2ITCC

Potassium channel kcsa-fab complex in sodium chloride
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab fragment heavy chain
molecule tags Membrane protein
source organism Streptomyces lividans
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2itcC00
2ATKC 4P30A 1R3IC 3OUFA 2DWEC 2DYRC 4R8CA 3RVYA 2EIMC 2Q67A 4J9ZB 3X2QC 4LCUC 4PDMA 2WLLB 1OCRC 2HVJC 4H37A 4HYOA 5EBWC 4MW8A 2AHZA 4RO2A 1J95A 2EIKC 3OUSA 3LNMB 4R50A 1V54C 4MVOA 3SPGA 3AG4C 3E86A 5E1AC 4KFMA 5EC2C 4MTFA 3E8GA 2X6AA 3F5WC 4LP8A 2YEVA 3LDEA 2DWDC 2OCCC 4QE9A 2EIJC 3K04A 4OXSA 5KUKA 2Q68A 3SYOA 2BOBC 2R9RB 3WG7C 5EC1C 2Y69C 5J9PC 1ORQC 4X88A 3STZC 3T2MA 4R6ZA 4PA3A 2WLIA 3K08A 3SYAA 2K1EA 5B1BC 2WLMA 1S5HC 2AHYA 2IH1C 2EINC 4XDJA 1OCZC 3ASNC 3E8BA 4RUEA 1V55C 4WFGA 4J9YB 3PJSK 3SPHA 2WLLA 3VOUA 4JTCB 4TWKA 1OCCC 3R65A 4MS2A 3IGAC 5B3SC 5B1AC 3OGCC 2ZD9A 3AG1C 1M57C 4MW3A 4UUJC 4CBCA 4RUFA 4PDLA 1K4DC 4GX2A 4H33A 4MTOA 2A9HA 2HFEC 1BL8A 2WLNA 4GX5A 2HJFC 1JVMA 2ZXWC 5EBMC 3IFXA 4G28B 3STLC 2WLIB 3T4DA 2A79B 4MVUA 4G27B 4QNHB 2W0FC 2QTOA 2HG5C 4QE7A 5KUMA 3SYCA 1XL4A 4JTAB 4PA7A 4R7CA 4ZBMA 3EFFK 3KG2A 4I9WA 2JK5C 2Q69A 3SPCA 2A0LA 3F7YC 3OR6C 5EBLC 2X6CA 1LNQA 2NLJC 3E8HA 3FB7C 3LUTB 3OR7C 2ITCC 4GX1A 3K0GA 4RAIA 3F7VC 4MTGA 4P9PA 1P7BA 2WLKA 3UM7A 2IH3C 3LDDA 2WLHA 4BW5A 3ZJZA 2DYSC 3ABLC 3RVZA 3AG3C 4X8AA 3SYPA 4EKWA 3SJQC 3SPJA 3E89A 1KKDA 3TETA 2X6BA 3K06A 3K03A 4MVRA 3FB5C 4PA9A 3HPLC 5CBHA 4F4LA 1QLEC 3AG2C 1OCOC 4MVQA 2Q6AA 3T4ZA 4MVZA 4P2ZA 3BEHA 1ZWIC 3ABMC 2WLJA 3GB7C 4LBEC 1R3JC 4PA4A 2H8PC 4PA6A 4MSWC 5CBFA 1R3KC 2EILC 4MVMA 1K4CC 3RW0A 4MVSA 3T1CA 3TCUA 5IY5C 3SPIA 1G4YB 2KB1A 3E8FA 1XL6A 3FB8C 4WFEA 2P7TC 5BZBA 3ABKC 4X89A 2HVKC 2QKSA 4PDRA 4WFHA 4WFFA 1M56C 3FB6C 4PDVA 4XDLA 5CBGA 3LDCA 4XDKA 3K0DA 3ASOC 1R3LC 2BOCC 2ITDC 4HZ3A 3UKMA 4GX0A 3RBZA 3JYCA 3ZRSA 3SYQA 3E83A 4DXWA 5EK0A 4P9OA 4JTDB
chains in the Genus database with same CATH superfamily
5CB4A 2QWPB 4X9QA 2E74B 1UJWB 2FYUH 4H37A 2X0LA 4X65B 3D3IA 5LHIA 4X1IA 1OCZB 3OMAB 4LP8A 2EIJC 1RPOA 5GW7A 1WB7A 3SYAA 4YHHO 3ETGA 1VQOV 2WLLA 4LWSB 2GV9A 2HHHB 1Y76B 1AI7A 5K1XA 4I55A 1M57C 5JH7A 4QGPA 3WG7B 2AGAA 5ITZB 2QE7G 2Q0OC 1JVMA 1VQLV 2A79B 4MVUA 4I9QA 4R7CA 1RM1C 2BTQA 4I9WA 1YI2V 1T5EA 1MNGA 2IJJA 3CXHF 1XNRB 1FXVA 4DYLA 2V7QG 4ZI7B 4LH6A 2QKAA 4K0KO 3A8TA 2WLHA 5CA3A 2HLDG 1EN5A 1XILA 1Q81W 2P6JA 4BAYA 3HKDB 2CH7A 1WPBA 1XREA 1H2GA 4W4KA 3ZRXA 3IAYA 4DR6B 2BSKA 5JH7B 1AI6A 1Q6UA 2F23A 5KHGA 1SRYA 1PL0A 3RYFB 4LH7A 4XDKA 2BOCC 2VWKA 1DLBA 3E35A 4FFBA 2QEXV 5A9GA 3CEIA 3JYCA 3E83A 1LUWA 1SS3A 2ZT9B 3X2QC 2Q67A 2HVJC 3N2KB 1GN3A 4JI3O 3BRCA 4J42A 3CCMV 3CRCA 3AG4C 4I50A 2PY5A 2EZPA 2X6AA 1S77D 1NVPD 1D5AA 1MMMA 4X62B 1WJZA 3AG1B 1YIJV 2QM4A 2R9RB 1UPGA 1CP9A 2K1EA 5KA6A 4HNAA 1N34O 4LF8O 3TXSA 3OMIB 3HKCA 1OV9A 2N05A 2YXHA 3VQXA 1AVMA 3PJSK 5GTHZ 1LR1A 1FAFA 3ZN1A 3W7XA 4DV0B 5IYZB 2EIMB 2AZ2A 4DUYO 1YXBA 1NVPB 1IZ3A 5GONA 4A5UB 5D5QA 4AI8A 3L70H 3ZHSA 1DTOA 5IYCO 4FLYA 2HEPA 1E1RG 1NT2B 3CCEV 3OD4A 3FYEB 3ABMB 5EBMC 3JAKB 4GKKB 3KCXA 2ZKOA 4JI7O 2OCCB 4LF7O 3JD4A 3JD3A 4JPRA 3RYCB 4U7NA 2DQ3A 3EFFK 1N4CA 4O4LA 4X66O 2WA3A 4J7KA 1FD9A 5EBLC 5H6QA 1YJWV 5IJ9A 1I5XA 5CA1A 3UM7A 2EJ7A 4OGQB 4GCZA 2ILMA 1AR1B 3SJQC 4DR4O 3K06A 4FLZA 1BHAA 5DEDA 1KKCA 5CBHA 4MVQA 1ZLZA 4JV5B 3P3PA 4FFBB 2YXLA 2IM9A 2WLJA 1NS1A 5D5PA 2HKOA 3W7UA 1OZ0A 2XAQA 1CPYA 2LGQA 2BTOA 1G1XB 1XOUA 2KB1A 5LGUA 3W7TA 4ZIBA 3H9VA 3FB6C 3EVKA 2AXTZ 3H1LH 3E22A 3GWOA 1S5LZ 3RBZA 2YC0A 4DXWA 1PPJH 2VQFO 1SQFA 3D36C 3G80A 4BR6A 5JVDA 4JV5O 4J9ZB 1KP2A 1Z5VA 1DK1A 3DC6A 4AQYO 4MVOA 3SPGA 3B4SA 3T1HO 3L73H 1TUBB 1Y67A 4LF6B 4UCVA 2Y4TA 3ZMSA 1QCEA 3RWRD 1SQGA 4NXMO 2Y69C 4LC1A 4PA3A 2WSSG 3ASNC 1CXZB 1MSWD 3JD2A 4AQYB 5LMNO 4X1KB 1OCCC 1S3JA 2PF4E 4EB6A 1HNZB 4NXNB 3B2EE 1EM1A 3ABUA 1SF9A 1EN4A 1GKFA 2G38A 5CA1B 3GVMA 3IFXA 2EILB 2DQ0A 1AJPA 1KYOF 1XL4A 2YSUB 3RYIA 4NB5A 4X20A 1VQ9V 3BA9A 4LF4O 1V55B 1XMQB 4O4IA 3OAAG 2GHYA 4JYAO 3RN4A 3DXRA 3LDDA 1FXKA 2JJ1G 3S3XA 4Q20A 3FAVB 3OW2U 4IYHA 4H44B 5CN0A 3JCUZ 1VQ8V 3T4ZA 4K0KB 1ZWIC 2VQEB 1K34A 1BHBA 4PJ0Z 2ODMA 1GRJA 2IW5A 3HKEB 2F95B 3CYOA 5KA5A 2QWNB 3LDCA 1MZEA 4GX0A 1PL4A 4FK5C 3WB1A 1IBKB 1R3IC 5L3BA 2DW4A 1Z2GA 2XHBA 3LNMB 4DV0O 1R6KA 3E86A 4I0XB 1TUBA 4O4JA 1YTFD 5L3FA 4DRXB 4FJCC 1YITV 4LFBO 1XNRO 2YIBD 5C8YB 3AK3A 1ORQC 4DW0A 4X88A 5LGNA 1N36B 2NN4A 1KBHA 1H38A 1AP6A 4LNUA 1V55C 1IBLO 1SQXH 1AR5A 2QM7A 1QU7A 5B3SC 1B06A 3OGCC 4UCRA 1BQZA 2MW2B 2H94A 4GX2A 5EIBD 1Q90D 1AP5A 4QIWF 2Y4UA 2F1MA 2A7WA 1KMIZ 3SDLA 3JCZA 1IBMB 2JIZG 3CRRA 3CCRV 3OR6C 1UFIA 3K9AA 3LUTB 2JGDA 2Q4PA 3AK1A 2PYLA 4K3AA 2IU3A 2UXDO 4CH5A 1SC5B 4UFZA 3N2GB 1YVWA 3ABLC 4DR3O 2JRIA 2X7RB 1QR8A 3AK2A 2LQTA 4JI1O 2M6YA 2Z3YA 2YIDA 3U11A 3ZMTA 3CCQV 1NU1H 3CD6V 3ZS8C 2F93B 2ZCEA 1I94O 4WF9V 4PI0A 2H8PC 2LFRA 5EZYB 4MVMA 5KHIA 1Q8IA 2HP8A 2Z0AA 4QJFB 5IY5C 4DV7O 1BZKA 4GLXA 4X89A 5J2TA 3ASOC 3ZX6A 4HZ3A 1NR1A 4UB6Z 4D7TA 1ZL8B 2UXBB 4JTDB 1Q86W 2DYRC 4CS3A 3OUSA 1XEQA 2LW1A 4J11A 5B5EZ 5KHKA 3E8GA 1PM9A 4O4IB 2Q7GA 4TQDA 2YDEA 5IYDO 1RPRA 3BY6A 2GUZA 1JOYA 1AJQA 2WA4A 1ZUQA 2PYJA 4LF4B 4RUEA 1K8AW 1BSMA 3RYCA 4BW9A 3VOUA 5KMGB 1XBLA 4YJ3A 1KECA 5B1AC 4X1KA 1W59A 1RFYA 3CSXA 1NTMH 4DV4B 3EXAA 5F2VO 1RSOB 5LMNB 3M7MX 3OMNB 4LF5O 1HNZO 3ETEA 2P5OA 2RDCA 4G27B 1EBOA 4PA7A 3AG7A 2WAMA 2A0LA 2B5UA 4CH6A 2RCVA 2VQFB 4GX1A 1L0LH 4WBNA 5IE9A 2EINB 1JJ2U 4MTGA 3K5LA 1Q82W 3TK1A 1XMOB 4OPAA 1BE3H 1JFFA 3A2FA 3FB5C 2ZQMA 4DV3B 2UXXA 1EFRG 5JVDB 4PA9A 1A32A 1V54B 1NTZH 2ZR2A 2ZDIA 3E22B 3MD0A 2P4KA 4PA6A 2Y48A 3C3SA 4UVAA 4DR1B 1P4RA 3T1CA 4X1YA 2OTLV 4N21A 1K5QA 1XL6A 1ZTEA 5LP6A 4LFBB 1ROPA 4XDLA 1N8RW 2YS8A 1VF5B 3BCCH 3DSQA 2Y0PA 2ARHA 3BAAA 2ZNIA 4B3RB 4LF9B 4AHCA 4O2AB 4X1YB 4F6RA 1IBLB 3Q4HB 4MW8A 3THOA 2LP7A 4Z1VA 1YHQV 2UU9O 1SKVA 1JR9A 4K35A 1TGOA 1HNWB 5L3CA 2QDOA 3JAWA 2B9ZA 4OXSA 1JA8A 1XMQO 5HFLA 4ZI7A 2GTAA 1QVGU 5B1BC 2IH1C 4XDJA 1NBMG 3K79A 4WFGA 3TXQA 5J2UB 4CC6A 1FFXB 3CRQA 5HFMA 4JI5B 2FTKA 4B3TO 1RSOA 3SJAC 1NJIW 3K57A 2WLNA 2YUAA 1R6NA 2WLIB 4LF5B 2E76B 4QNHB 1BQ0A 2W0FC 3CWBH 3SYCA 4KHPB 3QO8A 1FJGB 2ZIOA 1I08A 3QO5A 2JS5A 1L0NH 3SPCA 5B3SB 3E8HA 3OR7C 5IWAB 4P9PA 2YIBA 3OTOO 1M4UA 2QTSA 1BGYH 1OHHG 4BW5A 4B08A 4X8AA 1GM9A 3APOA 1OCRB 1KU9A 3TETA 4YY3O 4DO2A 4E2LA 1TA8A 4DR2B 3AG2C 2L35A 2QWOB 3FYIB 4PA4A 3PN1A 1K4CC 1IURA 2XOKG 5L3GA 2YEVB 4JI1B 1U96A 5BMVB 2QKSA 1GO3F 5B66Z 3UQ8A 4JI2O 4TT3G 2CH7B 3VQVA 2C2AA 3G6BA 1Q43A 4Z2WA 5EIBC 4FLUA 3CE2A 1SA0B 3B77A 2DMXA 4IIJB 3IJ4A 4RO2A 3ZBHA 2EIKC 2K9PA 3OE7G 4DR5B 4R50A 2QA4V 2XNDG 3JASA 3ZHUA 4N23A 3KCYA 4NR1A 4NXMB 5B1NA 5LXTA 1Q3EA 3B8NA 3U10A 3CP1A 3BVOA 1MOFA 4FLVA 2YI9A 2R9AA 3SGIA 2OYQA 3H01A 3UT5A 3ZHRA 2UUCB 2DYRB 4GYCB 3T2MA 3K08A 1XHXA 1Y74A 3RGBA 2ZM6B 4TOIA 4JI4O 3T1YB 5FPOA 1YEWA 4WFBV 5JCOA 4U3JA 4NVPA 4JI3B 3D36A 4I4TB 1AI4A 4F6RB 2JGUA 3W7SA 1M93A 3G67A 3G71V 2DOSA 4O2AA 3STLC 2FB5A 4LF9O 2YIAA 4OX9O 5FL7G 5JWPA 4L8JA 1EN6A 5KX5B 3ABKB 3KG2A 3CCLV 4KHPO 5LL6Y 2JK5C 1VQ4V 3FKSG 2X6CA 1LNQA 1WP7A 3HKDA 1M57B 3BABA 4YIOA 1BCCH 1QQCA 3APQA 4NKGB 2DYSC 3RVZA 2ZDIC 5FNVB 2IU0A 4EKWA 1XDCA 1R73A 3E89A 4LNUB 4IGGA 2F43G 4DK0A 4DV1B 3CJHA 4P2ZA 2P4VA 4FLWA 1KD1W 1YJNV 3B09A 1NR7A 3TCUA 3VBBA 4LF7B 3FB8C 5BZBA 1VF6C 2EBOA 4O4HB 5CBGA 1OCOB 3WFVA 1IBMO 3P30A 5JQGB 3HKEA 4U3FH 1VF6A 1HP8A 3OUFA 3OM3B 3ZIAG 4DV4O 4DR3B 2XAJA 4L87A 4ASUG 3LDEA 3K04A 1SZXA 2QR4A 1FXKB 1SQQH 2BOBC 4DR2O 2Q5ZA 3AEIA 2CTRA 4X20B 2FL4A 1OCZC 4JYAB 2N04A 3FAVA 3E8BA 1J5EB 4WFAV 3H1HH 3A0RA 4JTCB 5A2QN 1RM1B 3K9SA 2QJ1A 1SQPH 3JATA 4GT1A 1X4TA 2ZE5A 2IJHA 4CS4A 4PI2A 3T1HB 1M1KW 3FFQA 4GX5A 3HB3B 2QKCA 2EX3A 3CMEV 2ZINA 1FYJA 4GKJB 4JI8O 3QVNA 2IH3C 5EZYA 1KKDA 4O4HA 2X6BA 3K03A 1PP9H 1TAEA 3N2GA 4PELA 5H2FZ 1TUEB 1QLEC 4FZ1A 1F7YA 1TVKB 4DV6B 4DV1O 1R3JC 4X62O 2W6IG 4WCEV 2Q0AA 3RW0A 3CJHB 2KSDA 1BMFG 4GKJO 1VF7A 3JALA 1I5YA 4OPHA 1D5NA 1YCIA 3CPWU 5LYJA 4B3MO 3UKMA 3C3TA 3OEHG 1E79G 1N33O 3QF7A 5B1OA 5CA0A 3JSLA 4PDMA 3O9OA 1HDJA 1VQPV 2HHHO 4FMTA 1P7GA 5LHHA 1O9HA 2CAZC 1W0JG 1SESA 2OCHA 1JQ0A 3F5WC 2YEVA 2GSMB 1XUQA 3ML0A 1W2BU 4DV5B 1VIBA 2Z5UA 5KUKA 1OCCB 4ZOLB 1PNLA 2Q68A 1E1QG 3CCSV 4QPJA 2F4VO 5CMUA 3STZC 2JDIG 1NI8A 5DM6V 3DC5A 5H9CA 1Y74B 1H8EG 3IGAC 3KKYA 3ABLB 3WB2A 1IXBA 4CBCA 2Q8VA 4O2BA 4MTOA 4NTYA 1NTKH 2A9HA 5GONB 4UCOA 5H6RA 1XQ8A 4JAVA 3GWKC 4CH4A 4JI6B 3I5DA 2PI5A 3ZN0A 2KQXA 2RNBA 3CXCU 3F7YC 1BT8A 3F5TA 2ITCC 2UUBB 4NYKA 4RAIA 5DN6G 1HW7A 3OT7A 3WB0A 1H2MA 3P3NA 1GMGA 1M90W 4DR1O 1KC8W 5BMVA 5DECA 1M5IA 1S0VA 4JYYA 1K9MW 4I50B 2ZXWB 3QNEA 4YHHB 3JD0A 3ABMC 4O2BB 5KHHA 3BPZA 3UCSC 4DUYB 1I0HA 1DGSA 2P7TC 4QPKA 4PDRA 3BHPA 5IT9N 2V4DA 4B3MB 1B6QA 3OTFA 1N34B 4P9OA 1VQ5V 5LP6C 4LF8B 4GKKO 4R8CA 2DWEC 4DR7B 1YF2A 2IBZH 4HYOA 5EBWC 2R9IA 4FPPA 1J95A 4IL6Z 1S5JA 3OEEG 1SETA 4IYIA 2HR3A 1WB8A 1GN4A 1QHTA 1FPOA 1R1BA 2DWDC 2JJ2G 3MDSA 2ADPA 2OWOA 1FFXA 3K5OA 1AI5A 3ZEDA 3MAQA 4FM1A 5J2UA 2EINC 1HNXB 4ZHQA 3L75H 3SPHA 3SJBC 5JCOC 3W7WA 2AW9A 5IJ0A 4JASA 3K5MA 3ZCCA 1K4DC 5FNVA 1BL8A 1K33A 1TVKA 2ZXWC 2F66C 4HBNA 1VQ6V 5KUMA 1AR4A 4JTAB 1K3EA 4YXWG 4YJ3B 3F7VC 3ASNB 2UUBO 1URFA 3D3QA 3K3WA 1PNKA 3HKBB 3J81N 1WAZA 2CDYA 3IC7A 4U3JB 4RQEA 3RT3C 2NR5A 4HAMA 4FLTA 1PNMA 4JI2B 1R3KC 2EILC 2A06H 3JAKA 1EZJA 2BE3A 3CC4V 1MZFA 2XAHA 5BY1A 4O4LB 1YTFB 2WWWA 3CCJV 1QLEB 3ZRVA 3B40A 3CB2A 4P30A 4UVCA 1MSDA 1ZSPA 4TUYA 1OCRC 1Q6IA 4B3TB 3BA8A 5LOVB 1SA0A 3MHHC 3QTCA 3M99B 4HNAB 2YICA 5E1AC 3CCUV 1D2DA 1KUQA 2PUSA 1S76D 3JARB 5J9PC 4IHJB 3G6EV 2JEUA 2LO1A 5JQGA 4ICGA 4JYCA 3UO2A 4TV9A 4FVMA 2CTWA 2EIJB 2EJRA 1VP7A 2E5LO 3AG1C 4FLXA 1M9NA 4RUFA 4H33A 1K7DA 3N2KA 2XUMA 5TISZ 4D7SA 1K97A 5JJJB 2QTOA 4DK1A 3JSNA 1PV0A 3ETQA 3K0GA 5KLVH 1GM7A 1K5SA 1V9PA 1VARA 4Z1MG 4W4LA 4DR4B 5KAIZ 1J5EO 3NXSA 1US6A 1Q6HA 3ZHVA 1QVFU 2ZIMA 1N36O 4F4LA 3A0HZ 2EIKB 1H2LA 2QM8A 4FZ0A 1GH6A 5LMUO 4DRXA 2P22C 5EYPA 1H2KA 1THZA 3L9DA 2W6JG 4NXNO 4WFHA 4WFFA 2ETNA 4J41A 1R3LC 4J7ZA 2P06A 3M8AA 1HNXO 5LGTA 4IHJA 2WLLB 4X64B 5ITZA 5LMUB 3QO7A 1L8DA 4I55B 1Y76A 3ZMUA 4LFCB 5BR8B 4KXRA 4IIJA 5E79Z 3WG7C 3CC2V 2EZOA 1IX9A 3KZIZ 1YSCA 3AG4B 2MK3A 3OGIB 2B1IA 2LFSA 1GTOA 1SZTA 1I94B 1MG1A 4EFEA 5JJEB 4BIOA 5GTIZ 4MS2A 4ABMA 1AILA 2ZE6A 5C8YA 3ABTA 1F51A 1FS0G 5FLXN 4LFAO 3RYIB 2OIEA 1G8MA 4ZKIA 2UXBO 4O4JB 4DW1A 1SERA 4UCTA 3FD9A 4I0XA 2PGGA 2VS0A 1WA8A 3SR2C 4H0LB 1VEWA 5IY5B 2PI4A 2XT9A 5J2TB 4DV7B 1MABG 3BFRA 1JCHA 3T1YO 4EFBA 1DF4A 4B3SB 1XMOO 1WLEA 3HPLC 2Q6AA 2NNUA 2BCCH 1HR0B 1HNWO 3K5NA 3LNNA 4DR5O 1P84F 4MSWC 5CBFA 3HR0A 4MVSA 2JVDA 1Z5WA 5EYPB 2FKXA 2GDSA 1N32B 3CRAA 4MT8A 4Q6GA 4ZHQB 1VQKV 3AG2B 2KG7A 5IYBO 4CZZA 3RFRA 4B3RO 3QG5A 4JAUA 5L3EA 1WPXA 2AHZA 2UXCB 1V54C 3OFNG 2OT5A 4KFMA 4FFKA 1NZ6A 5LA6B 2R70A 1CEZA 2UU9B 4DR6O 1QR9A 1N32O 4TSFG 4I4TA 3TGUH 2L6LA 4PD4F 3Q4HA 1EZVH 2Q9LA 2ZR3A 2D3OW 4K8ZA 1U97A 4TV8B 3L72H 1SQBH 4JI0O 3OTOB 1X59A 2AHYA 1AJNA 4NTXA 1NQTA 3LSUA 2RJZA 1Y6XA 4J9YB 1NKDA 1AROP 2UXCO 4DUZB 2B1GA 1IBKO 1W0KG 4PHZA 4JAAA 4JI6O 1YZBA 4CS2A 4TV9B 3EHBB 4JF3A 1H2NA 4UCUA 2XASA 1OJHA 4DV2O 4F6EA 2AZ0A 1YJ9V 2GBOA 2HG5C 2Y0IA 1JFFB 4ZBMA 1XNQO 1N0JA 5KAFZ 3ASOB 1YDXA 5LXTB 4UV8A 2D2CB 3SPJA 1AB3A 1SQVH 3HKCB 4FM2A 5L3DA 4X64O 4AILC 1ENVA 3BEHA 1KP3A 2DN9A 4LBEC 2P90A 1QLNA 2RMKB 1VQNV 2H3OA 3MHSC 4B7EA 4DR7O 1F23A 1M56C 2CUGA 4LFAB 3J80N 2O57A 2VRZA 2ITDC 2HJDA 2XTAA 5IJ9B 3P32A 3SYQA 2E5LB 5EK0A 1JMKC 4BWAA 2EIMC 4LCUC 1K73W 5LHGA 3HKBA 5B1AB 1FJGO 3ZRWA 4K8XA 1P49A 1WNSA 3RYFA 4JI5O 3CX5F 4EB6B 5IWAO 2E3CA 2CGNA 3JARA 3K59A 2LW7A 2OCCC 4JYBA 1B04A 5EC1C 4DV3O 5CA0B 4EEQA 2UUCO 3L74H 2WLIA 4CC5A 1NH2B 5BR8O 4YJ2B 4LFCO 3J7AU 1RP3B 3X2QB 3ZMZA 2IJIA 2PZSA 2N74A 4PV1B 2ZD9A 4MW3A 1MA1A 4PDLA 5LBQA 3JAWB 3AG3B 3ICXA 1VMGA 2KKWA 2P67A 4J80A 4G28B 2W0XA 2JS3A 2Y69B 2XAGA 3N27A 2CTQA 1DF5A 2M7WA 2V1DA 1FFTB 3RYHA 4UCSA 1F4NA 1FKAO 1M56B 4J7JA 1PD3A 2WLKA 2OTJV 3ZMVA 2QGNA 3K58A 3ZJZA 3SYPA 4KL1A 5LA6A 2FMLA 3VQWA 2A3QA 3LSSA 3GB7C 4I5SA 3IC9A 4RWUA 4B3SO 1COWG 1PKXA 1G4YB 1ZX3A 5BXZA 1BS3A 3RYHB 3SJCC 3DTUB 3WU2Z 5LYJB 3CMAV 4X65O 1QBZA 5IJ0B 5CB4B 4JI0B 2ATKC 5KHJA 3RVYA 1XNQB 2LJ2A 1GAXA 4YJ2A 3O65A 4TQFA 4BIZA 5EC2C 2ZNJA 1N0NA 2ADQB 2UUAO 2VQEO 4QE9A 1WN7A 4X66B 2E75B 3JAMN 1QNMA 1S72V 4R6ZA 3LSQA 4JI8B 2WLMA 1S5HC 4LWSA 5H5NA 4H13B 1Q7YW 1WA8B 4UVBA 4NTWA 2GUZB 2XAFA 2IJKA 5KMGA 3DGEA 2Q7EA 4JGSA 2YI8A 4XBFA 3ZRWB 5IDJA 1F4MA 3JATB 2HJFC 1O9GA 1NH2D 4X1IB 1Y4MA 2UXNA 4QE7A 1GN2A 4J10A 1FXHA 2NLJC 3FB7C 4DV2B 5AG2A 4IT5A 1P7BA 2BSKB 4JZ2A 2PTMA 4YY3B 5KX5A 2CGOA 4JZGA 4MVRA 4E4EA 3VQYA 1B3QA 2R72A 4G2KA 4LF6O 1IXMA 2CTPA 2LGWA 4MVZA 4U7OA 1ZL8A 3JD1A 4DV6O 3I56V 2DJVA 3H1KH 3L71H 3H1IH 3JALB 3R66A 3SPIA 4C7UA 3ABKC 2HVKC 4JI7B 1R6TA 4PDVA 4B7KA 2DYSB 3ZRSA 4CH3A 4OX9B 4GZRB 1Q5OA 4D6TH 3UT5B 2CK3G 5B1BB 2ZE8A 1Y66A 2WPDG 1K92A 3TJTA 1JPXA 1VQMV 4FM0A 4MTFA 4TV8A 2YXYA 1JJOA 1GN6A 2JGDB 2RQ6A 3JASB 2UUAB 2GTSA 4ZOLA 4I7ZB 3SYOA 4DV5O 1VQ7V 5LP6B 3CS5A 3E2EA 2F4VB 1I7FA 5K1PA 1ZAUA 3G4SV 4JI4B 3I55V 2QWQB 2Q7HA 3NR7A 4UV9A 5C93A 4FIPC 2CE4A 4TWKA 3B8MA 2QWRB 3R65A 4BIUA 4UXNA 2KG7B 3CRMA 3ETDA 2Q73A 4UUJC 4UB8Z 3U0ZA 5FPRA 1KB9F 2HFEC 1WP8A 3UO3A 3CCVV 1FXKC 1N33B 3H1JH 4WBNB 3FX7A 3CC7V 3T4DA 1JX9A 2BTQB 4RQFA 2Q69A 2JEXA 2OIGA 3C90A 5JJNB 1XI1A 1GK9A 1LUVA 2ZM6O 2QSAA 1HR0O 4MTXA 2VWJA 2ZE7A 3AG3C 1L1FA 1IVSA 2DE0X 4DUZO 4YIPA 2UXDB 1OCOC 3CHXA 4KP4A 2EULA 1G6UA 4KUMA 4TUYB 1KQSU 1GM8A 2RN9A 3D8CA 1XHZA 1H8HG 3E8FA 1H2SB 3ZHTA 4WFEA 5IYZA 3S3WA 5LOVA 3ZHQA 3K0DA 1IDSA 4LR3A 3DXRB 1HWYA 3A0BZ 4GUNA
chains in the Genus database with same CATH topology
5B1OA 1Q86W 2DYRC 1UJWB 4PDMA 4H37A 2X0LA 4JAUA 5L3EA 1WPXA 2AHZA 3OUSA 1VQPV 4FMTA 3D3IA 5LHHA 1V54C 3OFNG 5LHIA 2OT5A 4KFMA 1W0JG 1SESA 3E8GA 1OCZB 1CEZA 1JQ0A 3F5WC 3OMAB 4LP8A 2YEVA 2GSMB 5IYDO 3ML0A 1W2BU 1RPRA 1QR9A 2EIJC 4TSFG 2Z5UA 5KUKA 1OCCB 1PNLA 2Q68A 1RPOA 1E1QG 2D3OW 3CCSV 2ZR3A 4QPJA 5GW7A 3BY6A 5CMUA 3STZC 2JDIG 3SYAA 1JOYA 1AJQA 2AHYA 3ETGA 1AJNA 1NQTA 5DM6V 4RUEA 1VQOV 4J9YB 1K8AW 1NKDA 2WLLA 1AROP 3VOUA 5H9CA 1H8EG 2B1GA 3IGAC 1AI7A 1W0KG 1KECA 5B1AC 3ABLB 1M57C 3WG7B 4CBCA 4MTOA 3EHBB 2A9HA 2QE7G 3OMNB 4JF3A 2XASA 5H6RA 1JVMA 1VQLV 3ETEA 1YJ9V 4JAVA 2A79B 4MVUA 4G27B 1EBOA 2HG5C 2PI5A 4PA7A 4R7CA 4ZBMA 3ZN0A 1RM1C 4I9WA 1YI2V 2WAMA 3CXCU 2A0LA 2B5UA 3F7YC 2IJJA 4GX1A 3ASOB 2ITCC 1FXVA 2V7QG 2EINB 4RAIA 1JJ2U 4MTGA 5DN6G 1Q82W 3TK1A 4UV8A 2WLHA 5CA3A 2HLDG 3SPJA 1GMGA 1Q81W 1M90W 1KC8W 3FB5C 2ZQMA 2UXXA 1EFRG 4PA9A 5L3DA 2P6JA 4BAYA 1V54B 2ZR2A 1K9MW 1S0VA 1ENVA 2ZDIA 2ZXWB 3QNEA 3BEHA 3JD0A 3ABMC 3MD0A 1KP3A 4LBEC 4PA6A 3ZRXA 1H2GA 2Y48A 4UVAA 2P90A 1QLNA 1P4RA 3T1CA 1VQNV 1AI6A 5IYBO 2OTLV 4N21A 1K5QA 1SRYA 1XL6A 3MHSC 2P7TC 1PL0A 4QPKA 4PDRA 1F23A 1M56C 1ROPA 4XDLA 1N8RW 4XDKA 2BOCC 2ITDC 1DLBA 3E35A 2QEXV 3JYCA 3P32A 1B6QA 3E83A 3SYQA 5EK0A 1VQ5V 4P9OA 4R8CA 2DWEC 3X2QC 2EIMC 2Q67A 4LCUC 1K73W 2HVJC 5LHGA 4HYOA 5EBWC 5B1AB 4MW8A 2R9IA 4FPPA 1J95A 3ZRWA 3OEEG 2LP7A 1SETA 3CCMV 2HR3A 3AG4C 1YHQV 2EZPA 2X6AA 1S77D 5L3CA 1NVPD 2DWDC 2OCCC 2JJ2G 4OXSA 3AG1B 1YIJV 4JYBA 2R9RB 5HFLA 5EC1C 2WLIA 1CP9A 2K1EA 5KA6A 1QVGU 1AI5A 5B1BC 3OMIB 1NH2B 2IH1C 2EINC 4XDJA 1NBMG 3K79A 3X2QB 3ZMZA 4WFGA 3PJSK 3SPHA 3ZN1A 3W7XA 2IJIA 2EIMB 5HFMA 3W7WA 1NVPB 2FTKA 2ZD9A 4MW3A 4JASA 1DTOA 5IYCO 1E1RG 4PDLA 1K4DC 3ZCCA 3CCEV 5LBQA 1NJIW 1BL8A 1K33A 3FYEB 3ABMB 2WLNA 3AG3B 2ZXWC 2P67A 5EBMC 1R6NA 4G28B 2WLIB 2OCCB 3JD4A 4QNHB 3JD3A 4JPRA 2W0FC 3SYCA 1VQ6V 5KUMA 4U7NA 3QO8A 4JTAB 2DQ3A 2Y69B 1K3EA 3EFFK 3QO5A 2XAGA 4YXWG 3SPCA 1DF5A 2M7WA 5EBLC 5B3SB 3E8HA 3OR7C 2V1DA 1FFTB 5H6QA 1YJWV 1F4NA 1M56B 3F7VC 4P9PA 1PD3A 3ASNB 1I5XA 2WLKA 2OTJV 3ZMVA 3K3WA 3UM7A 1OHHG 4BW5A 3ZJZA 4GCZA 4X8AA 1GM9A 3SYPA 1PNKA 3SJQC 1AR1B 3TETA 1OCRB 3K06A 4DO2A 4E2LA 1BHAA 5CBHA 3IC7A 3AG2C 4MVQA 4RQEA 3LSSA 4HAMA 2WLJA 3GB7C 3FYIB 4PA4A 4I5SA 1PNMA 2HKOA 1R3KC 2EILC 1K4CC 2XOKG 5L3GA 1COWG 2YEVB 1OZ0A 4CZZA 1PKXA 2XAQA 1CPYA 3W7UA 1EZJA 1G4YB 2KB1A 5LGUA 3W7TA 3CC4V 2QKSA 2XAHA 3DTUB 3FB6C 1YTFB 1GO3F 2WWWA 3CMAV 3CCJV 4TT3G 3GWOA 1QLEB 3RBZA 2C2AA 1QBZA 4DXWA 3ZRVA 2ATKC 4P30A 4UVCA 3RVYA 3B77A 4J9ZB 1KP2A 1OCRC 4RO2A 2EIKC 3OE7G 4R50A 2QA4V 2XNDG 3MHHC 4MVOA 4N23A 3SPGA 3M99B 4BIZA 5B1NA 5E1AC 5EC2C 3CCUV 3B8NA 3CP1A 1MOFA 1S76D 4QE9A 3ZMSA 1QCEA 3H01A 2Y69C 5J9PC 4LC1A 1S72V 2DYRB 3G6EV 2JEUA 3T2MA 4R6ZA 4PA3A 3LSQA 3K08A 2WLMA 1S5HC 2WSSG 3ASNC 1MSWD 4JYCA 3JD2A 1Q7YW 2EIJB 4WFBV 4UVBA 1OCCC 2EJRA 1S3JA 2XAFA 2IJKA 3AG1C 3DGEA 1M9NA 3ABUA 4JGSA 4RUFA 3D36A 4XBFA 4H33A 1AI4A 1K7DA 1GKFA 3ZRWB 5IDJA 1F4MA 3W7SA 2HJFC 3G71V 3IFXA 3STLC 2EILB 1NH2D 2DQ0A 1K97A 1AJPA 1Y4MA 2UXNA 2QTOA 4QE7A 5FL7G 1XL4A 2YSUB 3ABKB 3KG2A 3CCLV 2JK5C 1VQ4V 1VQ9V 3FKSG 1FXHA 2X6CA 1LNQA 2NLJC 1V55B 3FB7C 3K0GA 1M57B 3OAAG 1GM7A 1K5SA 2GHYA 1P7BA 4Z1MG 3LDDA 1FXKA 2DYSC 3RVZA 2ZDIC 2IU0A 2JJ1G 3NXSA 4EKWA 3OW2U 4Q20A 1R73A 3E89A 1QVFU 4MVRA 5CN0A 1VQ8V 2F43G 4F4LA 3T4ZA 4G2KA 1IXMA 2EIKB 4U7OA 4MVZA 2QM8A 4P2ZA 1ZWIC 1KD1W 3JD1A 1K34A 1YJNV 3I56V 1BHBA 1NR7A 3TCUA 3VBBA 1THZA 3SPIA 2IW5A 3FB8C 2W6JG 5BZBA 3ABKC 2HVKC 3CYOA 4WFHA 2EBOA 4WFFA 5KA5A 5CBGA 4PDVA 1OCOB 3WFVA 3LDCA 1R3LC 4GX0A 2DYSB 3ZRSA 3P30A 4FK5C 1R3IC 3OUFA 5L3BA 5LGTA 3OM3B 3ZIAG 2WLLB 2CK3G 2DW4A 5B1BB 1Y66A 3LNMB 3QO7A 2XAJA 4L87A 2WPDG 1K92A 1R6KA 1JPXA 3E86A 1VQMV 4MTFA 1YTFD 5L3FA 3ZMUA 4ASUG 3LDEA 4FJCC 1YITV 3K04A 1FXKB 3SYOA 2BOBC 1VQ7V 3WG7C 3CC2V 1ORQC 3E2EA 2EZOA 4X88A 5LGNA 3AEIA 1YSCA 3AG4B 2MK3A 3G4SV 2B1IA 3I55V 1OCZC 2LFSA 1H38A 1GTOA 1SZTA 3E8BA 1V55C 4WFAV 1MG1A 4UV9A 5C93A 3A0RA 4FIPC 4JTCB 4TWKA 3B8MA 1RM1B 4MS2A 3R65A 4BIUA 4UXNA 2QM7A 5B3SC 3ETDA 3OGCC 4GT1A 3ABTA 4UUJC 1F51A 2H94A 1FS0G 2IJHA 4GX2A 2HFEC 1M1KW 1G8MA 4ZKIA 4GX5A 3HB3B 3CCVV 1FXKC 1SERA 4QIWF 3CC7V 3T4DA 3JCZA 1JX9A 2JIZG 4RQFA 3CCRV 2Q69A 2JEXA 5IY5B 3CMEV 2PI4A 3OR6C 3K9AA 3LUTB 1MABG 2IU3A 1GK9A 1JCHA 2IH3C 4MTXA 3ABLC 3AG3C 1KKDA 1L1FA 1DF4A 2X7RB 2X6BA 3K03A 4PELA 1QR8A 1WLEA 1TUEB 3HPLC 2Z3YA 1QLEC 1OCOC 2Q6AA 2NNUA 3ZMTA 3CCQV 4KP4A 3CD6V 4WF9V 1R3JC 2H8PC 2W6IG 4WCEV 4KUMA 4MSWC 5CBFA 2LFRA 4MVMA 1GM8A 3RW0A 1KQSU 4MVSA 1BMFG 5IY5C 1H8HG 3E8FA 4QJFB 4WFEA 1I5YA 4X89A 3K0DA 3CPWU 3ASOC 4HZ3A 1NR1A 3UKMA 1HWYA 4MT8A 1VQKV 3AG2B 3OEHG 1E79G 4JTDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATK C;  4P30 A;  1R3I C;  3OUF A;  2DWE C;  2DYR C;  4R8C A;  3RVY A;  2EIM C;  2Q67 A;  4J9Z B;  3X2Q C;  4LCU C;  4PDM A;  2WLL B;  1OCR C;  2HVJ C;  4H37 A;  4HYO A;  5EBW C;  4MW8 A;  2AHZ A;  4RO2 A;  1J95 A;  2EIK C;  3OUS A;  3LNM B;  4R50 A;  1V54 C;  4MVO A;  3SPG A;  3AG4 C;  3E86 A;  5E1A C;  4KFM A;  5EC2 C;  4MTF A;  3E8G A;  2X6A A;  3F5W C;  4LP8 A;  2YEV A;  3LDE A;  2DWD C;  2OCC C;  4QE9 A;  2EIJ C;  3K04 A;  4OXS A;  5KUK A;  2Q68 A;  3SYO A;  2BOB C;  2R9R B;  3WG7 C;  5EC1 C;  2Y69 C;  5J9P C;  1ORQ C;  4X88 A;  3STZ C;  3T2M A;  4R6Z A;  4PA3 A;  2WLI A;  3K08 A;  3SYA A;  2K1E A;  5B1B C;  2WLM A;  1S5H C;  2AHY A;  2IH1 C;  2EIN C;  4XDJ A;  1OCZ C;  3ASN C;  3E8B A;  4RUE A;  1V55 C;  4WFG A;  4J9Y B;  3PJS K;  3SPH A;  2WLL A;  3VOU A;  4JTC B;  4TWK A;  1OCC C;  3R65 A;  4MS2 A;  3IGA C;  5B3S C;  5B1A C;  3OGC C;  2ZD9 A;  3AG1 C;  1M57 C;  4MW3 A;  4UUJ C;  4CBC A;  4RUF A;  4PDL A;  1K4D C;  4GX2 A;  4H33 A;  4MTO A;  2A9H A;  2HFE C;  1BL8 A;  2WLN A;  4GX5 A;  2HJF C;  1JVM A;  2ZXW C;  5EBM C;  3IFX A;  4G28 B;  3STL C;  2WLI B;  3T4D A;  2A79 B;  4MVU A;  4G27 B;  4QNH B;  2W0F C;  2QTO A;  2HG5 C;  4QE7 A;  5KUM A;  3SYC A;  1XL4 A;  4JTA B;  4PA7 A;  4R7C A;  4ZBM A;  3EFF K;  3KG2 A;  4I9W A;  2JK5 C;  2Q69 A;  3SPC A;  2A0L A;  3F7Y C;  3OR6 C;  5EBL C;  2X6C A;  1LNQ A;  2NLJ C;  3E8H A;  3FB7 C;  3LUT B;  3OR7 C;  2ITC C;  4GX1 A;  3K0G A;  4RAI A;  3F7V C;  4MTG A;  4P9P A;  1P7B A;  2WLK A;  3UM7 A;  2IH3 C;  3LDD A;  2WLH A;  4BW5 A;  3ZJZ A;  2DYS C;  3ABL C;  3RVZ A;  3AG3 C;  4X8A A;  3SYP A;  4EKW A;  3SJQ C;  3SPJ A;  3E89 A;  1KKD A;  3TET A;  2X6B A;  3K06 A;  3K03 A;  4MVR A;  3FB5 C;  4PA9 A;  3HPL C;  5CBH A;  4F4L A;  1QLE C;  3AG2 C;  1OCO C;  4MVQ A;  2Q6A A;  3T4Z A;  4MVZ A;  4P2Z A;  3BEH A;  1ZWI C;  3ABM C;  2WLJ A;  3GB7 C;  4LBE C;  1R3J C;  4PA4 A;  2H8P C;  4PA6 A;  4MSW C;  5CBF A;  1R3K C;  2EIL C;  4MVM A;  1K4C C;  3RW0 A;  4MVS A;  3T1C A;  3TCU A;  5IY5 C;  3SPI A;  1G4Y B;  2KB1 A;  3E8F A;  1XL6 A;  3FB8 C;  4WFE A;  2P7T C;  5BZB A;  3ABK C;  4X89 A;  2HVK C;  2QKS A;  4PDR A;  4WFH A;  4WFF A;  1M56 C;  3FB6 C;  4PDV A;  4XDL A;  5CBG A;  3LDC A;  4XDK A;  3K0D A;  3ASO C;  1R3L C;  2BOC C;  2ITD C;  4HZ3 A;  3UKM A;  4GX0 A;  3RBZ A;  3JYC A;  3ZRS A;  3SYQ A;  3E83 A;  4DXW A;  5EK0 A;  4P9O A;  4JTD B; 
#chains in the Genus database with same CATH topology
 5CB4 A;  2QWP B;  4X9Q A;  2E74 B;  1UJW B;  2FYU H;  4H37 A;  2X0L A;  4X65 B;  3D3I A;  5LHI A;  4X1I A;  1OCZ B;  3OMA B;  4LP8 A;  2EIJ C;  1RPO A;  5GW7 A;  1WB7 A;  3SYA A;  4YHH O;  3ETG A;  1VQO V;  2WLL A;  4LWS B;  2GV9 A;  2HHH B;  1Y76 B;  1AI7 A;  5K1X A;  4I55 A;  1M57 C;  5JH7 A;  4QGP A;  3WG7 B;  2AGA A;  5ITZ B;  2QE7 G;  2Q0O C;  1JVM A;  1VQL V;  2A79 B;  4MVU A;  4I9Q A;  4R7C A;  1RM1 C;  2BTQ A;  4I9W A;  1YI2 V;  1T5E A;  1MNG A;  2IJJ A;  3CXH F;  1XNR B;  1FXV A;  4DYL A;  2V7Q G;  4ZI7 B;  4LH6 A;  2QKA A;  4K0K O;  3A8T A;  2WLH A;  5CA3 A;  2HLD G;  1EN5 A;  1XIL A;  1Q81 W;  2P6J A;  4BAY A;  3HKD B;  2CH7 A;  1WPB A;  1XRE A;  1H2G A;  4W4K A;  3ZRX A;  3IAY A;  4DR6 B;  2BSK A;  5JH7 B;  1AI6 A;  1Q6U A;  2F23 A;  5KHG A;  1SRY A;  1PL0 A;  3RYF B;  4LH7 A;  4XDK A;  2BOC C;  2VWK A;  1DLB A;  3E35 A;  4FFB A;  2QEX V;  5A9G A;  3CEI A;  3JYC A;  3E83 A;  1LUW A;  1SS3 A;  2ZT9 B;  3X2Q C;  2Q67 A;  2HVJ C;  3N2K B;  1GN3 A;  4JI3 O;  3BRC A;  4J42 A;  3CCM V;  3CRC A;  3AG4 C;  4I50 A;  2PY5 A;  2EZP A;  2X6A A;  1S77 D;  1NVP D;  1D5A A;  1MMM A;  4X62 B;  1WJZ A;  3AG1 B;  1YIJ V;  2QM4 A;  2R9R B;  1UPG A;  1CP9 A;  2K1E A;  5KA6 A;  4HNA A;  1N34 O;  4LF8 O;  3TXS A;  3OMI B;  3HKC A;  1OV9 A;  2N05 A;  2YXH A;  3VQX A;  1AVM A;  3PJS K;  5GTH Z;  1LR1 A;  1FAF A;  3ZN1 A;  3W7X A;  4DV0 B;  5IYZ B;  2EIM B;  2AZ2 A;  4DUY O;  1YXB A;  1NVP B;  1IZ3 A;  5GON A;  4A5U B;  5D5Q A;  4AI8 A;  3L70 H;  3ZHS A;  1DTO A;  5IYC O;  4FLY A;  2HEP A;  1E1R G;  1NT2 B;  3CCE V;  3OD4 A;  3FYE B;  3ABM B;  5EBM C;  3JAK B;  4GKK B;  3KCX A;  2ZKO A;  4JI7 O;  2OCC B;  4LF7 O;  3JD4 A;  3JD3 A;  4JPR A;  3RYC B;  4U7N A;  2DQ3 A;  3EFF K;  1N4C A;  4O4L A;  4X66 O;  2WA3 A;  4J7K A;  1FD9 A;  5EBL C;  5H6Q A;  1YJW V;  5IJ9 A;  1I5X A;  5CA1 A;  3UM7 A;  2EJ7 A;  4OGQ B;  4GCZ A;  2ILM A;  1AR1 B;  3SJQ C;  4DR4 O;  3K06 A;  4FLZ A;  1BHA A;  5DED A;  1KKC A;  5CBH A;  4MVQ A;  1ZLZ A;  4JV5 B;  3P3P A;  4FFB B;  2YXL A;  2IM9 A;  2WLJ A;  1NS1 A;  5D5P A;  2HKO A;  3W7U A;  1OZ0 A;  2XAQ A;  1CPY A;  2LGQ A;  2BTO A;  1G1X B;  1XOU A;  2KB1 A;  5LGU A;  3W7T A;  4ZIB A;  3H9V A;  3FB6 C;  3EVK A;  2AXT Z;  3H1L H;  3E22 A;  3GWO A;  1S5L Z;  3RBZ A;  2YC0 A;  4DXW A;  1PPJ H;  2VQF O;  1SQF A;  3D36 C;  3G80 A;  4BR6 A;  5JVD A;  4JV5 O;  4J9Z B;  1KP2 A;  1Z5V A;  1DK1 A;  3DC6 A;  4AQY O;  4MVO A;  3SPG A;  3B4S A;  3T1H O;  3L73 H;  1TUB B;  1Y67 A;  4LF6 B;  4UCV A;  2Y4T A;  3ZMS A;  1QCE A;  3RWR D;  1SQG A;  4NXM O;  2Y69 C;  4LC1 A;  4PA3 A;  2WSS G;  3ASN C;  1CXZ B;  1MSW D;  3JD2 A;  4AQY B;  5LMN O;  4X1K B;  1OCC C;  1S3J A;  2PF4 E;  4EB6 A;  1HNZ B;  4NXN B;  3B2E E;  1EM1 A;  3ABU A;  1SF9 A;  1EN4 A;  1GKF A;  2G38 A;  5CA1 B;  3GVM A;  3IFX A;  2EIL B;  2DQ0 A;  1AJP A;  1KYO F;  1XL4 A;  2YSU B;  3RYI A;  4NB5 A;  4X20 A;  1VQ9 V;  3BA9 A;  4LF4 O;  1V55 B;  1XMQ B;  4O4I A;  3OAA G;  2GHY A;  4JYA O;  3RN4 A;  3DXR A;  3LDD A;  1FXK A;  2JJ1 G;  3S3X A;  4Q20 A;  3FAV B;  3OW2 U;  4IYH A;  4H44 B;  5CN0 A;  3JCU Z;  1VQ8 V;  3T4Z A;  4K0K B;  1ZWI C;  2VQE B;  1K34 A;  1BHB A;  4PJ0 Z;  2ODM A;  1GRJ A;  2IW5 A;  3HKE B;  2F95 B;  3CYO A;  5KA5 A;  2QWN B;  3LDC A;  1MZE A;  4GX0 A;  1PL4 A;  4FK5 C;  3WB1 A;  1IBK B;  1R3I C;  5L3B A;  2DW4 A;  1Z2G A;  2XHB A;  3LNM B;  4DV0 O;  1R6K A;  3E86 A;  4I0X B;  1TUB A;  4O4J A;  1YTF D;  5L3F A;  4DRX B;  4FJC C;  1YIT V;  4LFB O;  1XNR O;  2YIB D;  5C8Y B;  3AK3 A;  1ORQ C;  4DW0 A;  4X88 A;  5LGN A;  1N36 B;  2NN4 A;  1KBH A;  1H38 A;  1AP6 A;  4LNU A;  1V55 C;  1IBL O;  1SQX H;  1AR5 A;  2QM7 A;  1QU7 A;  5B3S C;  1B06 A;  3OGC C;  4UCR A;  1BQZ A;  2MW2 B;  2H94 A;  4GX2 A;  5EIB D;  1Q90 D;  1AP5 A;  4QIW F;  2Y4U A;  2F1M A;  2A7W A;  1KMI Z;  3SDL A;  3JCZ A;  1IBM B;  2JIZ G;  3CRR A;  3CCR V;  3OR6 C;  1UFI A;  3K9A A;  3LUT B;  2JGD A;  2Q4P A;  3AK1 A;  2PYL A;  4K3A A;  2IU3 A;  2UXD O;  4CH5 A;  1SC5 B;  4UFZ A;  3N2G B;  1YVW A;  3ABL C;  4DR3 O;  2JRI A;  2X7R B;  1QR8 A;  3AK2 A;  2LQT A;  4JI1 O;  2M6Y A;  2Z3Y A;  2YID A;  3U11 A;  3ZMT A;  3CCQ V;  1NU1 H;  3CD6 V;  3ZS8 C;  2F93 B;  2ZCE A;  1I94 O;  4WF9 V;  4PI0 A;  2H8P C;  2LFR A;  5EZY B;  4MVM A;  5KHI A;  1Q8I A;  2HP8 A;  2Z0A A;  4QJF B;  5IY5 C;  4DV7 O;  1BZK A;  4GLX A;  4X89 A;  5J2T A;  3ASO C;  3ZX6 A;  4HZ3 A;  1NR1 A;  4UB6 Z;  4D7T A;  1ZL8 B;  2UXB B;  4JTD B;  1Q86 W;  2DYR C;  4CS3 A;  3OUS A;  1XEQ A;  2LW1 A;  4J11 A;  5B5E Z;  5KHK A;  3E8G A;  1PM9 A;  4O4I B;  2Q7G A;  4TQD A;  2YDE A;  5IYD O;  1RPR A;  3BY6 A;  2GUZ A;  1JOY A;  1AJQ A;  2WA4 A;  1ZUQ A;  2PYJ A;  4LF4 B;  4RUE A;  1K8A W;  1BSM A;  3RYC A;  4BW9 A;  3VOU A;  5KMG B;  1XBL A;  4YJ3 A;  1KEC A;  5B1A C;  4X1K A;  1W59 A;  1RFY A;  3CSX A;  1NTM H;  4DV4 B;  3EXA A;  5F2V O;  1RSO B;  5LMN B;  3M7M X;  3OMN B;  4LF5 O;  1HNZ O;  3ETE A;  2P5O A;  2RDC A;  4G27 B;  1EBO A;  4PA7 A;  3AG7 A;  2WAM A;  2A0L A;  2B5U A;  4CH6 A;  2RCV A;  2VQF B;  4GX1 A;  1L0L H;  4WBN A;  5IE9 A;  2EIN B;  1JJ2 U;  4MTG A;  3K5L A;  1Q82 W;  3TK1 A;  1XMO B;  4OPA A;  1BE3 H;  1JFF A;  3A2F A;  3FB5 C;  2ZQM A;  4DV3 B;  2UXX A;  1EFR G;  5JVD B;  4PA9 A;  1A32 A;  1V54 B;  1NTZ H;  2ZR2 A;  2ZDI A;  3E22 B;  3MD0 A;  2P4K A;  4PA6 A;  2Y48 A;  3C3S A;  4UVA A;  4DR1 B;  1P4R A;  3T1C A;  4X1Y A;  2OTL V;  4N21 A;  1K5Q A;  1XL6 A;  1ZTE A;  5LP6 A;  4LFB B;  1ROP A;  4XDL A;  1N8R W;  2YS8 A;  1VF5 B;  3BCC H;  3DSQ A;  2Y0P A;  2ARH A;  3BAA A;  2ZNI A;  4B3R B;  4LF9 B;  4AHC A;  4O2A B;  4X1Y B;  4F6R A;  1IBL B;  3Q4H B;  4MW8 A;  3THO A;  2LP7 A;  4Z1V A;  1YHQ V;  2UU9 O;  1SKV A;  1JR9 A;  4K35 A;  1TGO A;  1HNW B;  5L3C A;  2QDO A;  3JAW A;  2B9Z A;  4OXS A;  1JA8 A;  1XMQ O;  5HFL A;  4ZI7 A;  2GTA A;  1QVG U;  5B1B C;  2IH1 C;  4XDJ A;  1NBM G;  3K79 A;  4WFG A;  3TXQ A;  5J2U B;  4CC6 A;  1FFX B;  3CRQ A;  5HFM A;  4JI5 B;  2FTK A;  4B3T O;  1RSO A;  3SJA C;  1NJI W;  3K57 A;  2WLN A;  2YUA A;  1R6N A;  2WLI B;  4LF5 B;  2E76 B;  4QNH B;  1BQ0 A;  2W0F C;  3CWB H;  3SYC A;  4KHP B;  3QO8 A;  1FJG B;  2ZIO A;  1I08 A;  3QO5 A;  2JS5 A;  1L0N H;  3SPC A;  5B3S B;  3E8H A;  3OR7 C;  5IWA B;  4P9P A;  2YIB A;  3OTO O;  1M4U A;  2QTS A;  1BGY H;  1OHH G;  4BW5 A;  4B08 A;  4X8A A;  1GM9 A;  3APO A;  1OCR B;  1KU9 A;  3TET A;  4YY3 O;  4DO2 A;  4E2L A;  1TA8 A;  4DR2 B;  3AG2 C;  2L35 A;  2QWO B;  3FYI B;  4PA4 A;  3PN1 A;  1K4C C;  1IUR A;  2XOK G;  5L3G A;  2YEV B;  4JI1 B;  1U96 A;  5BMV B;  2QKS A;  1GO3 F;  5B66 Z;  3UQ8 A;  4JI2 O;  4TT3 G;  2CH7 B;  3VQV A;  2C2A A;  3G6B A;  1Q43 A;  4Z2W A;  5EIB C;  4FLU A;  3CE2 A;  1SA0 B;  3B77 A;  2DMX A;  4IIJ B;  3IJ4 A;  4RO2 A;  3ZBH A;  2EIK C;  2K9P A;  3OE7 G;  4DR5 B;  4R50 A;  2QA4 V;  2XND G;  3JAS A;  3ZHU A;  4N23 A;  3KCY A;  4NR1 A;  4NXM B;  5B1N A;  5LXT A;  1Q3E A;  3B8N A;  3U10 A;  3CP1 A;  3BVO A;  1MOF A;  4FLV A;  2YI9 A;  2R9A A;  3SGI A;  2OYQ A;  3H01 A;  3UT5 A;  3ZHR A;  2UUC B;  2DYR B;  4GYC B;  3T2M A;  3K08 A;  1XHX A;  1Y74 A;  3RGB A;  2ZM6 B;  4TOI A;  4JI4 O;  3T1Y B;  5FPO A;  1YEW A;  4WFB V;  5JCO A;  4U3J A;  4NVP A;  4JI3 B;  3D36 A;  4I4T B;  1AI4 A;  4F6R B;  2JGU A;  3W7S A;  1M93 A;  3G67 A;  3G71 V;  2DOS A;  4O2A A;  3STL C;  2FB5 A;  4LF9 O;  2YIA A;  4OX9 O;  5FL7 G;  5JWP A;  4L8J A;  1EN6 A;  5KX5 B;  3ABK B;  3KG2 A;  3CCL V;  4KHP O;  5LL6 Y;  2JK5 C;  1VQ4 V;  3FKS G;  2X6C A;  1LNQ A;  1WP7 A;  3HKD A;  1M57 B;  3BAB A;  4YIO A;  1BCC H;  1QQC A;  3APQ A;  4NKG B;  2DYS C;  3RVZ A;  2ZDI C;  5FNV B;  2IU0 A;  4EKW A;  1XDC A;  1R73 A;  3E89 A;  4LNU B;  4IGG A;  2F43 G;  4DK0 A;  4DV1 B;  3CJH A;  4P2Z A;  2P4V A;  4FLW A;  1KD1 W;  1YJN V;  3B09 A;  1NR7 A;  3TCU A;  3VBB A;  4LF7 B;  3FB8 C;  5BZB A;  1VF6 C;  2EBO A;  4O4H B;  5CBG A;  1OCO B;  3WFV A;  1IBM O;  3P30 A;  5JQG B;  3HKE A;  4U3F H;  1VF6 A;  1HP8 A;  3OUF A;  3OM3 B;  3ZIA G;  4DV4 O;  4DR3 B;  2XAJ A;  4L87 A;  4ASU G;  3LDE A;  3K04 A;  1SZX A;  2QR4 A;  1FXK B;  1SQQ H;  2BOB C;  4DR2 O;  2Q5Z A;  3AEI A;  2CTR A;  4X20 B;  2FL4 A;  1OCZ C;  4JYA B;  2N04 A;  3FAV A;  3E8B A;  1J5E B;  4WFA V;  3H1H H;  3A0R A;  4JTC B;  5A2Q N;  1RM1 B;  3K9S A;  2QJ1 A;  1SQP H;  3JAT A;  4GT1 A;  1X4T A;  2ZE5 A;  2IJH A;  4CS4 A;  4PI2 A;  3T1H B;  1M1K W;  3FFQ A;  4GX5 A;  3HB3 B;  2QKC A;  2EX3 A;  3CME V;  2ZIN A;  1FYJ A;  4GKJ B;  4JI8 O;  3QVN A;  2IH3 C;  5EZY A;  1KKD A;  4O4H A;  2X6B A;  3K03 A;  1PP9 H;  1TAE A;  3N2G A;  4PEL A;  5H2F Z;  1TUE B;  1QLE C;  4FZ1 A;  1F7Y A;  1TVK B;  4DV6 B;  4DV1 O;  1R3J C;  4X62 O;  2W6I G;  4WCE V;  2Q0A A;  3RW0 A;  3CJH B;  2KSD A;  1BMF G;  4GKJ O;  1VF7 A;  3JAL A;  1I5Y A;  4OPH A;  1D5N A;  1YCI A;  3CPW U;  5LYJ A;  4B3M O;  3UKM A;  3C3T A;  3OEH G;  1E79 G;  1N33 O;  3QF7 A;  5B1O A;  5CA0 A;  3JSL A;  4PDM A;  3O9O A;  1HDJ A;  1VQP V;  2HHH O;  4FMT A;  1P7G A;  5LHH A;  1O9H A;  2CAZ C;  1W0J G;  1SES A;  2OCH A;  1JQ0 A;  3F5W C;  2YEV A;  2GSM B;  1XUQ A;  3ML0 A;  1W2B U;  4DV5 B;  1VIB A;  2Z5U A;  5KUK A;  1OCC B;  4ZOL B;  1PNL A;  2Q68 A;  1E1Q G;  3CCS V;  4QPJ A;  2F4V O;  5CMU A;  3STZ C;  2JDI G;  1NI8 A;  5DM6 V;  3DC5 A;  5H9C A;  1Y74 B;  1H8E G;  3IGA C;  3KKY A;  3ABL B;  3WB2 A;  1IXB A;  4CBC A;  2Q8V A;  4O2B A;  4MTO A;  4NTY A;  1NTK H;  2A9H A;  5GON B;  4UCO A;  5H6R A;  1XQ8 A;  4JAV A;  3GWK C;  4CH4 A;  4JI6 B;  3I5D A;  2PI5 A;  3ZN0 A;  2KQX A;  2RNB A;  3CXC U;  3F7Y C;  1BT8 A;  3F5T A;  2ITC C;  2UUB B;  4NYK A;  4RAI A;  5DN6 G;  1HW7 A;  3OT7 A;  3WB0 A;  1H2M A;  3P3N A;  1GMG A;  1M90 W;  4DR1 O;  1KC8 W;  5BMV A;  5DEC A;  1M5I A;  1S0V A;  4JYY A;  1K9M W;  4I50 B;  2ZXW B;  3QNE A;  4YHH B;  3JD0 A;  3ABM C;  4O2B B;  5KHH A;  3BPZ A;  3UCS C;  4DUY B;  1I0H A;  1DGS A;  2P7T C;  4QPK A;  4PDR A;  3BHP A;  5IT9 N;  2V4D A;  4B3M B;  1B6Q A;  3OTF A;  1N34 B;  4P9O A;  1VQ5 V;  5LP6 C;  4LF8 B;  4GKK O;  4R8C A;  2DWE C;  4DR7 B;  1YF2 A;  2IBZ H;  4HYO A;  5EBW C;  2R9I A;  4FPP A;  1J95 A;  4IL6 Z;  1S5J A;  3OEE G;  1SET A;  4IYI A;  2HR3 A;  1WB8 A;  1GN4 A;  1QHT A;  1FPO A;  1R1B A;  2DWD C;  2JJ2 G;  3MDS A;  2ADP A;  2OWO A;  1FFX A;  3K5O A;  1AI5 A;  3ZED A;  3MAQ A;  4FM1 A;  5J2U A;  2EIN C;  1HNX B;  4ZHQ A;  3L75 H;  3SPH A;  3SJB C;  5JCO C;  3W7W A;  2AW9 A;  5IJ0 A;  4JAS A;  3K5M A;  3ZCC A;  1K4D C;  5FNV A;  1BL8 A;  1K33 A;  1TVK A;  2ZXW C;  2F66 C;  4HBN A;  1VQ6 V;  5KUM A;  1AR4 A;  4JTA B;  1K3E A;  4YXW G;  4YJ3 B;  3F7V C;  3ASN B;  2UUB O;  1URF A;  3D3Q A;  3K3W A;  1PNK A;  3HKB B;  3J81 N;  1WAZ A;  2CDY A;  3IC7 A;  4U3J B;  4RQE A;  3RT3 C;  2NR5 A;  4HAM A;  4FLT A;  1PNM A;  4JI2 B;  1R3K C;  2EIL C;  2A06 H;  3JAK A;  1EZJ A;  2BE3 A;  3CC4 V;  1MZF A;  2XAH A;  5BY1 A;  4O4L B;  1YTF B;  2WWW A;  3CCJ V;  1QLE B;  3ZRV A;  3B40 A;  3CB2 A;  4P30 A;  4UVC A;  1MSD A;  1ZSP A;  4TUY A;  1OCR C;  1Q6I A;  4B3T B;  3BA8 A;  5LOV B;  1SA0 A;  3MHH C;  3QTC A;  3M99 B;  4HNA B;  2YIC A;  5E1A C;  3CCU V;  1D2D A;  1KUQ A;  2PUS A;  1S76 D;  3JAR B;  5J9P C;  4IHJ B;  3G6E V;  2JEU A;  2LO1 A;  5JQG A;  4ICG A;  4JYC A;  3UO2 A;  4TV9 A;  4FVM A;  2CTW A;  2EIJ B;  2EJR A;  1VP7 A;  2E5L O;  3AG1 C;  4FLX A;  1M9N A;  4RUF A;  4H33 A;  1K7D A;  3N2K A;  2XUM A;  5TIS Z;  4D7S A;  1K97 A;  5JJJ B;  2QTO A;  4DK1 A;  3JSN A;  1PV0 A;  3ETQ A;  3K0G A;  5KLV H;  1GM7 A;  1K5S A;  1V9P A;  1VAR A;  4Z1M G;  4W4L A;  4DR4 B;  5KAI Z;  1J5E O;  3NXS A;  1US6 A;  1Q6H A;  3ZHV A;  1QVF U;  2ZIM A;  1N36 O;  4F4L A;  3A0H Z;  2EIK B;  1H2L A;  2QM8 A;  4FZ0 A;  1GH6 A;  5LMU O;  4DRX A;  2P22 C;  5EYP A;  1H2K A;  1THZ A;  3L9D A;  2W6J G;  4NXN O;  4WFH A;  4WFF A;  2ETN A;  4J41 A;  1R3L C;  4J7Z A;  2P06 A;  3M8A A;  1HNX O;  5LGT A;  4IHJ A;  2WLL B;  4X64 B;  5ITZ A;  5LMU B;  3QO7 A;  1L8D A;  4I55 B;  1Y76 A;  3ZMU A;  4LFC B;  5BR8 B;  4KXR A;  4IIJ A;  5E79 Z;  3WG7 C;  3CC2 V;  2EZO A;  1IX9 A;  3KZI Z;  1YSC A;  3AG4 B;  2MK3 A;  3OGI B;  2B1I A;  2LFS A;  1GTO A;  1SZT A;  1I94 B;  1MG1 A;  4EFE A;  5JJE B;  4BIO A;  5GTI Z;  4MS2 A;  4ABM A;  1AIL A;  2ZE6 A;  5C8Y A;  3ABT A;  1F51 A;  1FS0 G;  5FLX N;  4LFA O;  3RYI B;  2OIE A;  1G8M A;  4ZKI A;  2UXB O;  4O4J B;  4DW1 A;  1SER A;  4UCT A;  3FD9 A;  4I0X A;  2PGG A;  2VS0 A;  1WA8 A;  3SR2 C;  4H0L B;  1VEW A;  5IY5 B;  2PI4 A;  2XT9 A;  5J2T B;  4DV7 B;  1MAB G;  3BFR A;  1JCH A;  3T1Y O;  4EFB A;  1DF4 A;  4B3S B;  1XMO O;  1WLE A;  3HPL C;  2Q6A A;  2NNU A;  2BCC H;  1HR0 B;  1HNW O;  3K5N A;  3LNN A;  4DR5 O;  1P84 F;  4MSW C;  5CBF A;  3HR0 A;  4MVS A;  2JVD A;  1Z5W A;  5EYP B;  2FKX A;  2GDS A;  1N32 B;  3CRA A;  4MT8 A;  4Q6G A;  4ZHQ B;  1VQK V;  3AG2 B;  2KG7 A;  5IYB O;  4CZZ A;  3RFR A;  4B3R O;  3QG5 A;  4JAU A;  5L3E A;  1WPX A;  2AHZ A;  2UXC B;  1V54 C;  3OFN G;  2OT5 A;  4KFM A;  4FFK A;  1NZ6 A;  5LA6 B;  2R70 A;  1CEZ A;  2UU9 B;  4DR6 O;  1QR9 A;  1N32 O;  4TSF G;  4I4T A;  3TGU H;  2L6L A;  4PD4 F;  3Q4H A;  1EZV H;  2Q9L A;  2ZR3 A;  2D3O W;  4K8Z A;  1U97 A;  4TV8 B;  3L72 H;  1SQB H;  4JI0 O;  3OTO B;  1X59 A;  2AHY A;  1AJN A;  4NTX A;  1NQT A;  3LSU A;  2RJZ A;  1Y6X A;  4J9Y B;  1NKD A;  1ARO P;  2UXC O;  4DUZ B;  2B1G A;  1IBK O;  1W0K G;  4PHZ A;  4JAA A;  4JI6 O;  1YZB A;  4CS2 A;  4TV9 B;  3EHB B;  4JF3 A;  1H2N A;  4UCU A;  2XAS A;  1OJH A;  4DV2 O;  4F6E A;  2AZ0 A;  1YJ9 V;  2GBO A;  2HG5 C;  2Y0I A;  1JFF B;  4ZBM A;  1XNQ O;  1N0J A;  5KAF Z;  3ASO B;  1YDX A;  5LXT B;  4UV8 A;  2D2C B;  3SPJ A;  1AB3 A;  1SQV H;  3HKC B;  4FM2 A;  5L3D A;  4X64 O;  4AIL C;  1ENV A;  3BEH A;  1KP3 A;  2DN9 A;  4LBE C;  2P90 A;  1QLN A;  2RMK B;  1VQN V;  2H3O A;  3MHS C;  4B7E A;  4DR7 O;  1F23 A;  1M56 C;  2CUG A;  4LFA B;  3J80 N;  2O57 A;  2VRZ A;  2ITD C;  2HJD A;  2XTA A;  5IJ9 B;  3P32 A;  3SYQ A;  2E5L B;  5EK0 A;  1JMK C;  4BWA A;  2EIM C;  4LCU C;  1K73 W;  5LHG A;  3HKB A;  5B1A B;  1FJG O;  3ZRW A;  4K8X A;  1P49 A;  1WNS A;  3RYF A;  4JI5 O;  3CX5 F;  4EB6 B;  5IWA O;  2E3C A;  2CGN A;  3JAR A;  3K59 A;  2LW7 A;  2OCC C;  4JYB A;  1B04 A;  5EC1 C;  4DV3 O;  5CA0 B;  4EEQ A;  2UUC O;  3L74 H;  2WLI A;  4CC5 A;  1NH2 B;  5BR8 O;  4YJ2 B;  4LFC O;  3J7A U;  1RP3 B;  3X2Q B;  3ZMZ A;  2IJI A;  2PZS A;  2N74 A;  4PV1 B;  2ZD9 A;  4MW3 A;  1MA1 A;  4PDL A;  5LBQ A;  3JAW B;  3AG3 B;  3ICX A;  1VMG A;  2KKW A;  2P67 A;  4J80 A;  4G28 B;  2W0X A;  2JS3 A;  2Y69 B;  2XAG A;  3N27 A;  2CTQ A;  1DF5 A;  2M7W A;  2V1D A;  1FFT B;  3RYH A;  4UCS A;  1F4N A;  1FKA O;  1M56 B;  4J7J A;  1PD3 A;  2WLK A;  2OTJ V;  3ZMV A;  2QGN A;  3K58 A;  3ZJZ A;  3SYP A;  4KL1 A;  5LA6 A;  2FML A;  3VQW A;  2A3Q A;  3LSS A;  3GB7 C;  4I5S A;  3IC9 A;  4RWU A;  4B3S O;  1COW G;  1PKX A;  1G4Y B;  1ZX3 A;  5BXZ A;  1BS3 A;  3RYH B;  3SJC C;  3DTU B;  3WU2 Z;  5LYJ B;  3CMA V;  4X65 O;  1QBZ A;  5IJ0 B;  5CB4 B;  4JI0 B;  2ATK C;  5KHJ A;  3RVY A;  1XNQ B;  2LJ2 A;  1GAX A;  4YJ2 A;  3O65 A;  4TQF A;  4BIZ A;  5EC2 C;  2ZNJ A;  1N0N A;  2ADQ B;  2UUA O;  2VQE O;  4QE9 A;  1WN7 A;  4X66 B;  2E75 B;  3JAM N;  1QNM A;  1S72 V;  4R6Z A;  3LSQ A;  4JI8 B;  2WLM A;  1S5H C;  4LWS A;  5H5N A;  4H13 B;  1Q7Y W;  1WA8 B;  4UVB A;  4NTW A;  2GUZ B;  2XAF A;  2IJK A;  5KMG A;  3DGE A;  2Q7E A;  4JGS A;  2YI8 A;  4XBF A;  3ZRW B;  5IDJ A;  1F4M A;  3JAT B;  2HJF C;  1O9G A;  1NH2 D;  4X1I B;  1Y4M A;  2UXN A;  4QE7 A;  1GN2 A;  4J10 A;  1FXH A;  2NLJ C;  3FB7 C;  4DV2 B;  5AG2 A;  4IT5 A;  1P7B A;  2BSK B;  4JZ2 A;  2PTM A;  4YY3 B;  5KX5 A;  2CGO A;  4JZG A;  4MVR A;  4E4E A;  3VQY A;  1B3Q A;  2R72 A;  4G2K A;  4LF6 O;  1IXM A;  2CTP A;  2LGW A;  4MVZ A;  4U7O A;  1ZL8 A;  3JD1 A;  4DV6 O;  3I56 V;  2DJV A;  3H1K H;  3L71 H;  3H1I H;  3JAL B;  3R66 A;  3SPI A;  4C7U A;  3ABK C;  2HVK C;  4JI7 B;  1R6T A;  4PDV A;  4B7K A;  2DYS B;  3ZRS A;  4CH3 A;  4OX9 B;  4GZR B;  1Q5O A;  4D6T H;  3UT5 B;  2CK3 G;  5B1B B;  2ZE8 A;  1Y66 A;  2WPD G;  1K92 A;  3TJT A;  1JPX A;  1VQM V;  4FM0 A;  4MTF A;  4TV8 A;  2YXY A;  1JJO A;  1GN6 A;  2JGD B;  2RQ6 A;  3JAS B;  2UUA B;  2GTS A;  4ZOL A;  4I7Z B;  3SYO A;  4DV5 O;  1VQ7 V;  5LP6 B;  3CS5 A;  3E2E A;  2F4V B;  1I7F A;  5K1P A;  1ZAU A;  3G4S V;  4JI4 B;  3I55 V;  2QWQ B;  2Q7H A;  3NR7 A;  4UV9 A;  5C93 A;  4FIP C;  2CE4 A;  4TWK A;  3B8M A;  2QWR B;  3R65 A;  4BIU A;  4UXN A;  2KG7 B;  3CRM A;  3ETD A;  2Q73 A;  4UUJ C;  4UB8 Z;  3U0Z A;  5FPR A;  1KB9 F;  2HFE C;  1WP8 A;  3UO3 A;  3CCV V;  1FXK C;  1N33 B;  3H1J H;  4WBN B;  3FX7 A;  3CC7 V;  3T4D A;  1JX9 A;  2BTQ B;  4RQF A;  2Q69 A;  2JEX A;  2OIG A;  3C90 A;  5JJN B;  1XI1 A;  1GK9 A;  1LUV A;  2ZM6 O;  2QSA A;  1HR0 O;  4MTX A;  2VWJ A;  2ZE7 A;  3AG3 C;  1L1F A;  1IVS A;  2DE0 X;  4DUZ O;  4YIP A;  2UXD B;  1OCO C;  3CHX A;  4KP4 A;  2EUL A;  1G6U A;  4KUM A;  4TUY B;  1KQS U;  1GM8 A;  2RN9 A;  3D8C A;  1XHZ A;  1H8H G;  3E8F A;  1H2S B;  3ZHT A;  4WFE A;  5IYZ A;  3S3W A;  5LOV A;  3ZHQ A;  3K0D A;  1IDS A;  4LR3 A;  3DXR B;  1HWY A;  3A0B Z;  4GUN A; 
#chains in the Genus database with same CATH homology
 5B1O A;  1Q86 W;  2DYR C;  1UJW B;  4PDM A;  4H37 A;  2X0L A;  4JAU A;  5L3E A;  1WPX A;  2AHZ A;  3OUS A;  1VQP V;  4FMT A;  3D3I A;  5LHH A;  1V54 C;  3OFN G;  5LHI A;  2OT5 A;  4KFM A;  1W0J G;  1SES A;  3E8G A;  1OCZ B;  1CEZ A;  1JQ0 A;  3F5W C;  3OMA B;  4LP8 A;  2YEV A;  2GSM B;  5IYD O;  3ML0 A;  1W2B U;  1RPR A;  1QR9 A;  2EIJ C;  4TSF G;  2Z5U A;  5KUK A;  1OCC B;  1PNL A;  2Q68 A;  1RPO A;  1E1Q G;  2D3O W;  3CCS V;  2ZR3 A;  4QPJ A;  5GW7 A;  3BY6 A;  5CMU A;  3STZ C;  2JDI G;  3SYA A;  1JOY A;  1AJQ A;  2AHY A;  3ETG A;  1AJN A;  1NQT A;  5DM6 V;  4RUE A;  1VQO V;  4J9Y B;  1K8A W;  1NKD A;  2WLL A;  1ARO P;  3VOU A;  5H9C A;  1H8E G;  2B1G A;  3IGA C;  1AI7 A;  1W0K G;  1KEC A;  5B1A C;  3ABL B;  1M57 C;  3WG7 B;  4CBC A;  4MTO A;  3EHB B;  2A9H A;  2QE7 G;  3OMN B;  4JF3 A;  2XAS A;  5H6R A;  1JVM A;  1VQL V;  3ETE A;  1YJ9 V;  4JAV A;  2A79 B;  4MVU A;  4G27 B;  1EBO A;  2HG5 C;  2PI5 A;  4PA7 A;  4R7C A;  4ZBM A;  3ZN0 A;  1RM1 C;  4I9W A;  1YI2 V;  2WAM A;  3CXC U;  2A0L A;  2B5U A;  3F7Y C;  2IJJ A;  4GX1 A;  3ASO B;  2ITC C;  1FXV A;  2V7Q G;  2EIN B;  4RAI A;  1JJ2 U;  4MTG A;  5DN6 G;  1Q82 W;  3TK1 A;  4UV8 A;  2WLH A;  5CA3 A;  2HLD G;  3SPJ A;  1GMG A;  1Q81 W;  1M90 W;  1KC8 W;  3FB5 C;  2ZQM A;  2UXX A;  1EFR G;  4PA9 A;  5L3D A;  2P6J A;  4BAY A;  1V54 B;  2ZR2 A;  1K9M W;  1S0V A;  1ENV A;  2ZDI A;  2ZXW B;  3QNE A;  3BEH A;  3JD0 A;  3ABM C;  3MD0 A;  1KP3 A;  4LBE C;  4PA6 A;  3ZRX A;  1H2G A;  2Y48 A;  4UVA A;  2P90 A;  1QLN A;  1P4R A;  3T1C A;  1VQN V;  1AI6 A;  5IYB O;  2OTL V;  4N21 A;  1K5Q A;  1SRY A;  1XL6 A;  3MHS C;  2P7T C;  1PL0 A;  4QPK A;  4PDR A;  1F23 A;  1M56 C;  1ROP A;  4XDL A;  1N8R W;  4XDK A;  2BOC C;  2ITD C;  1DLB A;  3E35 A;  2QEX V;  3JYC A;  3P32 A;  1B6Q A;  3E83 A;  3SYQ A;  5EK0 A;  1VQ5 V;  4P9O A;  4R8C A;  2DWE C;  3X2Q C;  2EIM C;  2Q67 A;  4LCU C;  1K73 W;  2HVJ C;  5LHG A;  4HYO A;  5EBW C;  5B1A B;  4MW8 A;  2R9I A;  4FPP A;  1J95 A;  3ZRW A;  3OEE G;  2LP7 A;  1SET A;  3CCM V;  2HR3 A;  3AG4 C;  1YHQ V;  2EZP A;  2X6A A;  1S77 D;  5L3C A;  1NVP D;  2DWD C;  2OCC C;  2JJ2 G;  4OXS A;  3AG1 B;  1YIJ V;  4JYB A;  2R9R B;  5HFL A;  5EC1 C;  2WLI A;  1CP9 A;  2K1E A;  5KA6 A;  1QVG U;  1AI5 A;  5B1B C;  3OMI B;  1NH2 B;  2IH1 C;  2EIN C;  4XDJ A;  1NBM G;  3K79 A;  3X2Q B;  3ZMZ A;  4WFG A;  3PJS K;  3SPH A;  3ZN1 A;  3W7X A;  2IJI A;  2EIM B;  5HFM A;  3W7W A;  1NVP B;  2FTK A;  2ZD9 A;  4MW3 A;  4JAS A;  1DTO A;  5IYC O;  1E1R G;  4PDL A;  1K4D C;  3ZCC A;  3CCE V;  5LBQ A;  1NJI W;  1BL8 A;  1K33 A;  3FYE B;  3ABM B;  2WLN A;  3AG3 B;  2ZXW C;  2P67 A;  5EBM C;  1R6N A;  4G28 B;  2WLI B;  2OCC B;  3JD4 A;  4QNH B;  3JD3 A;  4JPR A;  2W0F C;  3SYC A;  1VQ6 V;  5KUM A;  4U7N A;  3QO8 A;  4JTA B;  2DQ3 A;  2Y69 B;  1K3E A;  3EFF K;  3QO5 A;  2XAG A;  4YXW G;  3SPC A;  1DF5 A;  2M7W A;  5EBL C;  5B3S B;  3E8H A;  3OR7 C;  2V1D A;  1FFT B;  5H6Q A;  1YJW V;  1F4N A;  1M56 B;  3F7V C;  4P9P A;  1PD3 A;  3ASN B;  1I5X A;  2WLK A;  2OTJ V;  3ZMV A;  3K3W A;  3UM7 A;  1OHH G;  4BW5 A;  3ZJZ A;  4GCZ A;  4X8A A;  1GM9 A;  3SYP A;  1PNK A;  3SJQ C;  1AR1 B;  3TET A;  1OCR B;  3K06 A;  4DO2 A;  4E2L A;  1BHA A;  5CBH A;  3IC7 A;  3AG2 C;  4MVQ A;  4RQE A;  3LSS A;  4HAM A;  2WLJ A;  3GB7 C;  3FYI B;  4PA4 A;  4I5S A;  1PNM A;  2HKO A;  1R3K C;  2EIL C;  1K4C C;  2XOK G;  5L3G A;  1COW G;  2YEV B;  1OZ0 A;  4CZZ A;  1PKX A;  2XAQ A;  1CPY A;  3W7U A;  1EZJ A;  1G4Y B;  2KB1 A;  5LGU A;  3W7T A;  3CC4 V;  2QKS A;  2XAH A;  3DTU B;  3FB6 C;  1YTF B;  1GO3 F;  2WWW A;  3CMA V;  3CCJ V;  4TT3 G;  3GWO A;  1QLE B;  3RBZ A;  2C2A A;  1QBZ A;  4DXW A;  3ZRV A;  2ATK C;  4P30 A;  4UVC A;  3RVY A;  3B77 A;  4J9Z B;  1KP2 A;  1OCR C;  4RO2 A;  2EIK C;  3OE7 G;  4R50 A;  2QA4 V;  2XND G;  3MHH C;  4MVO A;  4N23 A;  3SPG A;  3M99 B;  4BIZ A;  5B1N A;  5E1A C;  5EC2 C;  3CCU V;  3B8N A;  3CP1 A;  1MOF A;  1S76 D;  4QE9 A;  3ZMS A;  1QCE A;  3H01 A;  2Y69 C;  5J9P C;  4LC1 A;  1S72 V;  2DYR B;  3G6E V;  2JEU A;  3T2M A;  4R6Z A;  4PA3 A;  3LSQ A;  3K08 A;  2WLM A;  1S5H C;  2WSS G;  3ASN C;  1MSW D;  4JYC A;  3JD2 A;  1Q7Y W;  2EIJ B;  4WFB V;  4UVB A;  1OCC C;  2EJR A;  1S3J A;  2XAF A;  2IJK A;  3AG1 C;  3DGE A;  1M9N A;  3ABU A;  4JGS A;  4RUF A;  3D36 A;  4XBF A;  4H33 A;  1AI4 A;  1K7D A;  1GKF A;  3ZRW B;  5IDJ A;  1F4M A;  3W7S A;  2HJF C;  3G71 V;  3IFX A;  3STL C;  2EIL B;  1NH2 D;  2DQ0 A;  1K97 A;  1AJP A;  1Y4M A;  2UXN A;  2QTO A;  4QE7 A;  5FL7 G;  1XL4 A;  2YSU B;  3ABK B;  3KG2 A;  3CCL V;  2JK5 C;  1VQ4 V;  1VQ9 V;  3FKS G;  1FXH A;  2X6C A;  1LNQ A;  2NLJ C;  1V55 B;  3FB7 C;  3K0G A;  1M57 B;  3OAA G;  1GM7 A;  1K5S A;  2GHY A;  1P7B A;  4Z1M G;  3LDD A;  1FXK A;  2DYS C;  3RVZ A;  2ZDI C;  2IU0 A;  2JJ1 G;  3NXS A;  4EKW A;  3OW2 U;  4Q20 A;  1R73 A;  3E89 A;  1QVF U;  4MVR A;  5CN0 A;  1VQ8 V;  2F43 G;  4F4L A;  3T4Z A;  4G2K A;  1IXM A;  2EIK B;  4U7O A;  4MVZ A;  2QM8 A;  4P2Z A;  1ZWI C;  1KD1 W;  3JD1 A;  1K34 A;  1YJN V;  3I56 V;  1BHB A;  1NR7 A;  3TCU A;  3VBB A;  1THZ A;  3SPI A;  2IW5 A;  3FB8 C;  2W6J G;  5BZB A;  3ABK C;  2HVK C;  3CYO A;  4WFH A;  2EBO A;  4WFF A;  5KA5 A;  5CBG A;  4PDV A;  1OCO B;  3WFV A;  3LDC A;  1R3L C;  4GX0 A;  2DYS B;  3ZRS A;  3P30 A;  4FK5 C;  1R3I C;  3OUF A;  5L3B A;  5LGT A;  3OM3 B;  3ZIA G;  2WLL B;  2CK3 G;  2DW4 A;  5B1B B;  1Y66 A;  3LNM B;  3QO7 A;  2XAJ A;  4L87 A;  2WPD G;  1K92 A;  1R6K A;  1JPX A;  3E86 A;  1VQM V;  4MTF A;  1YTF D;  5L3F A;  3ZMU A;  4ASU G;  3LDE A;  4FJC C;  1YIT V;  3K04 A;  1FXK B;  3SYO A;  2BOB C;  1VQ7 V;  3WG7 C;  3CC2 V;  1ORQ C;  3E2E A;  2EZO A;  4X88 A;  5LGN A;  3AEI A;  1YSC A;  3AG4 B;  2MK3 A;  3G4S V;  2B1I A;  3I55 V;  1OCZ C;  2LFS A;  1H38 A;  1GTO A;  1SZT A;  3E8B A;  1V55 C;  4WFA V;  1MG1 A;  4UV9 A;  5C93 A;  3A0R A;  4FIP C;  4JTC B;  4TWK A;  3B8M A;  1RM1 B;  4MS2 A;  3R65 A;  4BIU A;  4UXN A;  2QM7 A;  5B3S C;  3ETD A;  3OGC C;  4GT1 A;  3ABT A;  4UUJ C;  1F51 A;  2H94 A;  1FS0 G;  2IJH A;  4GX2 A;  2HFE C;  1M1K W;  1G8M A;  4ZKI A;  4GX5 A;  3HB3 B;  3CCV V;  1FXK C;  1SER A;  4QIW F;  3CC7 V;  3T4D A;  3JCZ A;  1JX9 A;  2JIZ G;  4RQF A;  3CCR V;  2Q69 A;  2JEX A;  5IY5 B;  3CME V;  2PI4 A;  3OR6 C;  3K9A A;  3LUT B;  1MAB G;  2IU3 A;  1GK9 A;  1JCH A;  2IH3 C;  4MTX A;  3ABL C;  3AG3 C;  1KKD A;  1L1F A;  1DF4 A;  2X7R B;  2X6B A;  3K03 A;  4PEL A;  1QR8 A;  1WLE A;  1TUE B;  3HPL C;  2Z3Y A;  1QLE C;  1OCO C;  2Q6A A;  2NNU A;  3ZMT A;  3CCQ V;  4KP4 A;  3CD6 V;  4WF9 V;  1R3J C;  2H8P C;  2W6I G;  4WCE V;  4KUM A;  4MSW C;  5CBF A;  2LFR A;  4MVM A;  1GM8 A;  3RW0 A;  1KQS U;  4MVS A;  1BMF G;  5IY5 C;  1H8H G;  3E8F A;  4QJF B;  4WFE A;  1I5Y A;  4X89 A;  3K0D A;  3CPW U;  3ASO C;  4HZ3 A;  1NR1 A;  3UKM A;  1HWY A;  4MT8 A;  1VQK V;  3AG2 B;  3OEH G;  1E79 G;  4JTD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...