 4BF7A 1HL2A 4DYEA 2OO6A 4EPEC 4CLMA 3VDBA 2RDTA 1ZJIA 3R12A 1OX4A 2B0MA 4US6A 3B0PA 4HOWA 2GJRA 4W7WA 3OA5A 1WBHA 4DZAA 4HYVA 2NT1A 2PTYA 3KL0A 4ICMA 1TX2A 4B5WA 4C1KA 1X7FA 2EG8A 3OBAA 2INFA 5H1WA 3VDHA 4TO8A 3ABZA 4DF2A 4E4FA 1XUUA 1FCBA 3LCXA 4F2BA 4DELA 3RITA 1VRDA 2WHKA 1OIFA 1NOUA 4KRTA 3KZSA 4AWSA 3TYUA 3HGSA 3QKZA 2V2CA 1PYMA 2QUVA 3NZQA 3USZA 4IMEA 4Q8NA 2J47A 5CLTA 4Z17A 3U2ZA 4FNQA 3BG3A 1WDDA 3D3FA 3QMTA 3VDAA 5H8PA 2PEVA 1PB0A 2DUZA 1EGZA 4IP4A 1HN1A 2A4AA 1IT8A 3AOFA 1VCGA 4WCJA 2ZZ4A 2OYKA 4PFHA 3QSTA 2Y5JA 2YXGA 2J9XA 3L0KA 1E1CA 4L6HA 2QF8A 3MVIA 3COTA 1IXQA 3ORWA 2I1OA 1HZYA 3J7HA 5FJOA 4GXMA 1S2CA 5BZAA 4CQDA 3WD0A 1Y65A 1EIXA 1B4KA 4PMOA 1XLBA 3W24A 1T41A 3P74A 2GGGA 4TX8A 3NWRA 4S1FA 1PVNA 4J9JA 4DYKA 2J75A 1Z9AA 2FH6A 3NPUA 1H49A 1NWUA 2P53A 2Y88A 1YBQA 1BYDA 3E2VA 2IQ0A 1XFBA 5DRCA 1E6NA 1GNXA 1OX6A 3A12A 4UQDA 3I6RA 5FSEC 3H2CA 1RQEA 1KRBC 1GKRA 4YVXA 4FR1A 4F79A 1PTDA 3ARUA 4MWAB 4PR4A 1JCLA 4IFKA 2WO5A 5CJ5A 2PWHA 1MQQA 1PEZA 5E93A 2UY3A 2VRKA 3AIUA 1B3ZA 4A3QA 1JXKA 3TOPA 4UBPC 1OX4B 2XH2A 3ARQA 5HNRA 2OEJA 3G77A 2O4QA 1KBLA 3RR1A 3BSGA 3EWDA 1HW6A 4UCFA 3Q2DA 1KXVA 2A21A 3CPGA 2OFJA 4HSHA 2YDRA 5E9XA 3KEHA 3LGEA 1KV5A 2QPXA 3GNXA 3AROA 2NSXA 3BGAA 1QOQA 4DBEA 5AHFA 3V5OA 1HVXA 1XLKA 3S2JA 3ZVIA 3OVRA 3S9YA 2HXUA 5CPOA 1KFWA 4BI5A 2DSKA 3ABRA 2EKCA 3EXSA 1UWIA 3B4UA 1UWSA 4KRZA 1XIDA 3EDFA 2EXOA 3L4ZA 4ZO6A 3UA3A 1WPCA 1VAHA 1W5NA 3VNZA 3TJIA 2Z7GA 2HNHA 1Q6DA 4NAFA 4MJZA 1W91A 2VYOA 3CHVA 3BL3A 2HRWA 5HMSA 4Q8MA 3WF2A 1BQCA 1JL8A 4ZB0A 3CAQA 3GY1A 3KL5A 3E96A 1FWBC 1KGUA 3UCDA 1CENA 1AH4A 2E25A 5E5CA 2I56A 4FX6M 4DXVA 2Y70A 4FIQA 1GVFA 4LYPA 2XFYA 3UG8A 4AU0A 3OVPA 3MVTA 4GIRA 4K38A 1AFSA 1X1OA 3M6DA 4O0ZA 3BOLA 2YL9A 1DP0A 4QFUA 3OLEA 3FW6A 1X97A 4RCXA 1PWLA 1CW2A 1W1VA 5KETA 3LV6A 3BZGA 1N8IA 3AC0A 3WBYA 1P7TB 2VDGA 5DO8A 3NAVA 3L5MA 4GMEA 1W3TA 4URIA 4AVNA 4PTMA 4J3WA 1VJZA 4BCEA 3MJYA 3SFKA 4TMCA 2CCRA 1FWEC 2BMBA 3UZJA 3KTSA 2QULA 2XH7A 3E0IA 1DL3A 3WBXA 3NFUA 1DVJA 2HNEA 3NZPA 2YR1A 3VTRA 1BTCA 2YFNA 4H01A 1G9HA 4L80A 4JHOA 3VOJA 2P8BA 2CLEA 2KX9A 4GI4A 4CQCA 1JUBA 3MV01 4I7VA 2VZUA 4D6DA 4LS2A 2BVDA 4ZTYA 2VFIA 1GK8A 4NY2A 3WH6A 4BR1A 3LTPA 4XTDA 4WY0F 1YE4A 3UESA 2G3NA 1E4IA 4O1EA 1X6UA 3S2CA 3RNDA 3F03K 2BY1A 3MCNA 2PWGA 5DX7A 2BVYA 2JK2A 1BXBA 2Y61A 4JN6A 3VKKA 1KCXA 3N11A 3WUGA 4P2VA 3W1XA 1KLZA 5IRPA 1UPMB 1TV7A 5I3JA 3WUBA 2V0TA 3AMKA 3FOKA 3VX1A 1E6RA 2TRSA 4WX2A 3W81A 5CC6A 4DM1A 1EWEA 1EXPA 1K9DA 1JAEA 3VAVA 2JEQA 2XM2A 2YL6A 1F8IA 1CXHA 1O5XA 2OQYA 2OODA 1IHIA 2X1RA 4DX3A 1D3CA 1H7PA 1Q7QA 1LP6A 3GHUA 1QWKA 4NZ1A 3DOPA 3OJGA 3AWOA 1IGWA 3QHOA 4F9JA 3K46A 4M80A 4ORIA 4ATLA 1RK5A 1GHRA 4ICCX 4LBSA 3QYQA 3RF9A 2XGIA 4LUIA 2Y1HA 2PRLA 4XAZA 5AHEA 1JZ8A 1GORA 2HISA 4EAMA 3PZTA 5REQA 1V3LA 4ROPA 4WJ8A 5A6LA 2DH2A 3SN0A 4CQ9A 4L4MA 4TOQA 2PDFA 5CZKA 1IYXA 2ZUWA 2Z2AA 1P0DA 5TD4A 3F4DA 4HKPA 3PAOA 1YPXA 3NL3A 1YXCA 4S2CA 3AYRA 5K9DA 1MXSA 2QUUA 4G1KA 1TCMA 2PGWA 1T40A 2XFRA 1ITCA 4O8RA 4N0RA 1OM0A 2WQPA 3CV7A 2BASA 1LYXA 3N6JA 4FXFA 1V6VA 3ZJ8A 3UG5A 4KF1A 3W1MA 1OK4A 3GH4A 2R1PA 1YNQA 5FAJA 3DYPA 4FZIA 2IQTA 2B7PA 4Q4KA 2B7NA 2H6RA 4IGNA 4AISA 2BV9A 2R9RA 3B9NA 1EGMA 2DSZA 4QJ1A 2PLCA 1Q13A 1XBVA 1SR9A 5C55A 4AUBA 2NQJA 1SGJA 4DUWA 2J7FA 3N13A 4KFNA 3N12A 1QMLA 3S47A 4P7NA 4LY8A 3O15A 3TN5A 1C7SA 3SSZA 4V1YA 3H7RA 3BXWA 3QW4B 2C8NA 4AD0A 3HB9A 1EQCA 1NWTA 1R2TA 3QV7A 3UJSA 3GXNA 3GSMA 3VNLA 3PC0A 5I06A 2FGLA 1L6SA 3A4WA 1TUXA 2DEPA 3EDJA 1SZNA 1XLAA 4W84A 1F73A 4DN1A 1UH2A 3PUGA 2EAWA 2CESA 3L0NA 5HNUA 1PL9A 1XQLA 5FEZA 4IMFA 3WBWA 3RGTA 3D47A 1XCXA 5JXQA 4GGBA 5FSDC 4IIBA 1EP2A 4U2YA 2MNRA 3MUZ1 5K4ZA 4S3KA 4L9ZA 4UNKA 4S3BA 1H4PA 3W1TA 1EOKA 3SJ3A 4LX4A 4CU8A 3G2GA 4Y9MA 4V33A 4B3ZA 4PCPA 1R3TA 1W9PA 2ZYFA 2FMOA 1LBMA 4HIBA 1DQWA 2YXXA 2PU1A 3EGJA 4IG2B 5FL0A 1OF6A 2X1UA 2YL5A 3TNBA 3DIPA 2QDHA 2PLMA 4FLSA 1XYFA 4IIDA 2GWNA 3MSDA 3RJYA 5BOFA 2ANUA 4KEMA 4IX0A 2QJMA 4R9XA 5BU6A 1CXIA 4TIMA 2J4GA 1W5MA 3W6YA 1RCOB 1HQTA 3CJPA 3P93A 1EJVC 4M6UA 4Z1BA 5REQB 3ZM8A 2E9LA 3HFYA 3LBCA 4KESA 3UWQA 4O0QA 5LNWA 1B3VA 4C6MA 4MPQA 1AQHA 4K8EA 3P60A 3WNKA 3K5XA 4LAZA 3FGCA 1NQ6A 2NX3A 5IM51 1YEYA 2Y2WA 2WC4A 4P8VA 3LEPA 1E6PA 5M2FX 1UR0A 1U83A 4FOKA 3GTIA 4S3JA 2NW0A 2JKEA 3ITXA 3N2TA 3ZYZA 1Q6CA 1QNPA 3NSNA 5TNVA 5HA7A 1CPUA 4AMCA 4GCXA 3BH4A 1RY0A 3OVGA 1IXNA 2R14A 3E5PA 2YPIA 2V2HA 3CIVA 3IVTA 5D4YA 4NJHA 1R9ZA 2R94A 3KBWA 4ATDA 3L4UA 4NRRA 4QTGA 4NZ3A 4IUGA 3H24A 2PBGA 2PTXA 2JKPA 2HBVA 2QCGA 4ERGA 2VUNA 1GZJA 3LS9A 3A21A 4QCEA 3URBA 2Y0FA 1AD4A 2WMGA 4PTWA 1UZHA 4UTWC 1OX5A 3R1ZA 3UWVA 1CLVA 3STEA 4R27A 1WXJA 3G1AA 4HHLA 3R0KA 5C5YA 5DN1A 4AWUA 2WPBA 1NTHA 5DBTA 3OA3A 4JTFA 1BVWA 2A3HA 3V0SA 2R24A 2ASHA 4U5KA 2P5NA 3CNYA 4CQBA 5AFDA 5K9XA 7TIMA 3O06A 3TE9A 3V0UA 4TVUA 2PWEA 1R3VA 4TXEA 1ZCCA 2HK0A 1DJQA 1HUVA 3QTGA 3HG5A 5U7SA 3ZT5A 3M0IA 2CZ5A 4J35A 1Y7VA 1XSKA 1UWQA 3SGGA 3P0WA 1OYAA 1UWRA 2DZPA 3ZQ9A 1F74A 2XJ7A 3F2BA 2A3EA 5FD0A 3SN4A 4NJGA 1SMAA 1KTBA 2WM0A 3W23A 2FZ8A 2XIBA 1TE1A 4PZVA 4KWSA 4GKLA 3NG3A 3PWGA 3QFWA 5JQ9A 1RALA 1WAWA 1L8PA 3HGRA 3DX5A 2ZDSA 3MBFA 1ONXA 3CH9A 3REQA 4F0MA 3QHMA 4Y9NA 4QRNA 4NX0A 1RHCA 5HJYA 3WNOA 3M0KA 5I79A 3HG3A 1L6FA 2IPJA 5E0FA 1TTJA 3H54A 3IJ6A 3FDGA 4HMNA 5ABHA 1NOWA 3IAQA 3EX3A 2AL2A 3AS2A 3OYXA 1H7XA 3OIXA 5GJMA 1GOXA 4PEKA 1WB0A 3OYZA 3M0ZA 3G1DA 2J66A 1D8CA 3QBUA 3AYSA 3I7SA 4KMQA 3RCYA 2J7CA 5G5IA 1W5OA 1XH1A 5IDZA 3QRHA 2WZHA 2QLYA 4HNLA 1G4EA 5TF0A 2J74A 3GUGA 2KAUC 4FMVA 1K70A 4DJDD 1F6KA 4GK8A 4IQJA 3PSVA 3C2OA 3W86A 4IFOA 4GVIA 3CLMA 4NNCA 2TODA 5I5RA 5J5DA 3MJMA 4GI8A 1DTUA 2PZNA 4XZHA 1JEZA 3JZUA 1GEQA 3NTYA 3ALGA 3DAQA 2GOUA 3UA4A 1ISXA 3W25A 3AS1A 1D7KA 1MFUA 3OLGA 4MYAA 3V4BA 1GQKA 2HE5A 2E5BA 3STFA 2Y7EA 4AD5A 4ZB5A 1WUFA 5HMEA 2BHYA 3S5YA 1YX1A 3DHPA 1OINA 3QZAA 1FWRA 1QOPA 1K4HA 1BSLA 3W00A 1DOSA 3MYOA 4QQ3A 4K1GA 2X1SA 1YTDA 1ZQ5A 4FPSA 1V5XA 2NUYA 4W88A 1WP6A 1BKHA 3AWNA 2NXHA 3E2SA 4PH6A 2BOFX 3MI2A 2A7NA 5HWNA 1KBBA 4F8XA 3QV8A 4J3XA 2WBKA 4PYSA 1UCWA 4OTKA 1XLGA 2YLLA 4GXWA 5I07A 1SPQA 3FA5A 3GXDA 3GKAA 1Q6GA 3TWAA 3C5QA 1WKDA 2GYIA 3R6IA 5MKGB 4E3TA 1BKSA 5LA1A 1FRBA 1UR9A 1LM1A 3GXTA 4JX5A 2X0SA 4DRSA 2FTWA 1N55A 1VCVA 3KVKA 1JYVA 3GU2A 3GC4A 1QPNA 1A5OC 2ZX5A 3ZLHA 3A13A 4OOZA 3LQLA 1CBGA 2OX4A 3PR2A 4B3LA 4O11A 3F5JA 2R8WA 5EU9A 4OBSA 2WLZA 4CU7A 4AYGA 3P14A 1SSGA 2J62A 1RAKA 5F2IA 3WFAA 2QAFA 3MUY1 2BNJA 2PDJA 1M3UA 4LFYA 4LYQA 1BWVA 3T6CA 3VOIA 3XISA 2I9UA 4U4MA 1QT1A 2REQA 1EBGA 2JQXA 1GJPA 2D69A 2ZWZA 4Z2JA 3VD4A 3LBOA 2D2JA 4P8WA 3P7YA 1SFLA 3N04A 1W32A 4FX8A 3AQUA 1OD0A 4K68A 3LX9A 7TAAA 1KA9F 1TPB1 1OF8A 1MW0A 4F2UA 4Q6JA 3W1QA 1MO0A 4YXGA 2D3NA 2VO5A 1A5NC 4D6EA 3SZ8A 1UQYA 3QMSA 3M0MA 2PUZA 2SFPA 1XIIA 1RCQA 2W6RA 5F4SA 3UJEA 4ERIA 3A6OA 2Z0IA 5LGXA 3DHUA 1HKVA 3AJXA 1Y8BA 4B3KA 2I16A 3W7GA 2WWCA 1WBJA 4UFJA 2QCEA 1YW1A 3BMWA 2CIPA 3DYMA 2HJPA 2W63A 1H0IA 3M5YA 2BOGX 4FI4A 1TCDA 3GR4A 2V5BA 4KIRA 4W8AA 3N3MA 1EJRC 1TPUA 5LNRA 1ZZMA 5DT5A 4E0CA 4I3GA 3NJ3A 3G1XA 4WLCA 3THDA 2FGZA 4LS1A 3QV9A 1EP3A 3W72A 4I5XA 1IIGA 4FO4A 1XYCA 4QJ5B 2DSWA 4ZOAA 1RJPA 2QCNA 3HZ3A 2FVLA 1A0DA 2X16A 1NOFA 4RZ4A 7A3HA 1J5SA 2CC0A 1VZWA 2W92A 4DJFA 3WG6A 5JBFA 1B9BA 5C2GA 1P4CA 3TVAA 3F4WA 3OW1A 4M29A 1GKPA 3EKZA 2OGYA 1XXXA 1VYSX 3C3UA 3UZXA 1E6XM 3ZJKA 1RD6A 4JTUA 2QPUA 1TVLA 4WGXA 2CPUA 3LM7A 2DP3A 4Q6XA 3AXMA 3OBEA 4PUNA 3KRUA 4Q22A 4L65A 4R7OA 1GGOA 4NKCA 2C91A 1F8MA 2BG5A 1HL8A 1CCWB 1EUAA 2H8ZA 4GYJA 3DEQA 2H9AB 3CWHA 3PANA 1P43A 5HUPA 4G5DA 3GIPA 2L5HA 3LI1A 4X2PA 4A29A 1X6NA 4AFYA 5JH2A 4UR7A 5F4XA 2ZXBA 3SUWA 2DU2A 3LG3A 2PGFA 8XIAA 4M51A 1HO4A 3WNPA 1JCMP 5AY7A 2I7GA 3OB8A 3HPAA 1LTDA 4I5UA 3G5EA 2CLFA 3LPOA 2QDDA 2YCJA 3B03A 3E0FA 5CPMA 2V69A 4OUIA 4CQ8A 4ATWA 4JTGA 3K4AA 3B3DA 3I3DA 1QPQA 4Q7NA 3VFCA 5C71A 2BX7A 4DF0A 3GXIA 4ZSTA 2OEKA 3QQ0A 3HPSA 5A8MA 3C52A 1ESWA 1F3XA 3SRHA 3IAPA 3VGBA 4AZCB 1B9ZA 2P3EA 4KH2A 4ADSA 4PUMA 4M6PA 1KXTA 4OZOA 2NUWA 4GA8A 2X8RA 2A3BA 4BFAA 2QCMA 3W1NA 5A2CA 4I7WA 1IT0A 1ICPA 3LCFA 3TU9A 1HKJA 4JQ3A 3LXBA 2VRQA 2EO7A 3IVSA 2PWUA 5CPNA 1GT8A 3CQJA 1W2PA 4W5UA 4W8BA 3IIOA 4C91A 1WA3A 4RW5A 3DENA 3GC5A 3MCOA 1GW9A 5HK4A 2D0FA 4XAYA 2WJDA 4GZJA 2IXUA 8CGTA 4B5UA 2ACSA 1BRLB 4F0SA 3L68A 4RZ5A 3LTSA 4INFA 1GYMA 3W9ZA 3UWEA 1JULA 1M03A 1XIJA 5BWAA 4WSJA 3V7PA 3INPA 3WD3A 3GBDA 4Z1AA 4FXSA 3AHXA 1NQKA 1FXPA 2W27A 5A5WA 3VIOA 3GNDA 4GJ1A 1J12A 1W3KA 2VMFA 3EOLA 4YYCA 3G8RA 4D6JA 2J8TA 3LGDA 3OZPA 3ARVA 2F8QA 4PODA 4LT9A 3VIGA 4CQAA 3VKAA 2PLKA 5EMMA 3WJWA 3NYZA 4BHYA 2G0WA 1AA1B 1F7BA 1XC6A 1FWNA 2CXEA 2E28A 4I90A 4JIPA 3EA1A 4M1RA 3DG3A 3QQWA 5C0QA 4LY4A 4F0KA 1W1YA 1HTIA 5HXMA 1P6WA 1CDGA 2QJJA 4QAIA 3BLEA 3E12A 1KFBA 1HP4A 2XIQA 4LF2A 4YN5A 1ENUA 4KW2A 3WJZA 4I5RA 4U31A 2IS7A 2CLOA 4H6EA 4EIVA 4E2DA 1GWJA 4OQVA 4L1GA 3CIXA 1REQA 2VFHA 3F7JA 1B31A 1F9CA 2ABBA 2GVLA 3MSYA 1JUEA 4E8CA 5A6AA 5DRIA 5AC7A 2I17A 3UXKA 3P0XA 1V3HA 3RM4A 5ECVA 3EX1A 4RE2A 4MSSA 4IPIA 4F9DA 4W5ZA 2ZXQA 2Z28A 5A1AA 2H3DA 2BY2A 3E0WA 2ZFAA 1EFZA 4QSFA 1FXQA 3WL1A 2PRHA 5PTDA 1BYCA 4V1XA 4OKDA 4HP5A 4UFMA 3P82A 3F5LA 1K8XA 1VFTA 5A6TC 4D1IA 2NV2A 1H7OA 3UR8A 2VCAA 5CXPA 1RH9A 2ZRWA 3IUHA 3PBVA 4Z0JA 1R9YA 3R0UA 3HPZA 3R25A 3CMFA 3L9CA 3XINA 3QTPA 3ENLA 1SYTA 3PUDA 3H12A 5CC7A 4JCLA 1ICSA 4ACZB 4HHHA 3UZYA 3TKFA 3I65A 4PSPA 4Q8VA 1OEPA 3W88A 1QW9A 3C2YA 1P1MA 2WKLA 2J7HA 4IGSA 4MFDA 4H2CA 4PUDA 4C6NA 4IMCA 3I4EA 3A9IA 5GNXA 1VPQA 3T78A 1Q2RA 3R8GA 4KFPA 5DT7A 4C6CA 1WZKA 3CWNA 3PG8A 2YYTA 3B06A 9XIMA 3LHVA 4XAGA 4GIEA 3BAIA 4BQ2A 3NL5A 4HMEA 4GX9A 1P1XA 4G7EA 3HA1A 2QJNA 1OFQA 2EKGA 5LNVA 1DHKA 1W9XA 1OFRA 3LPFA 1J01A 1K6WA 2Z6IA 4LEQA 4KCWA 1XL9A 2VKZG 3PUOA 1QHZA 2QGYA 1H5YA 1R9XA 4PUEA 4O1FA 2UWFA 3WMBA 2VEFA 3PNZA 1KRCC 3CLWA 1XLHA 3EWWA 2PE4A 1KRAC 2HVOA 2FPVA 5LXEA 3WQDA 3QEZA 1V6XA 2AMGA 3PULA 5KEZA 1XCFA 3WJSA 2X1IA 1QXLA 4PTXA 4NASA 5E1QA 3C6CA 4JBRA 3OIHA 1R8LA 2QJHA 5A2AA 1QATA 3TLLA 2I57A 3TJLA 3U5YA 4G8TA 4B2DD 4CCDA 4H8VA 1C9WA 4AWTA 3O8AA 1TV4A 1VQTA 1CLKA 4HPNA 1LQAA 3L2MA 1BF6A 1TWDA 4L4OA 4JTSA 1GQLA 2WNWA 5I03A 4AZBA 3H7UA 3CAKA 2WKJA 1EA0A 3BCDA 4HA3A 5J8LA 4OJYA 3U3HA 2JF6A 4M82A 4GIAA 4PCFA 3GFXA 3CAWA 3O3RA 2Y8UA 3HTWA 3R2GA 4XBSA 3F2DA 1J0YA 1WXYA 4JKLA 4BI7A 4CD5A 5CBJA 1UQZA 3MKKA 3SCTA 3LB0A 1FWDC 4YMZA 2R6OA 2QKFA 1JI2A 5LGZA 4YJ5A 2DQWA 2INZA 1N82A 1T5AA 1PWMA 4YYFA 1VFOA 3EA3A 1GQNA 2QCDA 2WZMA 3G1YA 4LQ1A 3FEQA 1EO7A 4UTJA 3EWXA 3M16A 2GJLA 2D2HA 3RN6A 2YCLB 4O52A 3KOYA 3S3GA 4NYUA 3SIMA 1DJYA 4MAZA 3F1QA 3ZJ7A 1XC4A 3CXOA 3VZXA 4TVDA 3WD4A 1CZ1A 1O1HA 1F5ZA 1Q85A 4IP7A 2QMJA 1KFLA 3ITVA 1F61A 1Y5XA 4KGJA 3TW6A 4YCPA 2V82A 1VS1A 1GOMA 4MZ8A 1RLDA 4LBRA 1LRQA 3AISA 5BXRA 1LF1A 4LAUA 4S3AA 4JQAA 3A64A 2G96A 4J28A 1XIBA 3HV9A 4NZJA 1AZ2A 3MZ2A 5L9FA 3UNDA 4GQ0A 4Z2KA 4IPJA 1ZP4A 2GGJA 1G94A 4I8YA 1JDEA 3T2OA 9RUBA 2RJHA 3WLNA 3MBDA 3GVGA 5D37A 3KTXA 1GVOA 5T9BG 2J78A 1R5YA 5I6SA 1XBYA 1KKRA 1DIDA 2ESCA 1V77A 1KQYA 5IBXA 2C19A 3FV9A 4K2SA 3HFTA 4UZUA 5CAHA 4UQBA 2QS8A 2HS6A 1T6MA 2C7FA 1ZALA 2XZ9A 3P67A 1DIEA 4DJEA 3VIPA 2RHGA 4E3VA 3K1GA 4ZR8A 4R53A 4XIMA 1G69A 1IR2A 2VVSA 5BYWA 2DZBA 1Y5VA 3UR2A 4FOUA 3QN3A 2VQTA 3XIMA 1A49A 1CXKA 4O4WA 1L9WA 3CZGA 3IPWA 1AQFA 3TCEA 3PNUA 4AHQA 3GIYA 1Z3NA 4NXSA 1XWYA 1XLJA 4NRSA 4LUYA 4UTUA 1W8SA 3SJNA 1ZNNA 4FR6A 4S3GA 4UOQA 5AHLA 3MY9A 3N73A 3E2QA 1TPDA 3PTKA 5JU6A 4IUOA 1EDQA 3A4AA 3ISIX 5D2XA 3DECA 4EKJA 3U9IA 4H1ZA 1A3WA 3NPWA 4GG9A 3PB2A 3VMPA 4DO6A 1JRBA 3G22A 3WLMA 4U2ZA 1QWGA 1YDNA 4XISA 4KFOA 2G3IA 5M3WA 2DDXA 3W28A 4H41A 3FX4A 4OUEA 2VGBA 1W3HA 4BY3A 4CCEA 4DNHA 1WNOA 3CUZA 2D20A 3H53A 3QFEA 4XKMA 1TJ1A 1EO5A 1M01A 1H51A 2E1DA 3MO7A 4DI8A 1JVNA 2DJLA 4OECA 1KCLA 5LYRA 5LZLA 3UJRA 1P6BA 3SRKA 4HA1A 3WLIA 4E8DA 3NO5A 1E0WA 1I45A 2QCHA 4F0RA 4DLFA 3W73A 2WVSA 2CZEA 1RPXA 2GDUA 2IPWA 4NQ1A 4JTDA 3O63A 2VC5A 4MWAE 2GJXB 1FQ0A 4FF5A 5D02A 1PE1A 1DEDA 2CHOA 5A2BA 5EB8A 4DO5A 1KC7A 3DI1A 2WZTA 3H2EA 1Z32X 2AAMA 1AZ1A 3O1NA 3AIVA 3IGUA 2WSRA 2A7PA 3LHTA 1LROA 1VCFA 4LWWA 1H7WA 4H9UA 3UT0A 3WQ6A 3T05A 3NQGA 1IZKA 1SUXA 3HM7A 1E9YB 2I5GA 3L21A 3F2CA 3WIJA 3GU1A 4GIYA 3VGDA 4C6EA 1SJAA 5DELA 4AEFA 3KTCA 4C6PA 3U0HA 3C2FA 4XV0A 1AK5A 4RKAA 3NDZA 1T8QA 3N3TA 2AQWA 1FWIC 3LM3A 1VENA 3CV6A 1WXZA 1WAUA 3WLQA 4EP8C 1Z42A 1C29A 1SZGA 3EOSA 2B7OA 3WQEA 2ZE0A 3O7UA 3TTOA 2GVEA 2QCLA 3LLXA 2YYUA 1B3YA 3VA8A 4H6KA 4HMCA 5IFPA 3G1SA 4MTVA 3M1ZA 2FZMA 2AKZA 3ATYA 4IICA 1ONRA 4JNMA 2D73A 1O7AA 3CV2A 3KDOA 1EHAA 4H8NA 5AYXA 3HQ1A 1PIIA 2WKGA 1XS2A 4RDZA 5E0CA 3MU7A 4QJ4B 1EL3A 3IGSA 1D7FA 1KM2A 3P80A 3LPPA 5AC6A 5CC3A 1XKYA 3GDKA 3VD7A 1M1BA 4Z2HA 3ONCA 3VNJA 3BDKA 1Q63A 3ITLA 3SY5A 5HJXA 1ZB5A 4HTBA 2C0AA 4KWWA 1DXEA 1QCWA 1FH7A 4WIWA 3GH7A 3S83A 1G67A 5I77A 3GKFA 4YTSA 5C6MA 4DM2A 1GG1A 3AXKA 6XIAA 1E56A 3IRSA 4LUSB 5H6HA 1ADDA 2V81A 1PCKA 2OWCA 3G1FA 1GZGA 4Z1YA 5AC5A 4W87A 3HG2A 4AVFA 3TWBA 4J2PA 4I6KA 5RUBA 3CL6A 2OLSA 3L4XA 5CG7A 3THAA 2RDWA 1U5JA 3O6AA 1AH3A 3NQ8A 3EPOA 4UC5A 2OTDA 4C6QA 4HNVA 3CZ8A 2EPKX 4RV8A 3N18A 4ZMGA 2PURA 5IOBA 4L56A 3WDPP 4MWAD 4GHRA 5CSSA 3TUUA 2GK1B 2PB1A 3PF3A 1PKLA 3OODA 4L9XA 3GS6A 5FA5A 4E2OA 1OCQA 4RK8A 3URNA 1G7UA 4O1CA 3BSMA 3PWIA 4CCZA 2ACQA 5F2GA 1NWSA 5A69A 4QR6A 3EEGA 2WSPA 3NEHA 4ZOCA 4JZ5A 3JUGA 4KWUA 1V0LA 2HVNA 4JX6A 1BYAA 2BGSA 2Z25A 4C5ZA 1TTIA 1ISVA 2EJAA 4JNZA 3ZIZA 4JL1A 1B3OA 4DUVA 3TC6A 3AMGA 1ZRQA 3K8LA 3NXFA 1OC6A 3P61A 3W7HA 1VLWA 3L4TA 3NQEA 1JQXA 3DHDA 1E6ZA 4GUIA 1OADA 2IQDA 3P2VA 4MB4A 3K1DA 1OCNA 2DUAA 4DJFC 1ZAHA 4HVXA 2Y7DA 1WO2A 3LY0A 3LI0A 3S1XA 4B16A 4V27A 3PZNA 1JUKA 2TMDA 2NWRA 4O1BA 4HZ6A 3THCA 2OZ8A 3BLOA 4HU3A 2VFFA 3NGFA 1DJNA 3N2BA 3L4YA 1O95A 3A22A 2Q8XA 3U57A 2HEJA 4GQBA 3IWPA 1MRAA 2XTKA 1EDGA 4PB5A 1FWGC 3TA6A 4YWSA 1S5NA 1LQ0A 4C6OA 3QMRA 3GTHA 4KIEA 2I14A 3OZMA 2VENA 3SRDA 1JCJA 2YB1A 3S0CA 1UIOA 2CBJA 2ZRUA 4O16A 3T55A 3HU7A 2GGIA 1NP0A 3WH7A 3WK3A 1XHGA 2G50A 3TP4A 2DIKA 1JGIA 1KBIA 3ANYA 3O2LA 4O12A 4RE3A 1TV3A 1TVPA 4AQLA 1XM3A 2FB3A 2E5DA 2NLYA 2PGEA 2AQOA 1G7VA 2W4XA 4LH8A 4H2HA 1ITXA 3TJ4A 2DORA 3WX7A 3LCGA 4BS0A 1DWHM 3KE0A 3EEZA 2V5CA 3D5HA 4RXGA 4N9EA 2PDIA 3I3BA 5I3GA 4K3ZA 2QV4A 1DJWA 3BJFA 1TPEA 4FALA 2XH4A 1W17A 3SCQA 2ZZ7A 2GVYA 2WVUA 2PAJA 1FCUA 1XLCA 2OZ3A 4XZBA 7REQA 3P81A 1AL8A 3PK7A 2UZ9A 1T7LA 2FB2A 3OZYA 4PULA 5CJNA 3P62A 4ZGYA 3UWWA 1H7NA 4N42A 2F7FA 3D6NA 4NI8A 1IEXA 1XGEA 2POZA 2XFWA 3W2JA 5SWUA 4FK9A 1WZAA 5U4NA 1IEIA 1ZENA 1XV8A 3MYPA 3TTQA 4EXQA 2O9OA 1W0MA 4JNYA 3S5OA 3FA4A 4Z2GA 4XD6A 3WSUA 3OOQA 1B90A 3FJLA 1GUVA 4EX4A 2OXNA 2BXZA 1EJUC 2WVVA 4XD5A 5J5RA 1H1NA 2FDMA 5EYWA 5HUOA 1S46A 2V3FA 4GCAA 4OT7A 2O9TA 4P7RA 1EA9C 2J9ZA 4AZIA 2QIWA 1LBLA 4NZCA 3TTYA 1M68A 3B97A 3IVUA 3GFYA 1XIHA 3WK0A 4BWLA 4Z2IA 1D9EA 3GTNA 3V18A 1MVYA 2OQLA 2A5HA 4JYDA 4WZHA 3L4WA 3AICA 1ZBVA 5AECA 3MKCA 3T08A 5HQLA 5DY3A 4AH7A 4RXFA 3TA9A 1T96A 1XUZA 2ZTKA 1E40A 4P7LA 1YTKA 1DXFA 5FL1A 3ABXA 4GKTA 3N34A 4HPXA 4XZMX 3NO3A 4ECLA 4EXAA 4PTDA 1QJWA 3HURA 4J3TA 1TZ7A 3UG4A 3AS0A 1ZJBA 2YLAA 4JTEA 2FJUB 5DBUA 4JQ2A 2ZUMA 3NO1A 4EANA 1S5VA 2GOKA 1QPKA 1GQIA 3ZXWA 1PSCA 1G0CA 4NJKA 2HV5A 4Y7EA 3TZNA 1YTEA 4PUJA 1BXCA 3I6TA 4DWSA 1ISZA 3DU0A 3RMEA 3E6EA 2FVKA 3ARZA 4LBUA 3G18A 1EYEA 1WDWA 2V67A 5FCZA 3FDKA 1X96A 1TRDA 3R10A 3OVQA 3LRKA 2MANA 2TAAA 1DIKA 2ISWA 2J79A 2X42A 2Z4GA 1TPC1 3Q37A 3BAXA 4PFMA 7REQB 4I9TA 1EBHA 1R85A 3SCUA 4AEEA 3PS7A 2ACUA 4XBJA 3GR8A 2GGHA 4C65A 3IJ8A 3THUA 2CHRA 5IHRA 1F07A 2X7WA 1FFQA 1DWJM 3EXRA 4NSBA 3W01A 4O19A 1PXGA 1V3MA 2CITA 3GYCA 1VBRA 2ZXAA 5FI8A 4GUFA 3LXAA 5HMDA 4H6QA 3GG0A 1ZBKA 1W56A 3N6QA 3KW3A 2FZDA 1BPLB 1UROA 3UCQA 5C2XA 2P10A 1ZP3A 4JY9A 1OGBA 3TN3A 1VFLA 3M4HA 1WDPA 1Z48A 4DXKA 1SW7A 2VEIA 4KCUA 2VM8A 3A3XA 1TQJA 4Y9AA 4O18A 2WZEA 4DUOA 4DO4A 3TYDA 1BGGA 1DORA 2RAGA 3T7VA 4PB3A 5IXEA 2NSOA 5AHNA 5LIYX 3NQBA 1VFHA 3NOEA 1KM0A 4GY1A 4F4RA 4IZGA 4MPKA 4JTHA 4QJ3B 4R9OA 1XISA 3GDBA 3N2CA 4D71A 4UOJA 3E2RA 3UWUA 2XN1A 1LWJA 1I60A 2P0OA 3O07A 4XUYA 1RBAA 1OB0A 1GOOA 2POTA 4GZ7A 4IQEA 4MADA 1A53A 2KZHA 2X0YA 1K1DA 1BXNA 1KXHA 4IL0A 3VI2A 3IS4A 1IXPA 2EBNA 4YIWA 4S3DA 4HK7A 5G1TA 2BFGA 4JHZA 1OSEA 3KWXA 2NXGA 3T40A 4MB3A 5DCDA 3U5UA 1IV8A 2E6YA 2WHLA 1EJWC 2WYSA 3WF1A 2X41A 3VNIA 1E70M 3PJXA 1M41A 2YX0A 3CHEA 2YSWA 4XZWA 2VJXA 1OG0A 4QE4A 3V3WA 1G01A 1GCYA 1O66A 3ERPA 3TYAA 1O1ZA 3N17A 3GRIA 1ODUA 1WOAA 3Q94A 1IF2A 3KHDA 3MP3A 1FP8A 1D3HA 2FJKA 4I8DA 1QNQA 4DY1A 2NXIA 1J6OA 1TA3A 3C8FA 4HMDA 1EDTA 1KV8A 2ZZ1A 3HJEA 4B92A 1FHLA 3PPFA 4XIAA 1I2QA 3USBA 2PC4A 1W54A 4GUHA 1C93A 3KP0A 4C7GA 1IR1A 1W1A1 4MG4A 4AF0B 3BG5A 4L4PA 4PA8A 4JCMA 4KWVA 1TR1A 1TZZA 3DFYA 3BZJA 3T2PA 2C79A 5HOSA 4O4VA 3WY1A 2IPGA 1QTWA 2R1MA 1UYQA 3CQHA 5HWMA 3KBSA 4D9PA 1KM4A 4AZ6A 3VOGA 3VOFA 4QROA 1V8EA 2V2DA 3MI6A 1NF7A 3EWCA 3VILA 5LXXA 3UPBA 4P8UA 4DJDA 4G9PA 4JOMA 3VIKA 1YE6A 3B4YA 4ADUA 3SCVA 4CU6A 2DQXA 1IEVA 4JDBA 1EEPA 3WH5A 3U2EA 1UUMA 4TMBA 1R6WA 1TV8A 4NNAA 2W79A 4HCLA 3MSRA 3NIYA 3TFCA 4DBSA 2Q8ZA <