2ITCC

Potassium channel kcsa-fab complex in sodium chloride
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords Antibody Fab fragment heavy chain
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2itcC00
3ASOC 3OUSA 4CBCA 3FB5C 1QLEC 2Q68A 2A9HA 2WLLA 4LCUC 1OCCC 4MVOA 3BEHA 3ABMC 2ATKC 3JYCA 4WFFA 2HVKC 2HFEC 3VOUA 5EBMC 3E83A 4QE9A 4XDLA 3LDCA 2DWDC 2DYRC 2DYSC 3F7YC 3K06A 4RUFA 3X2QC 2AHYA 2EIMC 4GX1A 2ITCC 4R8CA 3AG3C 2P7TC 4MVSA 4WFHA 3SPHA 1S5HC 3K0DA 3ABKC 3SYAA 2BOCC 2X6AA 3FB8C 2Q69A 5CBFA 1ZWIC 3E8GA 1J95A 1R3IC 3K03A 2X6BA 3FB6C 4DXWA 3OUFA 1K4CC 3ZRSA 4HZ3A 4GX2A 2EIJC 2Y69C 4MVMA 1K4DC 4UUJC 4MW3A 4P9OA 5EK0A 3AG1C 4PDMA 3SPIA 3SYCA 4MVUA 4R6ZA 3SJQC 2A0LA 2AHZA 3SYPA 3KG2A 4PA6A 3K0GA 3F7VC 4MSWC 4MVZA 5EC1C 4XDKA 4F4LA 4G28B 4GX0A 2HVJC 2OCCC 1V55C 4TWKA 2WLLB 3HPLC 3LDEA 3R65A 3K08A 4MVQA 3PJSK 3OGCC 4QNHB 4OXSA 4PDRA 2WLIA 2IH3C 4MTGA 2Q67A 2QTOA 3AG4C 4XDJA 3TETA 3F5WC 1R3KC 1OCZC 4EKWA 4I9WA 3EFFK 3IGAC 4MTOA 4P2ZA 3T4ZA 3T4DA 3LUTB 4RO2A 3E8BA 3STLC 3AG2C 3E8FA 4MTFA 2QKSA 4WFGA 4MVRA 2KB1A 1M57C 1P7BA 4P9PA 1G4YB 4WFEA 3RW0A 4LBEC 5CBHA 3GB7C 4MS2A 2R9RB 3T1CA 4ZBMA 2WLIB 2Q6AA 2WLJA 3STZC 2EINC 3ZJZA 1XL6A 5J9PC 2JK5C 1V54C 5EBWC 4X88A 3RBZA 3T2MA 1ORQC 4JTAB 4RAIA 1OCRC 2WLKA 3LDDA 5KUKA 4X89A 3SPJA 2HG5C 4J9ZB 3ABLC 1JVMA 5CBGA 4GX5A 3K04A 1OCOC 4G27B 1M56C 2BOBC 3TCUA 2WLMA 2EILC 2EIKC 4PA7A 4QE7A 5KUMA 1KKDA 1BL8A 4BW5A 2H8PC 3UKMA 2DWEC 5B1BC 2ZXWC 4X8AA 4LP8A 3E89A 1LNQA 2WLHA 2X6CA 4P30A 4RUEA 2K1EA 2WLNA 3SPCA 1XL4A 5B3SC 2ITDC 3IFXA 5EC2C 4JTDB 2A79B 3FB7C 3WG7C 4R7CA 4R50A 4PA4A 3LNMB 4HYOA 4PDVA 4PA3A 3OR7C 4J9YB 3UM7A 4MW8A 5E1AC 4KFMA 5EBLC 3E8HA 4PDLA 2IH1C 5B1AC 3SPGA 5BZBA 1R3JC 3RVYA 3OR6C 1R3LC 4H33A 2NLJC 2ZD9A 2YEVA 3E86A 4PA9A 5IY5C 3SYQA 3ASNC 2HJFC 2W0FC 4JTCB 3RVZA 4H37A 3SYOA
chains in the Genus database with same CATH superfamily
1XUQA 3OUSA 3ASNB 1KP3A 1CPYA 1QQCA 3KCYA 3TGUH 1EN6A 4JI1O 3NXSA 2AHYA 2EIMC 5TISZ 3QTCA 1P4RA 4X62O 4X1KB 1O9HA 2X7RB 1Q5OA 2HEPA 4DK1A 4JV5B 3TXSA 3R66A 1N33B 4YY3B 2FKXA 3WB0A 2Q7GA 4Q20A 4DR1O 4JPRA 1WPBA 1VQ5V 4G28B 3W7WA 3LDEA 1OZ0A 1M9NA 4QNHB 3ABTA 1I94O 2H3OA 1VQKV 2A06H 1AVMA 2PY5A 2AZ0A 4P2ZA 1E1RG 1BZKA 1O9GA 4LF9O 4BAYA 2QKSA 2Q0AA 4J7ZA 4D7TA 1IBLB 2O57A 4IHJA 1YJNV 2KQXA 2EINC 5CA1B 5J9PC 4JTAB 5LMNO 3L75H 1URFA 1JVMA 2A3QA 1IBKB 4FZ0A 2XASA 2EILC 1R1BA 1S5LZ 4JI3O 1U97A 4LNUB 2GDSA 4CS4A 4MT8A 3T1HB 3FB7C 1YVWA 1ZLZA 2JS5A 1UFIA 3OGIB 2YUAA 5IYBO 1YZBA 1U96A 4GUNA 4K0KO 2ZD9A 3WB2A 4ZHQA 3JCZA 3RYCB 3JYCA 1OHHG 4J80A 3VOUA 2DYSC 3X2QC 3ZMVA 5JJJB 4OX9B 2V1DA 4DV2B 2UXXA 5L3GA 3ZHVA 1NH2B 3JD3A 2VQEO 2X6BA 5B3SB 2HHHB 1AR5A 3ABUA 3OE7G 2Y69C 1SQGA 2AW9A 1VQ4V 4DUZB 4ZI7B 3CXCU 4PJ0Z 4MVZA 1NKDA 1WB7A 4TUYB 4TWKA 4UV9A 5KX5B 4N21A 4HAMA 4BIOA 1RM1B 3OMNB 4O4JA 4X65B 5IT9N 1YEWA 3E22A 3T4ZA 3E2EA 3BA9A 2GUZA 3H1IH 2WWWA 1Y4MA 1BS3A 4WFGA 1KQSU 3H1LH 3SR2C 1M57C 4LBEC 2JGDA 1V9PA 3D8CA 5HFMA 2UUBO 4EB6B 2GBOA 2ZM6B 3TK1A 2P90A 3BABA 1E79G 3JALA 5KLVH 3HKEB 2EILB 1QVGU 4JI5B 2EIMB 4Z1VA 3QF7A 1YF2A 2ITDC 3OTOB 4JZGA 4GKJO 4PA4A 4JI0O 4XBFA 3UM7A 1MABG 4FJCC 1Q6UA 4TV8B 2Y0PA 4JTCB 3J80N 2LFSA 3ASOC 3JASB 1QLEC 4L87A 1GO3F 4MVOA 5JH7A 4X66B 1J5EO 2QM7A 1HNWO 5FPRA 2UXDB 2YICA 5J2UB 5JJEB 2BTOA 3AG3C 5H2FZ 4WFAV 4JYAB 1NVPB 1YTFD 2B1GA 4JAUA 3AG2B 1SQFA 2XAJA 1N32B 4NB5A 2IJJA 2CTPA 1KMIZ 3HR0A 4I4TB 1B04A 2A0LA 3ICXA 5B5EZ 1HR0O 4D7SA 2OCCC 1HNWB 1IX9A 4XDJA 2Q73A 1S0VA 3SJAC 4GCZA 5LOVA 3DXRA 3H1KH 1GN6A 2N04A 3C90A 4DV0B 1QVFU 3ZMSA 4P9PA 3K9AA 2UXBO 5CBHA 4F6RB 4ZBMA 4K3AA 3RWRD 3M99B 1YDXA 1PNLA 5CMUA 3W7TA 1EZJA 2UXCO 2F4VB 1MG1A 4GZRB 2QKCA 5LMUB 1IXMA 1N0JA 3O9OA 2W6JG 4DW0A 1KB9F 4G27B 4JASA 4WCEV 1VQ7V 2AXTZ 3JAKA 1Q7YW 2YS8A 1HW7A 4I50B 3UKMA 2ZM6O 4FLTA 3CYOA 1QR8A 3OTFA 2BCCH 3ZHRA 3JD2A 4AQYO 3CRMA 4PDVA 5EBLC 3L9DA 1BHBA 4D6TH 3HKEA 3E86A 5BR8B 2CTWA 4CS3A 4E2LA 3APOA 5B1BB 3ZS8C 4XDLA 5JWPA 3K57A 5DN6G 2PTMA 4B3SB 3SPHA 4WBNB 2LW7A 3ABKC 3D3IA 5LXTB 3FB8C 4DR5O 2NNUA 1K4CC 3BVOA 2EZPA 3ML0A 1Y76A 2A7WA 4A5UB 4O4HB 4I55A 1JJ2U 5F2VO 4LFBO 2HVJC 3ZX6A 4FLVA 1R73A 1TVKA 1YTFB 4TUYA 1QCEA 3EFFK 3CCMV 3UO2A 5K1XA 3B8MA 4U7OA 1OCRB 3QO5A 3E8FA 3IC7A 3L74H 3VQWA 3S3XA 3BAAA 3UT5B 1RPRA 1GN2A 3CMEV 5KX5A 2UU9O 2CH7B 3STZC 1K34A 3ZJZA 5C93A 1H8EG 1XILA 1VQOV 1XDCA 1YIJV 5EIBC 1SZTA 4J11A 1N32O 2QWNB 1TUBA 3CHXA 2MW2B 3TJTA 4CH5A 1H2LA 1HWYA 3ZMZA 1H8HG 1TVKB 2YSUB 5DEDA 3IFXA 4ZKIA 4X1IB 2RCVA 4DR7O 1VQMV 5LGNA 4MW8A 4CH4A 5GTHZ 4PDLA 5BZBA 1K97A 3RVYA 3CCLV 4HBNA 4PV1B 3BPZA 1XNQO 2NLJC 3UQ8A 3RN4A 4EFBA 2ZCEA 4YJ3B 4H37A 1MZFA 3JAMN 2HLDG 2A9HA 3A0RA 2WLLA 3HKBB 3CP1A 2HVKC 4TT3G 3K3WA 3OEEG 5BXZA 1GTOA 4HNAB 1FD9A 3OD4A 1S3JA 4WFHA 3A8TA 3QG5A 5L3EA 1GN4A 3K0DA 1N33O 4O2AB 5KHGA 2Q69A 1XQ8A 1J95A 4BW9A 4CC6A 3K79A 5JQGB 2XUMA 2HJDA 1NQTA 4R6ZA 2QWQB 4B3MB 3N2KB 3CEIA 4PA6A 1Q8IA 4MSWC 1A32A 3HPLC 2XAQA 1R6KA 2CH7A 3LSUA 4DV0O 1EBOA 3W7SA 5FL7G 3F5WC 3G71V 1K7DA 4K35A 3P32A 1Y67A 2UU9B 1LR1A 2VWKA 1OV9A 2DYSB 3N2GB 1NZ6A 4UVCA 3RW0A 3B4SA 1M56B 2Q6AA 5L3FA 1W0KG 3CCVV 1G8MA 4J7JA 4B3TB 2E5LO 1US6A 4LF8O 4O4IB 2FB5A 3LSQA 4LF5B 3GWKC 4JI8B 1UPGA 1BL8A 2H8PC 4LF7B 2DWEC 3CCRV 3P30A 1PPJH 2WLHA 3OW2U 1HDJA 1AILA 3DSQA 2A79B 2GTSA 4QJFB 4QGPA 5E1AC 5B1AC 1SESA 3VQVA 1NTKH 3DXRB 3L73H 1R3LC 1SQVH 4H33A 2OT5A 3THOA 2AZ2A 2LW1A 2F66C 2W0FC 5JJNB 4K0KB 4NXNO 3SYOA 4CBCA 4RQEA 1BGYH 5CA3A 2QA4V 3BEHA 1WPXA 4AILC 1I08A 5J2UA 3RYIB 1RFYA 2QSAA 5D5PA 2DWDC 1XHZA 1JPXA 2YIDA 1AP6A 1I7FA 2DYRB 3CS5A 4JF3A 1YSCA 2BSKA 3F5TA 2YXYA 1ZWIC 3G4SV 4O4JB 2Q5ZA 1IURA 4HZ3A 1H2GA 4B3SO 1AJQA 3SYCA 3JCUZ 1ZSPA 1BCCH 3K5MA 3ZMTA 4CH3A 3PJSK 1N4CA 5LYJA 4X64O 1SC5B 4DV7O 2Q67A 5LMUO 2EZOA 1NR7A 1QHTA 4F6RA 1SERA 3K5NA 1OCZC 1H2KA 1FJGO 2HR3A 1F4NA 1WA8A 4FLZA 4X64B 1NU1H 4KL1A 1VQ6V 2IW5A 1I94B 4AQYB 4DUYB 2DQ0A 2HKOA 1F7YA 5KHKA 2JVDA 3JAWB 5ITZA 4H0LB 1N34O 3B40A 3RBZA 3KCXA 1WJZA 2YEVB 4I4TA 4ICGA 1OCOC 4K8XA 4PHZA 1AJNA 5EYPB 2Q9LA 4DR3B 3MD0A 2X6CA 4NTWA 3K9SA 2JJ2G 1VQ9V 3AK3A 3SPCA 1XL4A 2UXBB 3D36A 4DV1O 3ZRWB 2FMLA 2P4KA 4LH7A 4CZZA 4DV1B 4O4LB 1Q81W 5IY5C 1X4TA 4DRXB 5FLXN 3AG3B 3CCQV 4I0XB 4U3JB 1J5EB 3AG4B 1VMGA 1OCOB 3FD9A 3Q4HA 2ATKC 4E4EA 2B1IA 1BSMA 2JDIG 4DR6B 4JI3B 1PP9H 1VF6C 2P7TC 4DR5B 4LF5O 1DK1A 4I9QA 3CC2V 2R70A 4TOIA 2RDCA 4O2AA 1IXBA 4WF9V 5A2QN 1XMQO 2AHZA 4IIJA 3F7VC 5BR8O 4XDKA 3DGEA 4OPHA 4X66O 4EB6A 3RGBA 2F43G 2R9AA 1JR9A 1H2NA 3K08A 3W7XA 3W7UA 3OGCC 1CEZA 1NH2D 3N2GA 3CC7V 1NT2B 3S3WA 3CE2A 2XAHA 3CWBH 4MTFA 3BHPA 1XEQA 2KB1A 3G67A 1NS1A 1GK9A 3P3NA 4DV5B 5IDJA 4DR1B 1FJGB 1KKCA 3CB2A 3MDSA 1QLEB 1Z5WA 2IJKA 2WA3A 2CK3G 2ZE5A 1ORQC 4RAIA 1PNKA 2LGQA 2QTSA 4X89A 1AB3A 2IBZH 3AK2A 4GKKB 5JQGA 3A0HZ 3H9VA 3O65A 4DV5O 2WPDG 2OWOA 4FMTA 1FXVA 4QE7A 5KUMA 1QLNA 1VP7A 1FPOA 3DTUB 5H9CA 2UUCO 2GV9A 3ETEA 1K33A 2RQ6A 5LGUA 1SS3A 5D5QA 2H94A 2JEXA 2EULA 1P7GA 3OR7C 4TV9B 2JEUA 1XNQB 4KFMA 4OGQB 2YC0A 3SYQA 2Q8VA 2P22C 1TUEB 2HJFC 3JD4A 3CC4V 4ASUG 3ABMC 4TV9A 2PYJA 3H1HH 3K58A 3TXQA 1K8AW 4B3TO 2P4VA 4LFBB 4DR6O 1X59A 1F4MA 4IYHA 4DXWA 1HR0B 1UJWB 3OT7A 4PDMA 4PD4F 4LFCO 3SYPA 4I5SA 4Z1MG 3CJHB 1WP7A 2OTLV 3Q4HB 2LGWA 1WN7A 5IYZA 4MTGA 4DRXA 1L0LH 1N0NA 4QPKA 1LUWA 2JGUA 2OIEA 2QR4A 2XOKG 4NVPA 5LP6C 4RO2A 2UUAB 2QM8A 4O2BB 3I55V 1SF9A 4WFEA 1I5XA 3GB7C 5LP6A 2LFRA 2P5OA 4ZOLA 1MSWD 1ZUQA 5IJ0B 4PI2A 4I55B 1OCRC 1XOUA 2HG5C 2YI8A 5J2TA 2UUCB 1N36B 2UUBB 3ZHSA 4FM0A 1AROP 4ABMA 2LJ2A 1K3EA 4W4LA 1RSOB 4H44B 4JZ2A 2XHBA 3M7MX 5JCOA 1AI5A 1ENVA 3SPGA 3CRAA 4DR7B 5GW7A 1MMMA 2IU3A 2QM4A 2BTQA 3J81N 4DR4B 5LOVB 3FX7A 5CA0B 2Q68A 2Y4UA 3SGIA 5KHIA 3HKCA 1BQZA 3ZRWA 4X20A 1Y74B 4YY3O 2DOSA 5EZYA 4X65O 2QEXV 3BCCH 1FXKC 2F4VO 1KD1W 2PGGA 2X6AA 4FLYA 2XNDG 3PN1A 1R3IC 3OUFA 4IT5A 5GTIZ 1DGSA 4JI8O 4MW3A 1GAXA 1AR4A 1NTZH 5LL6Y 2DW4A 2PYLA 3EXAA 1COWG 2Y69B 4NTXA 5IYDO 1IBMB 1YITV 2E5LB 4LF8B 4F4LA 2DMXA 4JI1B 3APQA 1NJIW 4YHHO 2F95B 2LP7A 3T1YO 1P49A 4OX9O 3BFRA 1F51A 1VQPV 1D2DA 4DW1A 2HP8A 4EKWA 1B06A 3T4DA 5E79Z 3VBBA 3CSXA 3AEIA 4LR3A 3ZMUA 5IWAB 2ZIOA 4X20B 4CC5A 5H5NA 2RN9A 3RYHA 3M8AA 1Q6IA 3G6BA 3IAYA 2XT9A 2JK5C 1PL0A 4J42A 4QPJA 2JJ1G 1SA0B 2JS3A 3KKYA 4OPAA 1DTOA 1WAZA 1SKVA 3OTOO 1PV0A 3K04A 1QR9A 1M56C 3VQYA 1XMOO 1AI6A 2QWPB 3BA8A 4KHPO 3K5LA 2YIBD 1TAEA 2ADQB 4P30A 2JGDB 1OCZB 2ODMA 3ZHTA 1IBKO 1EM1A 5LP6B 2WA4A 1N34B 5JH7B 2YXLA 3LNNA 4WFBV 1GMGA 3B8NA 1G6UA 1YJWV 1VF7A 1JFFA 4JI0B 1QBZA 2Y4TA 3ASNC 2ZT9B 3RVZA 5KMGA 4ZIBA 1L0NH 4I7ZB 4FIPC 2XAGA 4CH6A 3OM3B 1Y66A 4YIOA 3A0BZ 4UFZA 3RFRA 3BRCA 3CJHA 4GX1A 4JI2B 1KBHA 1GM8A 4X1YB 2JIZG 1SZXA 2VWJA 3OFNG 2BOCC 2Y0IA 1VQLV 3D36C 3DC5A 1N36O 5JVDB 1FXKB 4RQFA 2BTQB 5EK0A 4P9OA 4UCOA 2Q7EA 5LA6A 2VQEB 5EC1C 2QJ1A 1JJOA 4JV5O 1BMFG 4J7KA 3GWOA 4EFEA 2WLLB 2ZIMA 4X9QA 4FLUA 2D2CB 1G1XB 5CB4B 3AG4C 1DF5A 1R6TA 4NXNB 3E22B 2WSSG 1HNZB 1FFXA 1W59A 3OMAB 1ZL8A 1P7BA 1E1QG 2WLIB 1K5SA 4DR2B 4LFCB 5KUKA 2EINB 3RYIA 2RJZA 4U7NA 4JI4O 1XBLA 1SETA 1VF5B 3EHBB 2IJIA 2E74B 2BOBC 2E76B 3MHHC 1LNQA 2QWOB 3GVMA 2WLNA 1M93A 1YJ9V 3HKDB 3CCUV 4HYOA 4JYAO 4IGGA 1Q6HA 3OR6C 3HKBA 2P6JA 1NI8A 1R6NA 1OCCB 3ZN1A 1ROPA 2M7WA 3ZRVA 3SJCC 1S77D 4HNAA 3CPWU 1GM9A 1F23A 4J41A 4GT1A 1MOFA 1KUQA 2ITCC 2V7QG 4FM2A 2ZKOA 4YJ3A 4B3MO 2CAZC 5CBFA 3E8GA 3ETDA 3K03A 3ZRSA 2N05A 1SQPH 4UUJC 1K9MW 5EIBD 1B6QA 4X1IA 2NR5A 3R65A 4IHJB 2W6IG 1PM9A 2EBOA 1QU7A 2YIBA 1YCIA 4LFAO 5B66Z 3IC9A 1RM1C 3UT5A 2XTAA 1BHAA 3JATA 2CE4A 2R9IA 3C3SA 1P84F 2NN4A 4O4LA 4NXMO 3AG2C 4K8ZA 3ABLB 1QNMA 5FNVB 3U0ZA 1VARA 3FAVB 2OYQA 3EVKA 3CMAV 1KECA 3CRRA 3K59A 3CD6V 3T2MA 4B7KA 5IE9A 1ZX3A 1TA8A 4FPPA 3TCUA 4X1KA 3CX5F 5B1BC 2ZXWC 3ZHUA 2K1EA 4UVBA 1N8RW 2FYUH 2GSMB 3JD0A 3N27A 4MTXA 2Q7HA 3QVNA 4PA3A 4FLXA 2YDEA 1I5YA 2ZE6A 3JSLA 2B9ZA 5GONA 4UCUA 5H6RA 3T1HO 3FYEB 2YEVA 1BT8A 1FYJA 1RP3B 4DV4O 1FFTB 1OCCC 5LBQA 1B3QA 3ETQA 2HFEC 1CP9A 5B1NA 2QWRB 4RUFA 4FFBA 4LF4B 1TGOA 4GKJB 2OCHA 4MVSA 3NR7A 4JI5O 1WA8B 2K9PA 3SYAA 2MK3A 1XNRB 1ZL8B 2ZDIC 3JARA 2BSKB 4KXRA 3ZRXA 4JAVA 4RWUA 1YXBA 5IJ9A 1AI7A 4GX0A 1Q90D 5LMNB 2F1MA 3OMIB 5BMVB 4DUYO 3JSNA 4LWSA 1H38A 3JAKB 4L8JA 5EYPA 3SDLA 4LF6B 4O4HA 2QGNA 3STLC 5JVDA 4MVRA 2DE0X 4DV7B 2CGNA 3L70H 2L35A 1SRYA 2R9RB 2Z3YA 3JD1A 4FVMA 3WU2Z 4X1YA 5ITZB 5LA6B 5EBWC 3JAWA 4FFKA 1M4UA 3JALB 1XNRO 1Q86W 1GKFA 3RT3C 4LP8A 4LF4O 3CCSV 2FL4A 3WG7B 5BMVA 4DV2O 5KHJA 5LYJB 2ZR3A 4JTDB 4X62B 3CCJV 4R50A 2IJHA 1DLBA 1LUVA 3E8HA 1M5IA 5LHHA 4KP4A 3ETGA 5L3CA 2ZINA 1SQQH 3QO8A 4PA9A 4JYYA 1OJHA 4JI7B 4JI6B 2PF4E 1H2MA 2KSDA 2XAFA 1S72V 1PD3A 4WFFA 1Y74A 5EBMC 4TQFA 2HHHO 4YHHB 2JRIA 2DYRC 2ZE8A 4QIWF 1AJPA 1RPOA 2PZSA 4B3RO 4DV3B 3JARB 3JATB 1S5HC 5CA0A 3ZCCA 1HP8A 3FB6C 1IDSA 1FKAO 2L6LA 3ABKB 2KG7B 1PKXA 1VQ8V 4B3RB 3AG1C 5K1PA 4FFBB 3KG2A 3K0GA 4NYKA 1MA1A 1I0HA 1V54B 4DR2O 3N2KA 1V55C 4UCSA 4MVQA 4JGSA 4OXSA 3RYHB 4UV8A 3UCSC 5DM6V 3CXHF 1D5AA 1IBLO 5IYCO 4DR4O 4BIUA 4LFAB 3LUTB 2ZE7A 1MZEA 1IVSA 1DF4A 3QO7A 3OEHG 5IJ0A 2WAMA 2N74A 5IY5B 2ZNJA 2ARHA 4FK5C 1CXZB 4JYBA 1PL4A 1V54C 1EZVH 2F23A 5FNVA 3I56V 4O2BA 2VQFB 1L8DA 3B77A 4H13B 3H01A 3G6EV 1K92A 2UXCB 2UXNA 4LF9B 4JI2O 2ZR2A 5CN0A 2EIJB 3WG7C 1KC8W 4ZI7A 5H6QA 1TUBB 4DK0A 2IH1C 1R3JC 1JX9A 5KAIZ 2IU0A 3LSSA 1NVPD 4DO2A 3FB5C 5LGTA 2GTAA 4DV4B 2ZDIA 3WB1A 3LDCA 4JAAA 3I5DA 3F7YC 4GYCB 2RNBA 4ZOLB 2P06A 1Y76B 1BQ0A 4DUZO 2C2AA 1W0JG 4Z2WA 3L72H 3FYIB 4MVMA 2Z0AA 3IJ4A 5B1OA 4AHCA 3SPIA 4PELA 1H2SB 1GN3A 2EJ7A 5LHGA 2F93B 1HNXB 5JCOC 4DYLA 3MHSC 2IM9A 1WNSA 2QDOA 2DN9A 2IH3C 4BIZA 1HNZO 1JCHA 3FAVA 2QTOA 3ASOB 2YXHA 3ZIAG 3B09A 4DV3O 2E3CA 4I9WA 4WBNA 2CGOA 1WB8A 2CTRA 4MTOA 4B08A 3J7AU 1FXHA 4UCTA 1AP5A 2CDYA 3HKDA 1K73W 5KA5A 2ILMA 4F6EA 1G4YB 4NXMB 4MS2A 4YIPA 1D5NA 1JQ0A 1AI4A 3T1CA 4UB6Z 4B7EA 2D3OW 2EJRA 4FLWA 4CS2A 1WP8A 3G80A 4I50A 2V4DA 5CBGA 3ZEDA 3D3QA 3X2QB 2WLMA 2EIKC 4BW5A 4FM1A 4GKKO 4ZHQB 3E89A 4UXNA 4RUEA 1XREA 2VQFO 2YIAA 4IIJB 4DV6O 1FS0G 2PUSA 3P3PA 3CRQA 4FZ1A 4UVAA 3AG1B 1Z5VA 4LH6A 1BE3H 4R7CA 3ABMB 3QNEA 1L1FA 5LXTA 5C8YA 4LCUC 2EIKB 3E83A 2OIGA 3K06A 4R8CA 2PI5A 5CA1A 4DV6B 4J10A 1XMQB 3U11A 1FXKA 3U10A 2G38A 1NTMH 1Q3EA 2KG7A 2R72A 3E35A 4GX2A 2EIJC 2YI9A 4EEQA 2OTJV 1K4DC 2ETNA 1JA8A 4MVUA 4KUMA 3SJQC 1FAFA 2BE3A 4LC1A 2GHYA 5DECA 4YJ2B 4C7UA 3ZN0A 1Z2GA 1IZ3A 4PDRA 2WLIA 5IWAO 2DQ3A 2W0XA 5KHHA 5KMGB 2QKAA 2FTKA 4G2KA 1JFFB 2CUGA 2UUAO 1FFXB 1EN5A 1HNXO 3ZBHA 3T1YB 3E8BA 1V55B 1ZTEA 5BY1A 3RYFB 2E75B 4JYCA 3CCEV 2LQTA 3HB3B 4IL6Z 2M6YA 5CB4A 1XI1A 2WLJA 1IBMO 3FKSG 4NKGB 4X88A 1Q43A 2Q0OC 2WLKA 4DR3O 3FFQA 1THZA 2VS0A 3ABLC 3ZHQA 1M90W 4GX5A 4JI4B 1Q82W 1SQXH 4BWAA 1NR1A 1S5JA 4X8AA 2B5UA 3UO3A 1AR1B 2UXDO 1PNMA 1M1KW 4JI6O 2Y48A 5KAFZ 4JI7O 1EN4A 4J9YB 4Q6GA 5AG2A 3MAQA 5L3BA 4I0XA 4U3JA 4NR1A 4PI0A 2OCCB 5A9GA 1MNGA 2P67A 2ADPA 4LWSB 1KP2A 3AG7A 1YHQV 3H1JH 5B1AB 5EZYB 1WLEA 4QE9A 4YJ2A 1NBMG 1Y6XA 5IJ9B 4TQDA 2GUZB 5HFLA 3DC6A 2DJVA 3JASA 5L3DA 3SJBC 1YI2V 2RMKB 4TV8A 1KU9A 4NTYA 2PI4A 4GLXA 1SA0A 5LHIA 4YXWG 2ZXWB 4LF6O 3BY6A 1M57B 1RSOA 2QE7G 2ZQMA 2ZNIA 2LO1A 1K5QA 3TETA 1XHXA 2Z5UA 1R3KC 4N23A 1JOYA 1MSDA 3L71H 1GH6A 3WFVA 1GRJA 2KKWA 3RYFA 3IGAC 1VQNV 3OAAG 4UB8Z 4O4IA 5GONB 5J2TB 1S76D 2CTQA 4UCVA 3RYCA 1W2BU 3C3TA 1XL6A 2VRZA 2AGAA 2Q4PA 4KHPB 3LDDA 1VEWA 1XMOB 3SPJA 1VF6A 4J9ZB 4LF7O 1JMKC 1T5EA 5KA6A 1GM7A 4U3FH 3CRCA 3KZIZ 2X0LA 3VQXA 1ZAUA 4PA7A 1KKDA 4UCRA 1EFRG 3AK1A 1KYOF 3B2EE 1SQBH 2EX3A 5IYZB 5B3SC 5EC2C 4LNUA 4IYIA 1VIBA 3K5OA 3A2FA 4W4KA 3LNMB 4BR6A 3HKCB 5FPOA 5C8YB 4AI8A 4TSFG
chains in the Genus database with same CATH topology
3OUSA 2XAFA 1S72V 1PD3A 2HLDG 2A9HA 2Q68A 2WLLA 3A0RA 3ASNB 4WFFA 1KP3A 3CP1A 1CPYA 2HVKC 4TT3G 3NXSA 5EBMC 3K3WA 3OEEG 3ZRWA 2DYRC 1GTOA 2AHYA 2EIMC 1AJPA 1RPOA 4QIWF 1S3JA 4WFHA 5L3EA 2QEXV 1S5HC 1P4RA 3K0DA 3ZCCA 1FXKC 1KD1W 2X6AA 2Q69A 2XNDG 1J95A 1R3IC 2X7RB 3FB6C 3OUFA 3ABKB 3K79A 1VQ8V 1PKXA 4MW3A 1NQTA 3AG1C 2DW4A 4R6ZA 1COWG 2Y69B 3KG2A 4PA6A 4Q20A 5IYDO 3K0GA 1YITV 4JPRA 1V54B 4MSWC 4F4LA 1VQ5V 4G28B 3W7WA 1NJIW 1V55C 3HPLC 1OZ0A 3LDEA 4MVQA 2XAQA 1M9NA 4QNHB 3ABTA 4JGSA 1R6KA 4OXSA 4UV8A 2LP7A 1EBOA 3W7SA 5DM6V 5FL7G 3F5WC 3G71V 1F51A 1VQPV 5IYCO 1VQKV 4EKWA 1K7DA 3P32A 4P2ZA 3T4DA 3VBBA 1E1RG 4BIUA 3LUTB 3AEIA 2DYSB 3ZMUA 4BAYA 2QKSA 1DF4A 3QO7A 4UVCA 3OEHG 3RW0A 2WAMA 5IY5B 1M56B 4FK5C 1YJNV 2Q6AA 5L3FA 1W0KG 2EINC 4JYBA 5J9PC 2JK5C 1PL0A 1V54C 3CCVV 1G8MA 4QPJA 2JJ1G 4JTAB 3I56V 1DTOA 3LSQA 1JVMA 3B77A 3K04A 1QR9A 3H01A 1M56C 2XASA 2EILC 3G6EV 1AI6A 1BL8A 1K92A 2H8PC 2DWEC 3CCRV 3P30A 2UXNA 2WLHA 4P30A 3OW2U 1OCZB 2ZR2A 5CN0A 2EIJB 4MT8A 2A79B 4QJFB 3FB7C 3WG7C 1KC8W 5H6QA 5E1AC 5B1AC 4WFBV 2IH1C 1SESA 5IYBO 1R3JC 1GMGA 3B8NA 1JX9A 1YJWV 1R3LC 2IU0A 4H33A 3LSSA 1NVPD 2ZD9A 2OT5A 1QBZA 3ASNC 3RVZA 2W0FC 3JCZA 3SYOA 4DO2A 4CBCA 3FB5C 4FIPC 4RQEA 5CA3A 5LGTA 2QA4V 2XAGA 3BEHA 1WPXA 3JYCA 1OHHG 1Y66A 3OM3B 3VOUA 2ZDIA 3LDCA 2DWDC 2DYSC 3F7YC 3X2QC 3ZMVA 4GX1A 1JPXA 2V1DA 1GM8A 2JIZG 2DYRB 2UXXA 5L3GA 4JF3A 1YSCA 3OFNG 2BOCC 1NH2B 3JD3A 1ZWIC 3G4SV 1VQLV 2X6BA 5B3SB 2C2AA 1W0JG 1H2GA 1FXKB 3FYIB 3ABUA 3OE7G 2Y69C 4HZ3A 4MVMA 4RQFA 1AJQA 5B1OA 5EK0A 4P9OA 4PELA 3SPIA 3SYCA 1VQ4V 5LHGA 3CXCU 4MVZA 1NKDA 5EC1C 3ZMTA 1BMFG 3GWOA 4TWKA 2WLLB 3MHSC 4UV9A 4N21A 3PJSK 4HAMA 1RM1B 2IH3C 3OMNB 2Q67A 1JCHA 2EZOA 1NR7A 4BIZA 1SERA 2QTOA 3AG4C 3ASOB 1DF5A 3ZIAG 1OCZC 4I9WA 2HR3A 1F4NA 4MTOA 3T4ZA 3E2EA 2WSSG 1FXHA 2WWWA 1Y4MA 2IW5A 3OMAB 4WFGA 1KQSU 1VQ6V 1M57C 1P7BA 1K73W 2DQ0A 2HKOA 5KA5A 1G4YB 4LBEC 4MS2A 1JQ0A 1AI4A 3T1CA 1E1QG 2WLIB 1K5SA 2D3OW 5HFMA 2EJRA 3RBZA 5KUKA 2EINB 2YEVB 4U7NA 1SETA 3TK1A 5CBGA 3EHBB 2P90A 1OCOC 2IJIA 1E79G 3X2QB 1AJNA 2BOBC 2WLMA 2EIKC 3MHHC 4BW5A 3E89A 1LNQA 3MD0A 2X6CA 4UXNA 1VQ9V 2JJ2G 2EILB 4RUEA 3SPCA 2WLNA 1QVGU 1XL4A 2EIMB 1YJ9V 2ITDC 4PA4A 3D36A 3CCUV 4HYOA 1FS0G 3ZRWB 4XBFA 3UM7A 1MABG 4FJCC 4CZZA 1Q81W 4UVAA 3OR6C 2P6JA 3AG1B 5IY5C 1R6NA 1OCCB 4JTCB 4R7CA 3ABMB 1ROPA 3AG3B 3ZN1A 2LFSA 3CCQV 2M7WA 3QNEA 1L1FA 3AG4B 3ASOC 3ZRVA 1OCOB 1QLEC 4L87A 4LCUC 1GO3F 4MVOA 1S77D 2ATKC 2EIKB 3CPWU 1GM9A 2B1IA 1F23A 2QM7A 3E83A 2JDIG 3K06A 4GT1A 1MOFA 2ITCC 4R8CA 2V7QG 3AG3C 2P7TC 4WFAV 2PI5A 1FXKA 1NVPB 1YTFD 5CBFA 3E8GA 3ETDA 2B1GA 3K03A 3AG2B 4JAUA 3E35A 3CC2V 3ZRSA 2XAJA 4GX2A 2EIJC 2OTJV 2IJJA 1K4DC 4UUJC 4MVUA 4KUMA 3SJQC 4WF9V 4LC1A 2GHYA 2A0LA 1K9MW 2AHZA 1B6QA 3F7VC 4XDKA 3DGEA 3ZN0A 2OCCC 2F43G 3R65A 3W7XA 3K08A 2W6IG 3W7UA 2EBOA 3OGCC 1CEZA 4PDRA 2WLIA 2DQ3A 1NH2D 4XDJA 2FTKA 4G2KA 1S0VA 4GCZA 1RM1C 3CC7V 1BHAA 2XAHA 1V55B 2R9IA 3E8BA 3AG2C 4MTFA 1QVFU 3ZMSA 2KB1A 3ABLB 4JYCA 3K9AA 4P9PA 3HB3B 3CCEV 5CBHA 1GK9A 4ZBMA 5IDJA 2WLJA 3M99B 3CMAV 1KECA 3FKSG 1PNLA 1QLEB 2IJKA 2CK3G 4X88A 5CMUA 3T2MA 1ORQC 3CD6V 4RAIA 2WLKA 3W7TA 1EZJA 1PNKA 4X89A 1MG1A 1IXMA 1THZA 2W6JG 3ABLC 1M90W 4GX5A 4G27B 4JASA 2WPDG 4WCEV 1VQ7V 4FPPA 1Q82W 4FMTA 1FXVA 3TCUA 1Q7YW 4QE7A 5KUMA 1NR1A 1QLNA 3UKMA 3DTUB 5H9CA 2ZXWC 1QR8A 3CYOA 4X8AA 5B1BC 3ETEA 1K33A 2B5UA 5LGUA 2K1EA 1AR1B 4UVBA 1N8RW 2GSMB 3JD2A 1PNMA 1M1KW 3JD0A 2H94A 2JEXA 2Y48A 4MTXA 4PDVA 4PA3A 3OR7C 4J9YB 2JEUA 1I5YA 5EBLC 4KFMA 1BHBA 5L3BA 2OCCB 5H6RA 3FYEB 2YEVA 3E86A 3SYQA 1TUEB 2HJFC 3JD4A 3CC4V 2P67A 1FFTB 1KP2A 4ASUG 1OCCC 1YHQV 3ABMC 4E2LA 5LBQA 5B1AB 2HFEC 1WLEA 4QE9A 5B1BB 1CP9A 4XDLA 5B1NA 1NBMG 4RUFA 5DN6G 4MVSA 5HFLA 3SPHA 1K8AW 3ABKC 3D3IA 3SYAA 2MK3A 3FB8C 5L3DA 2NNUA 1YI2V 1F4MA 4DXWA 1K4CC 2ZDIC 2EZPA 1UJWB 3ML0A 3ZRXA 4PDMA 2PI4A 4JAVA 3SYPA 4I5SA 4Z1MG 1AI7A 1JJ2U 2OTLV 4GX0A 2HVJC 5LHIA 4YXWG 2ZXWB 3BY6A 1M57B 3OMIB 4MTGA 2QE7G 1R73A 2ZQMA 1YTFB 1K5QA 3TETA 2Z5UA 1R3KC 4N23A 1H38A 1JOYA 1QCEA 3EFFK 3CCMV 3IGAC 2XOKG 4QPKA 3WFVA 3B8MA 1VQNV 4U7OA 3OAAG 4RO2A 3STLC 1OCRB 2QM8A 3QO5A 3I55V 3E8FA 3IC7A 4MVRA 1RPRA 1S76D 4WFEA 1I5XA 3GB7C 1SRYA 3CMEV 2R9RB 2Z3YA 3JD1A 1W2BU 2LFRA 3STZC 1K34A 1MSWD 3ZJZA 1XL6A 5C93A 1H8EG 5EBWC 1OCRC 3LDDA 1VQOV 3SPJA 2HG5C 4J9ZB 1YIJV 1SZTA 5KA6A 1GM7A 1Q86W 2X0LA 4PA7A 1KKDA 1EFRG 1GKFA 4LP8A 1AROP 1HWYA 3CCSV 3ZMZA 1K3EA 1H8HG 3WG7B 5B3SC 2YSUB 3IFXA 2ZR3A 5EC2C 4ZKIA 4JTDB 3CCJV 4R50A 2IJHA 3LNMB 1AI5A 1ENVA 1VQMV 5LGNA 1DLBA 4MW8A 3SPGA 5BZBA 3E8HA 4PDLA 5LHHA 1K97A 4KP4A 3RVYA 3ETGA 5GW7A 3CCLV 5L3CA 2IU3A 2NLJC 3QO8A 4PA9A 4TSFG 4H37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASO C;  3OUS A;  4CBC A;  3FB5 C;  1QLE C;  2Q68 A;  2A9H A;  2WLL A;  4LCU C;  1OCC C;  4MVO A;  3BEH A;  3ABM C;  2ATK C;  3JYC A;  4WFF A;  2HVK C;  2HFE C;  3VOU A;  5EBM C;  3E83 A;  4QE9 A;  4XDL A;  3LDC A;  2DWD C;  2DYR C;  2DYS C;  3F7Y C;  3K06 A;  4RUF A;  3X2Q C;  2AHY A;  2EIM C;  4GX1 A;  2ITC C;  4R8C A;  3AG3 C;  2P7T C;  4MVS A;  4WFH A;  3SPH A;  1S5H C;  3K0D A;  3ABK C;  3SYA A;  2BOC C;  2X6A A;  3FB8 C;  2Q69 A;  5CBF A;  1ZWI C;  3E8G A;  1J95 A;  1R3I C;  3K03 A;  2X6B A;  3FB6 C;  4DXW A;  3OUF A;  1K4C C;  3ZRS A;  4HZ3 A;  4GX2 A;  2EIJ C;  2Y69 C;  4MVM A;  1K4D C;  4UUJ C;  4MW3 A;  4P9O A;  5EK0 A;  3AG1 C;  4PDM A;  3SPI A;  3SYC A;  4MVU A;  4R6Z A;  3SJQ C;  2A0L A;  2AHZ A;  3SYP A;  3KG2 A;  4PA6 A;  3K0G A;  3F7V C;  4MSW C;  4MVZ A;  5EC1 C;  4XDK A;  4F4L A;  4G28 B;  4GX0 A;  2HVJ C;  2OCC C;  1V55 C;  4TWK A;  2WLL B;  3HPL C;  3LDE A;  3R65 A;  3K08 A;  4MVQ A;  3PJS K;  3OGC C;  4QNH B;  4OXS A;  4PDR A;  2WLI A;  2IH3 C;  4MTG A;  2Q67 A;  2QTO A;  3AG4 C;  4XDJ A;  3TET A;  3F5W C;  1R3K C;  1OCZ C;  4EKW A;  4I9W A;  3EFF K;  3IGA C;  4MTO A;  4P2Z A;  3T4Z A;  3T4D A;  3LUT B;  4RO2 A;  3E8B A;  3STL C;  3AG2 C;  3E8F A;  4MTF A;  2QKS A;  4WFG A;  4MVR A;  2KB1 A;  1M57 C;  1P7B A;  4P9P A;  1G4Y B;  4WFE A;  3RW0 A;  4LBE C;  5CBH A;  3GB7 C;  4MS2 A;  2R9R B;  3T1C A;  4ZBM A;  2WLI B;  2Q6A A;  2WLJ A;  3STZ C;  2EIN C;  3ZJZ A;  1XL6 A;  5J9P C;  2JK5 C;  1V54 C;  5EBW C;  4X88 A;  3RBZ A;  3T2M A;  1ORQ C;  4JTA B;  4RAI A;  1OCR C;  2WLK A;  3LDD A;  5KUK A;  4X89 A;  3SPJ A;  2HG5 C;  4J9Z B;  3ABL C;  1JVM A;  5CBG A;  4GX5 A;  3K04 A;  1OCO C;  4G27 B;  1M56 C;  2BOB C;  3TCU A;  2WLM A;  2EIL C;  2EIK C;  4PA7 A;  4QE7 A;  5KUM A;  1KKD A;  1BL8 A;  4BW5 A;  2H8P C;  3UKM A;  2DWE C;  5B1B C;  2ZXW C;  4X8A A;  4LP8 A;  3E89 A;  1LNQ A;  2WLH A;  2X6C A;  4P30 A;  4RUE A;  2K1E A;  2WLN A;  3SPC A;  1XL4 A;  5B3S C;  2ITD C;  3IFX A;  5EC2 C;  4JTD B;  2A79 B;  3FB7 C;  3WG7 C;  4R7C A;  4R50 A;  4PA4 A;  3LNM B;  4HYO A;  4PDV A;  4PA3 A;  3OR7 C;  4J9Y B;  3UM7 A;  4MW8 A;  5E1A C;  4KFM A;  5EBL C;  3E8H A;  4PDL A;  2IH1 C;  5B1A C;  3SPG A;  5BZB A;  1R3J C;  3RVY A;  3OR6 C;  1R3L C;  4H33 A;  2NLJ C;  2ZD9 A;  2YEV A;  3E86 A;  4PA9 A;  5IY5 C;  3SYQ A;  3ASN C;  2HJF C;  2W0F C;  4JTC B;  3RVZ A;  4H37 A;  3SYO A; 
#chains in the Genus database with same CATH topology
 1XUQ A;  3OUS A;  3ASN B;  1KP3 A;  1CPY A;  1QQC A;  3KCY A;  3TGU H;  1EN6 A;  4JI1 O;  3NXS A;  2AHY A;  2EIM C;  5TIS Z;  3QTC A;  1P4R A;  4X62 O;  4X1K B;  1O9H A;  2X7R B;  1Q5O A;  2HEP A;  4DK1 A;  4JV5 B;  3TXS A;  3R66 A;  1N33 B;  4YY3 B;  2FKX A;  3WB0 A;  2Q7G A;  4Q20 A;  4DR1 O;  4JPR A;  1WPB A;  1VQ5 V;  4G28 B;  3W7W A;  3LDE A;  1OZ0 A;  1M9N A;  4QNH B;  3ABT A;  1I94 O;  2H3O A;  1VQK V;  2A06 H;  1AVM A;  2PY5 A;  2AZ0 A;  4P2Z A;  1E1R G;  1BZK A;  1O9G A;  4LF9 O;  4BAY A;  2QKS A;  2Q0A A;  4J7Z A;  4D7T A;  1IBL B;  2O57 A;  4IHJ A;  1YJN V;  2KQX A;  2EIN C;  5CA1 B;  5J9P C;  4JTA B;  5LMN O;  3L75 H;  1URF A;  1JVM A;  2A3Q A;  1IBK B;  4FZ0 A;  2XAS A;  2EIL C;  1R1B A;  1S5L Z;  4JI3 O;  1U97 A;  4LNU B;  2GDS A;  4CS4 A;  4MT8 A;  3T1H B;  3FB7 C;  1YVW A;  1ZLZ A;  2JS5 A;  1UFI A;  3OGI B;  2YUA A;  5IYB O;  1YZB A;  1U96 A;  4GUN A;  4K0K O;  2ZD9 A;  3WB2 A;  4ZHQ A;  3JCZ A;  3RYC B;  3JYC A;  1OHH G;  4J80 A;  3VOU A;  2DYS C;  3X2Q C;  3ZMV A;  5JJJ B;  4OX9 B;  2V1D A;  4DV2 B;  2UXX A;  5L3G A;  3ZHV A;  1NH2 B;  3JD3 A;  2VQE O;  2X6B A;  5B3S B;  2HHH B;  1AR5 A;  3ABU A;  3OE7 G;  2Y69 C;  1SQG A;  2AW9 A;  1VQ4 V;  4DUZ B;  4ZI7 B;  3CXC U;  4PJ0 Z;  4MVZ A;  1NKD A;  1WB7 A;  4TUY B;  4TWK A;  4UV9 A;  5KX5 B;  4N21 A;  4HAM A;  4BIO A;  1RM1 B;  3OMN B;  4O4J A;  4X65 B;  5IT9 N;  1YEW A;  3E22 A;  3T4Z A;  3E2E A;  3BA9 A;  2GUZ A;  3H1I H;  2WWW A;  1Y4M A;  1BS3 A;  4WFG A;  1KQS U;  3H1L H;  3SR2 C;  1M57 C;  4LBE C;  2JGD A;  1V9P A;  3D8C A;  5HFM A;  2UUB O;  4EB6 B;  2GBO A;  2ZM6 B;  3TK1 A;  2P90 A;  3BAB A;  1E79 G;  3JAL A;  5KLV H;  3HKE B;  2EIL B;  1QVG U;  4JI5 B;  2EIM B;  4Z1V A;  3QF7 A;  1YF2 A;  2ITD C;  3OTO B;  4JZG A;  4GKJ O;  4PA4 A;  4JI0 O;  4XBF A;  3UM7 A;  1MAB G;  4FJC C;  1Q6U A;  4TV8 B;  2Y0P A;  4JTC B;  3J80 N;  2LFS A;  3ASO C;  3JAS B;  1QLE C;  4L87 A;  1GO3 F;  4MVO A;  5JH7 A;  4X66 B;  1J5E O;  2QM7 A;  1HNW O;  5FPR A;  2UXD B;  2YIC A;  5J2U B;  5JJE B;  2BTO A;  3AG3 C;  5H2F Z;  4WFA V;  4JYA B;  1NVP B;  1YTF D;  2B1G A;  4JAU A;  3AG2 B;  1SQF A;  2XAJ A;  1N32 B;  4NB5 A;  2IJJ A;  2CTP A;  1KMI Z;  3HR0 A;  4I4T B;  1B04 A;  2A0L A;  3ICX A;  5B5E Z;  1HR0 O;  4D7S A;  2OCC C;  1HNW B;  1IX9 A;  4XDJ A;  2Q73 A;  1S0V A;  3SJA C;  4GCZ A;  5LOV A;  3DXR A;  3H1K H;  1GN6 A;  2N04 A;  3C90 A;  4DV0 B;  1QVF U;  3ZMS A;  4P9P A;  3K9A A;  2UXB O;  5CBH A;  4F6R B;  4ZBM A;  4K3A A;  3RWR D;  3M99 B;  1YDX A;  1PNL A;  5CMU A;  3W7T A;  1EZJ A;  2UXC O;  2F4V B;  1MG1 A;  4GZR B;  2QKC A;  5LMU B;  1IXM A;  1N0J A;  3O9O A;  2W6J G;  4DW0 A;  1KB9 F;  4G27 B;  4JAS A;  4WCE V;  1VQ7 V;  2AXT Z;  3JAK A;  1Q7Y W;  2YS8 A;  1HW7 A;  4I50 B;  3UKM A;  2ZM6 O;  4FLT A;  3CYO A;  1QR8 A;  3OTF A;  2BCC H;  3ZHR A;  3JD2 A;  4AQY O;  3CRM A;  4PDV A;  5EBL C;  3L9D A;  1BHB A;  4D6T H;  3HKE A;  3E86 A;  5BR8 B;  2CTW A;  4CS3 A;  4E2L A;  3APO A;  5B1B B;  3ZS8 C;  4XDL A;  5JWP A;  3K57 A;  5DN6 G;  2PTM A;  4B3S B;  3SPH A;  4WBN B;  2LW7 A;  3ABK C;  3D3I A;  5LXT B;  3FB8 C;  4DR5 O;  2NNU A;  1K4C C;  3BVO A;  2EZP A;  3ML0 A;  1Y76 A;  2A7W A;  4A5U B;  4O4H B;  4I55 A;  1JJ2 U;  5F2V O;  4LFB O;  2HVJ C;  3ZX6 A;  4FLV A;  1R73 A;  1TVK A;  1YTF B;  4TUY A;  1QCE A;  3EFF K;  3CCM V;  3UO2 A;  5K1X A;  3B8M A;  4U7O A;  1OCR B;  3QO5 A;  3E8F A;  3IC7 A;  3L74 H;  3VQW A;  3S3X A;  3BAA A;  3UT5 B;  1RPR A;  1GN2 A;  3CME V;  5KX5 A;  2UU9 O;  2CH7 B;  3STZ C;  1K34 A;  3ZJZ A;  5C93 A;  1H8E G;  1XIL A;  1VQO V;  1XDC A;  1YIJ V;  5EIB C;  1SZT A;  4J11 A;  1N32 O;  2QWN B;  1TUB A;  3CHX A;  2MW2 B;  3TJT A;  4CH5 A;  1H2L A;  1HWY A;  3ZMZ A;  1H8H G;  1TVK B;  2YSU B;  5DED A;  3IFX A;  4ZKI A;  4X1I B;  2RCV A;  4DR7 O;  1VQM V;  5LGN A;  4MW8 A;  4CH4 A;  5GTH Z;  4PDL A;  5BZB A;  1K97 A;  3RVY A;  3CCL V;  4HBN A;  4PV1 B;  3BPZ A;  1XNQ O;  2NLJ C;  3UQ8 A;  3RN4 A;  4EFB A;  2ZCE A;  4YJ3 B;  4H37 A;  1MZF A;  3JAM N;  2HLD G;  2A9H A;  3A0R A;  2WLL A;  3HKB B;  3CP1 A;  2HVK C;  4TT3 G;  3K3W A;  3OEE G;  5BXZ A;  1GTO A;  4HNA B;  1FD9 A;  3OD4 A;  1S3J A;  4WFH A;  3A8T A;  3QG5 A;  5L3E A;  1GN4 A;  3K0D A;  1N33 O;  4O2A B;  5KHG A;  2Q69 A;  1XQ8 A;  1J95 A;  4BW9 A;  4CC6 A;  3K79 A;  5JQG B;  2XUM A;  2HJD A;  1NQT A;  4R6Z A;  2QWQ B;  4B3M B;  3N2K B;  3CEI A;  4PA6 A;  1Q8I A;  4MSW C;  1A32 A;  3HPL C;  2XAQ A;  1R6K A;  2CH7 A;  3LSU A;  4DV0 O;  1EBO A;  3W7S A;  5FL7 G;  3F5W C;  3G71 V;  1K7D A;  4K35 A;  3P32 A;  1Y67 A;  2UU9 B;  1LR1 A;  2VWK A;  1OV9 A;  2DYS B;  3N2G B;  1NZ6 A;  4UVC A;  3RW0 A;  3B4S A;  1M56 B;  2Q6A A;  5L3F A;  1W0K G;  3CCV V;  1G8M A;  4J7J A;  4B3T B;  2E5L O;  1US6 A;  4LF8 O;  4O4I B;  2FB5 A;  3LSQ A;  4LF5 B;  3GWK C;  4JI8 B;  1UPG A;  1BL8 A;  2H8P C;  4LF7 B;  2DWE C;  3CCR V;  3P30 A;  1PPJ H;  2WLH A;  3OW2 U;  1HDJ A;  1AIL A;  3DSQ A;  2A79 B;  2GTS A;  4QJF B;  4QGP A;  5E1A C;  5B1A C;  1SES A;  3VQV A;  1NTK H;  3DXR B;  3L73 H;  1R3L C;  1SQV H;  4H33 A;  2OT5 A;  3THO A;  2AZ2 A;  2LW1 A;  2F66 C;  2W0F C;  5JJN B;  4K0K B;  4NXN O;  3SYO A;  4CBC A;  4RQE A;  1BGY H;  5CA3 A;  2QA4 V;  3BEH A;  1WPX A;  4AIL C;  1I08 A;  5J2U A;  3RYI B;  1RFY A;  2QSA A;  5D5P A;  2DWD C;  1XHZ A;  1JPX A;  2YID A;  1AP6 A;  1I7F A;  2DYR B;  3CS5 A;  4JF3 A;  1YSC A;  2BSK A;  3F5T A;  2YXY A;  1ZWI C;  3G4S V;  4O4J B;  2Q5Z A;  1IUR A;  4HZ3 A;  1H2G A;  4B3S O;  1AJQ A;  3SYC A;  3JCU Z;  1ZSP A;  1BCC H;  3K5M A;  3ZMT A;  4CH3 A;  3PJS K;  1N4C A;  5LYJ A;  4X64 O;  1SC5 B;  4DV7 O;  2Q67 A;  5LMU O;  2EZO A;  1NR7 A;  1QHT A;  4F6R A;  1SER A;  3K5N A;  1OCZ C;  1H2K A;  1FJG O;  2HR3 A;  1F4N A;  1WA8 A;  4FLZ A;  4X64 B;  1NU1 H;  4KL1 A;  1VQ6 V;  2IW5 A;  1I94 B;  4AQY B;  4DUY B;  2DQ0 A;  2HKO A;  1F7Y A;  5KHK A;  2JVD A;  3JAW B;  5ITZ A;  4H0L B;  1N34 O;  3B40 A;  3RBZ A;  3KCX A;  1WJZ A;  2YEV B;  4I4T A;  4ICG A;  1OCO C;  4K8X A;  4PHZ A;  1AJN A;  5EYP B;  2Q9L A;  4DR3 B;  3MD0 A;  2X6C A;  4NTW A;  3K9S A;  2JJ2 G;  1VQ9 V;  3AK3 A;  3SPC A;  1XL4 A;  2UXB B;  3D36 A;  4DV1 O;  3ZRW B;  2FML A;  2P4K A;  4LH7 A;  4CZZ A;  4DV1 B;  4O4L B;  1Q81 W;  5IY5 C;  1X4T A;  4DRX B;  5FLX N;  3AG3 B;  3CCQ V;  4I0X B;  4U3J B;  1J5E B;  3AG4 B;  1VMG A;  1OCO B;  3FD9 A;  3Q4H A;  2ATK C;  4E4E A;  2B1I A;  1BSM A;  2JDI G;  4DR6 B;  4JI3 B;  1PP9 H;  1VF6 C;  2P7T C;  4DR5 B;  4LF5 O;  1DK1 A;  4I9Q A;  3CC2 V;  2R70 A;  4TOI A;  2RDC A;  4O2A A;  1IXB A;  4WF9 V;  5A2Q N;  1XMQ O;  2AHZ A;  4IIJ A;  3F7V C;  5BR8 O;  4XDK A;  3DGE A;  4OPH A;  4X66 O;  4EB6 A;  3RGB A;  2F43 G;  2R9A A;  1JR9 A;  1H2N A;  3K08 A;  3W7X A;  3W7U A;  3OGC C;  1CEZ A;  1NH2 D;  3N2G A;  3CC7 V;  1NT2 B;  3S3W A;  3CE2 A;  2XAH A;  3CWB H;  4MTF A;  3BHP A;  1XEQ A;  2KB1 A;  3G67 A;  1NS1 A;  1GK9 A;  3P3N A;  4DV5 B;  5IDJ A;  4DR1 B;  1FJG B;  1KKC A;  3CB2 A;  3MDS A;  1QLE B;  1Z5W A;  2IJK A;  2WA3 A;  2CK3 G;  2ZE5 A;  1ORQ C;  4RAI A;  1PNK A;  2LGQ A;  2QTS A;  4X89 A;  1AB3 A;  2IBZ H;  3AK2 A;  4GKK B;  5JQG A;  3A0H Z;  3H9V A;  3O65 A;  4DV5 O;  2WPD G;  2OWO A;  4FMT A;  1FXV A;  4QE7 A;  5KUM A;  1QLN A;  1VP7 A;  1FPO A;  3DTU B;  5H9C A;  2UUC O;  2GV9 A;  3ETE A;  1K33 A;  2RQ6 A;  5LGU A;  1SS3 A;  5D5Q A;  2H94 A;  2JEX A;  2EUL A;  1P7G A;  3OR7 C;  4TV9 B;  2JEU A;  1XNQ B;  4KFM A;  4OGQ B;  2YC0 A;  3SYQ A;  2Q8V A;  2P22 C;  1TUE B;  2HJF C;  3JD4 A;  3CC4 V;  4ASU G;  3ABM C;  4TV9 A;  2PYJ A;  3H1H H;  3K58 A;  3TXQ A;  1K8A W;  4B3T O;  2P4V A;  4LFB B;  4DR6 O;  1X59 A;  1F4M A;  4IYH A;  4DXW A;  1HR0 B;  1UJW B;  3OT7 A;  4PDM A;  4PD4 F;  4LFC O;  3SYP A;  4I5S A;  4Z1M G;  3CJH B;  1WP7 A;  2OTL V;  3Q4H B;  2LGW A;  1WN7 A;  5IYZ A;  4MTG A;  4DRX A;  1L0L H;  1N0N A;  4QPK A;  1LUW A;  2JGU A;  2OIE A;  2QR4 A;  2XOK G;  4NVP A;  5LP6 C;  4RO2 A;  2UUA B;  2QM8 A;  4O2B B;  3I55 V;  1SF9 A;  4WFE A;  1I5X A;  3GB7 C;  5LP6 A;  2LFR A;  2P5O A;  4ZOL A;  1MSW D;  1ZUQ A;  5IJ0 B;  4PI2 A;  4I55 B;  1OCR C;  1XOU A;  2HG5 C;  2YI8 A;  5J2T A;  2UUC B;  1N36 B;  2UUB B;  3ZHS A;  4FM0 A;  1ARO P;  4ABM A;  2LJ2 A;  1K3E A;  4W4L A;  1RSO B;  4H44 B;  4JZ2 A;  2XHB A;  3M7M X;  5JCO A;  1AI5 A;  1ENV A;  3SPG A;  3CRA A;  4DR7 B;  5GW7 A;  1MMM A;  2IU3 A;  2QM4 A;  2BTQ A;  3J81 N;  4DR4 B;  5LOV B;  3FX7 A;  5CA0 B;  2Q68 A;  2Y4U A;  3SGI A;  5KHI A;  3HKC A;  1BQZ A;  3ZRW A;  4X20 A;  1Y74 B;  4YY3 O;  2DOS A;  5EZY A;  4X65 O;  2QEX V;  3BCC H;  1FXK C;  2F4V O;  1KD1 W;  2PGG A;  2X6A A;  4FLY A;  2XND G;  3PN1 A;  1R3I C;  3OUF A;  4IT5 A;  5GTI Z;  1DGS A;  4JI8 O;  4MW3 A;  1GAX A;  1AR4 A;  1NTZ H;  5LL6 Y;  2DW4 A;  2PYL A;  3EXA A;  1COW G;  2Y69 B;  4NTX A;  5IYD O;  1IBM B;  1YIT V;  2E5L B;  4LF8 B;  4F4L A;  2DMX A;  4JI1 B;  3APQ A;  1NJI W;  4YHH O;  2F95 B;  2LP7 A;  3T1Y O;  1P49 A;  4OX9 O;  3BFR A;  1F51 A;  1VQP V;  1D2D A;  4DW1 A;  2HP8 A;  4EKW A;  1B06 A;  3T4D A;  5E79 Z;  3VBB A;  3CSX A;  3AEI A;  4LR3 A;  3ZMU A;  5IWA B;  2ZIO A;  4X20 B;  4CC5 A;  5H5N A;  2RN9 A;  3RYH A;  3M8A A;  1Q6I A;  3G6B A;  3IAY A;  2XT9 A;  2JK5 C;  1PL0 A;  4J42 A;  4QPJ A;  2JJ1 G;  1SA0 B;  2JS3 A;  3KKY A;  4OPA A;  1DTO A;  1WAZ A;  1SKV A;  3OTO O;  1PV0 A;  3K04 A;  1QR9 A;  1M56 C;  3VQY A;  1XMO O;  1AI6 A;  2QWP B;  3BA8 A;  4KHP O;  3K5L A;  2YIB D;  1TAE A;  2ADQ B;  4P30 A;  2JGD B;  1OCZ B;  2ODM A;  3ZHT A;  1IBK O;  1EM1 A;  5LP6 B;  2WA4 A;  1N34 B;  5JH7 B;  2YXL A;  3LNN A;  4WFB V;  1GMG A;  3B8N A;  1G6U A;  1YJW V;  1VF7 A;  1JFF A;  4JI0 B;  1QBZ A;  2Y4T A;  3ASN C;  2ZT9 B;  3RVZ A;  5KMG A;  4ZIB A;  1L0N H;  4I7Z B;  4FIP C;  2XAG A;  4CH6 A;  3OM3 B;  1Y66 A;  4YIO A;  3A0B Z;  4UFZ A;  3RFR A;  3BRC A;  3CJH A;  4GX1 A;  4JI2 B;  1KBH A;  1GM8 A;  4X1Y B;  2JIZ G;  1SZX A;  2VWJ A;  3OFN G;  2BOC C;  2Y0I A;  1VQL V;  3D36 C;  3DC5 A;  1N36 O;  5JVD B;  1FXK B;  4RQF A;  2BTQ B;  5EK0 A;  4P9O A;  4UCO A;  2Q7E A;  5LA6 A;  2VQE B;  5EC1 C;  2QJ1 A;  1JJO A;  4JV5 O;  1BMF G;  4J7K A;  3GWO A;  4EFE A;  2WLL B;  2ZIM A;  4X9Q A;  4FLU A;  2D2C B;  1G1X B;  5CB4 B;  3AG4 C;  1DF5 A;  1R6T A;  4NXN B;  3E22 B;  2WSS G;  1HNZ B;  1FFX A;  1W59 A;  3OMA B;  1ZL8 A;  1P7B A;  1E1Q G;  2WLI B;  1K5S A;  4DR2 B;  4LFC B;  5KUK A;  2EIN B;  3RYI A;  2RJZ A;  4U7N A;  4JI4 O;  1XBL A;  1SET A;  1VF5 B;  3EHB B;  2IJI A;  2E74 B;  2BOB C;  2E76 B;  3MHH C;  1LNQ A;  2QWO B;  3GVM A;  2WLN A;  1M93 A;  1YJ9 V;  3HKD B;  3CCU V;  4HYO A;  4JYA O;  4IGG A;  1Q6H A;  3OR6 C;  3HKB A;  2P6J A;  1NI8 A;  1R6N A;  1OCC B;  3ZN1 A;  1ROP A;  2M7W A;  3ZRV A;  3SJC C;  1S77 D;  4HNA A;  3CPW U;  1GM9 A;  1F23 A;  4J41 A;  4GT1 A;  1MOF A;  1KUQ A;  2ITC C;  2V7Q G;  4FM2 A;  2ZKO A;  4YJ3 A;  4B3M O;  2CAZ C;  5CBF A;  3E8G A;  3ETD A;  3K03 A;  3ZRS A;  2N05 A;  1SQP H;  4UUJ C;  1K9M W;  5EIB D;  1B6Q A;  4X1I A;  2NR5 A;  3R65 A;  4IHJ B;  2W6I G;  1PM9 A;  2EBO A;  1QU7 A;  2YIB A;  1YCI A;  4LFA O;  5B66 Z;  3IC9 A;  1RM1 C;  3UT5 A;  2XTA A;  1BHA A;  3JAT A;  2CE4 A;  2R9I A;  3C3S A;  1P84 F;  2NN4 A;  4O4L A;  4NXM O;  3AG2 C;  4K8Z A;  3ABL B;  1QNM A;  5FNV B;  3U0Z A;  1VAR A;  3FAV B;  2OYQ A;  3EVK A;  3CMA V;  1KEC A;  3CRR A;  3K59 A;  3CD6 V;  3T2M A;  4B7K A;  5IE9 A;  1ZX3 A;  1TA8 A;  4FPP A;  3TCU A;  4X1K A;  3CX5 F;  5B1B C;  2ZXW C;  3ZHU A;  2K1E A;  4UVB A;  1N8R W;  2FYU H;  2GSM B;  3JD0 A;  3N27 A;  4MTX A;  2Q7H A;  3QVN A;  4PA3 A;  4FLX A;  2YDE A;  1I5Y A;  2ZE6 A;  3JSL A;  2B9Z A;  5GON A;  4UCU A;  5H6R A;  3T1H O;  3FYE B;  2YEV A;  1BT8 A;  1FYJ A;  1RP3 B;  4DV4 O;  1FFT B;  1OCC C;  5LBQ A;  1B3Q A;  3ETQ A;  2HFE C;  1CP9 A;  5B1N A;  2QWR B;  4RUF A;  4FFB A;  4LF4 B;  1TGO A;  4GKJ B;  2OCH A;  4MVS A;  3NR7 A;  4JI5 O;  1WA8 B;  2K9P A;  3SYA A;  2MK3 A;  1XNR B;  1ZL8 B;  2ZDI C;  3JAR A;  2BSK B;  4KXR A;  3ZRX A;  4JAV A;  4RWU A;  1YXB A;  5IJ9 A;  1AI7 A;  4GX0 A;  1Q90 D;  5LMN B;  2F1M A;  3OMI B;  5BMV B;  4DUY O;  3JSN A;  4LWS A;  1H38 A;  3JAK B;  4L8J A;  5EYP A;  3SDL A;  4LF6 B;  4O4H A;  2QGN A;  3STL C;  5JVD A;  4MVR A;  2DE0 X;  4DV7 B;  2CGN A;  3L70 H;  2L35 A;  1SRY A;  2R9R B;  2Z3Y A;  3JD1 A;  4FVM A;  3WU2 Z;  4X1Y A;  5ITZ B;  5LA6 B;  5EBW C;  3JAW A;  4FFK A;  1M4U A;  3JAL B;  1XNR O;  1Q86 W;  1GKF A;  3RT3 C;  4LP8 A;  4LF4 O;  3CCS V;  2FL4 A;  3WG7 B;  5BMV A;  4DV2 O;  5KHJ A;  5LYJ B;  2ZR3 A;  4JTD B;  4X62 B;  3CCJ V;  4R50 A;  2IJH A;  1DLB A;  1LUV A;  3E8H A;  1M5I A;  5LHH A;  4KP4 A;  3ETG A;  5L3C A;  2ZIN A;  1SQQ H;  3QO8 A;  4PA9 A;  4JYY A;  1OJH A;  4JI7 B;  4JI6 B;  2PF4 E;  1H2M A;  2KSD A;  2XAF A;  1S72 V;  1PD3 A;  4WFF A;  1Y74 A;  5EBM C;  4TQF A;  2HHH O;  4YHH B;  2JRI A;  2DYR C;  2ZE8 A;  4QIW F;  1AJP A;  1RPO A;  2PZS A;  4B3R O;  4DV3 B;  3JAR B;  3JAT B;  1S5H C;  5CA0 A;  3ZCC A;  1HP8 A;  3FB6 C;  1IDS A;  1FKA O;  2L6L A;  3ABK B;  2KG7 B;  1PKX A;  1VQ8 V;  4B3R B;  3AG1 C;  5K1P A;  4FFB B;  3KG2 A;  3K0G A;  4NYK A;  1MA1 A;  1I0H A;  1V54 B;  4DR2 O;  3N2K A;  1V55 C;  4UCS A;  4MVQ A;  4JGS A;  4OXS A;  3RYH B;  4UV8 A;  3UCS C;  5DM6 V;  3CXH F;  1D5A A;  1IBL O;  5IYC O;  4DR4 O;  4BIU A;  4LFA B;  3LUT B;  2ZE7 A;  1MZE A;  1IVS A;  1DF4 A;  3QO7 A;  3OEH G;  5IJ0 A;  2WAM A;  2N74 A;  5IY5 B;  2ZNJ A;  2ARH A;  4FK5 C;  1CXZ B;  4JYB A;  1PL4 A;  1V54 C;  1EZV H;  2F23 A;  5FNV A;  3I56 V;  4O2B A;  2VQF B;  1L8D A;  3B77 A;  4H13 B;  3H01 A;  3G6E V;  1K92 A;  2UXC B;  2UXN A;  4LF9 B;  4JI2 O;  2ZR2 A;  5CN0 A;  2EIJ B;  3WG7 C;  1KC8 W;  4ZI7 A;  5H6Q A;  1TUB B;  4DK0 A;  2IH1 C;  1R3J C;  1JX9 A;  5KAI Z;  2IU0 A;  3LSS A;  1NVP D;  4DO2 A;  3FB5 C;  5LGT A;  2GTA A;  4DV4 B;  2ZDI A;  3WB1 A;  3LDC A;  4JAA A;  3I5D A;  3F7Y C;  4GYC B;  2RNB A;  4ZOL B;  2P06 A;  1Y76 B;  1BQ0 A;  4DUZ O;  2C2A A;  1W0J G;  4Z2W A;  3L72 H;  3FYI B;  4MVM A;  2Z0A A;  3IJ4 A;  5B1O A;  4AHC A;  3SPI A;  4PEL A;  1H2S B;  1GN3 A;  2EJ7 A;  5LHG A;  2F93 B;  1HNX B;  5JCO C;  4DYL A;  3MHS C;  2IM9 A;  1WNS A;  2QDO A;  2DN9 A;  2IH3 C;  4BIZ A;  1HNZ O;  1JCH A;  3FAV A;  2QTO A;  3ASO B;  2YXH A;  3ZIA G;  3B09 A;  4DV3 O;  2E3C A;  4I9W A;  4WBN A;  2CGO A;  1WB8 A;  2CTR A;  4MTO A;  4B08 A;  3J7A U;  1FXH A;  4UCT A;  1AP5 A;  2CDY A;  3HKD A;  1K73 W;  5KA5 A;  2ILM A;  4F6E A;  1G4Y B;  4NXM B;  4MS2 A;  4YIP A;  1D5N A;  1JQ0 A;  1AI4 A;  3T1C A;  4UB6 Z;  4B7E A;  2D3O W;  2EJR A;  4FLW A;  4CS2 A;  1WP8 A;  3G80 A;  4I50 A;  2V4D A;  5CBG A;  3ZED A;  3D3Q A;  3X2Q B;  2WLM A;  2EIK C;  4BW5 A;  4FM1 A;  4GKK O;  4ZHQ B;  3E89 A;  4UXN A;  4RUE A;  1XRE A;  2VQF O;  2YIA A;  4IIJ B;  4DV6 O;  1FS0 G;  2PUS A;  3P3P A;  3CRQ A;  4FZ1 A;  4UVA A;  3AG1 B;  1Z5V A;  4LH6 A;  1BE3 H;  4R7C A;  3ABM B;  3QNE A;  1L1F A;  5LXT A;  5C8Y A;  4LCU C;  2EIK B;  3E83 A;  2OIG A;  3K06 A;  4R8C A;  2PI5 A;  5CA1 A;  4DV6 B;  4J10 A;  1XMQ B;  3U11 A;  1FXK A;  3U10 A;  2G38 A;  1NTM H;  1Q3E A;  2KG7 A;  2R72 A;  3E35 A;  4GX2 A;  2EIJ C;  2YI9 A;  4EEQ A;  2OTJ V;  1K4D C;  2ETN A;  1JA8 A;  4MVU A;  4KUM A;  3SJQ C;  1FAF A;  2BE3 A;  4LC1 A;  2GHY A;  5DEC A;  4YJ2 B;  4C7U A;  3ZN0 A;  1Z2G A;  1IZ3 A;  4PDR A;  2WLI A;  5IWA O;  2DQ3 A;  2W0X A;  5KHH A;  5KMG B;  2QKA A;  2FTK A;  4G2K A;  1JFF B;  2CUG A;  2UUA O;  1FFX B;  1EN5 A;  1HNX O;  3ZBH A;  3T1Y B;  3E8B A;  1V55 B;  1ZTE A;  5BY1 A;  3RYF B;  2E75 B;  4JYC A;  3CCE V;  2LQT A;  3HB3 B;  4IL6 Z;  2M6Y A;  5CB4 A;  1XI1 A;  2WLJ A;  1IBM O;  3FKS G;  4NKG B;  4X88 A;  1Q43 A;  2Q0O C;  2WLK A;  4DR3 O;  3FFQ A;  1THZ A;  2VS0 A;  3ABL C;  3ZHQ A;  1M90 W;  4GX5 A;  4JI4 B;  1Q82 W;  1SQX H;  4BWA A;  1NR1 A;  1S5J A;  4X8A A;  2B5U A;  3UO3 A;  1AR1 B;  2UXD O;  1PNM A;  1M1K W;  4JI6 O;  2Y48 A;  5KAF Z;  4JI7 O;  1EN4 A;  4J9Y B;  4Q6G A;  5AG2 A;  3MAQ A;  5L3B A;  4I0X A;  4U3J A;  4NR1 A;  4PI0 A;  2OCC B;  5A9G A;  1MNG A;  2P67 A;  2ADP A;  4LWS B;  1KP2 A;  3AG7 A;  1YHQ V;  3H1J H;  5B1A B;  5EZY B;  1WLE A;  4QE9 A;  4YJ2 A;  1NBM G;  1Y6X A;  5IJ9 B;  4TQD A;  2GUZ B;  5HFL A;  3DC6 A;  2DJV A;  3JAS A;  5L3D A;  3SJB C;  1YI2 V;  2RMK B;  4TV8 A;  1KU9 A;  4NTY A;  2PI4 A;  4GLX A;  1SA0 A;  5LHI A;  4YXW G;  2ZXW B;  4LF6 O;  3BY6 A;  1M57 B;  1RSO A;  2QE7 G;  2ZQM A;  2ZNI A;  2LO1 A;  1K5Q A;  3TET A;  1XHX A;  2Z5U A;  1R3K C;  4N23 A;  1JOY A;  1MSD A;  3L71 H;  1GH6 A;  3WFV A;  1GRJ A;  2KKW A;  3RYF A;  3IGA C;  1VQN V;  3OAA G;  4UB8 Z;  4O4I A;  5GON B;  5J2T B;  1S76 D;  2CTQ A;  4UCV A;  3RYC A;  1W2B U;  3C3T A;  1XL6 A;  2VRZ A;  2AGA A;  2Q4P A;  4KHP B;  3LDD A;  1VEW A;  1XMO B;  3SPJ A;  1VF6 A;  4J9Z B;  4LF7 O;  1JMK C;  1T5E A;  5KA6 A;  1GM7 A;  4U3F H;  3CRC A;  3KZI Z;  2X0L A;  3VQX A;  1ZAU A;  4PA7 A;  1KKD A;  4UCR A;  1EFR G;  3AK1 A;  1KYO F;  3B2E E;  1SQB H;  2EX3 A;  5IYZ B;  5B3S C;  5EC2 C;  4LNU A;  4IYI A;  1VIB A;  3K5O A;  3A2F A;  4W4K A;  3LNM B;  4BR6 A;  3HKC B;  5FPO A;  5C8Y B;  4AI8 A;  4TSF G; 
#chains in the Genus database with same CATH homology
 3OUS A;  2XAF A;  1S72 V;  1PD3 A;  2HLD G;  2A9H A;  2Q68 A;  2WLL A;  3A0R A;  3ASN B;  4WFF A;  1KP3 A;  3CP1 A;  1CPY A;  2HVK C;  4TT3 G;  3NXS A;  5EBM C;  3K3W A;  3OEE G;  3ZRW A;  2DYR C;  1GTO A;  2AHY A;  2EIM C;  1AJP A;  1RPO A;  4QIW F;  1S3J A;  4WFH A;  5L3E A;  2QEX V;  1S5H C;  1P4R A;  3K0D A;  3ZCC A;  1FXK C;  1KD1 W;  2X6A A;  2Q69 A;  2XND G;  1J95 A;  1R3I C;  2X7R B;  3FB6 C;  3OUF A;  3ABK B;  3K79 A;  1VQ8 V;  1PKX A;  4MW3 A;  1NQT A;  3AG1 C;  2DW4 A;  4R6Z A;  1COW G;  2Y69 B;  3KG2 A;  4PA6 A;  4Q20 A;  5IYD O;  3K0G A;  1YIT V;  4JPR A;  1V54 B;  4MSW C;  4F4L A;  1VQ5 V;  4G28 B;  3W7W A;  1NJI W;  1V55 C;  3HPL C;  1OZ0 A;  3LDE A;  4MVQ A;  2XAQ A;  1M9N A;  4QNH B;  3ABT A;  4JGS A;  1R6K A;  4OXS A;  4UV8 A;  2LP7 A;  1EBO A;  3W7S A;  5DM6 V;  5FL7 G;  3F5W C;  3G71 V;  1F51 A;  1VQP V;  5IYC O;  1VQK V;  4EKW A;  1K7D A;  3P32 A;  4P2Z A;  3T4D A;  3VBB A;  1E1R G;  4BIU A;  3LUT B;  3AEI A;  2DYS B;  3ZMU A;  4BAY A;  2QKS A;  1DF4 A;  3QO7 A;  4UVC A;  3OEH G;  3RW0 A;  2WAM A;  5IY5 B;  1M56 B;  4FK5 C;  1YJN V;  2Q6A A;  5L3F A;  1W0K G;  2EIN C;  4JYB A;  5J9P C;  2JK5 C;  1PL0 A;  1V54 C;  3CCV V;  1G8M A;  4QPJ A;  2JJ1 G;  4JTA B;  3I56 V;  1DTO A;  3LSQ A;  1JVM A;  3B77 A;  3K04 A;  1QR9 A;  3H01 A;  1M56 C;  2XAS A;  2EIL C;  3G6E V;  1AI6 A;  1BL8 A;  1K92 A;  2H8P C;  2DWE C;  3CCR V;  3P30 A;  2UXN A;  2WLH A;  4P30 A;  3OW2 U;  1OCZ B;  2ZR2 A;  5CN0 A;  2EIJ B;  4MT8 A;  2A79 B;  4QJF B;  3FB7 C;  3WG7 C;  1KC8 W;  5H6Q A;  5E1A C;  5B1A C;  4WFB V;  2IH1 C;  1SES A;  5IYB O;  1R3J C;  1GMG A;  3B8N A;  1JX9 A;  1YJW V;  1R3L C;  2IU0 A;  4H33 A;  3LSS A;  1NVP D;  2ZD9 A;  2OT5 A;  1QBZ A;  3ASN C;  3RVZ A;  2W0F C;  3JCZ A;  3SYO A;  4DO2 A;  4CBC A;  3FB5 C;  4FIP C;  4RQE A;  5CA3 A;  5LGT A;  2QA4 V;  2XAG A;  3BEH A;  1WPX A;  3JYC A;  1OHH G;  1Y66 A;  3OM3 B;  3VOU A;  2ZDI A;  3LDC A;  2DWD C;  2DYS C;  3F7Y C;  3X2Q C;  3ZMV A;  4GX1 A;  1JPX A;  2V1D A;  1GM8 A;  2JIZ G;  2DYR B;  2UXX A;  5L3G A;  4JF3 A;  1YSC A;  3OFN G;  2BOC C;  1NH2 B;  3JD3 A;  1ZWI C;  3G4S V;  1VQL V;  2X6B A;  5B3S B;  2C2A A;  1W0J G;  1H2G A;  1FXK B;  3FYI B;  3ABU A;  3OE7 G;  2Y69 C;  4HZ3 A;  4MVM A;  4RQF A;  1AJQ A;  5B1O A;  5EK0 A;  4P9O A;  4PEL A;  3SPI A;  3SYC A;  1VQ4 V;  5LHG A;  3CXC U;  4MVZ A;  1NKD A;  5EC1 C;  3ZMT A;  1BMF G;  3GWO A;  4TWK A;  2WLL B;  3MHS C;  4UV9 A;  4N21 A;  3PJS K;  4HAM A;  1RM1 B;  2IH3 C;  3OMN B;  2Q67 A;  1JCH A;  2EZO A;  1NR7 A;  4BIZ A;  1SER A;  2QTO A;  3AG4 C;  3ASO B;  1DF5 A;  3ZIA G;  1OCZ C;  4I9W A;  2HR3 A;  1F4N A;  4MTO A;  3T4Z A;  3E2E A;  2WSS G;  1FXH A;  2WWW A;  1Y4M A;  2IW5 A;  3OMA B;  4WFG A;  1KQS U;  1VQ6 V;  1M57 C;  1P7B A;  1K73 W;  2DQ0 A;  2HKO A;  5KA5 A;  1G4Y B;  4LBE C;  4MS2 A;  1JQ0 A;  1AI4 A;  3T1C A;  1E1Q G;  2WLI B;  1K5S A;  2D3O W;  5HFM A;  2EJR A;  3RBZ A;  5KUK A;  2EIN B;  2YEV B;  4U7N A;  1SET A;  3TK1 A;  5CBG A;  3EHB B;  2P90 A;  1OCO C;  2IJI A;  1E79 G;  3X2Q B;  1AJN A;  2BOB C;  2WLM A;  2EIK C;  3MHH C;  4BW5 A;  3E89 A;  1LNQ A;  3MD0 A;  2X6C A;  4UXN A;  1VQ9 V;  2JJ2 G;  2EIL B;  4RUE A;  3SPC A;  2WLN A;  1QVG U;  1XL4 A;  2EIM B;  1YJ9 V;  2ITD C;  4PA4 A;  3D36 A;  3CCU V;  4HYO A;  1FS0 G;  3ZRW B;  4XBF A;  3UM7 A;  1MAB G;  4FJC C;  4CZZ A;  1Q81 W;  4UVA A;  3OR6 C;  2P6J A;  3AG1 B;  5IY5 C;  1R6N A;  1OCC B;  4JTC B;  4R7C A;  3ABM B;  1ROP A;  3AG3 B;  3ZN1 A;  2LFS A;  3CCQ V;  2M7W A;  3QNE A;  1L1F A;  3AG4 B;  3ASO C;  3ZRV A;  1OCO B;  1QLE C;  4L87 A;  4LCU C;  1GO3 F;  4MVO A;  1S77 D;  2ATK C;  2EIK B;  3CPW U;  1GM9 A;  2B1I A;  1F23 A;  2QM7 A;  3E83 A;  2JDI G;  3K06 A;  4GT1 A;  1MOF A;  2ITC C;  4R8C A;  2V7Q G;  3AG3 C;  2P7T C;  4WFA V;  2PI5 A;  1FXK A;  1NVP B;  1YTF D;  5CBF A;  3E8G A;  3ETD A;  2B1G A;  3K03 A;  3AG2 B;  4JAU A;  3E35 A;  3CC2 V;  3ZRS A;  2XAJ A;  4GX2 A;  2EIJ C;  2OTJ V;  2IJJ A;  1K4D C;  4UUJ C;  4MVU A;  4KUM A;  3SJQ C;  4WF9 V;  4LC1 A;  2GHY A;  2A0L A;  1K9M W;  2AHZ A;  1B6Q A;  3F7V C;  4XDK A;  3DGE A;  3ZN0 A;  2OCC C;  2F43 G;  3R65 A;  3W7X A;  3K08 A;  2W6I G;  3W7U A;  2EBO A;  3OGC C;  1CEZ A;  4PDR A;  2WLI A;  2DQ3 A;  1NH2 D;  4XDJ A;  2FTK A;  4G2K A;  1S0V A;  4GCZ A;  1RM1 C;  3CC7 V;  1BHA A;  2XAH A;  1V55 B;  2R9I A;  3E8B A;  3AG2 C;  4MTF A;  1QVF U;  3ZMS A;  2KB1 A;  3ABL B;  4JYC A;  3K9A A;  4P9P A;  3HB3 B;  3CCE V;  5CBH A;  1GK9 A;  4ZBM A;  5IDJ A;  2WLJ A;  3M99 B;  3CMA V;  1KEC A;  3FKS G;  1PNL A;  1QLE B;  2IJK A;  2CK3 G;  4X88 A;  5CMU A;  3T2M A;  1ORQ C;  3CD6 V;  4RAI A;  2WLK A;  3W7T A;  1EZJ A;  1PNK A;  4X89 A;  1MG1 A;  1IXM A;  1THZ A;  2W6J G;  3ABL C;  1M90 W;  4GX5 A;  4G27 B;  4JAS A;  2WPD G;  4WCE V;  1VQ7 V;  4FPP A;  1Q82 W;  4FMT A;  1FXV A;  3TCU A;  1Q7Y W;  4QE7 A;  5KUM A;  1NR1 A;  1QLN A;  3UKM A;  3DTU B;  5H9C A;  2ZXW C;  1QR8 A;  3CYO A;  4X8A A;  5B1B C;  3ETE A;  1K33 A;  2B5U A;  5LGU A;  2K1E A;  1AR1 B;  4UVB A;  1N8R W;  2GSM B;  3JD2 A;  1PNM A;  1M1K W;  3JD0 A;  2H94 A;  2JEX A;  2Y48 A;  4MTX A;  4PDV A;  4PA3 A;  3OR7 C;  4J9Y B;  2JEU A;  1I5Y A;  5EBL C;  4KFM A;  1BHB A;  5L3B A;  2OCC B;  5H6R A;  3FYE B;  2YEV A;  3E86 A;  3SYQ A;  1TUE B;  2HJF C;  3JD4 A;  3CC4 V;  2P67 A;  1FFT B;  1KP2 A;  4ASU G;  1OCC C;  1YHQ V;  3ABM C;  4E2L A;  5LBQ A;  5B1A B;  2HFE C;  1WLE A;  4QE9 A;  5B1B B;  1CP9 A;  4XDL A;  5B1N A;  1NBM G;  4RUF A;  5DN6 G;  4MVS A;  5HFL A;  3SPH A;  1K8A W;  3ABK C;  3D3I A;  3SYA A;  2MK3 A;  3FB8 C;  5L3D A;  2NNU A;  1YI2 V;  1F4M A;  4DXW A;  1K4C C;  2ZDI C;  2EZP A;  1UJW B;  3ML0 A;  3ZRX A;  4PDM A;  2PI4 A;  4JAV A;  3SYP A;  4I5S A;  4Z1M G;  1AI7 A;  1JJ2 U;  2OTL V;  4GX0 A;  2HVJ C;  5LHI A;  4YXW G;  2ZXW B;  3BY6 A;  1M57 B;  3OMI B;  4MTG A;  2QE7 G;  1R73 A;  2ZQM A;  1YTF B;  1K5Q A;  3TET A;  2Z5U A;  1R3K C;  4N23 A;  1H38 A;  1JOY A;  1QCE A;  3EFF K;  3CCM V;  3IGA C;  2XOK G;  4QPK A;  3WFV A;  3B8M A;  1VQN V;  4U7O A;  3OAA G;  4RO2 A;  3STL C;  1OCR B;  2QM8 A;  3QO5 A;  3I55 V;  3E8F A;  3IC7 A;  4MVR A;  1RPR A;  1S76 D;  4WFE A;  1I5X A;  3GB7 C;  1SRY A;  3CME V;  2R9R B;  2Z3Y A;  3JD1 A;  1W2B U;  2LFR A;  3STZ C;  1K34 A;  1MSW D;  3ZJZ A;  1XL6 A;  5C93 A;  1H8E G;  5EBW C;  1OCR C;  3LDD A;  1VQO V;  3SPJ A;  2HG5 C;  4J9Z B;  1YIJ V;  1SZT A;  5KA6 A;  1GM7 A;  1Q86 W;  2X0L A;  4PA7 A;  1KKD A;  1EFR G;  1GKF A;  4LP8 A;  1ARO P;  1HWY A;  3CCS V;  3ZMZ A;  1K3E A;  1H8H G;  3WG7 B;  5B3S C;  2YSU B;  3IFX A;  2ZR3 A;  5EC2 C;  4ZKI A;  4JTD B;  3CCJ V;  4R50 A;  2IJH A;  3LNM B;  1AI5 A;  1ENV A;  1VQM V;  5LGN A;  1DLB A;  4MW8 A;  3SPG A;  5BZB A;  3E8H A;  4PDL A;  5LHH A;  1K97 A;  4KP4 A;  3RVY A;  3ETG A;  5GW7 A;  3CCL V;  5L3C A;  2IU3 A;  2NLJ C;  3QO8 A;  4PA9 A;  4TSF G;  4H37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...