2ITCC

Potassium channel kcsa-fab complex in sodium chloride
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords Antibody Fab fragment heavy chain
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2itcC00
2EINC 4GX0A 3ZJZA 3JYCA 5E1AC 4PA7A 4H33A 3AG4C 4MVRA 1XL4A 3EFFK 3SYQA 2Q68A 4GX2A 2X6CA 1K4CC 4XDJA 1KKDA 4WFEA 2WLIB 1R3LC 4HZ3A 3T4ZA 4DXWA 1M57C 2IH3C 4RUEA 2R9RB 1OCRC 1J95A 2EIKC 3R65A 4LCUC 4EKWA 3STZC 2WLJA 1M56C 2DWDC 2WLHA 2P7TC 4MTOA 3OR6C 3ABMC 4LP8A 4PA4A 1R3JC 2HG5C 1JVMA 2Y69C 3ABLC 2HVJC 3PJSK 3LNMB 2HJFC 3SYPA 1OCOC 5EC2C 4PDMA 3RW0A 4WFFA 2ZXWC 4MW3A 3ASOC 4MW8A 2X6BA 2Q69A 3E89A 4P9OA 4PDVA 3TCUA 3AG1C 1QLEC 3BEHA 2DYRC 4PA6A 2W0FC 1S5HC 3F5WC 4BW5A 5IY5C 5J9PC 3F7VC 4G28B 1OCZC 2JK5C 2WLNA 3E8BA 2A79B 2DWEC 3ASNC 3RVYA 1K4DC 2ATKC 2EILC 5KUKA 3E83A 4MVQA 4PDLA 4GX5A 3SPJA 3LDEA 4LBEC 3OUSA 4G27B 4J9YB 4I9WA 5CBFA 3X2QC 3WG7C 3LUTB 5B1AC 5KUMA 3SYCA 2Q67A 3HPLC 3OR7C 4MVZA 2OCCC 4RO2A 5EBMC 4H37A 3RBZA 3K06A 4MTGA 4R7CA 5EK0A 4MVSA 4R50A 3RVZA 1G4YB 3SJQC 3T1CA 3ZRSA 3FB5C 5EBLC 4PA9A 3TETA 3OGCC 2EIJC 2EIMC 4QNHB 4QE9A 3GB7C 2A0LA 3K03A 4MSWC 2WLLB 2ZD9A 3K0DA 2WLMA 4ZBMA 3LDCA 4JTDB 4R6ZA 3IGAC 4UUJC 4WFHA 4X89A 4X8AA 3E8GA 3SPGA 4X88A 3VOUA 4PDRA 3LDDA 4P9PA 4QE7A 2A9HA 2WLLA 3SPIA 2ITCC 2AHYA 3K08A 5EBWC 3UM7A 3E8HA 3AG3C 1R3IC 3FB6C 2HFEC 2WLIA 4J9ZB 4MVMA 4P2ZA 2BOBC 3F7YC 2Q6AA 3FB8C 4JTCB 4KFMA 2IH1C 1V54C 3UKMA 2DYSC 4XDKA 3SYOA 2BOCC 3FB7C 5CBGA 4MVOA 5EC1C 3K04A 2AHZA 1V55C 4RAIA 1ZWIC 3T2MA 4JTAB 3KG2A 3OUFA 4XDLA 4HYOA 4R8CA 4F4LA 4PA3A 4MVUA 2QKSA 3AG2C 2HVKC 2YEVA 3E8FA 4TWKA 5B3SC 5BZBA 3STLC 2ITDC 1P7BA 5CBHA 2K1EA 1BL8A 4RUFA 2NLJC 1R3KC 2WLKA 2QTOA 3ABKC 4GX1A 4P30A 3E86A 3SPHA 1LNQA 2X6AA 3SYAA 4CBCA 5B1BC 4MTFA 3SPCA 1XL6A 2KB1A 3T4DA 4OXSA 4WFGA 1OCCC 3IFXA 4MS2A 1ORQC 2H8PC 3K0GA
chains in the Genus database with same CATH superfamily
3H1LH 1VF7A 4DK0A 4JI5B 1NT2B 1KKDA 1R6TA 2E74B 5LOVB 4J7KA 1OCRC 1IX9A 1BZKA 2FL4A 4PA4A 5LGUA 3IAYA 1AI7A 2DW4A 1AP6A 1S72V 4WF9V 2XUMA 3OTOO 1GAXA 1N36B 4JYAO 3A0RA 2V7QG 1OCZB 1QLEC 1ENVA 1NKDA 1OCZC 1QLEB 1XNQB 1Q43A 1SQBH 1US6A 4DV0O 3K5NA 3L9DA 3CEIA 2ZQMA 5IYZA 1Y4MA 1Q3EA 1NTZH 2A0LA 1GM9A 3RWRD 3UCSC 5LHIA 3H1JH 4X65B 2ZKOA 1XMOB 1MOFA 4IYHA 1ZTEA 4J9ZB 2X0LA 4P2ZA 3B2EE 1KP3A 4I4TB 1V54C 1WJZA 1QHTA 1A32A 2QKAA 2YICA 4O2AB 2HEPA 4UB6Z 1JFFA 4CH4A 2JVDA 4FLXA 2UXBO 1K92A 1X59A 5B3SC 3CCJV 5FNVB 3K58A 3OMNB 2M7WA 1YZBA 1PNKA 4J7JA 4JAAA 3K5OA 1FXKB 2JS5A 3K0GA 1SQPH 2YXYA 4LH6A 5L3CA 4DV6B 3J80N 1SZXA 2X6CA 4GX2A 4DW0A 3CHXA 4GUNA 1R3LC 4O4IA 3TK1A 3ETGA 1KYOF 1I0HA 4CS2A 5IDJA 4X1YB 1MZEA 1AR4A 1F51A 2P7TC 2UUAO 4DUZO 4O4LB 3DC5A 2F93B 5L3GA 4JPRA 4E4EA 2OYQA 1AR5A 1GRJA 1QCEA 1NBMG 1S76D 3ASOC 3M8AA 2Q69A 3ASOB 4AQYB 5J9PC 3CMEV 2JJ2G 2ZE6A 1S0VA 4MVQA 3CB2A 3CCSV 4I5SA 4LR3A 1QR9A 4GKKB 3WG7C 4I7ZB 1IBKB 2RQ6A 2B5UA 5EK0A 1Q6HA 1BHAA 1WN7A 5GONA 4Z1MG 3IGAC 1R1BA 3SPGA 3MHSC 3APOA 4YY3B 1HW7A 1SA0B 4A5UB 1OV9A 2FTKA 3EXAA 3RT3C 5CA3A 2HP8A 4OPAA 5D5PA 1YXBA 1FS0G 1E1RG 3JCZA 4H0LB 1AI6A 4DV7B 1RM1C 1SF9A 3K79A 5AG2A 2JRIA 2BOBC 1SRYA 2Z0AA 3DGEA 4MVOA 5EC1C 2CTWA 1PP9H 3W7UA 1IXBA 1RM1B 5B66Z 2EINB 2IW5A 3STLC 4GT1A 4JI2O 3E35A 4NVPA 2ZXWB 2QTOA 1LNQA 1BT8A 1K5QA 3KKYA 5B1BC 3ZMZA 3FD9A 3M7MX 3ABUA 4UCVA 4WFGA 3FB5C 2EINC 1CPYA 4PA7A 2UXXA 4YJ3A 4KUMA 1XBLA 1SA0A 2WPDG 3SYQA 2E5LB 1IXMA 3CCLV 1MSWD 2RNBA 5EYPA 4HAMA 4WFAV 2KKWA 3CRCA 1KMIZ 4TV8B 4BR6A 3JAKA 4HBNA 1Y74B 2Q7HA 4DV5B 3RYFB 1W2BU 2C2AA 2X6BA 4PDVA 2VQFB 1KC8W 2UXCB 1YDXA 3P3PA 3F5WC 1U96A 1YIJV 2HLDG 3BABA 4EFEA 3ZRXA 5HFMA 4LBEC 2Q67A 2OCCC 5CMUA 4MVSA 2ILMA 3T1CA 2YDEA 4ASUG 1X4TA 3CRQA 3ZHRA 1W0KG 3HKCA 2LGQA 2ZR3A 4FMTA 3T1HB 4ZBMA 2XAHA 4MSWC 1O9HA 5A2QN 2WLMA 3LDCA 4W4LA 3IJ4A 5LHHA 4JAVA 3AG3B 5ITZA 4JYBA 1HR0O 4DUYB 3JASA 4LF8O 1N32B 2YEVB 2IJHA 2DYSC 1VQ4V 1BE3H 3EHBB 1YJNV 1V55C 5FNVA 4FLYA 3T2MA 1N0JA 3D3QA 2PTMA 3H1IH 2ITDC 1NH2B 4X65O 1GKFA 4CZZA 3QO8A 2DQ0A 2W6IG 3HKEB 1KECA 2H8PC 4X89A 3QF7A 3ZCCA 5E1AC 4IYIA 4MVRA 1CXZB 1P49A 2CH7A 1GTOA 5LXTA 4WBNB 4X62O 2UXBB 4ABMA 5LA6B 3JASB 1YVWA 2GDSA 4J80A 3OR6C 2ETNA 1N0NA 4GYCB 2Y69C 1N33B 4E2LA 2CH7B 4YJ2A 2QEXV 1NR7A 2EIKB 3HKCB 2Q8VA 1XDCA 1Q86W 3N2GB 2E5LO 5LGTA 3D36A 3CSXA 1Q5OA 4QJFB 4JI5O 3X2QC 2JEUA 5B1AC 3MHHC 1JPXA 1G8MA 5F2VO 1Q8IA 3QNEA 2XAFA 3ZHSA 4HNAB 3JARB 5KA5A 4IHJA 5FPRA 1H8EG 2CTPA 2DE0X 4NXNO 1MA1A 3DC6A 2KSDA 3D36C 1GN2A 4J11A 1HNWO 2Q0OC 3JSNA 2Q7EA 4DW1A 1R3IC 3K5MA 2QGNA 1J5EB 2WAMA 3CJHB 4FK5C 4I50A 2Y0PA 3CPWU 2CTQA 4GKKO 2LW7A 3FB7C 1Y76B 4DR6B 4KXRA 1BMFG 4YJ2B 2F23A 1VF5B 4X66B 3CC2V 2YEVA 3P32A 4U7NA 4P30A 3ZMSA 2QM7A 3JCUZ 2OIGA 2GUZA 3T4DA 4JYAB 3K5LA 5KHHA 4PDRA 3JYCA 3AG4C 1Y76A 3FX7A 1JR9A 1Z2GA 4B3SO 2Q68A 4MT8A 4WFEA 4OPHA 4HZ3A 2Z3YA 2R70A 2Y48A 5KHGA 3CJHA 3CC7V 4C7UA 4K8ZA 1WB8A 2HHHB 4FLVA 2DOSA 2DYSB 2P4VA 4UCRA 1LUVA 1B6QA 4X20B 2OWOA 5GONB 1AILA 1QNMA 2DYRC 5L3EA 2P90A 4G28B 4JI0O 4O2BA 3UO3A 3RVYA 1K4DC 4DV6O 3LSQA 1YJ9V 1M5IA 5EYPB 1Q6UA 1AJQA 4UCSA 3AEIA 3WFVA 3A2FA 1IBLO 1K8AW 1XHXA 3VQYA 5KX5B 1OJHA 1HNWB 1ZSPA 3VQVA 1EN5A 2ZD9A 4LF9B 4K35A 3D3IA 1N4CA 1NTKH 2KG7B 4X20A 1FXVA 3QO5A 4LF5O 4LFBO 3QG5A 5DM6V 1NS1A 1N36O 1EM1A 4K0KB 3K04A 5JWPA 3RFRA 1W59A 1YSCA 2IU3A 1QLNA 3Q4HA 3ZIAG 2ZCEA 1H2MA 5IY5B 5K1XA 4D6TH 2B9ZA 2YIDA 1E1QG 1R3KC 2EZOA 1DGSA 2XNDG 3BHPA 3ABKC 1GH6A 3SPCA 3ABKB 3H1HH 1Q90D 3BRCA 3RYIA 2UU9B 4LF7O 1VQLV 4JI8B 2ZINA 1TVKB 1XOUA 1MMMA 4DV1B 4LF6O 4OGQB 4DK1A 2YSUB 1F4NA 1XNRB 3AK1A 1IBMB 4JV5O 3ZBHA 4JI6O 2G38A 1L8DA 1VQ8V 1S5JA 1XILA 1GO3F 4LCUC 4DR3B 2VRZA 2CAZC 4XBFA 2LGWA 4I55B 3CMAV 1V54B 3H1KH 3UO2A 4TT3G 2GHYA 4O4IB 3CCUV 2OT5A 4PJ0Z 1YTFB 1OCOC 1O9GA 4MW8A 4U3FH 2M6YA 5CB4B 5BR8B 1EZJA 3F7VC 2PF4E 3ETQA 3ETEA 2A79B 2ZNIA 3NR7A 1K33A 3LDEA 2QWOB 4YIPA 4HNAA 1K9MW 5LMUO 3RBZA 2R9IA 1PNLA 1WPBA 3OGCC 3AK3A 3HB3B 4UCUA 1P84F 2ARHA 2LFRA 4TV8A 4LF4B 4UXNA 3LDDA 4FPPA 1LUWA 4L8JA 2UXCO 4EFBA 2AHYA 3AG3C 1PD3A 1H2SB 1I08A 2E75B 4DUYO 4UB8Z 1N8RW 2CGNA 4LNUA 1KB9F 5L3DA 4PHZA 1M9NA 3SJBC 4JAUA 4PI2A 2WA4A 2ADQB 5LP6B 3U11A 3OE7G 4LFCB 5LXTB 2EIMB 4NXMO 3E86A 3K57A 4DR4B 1FFXA 1DF4A 2R9AA 3W7SA 2JGUA 3IFXA 1K3EA 1L1FA 3HKBB 2LFSA 3Q4HB 3CXCU 4DR6O 5TISZ 2ZIOA 1WA8B 4DXWA 1BHBA 3U10A 4O2BB 4Q6GA 5DN6G 5J2UA 3OD4A 3BCCH 4FZ1A 1AR1B 2WLJA 1NU1H 1CEZA 4X66O 1R3JC 4CC6A 3CP1A 3CWBH 1JA8A 4IIJA 1FJGO 2V4DA 2YIAA 1Q82W 3W7XA 2F4VO 4YY3O 2Z5UA 3E8BA 4RWUA 4DYLA 2ATKC 3E83A 4JI3B 4I9WA 4W4KA 4PELA 2N05A 4DV4B 1N34B 4YXWG 3CCMV 2LW1A 4N23A 4I55A 3ZHTA 5EBLC 1ZUQA 2EIJC 1H2LA 1WP8A 2HR3A 1U97A 2PYJA 3RGBA 3FYEB 2CTRA 4I9QA 4MTXA 3RYIB 1YTFD 4TOIA 3GVMA 4X1IA 1NVPD 3VBBA 4OX9O 1ZL8B 2RJZA 2A7WA 3SYOA 2VWKA 2IJIA 5JVDB 2E76B 1WP7A 1WAZA 3KG2A 5CA0A 4X62B 2ZDIC 5C93A 2QR4A 2VWJA 4MVUA 1RSOB 4JI7B 1FFTB 3NXSA 3J81N 5JCOA 4LH7A 1N33O 5EIBD 1YEWA 1COWG 1I7FA 1JFFB 5IJ9B 3C90A 3EFFK 2PYLA 1TUEB 5JVDA 4K8XA 1GM7A 1PV0A 1M57C 1OZ0A 4JYCA 4EKWA 2UUBB 4X1IB 5EZYB 2P67A 3R66A 2HHHO 5E79Z 5IWAO 3OTOB 1YCIA 3K9SA 1HNXB 3CE2A 4LF8B 4B3RO 2UU9O 4LF7B 2QJ1A 3THOA 3AG1C 2EJRA 1M1KW 4FLZA 4ZIBA 2FB5A 2W0FC 4FLUA 4QIWF 4IHJB 3JATA 5FPOA 3ZHVA 1VF6A 4B7EA 4TQFA 2CK3G 1Y66A 4Z1VA 4JI6B 4UVAA 1JQ0A 4UVCA 3HPLC 3OR7C 3JD3A 5GTIZ 1TAEA 4K3AA 5JJJB 1NJIW 5J2TA 4PA9A 3TETA 1B06A 5C8YB 4QPJA 3AK2A 4DV3O 2WA3A 4F6EA 3RN4A 2L6LA 2VS0A 4P9PA 5CA1A 1TGOA 1MZFA 4YJ3B 4NTWA 3UM7A 4J7ZA 4CH5A 2LJ2A 2JS3A 4YHHO 5LMUB 2ZDIA 1EN4A 4FLWA 3L72H 2WWWA 4BWAA 2DN9A 1WB7A 4IT5A 1XI1A 4GCZA 2OCCB 1K97A 4JTAB 4CC5A 4XDLA 4CS3A 3ML0A 1VQPV 5CA1B 3I5DA 3OFNG 2MW2B 4JI4B 4DRXB 1W0JG 1DLBA 2QWRB 2IU0A 4GLXA 2N74A 3ZMVA 2KB1A 4J42A 4MS2A 1MSDA 1KD1W 2Y4TA 4D7SA 2Y4UA 5LL6Y 2F1MA 3ZRWB 1H2KA 3CXHF 2ZR2A 1L0NH 3OM3B 1H38A 2QDOA 1JOYA 2XTAA 4UFZA 1SESA 4DR7O 3STZC 1M56C 2DWDC 3G71V 4O2AA 5KHJA 1BCCH 2EX3A 1M56B 1BQZA 1SQXH 1TA8A 2HJFC 3TJTA 2AW9A 4WFFA 3J7AU 3HKBA 5C8YA 1VQ9V 2JIZG 4IIJB 1HNZO 1K5SA 1K7DA 4CH3A 2ZM6O 4WFBV 3B40A 4JZGA 1IBKO 2EULA 3CS5A 2QTSA 3CX5F 4H37A 4R7CA 3S3XA 3RVZA 1PPJH 1G4YB 2B1IA 3MAQA 5L3BA 1EFRG 5CB4A 1G1XB 4LWSB 4JTDB 4UUJC 5H5NA 4X8AA 1SS3A 3K08A 2P4KA 2LO1A 3JAKB 3OGIB 5LBQA 1G6UA 5CA0B 1QU7A 3ABTA 4BIUA 4UV9A 2IH1C 3JD0A 4XDKA 3X2QB 3B77A 1JJOA 2GV9A 2IBZH 2QM4A 4TWKA 5IYCO 4JI2B 4RUFA 5LP6C 2Q73A 1ZX3A 1UPGA 2CUGA 2UXDB 1D2DA 4JI1B 1S5LZ 2PZSA 4JGSA 3WB0A 4BW9A 2F43G 4J10A 3OAAG 3HKDB 4DR5O 2CGOA 4LNUB 1E79G 4GKJO 1XL4A 4JI0B 1K4CC 3FAVA 2LP7A 2R9RB 2B1GA 4TQDA 1NQTA 1J95A 4LWSA 4X1KB 1WPXA 4O4HB 2BSKA 4LP8A 1BQ0A 2Q9LA 1Z5WA 2QWQB 5HFLA 4JI4O 1VIBA 3H01A 1HDJA 3O65A 3RW0A 1HWYA 1OCRB 3TCUA 4LF9O 3FKSG 3AG2B 1FJGB 1FXKC 5IY5C 4DV2O 1F4MA 1AI4A 2DWEC 3E22A 3AG4B 1GN4A 2YS8A 2OTLV 2PI4A 2XASA 5J2UB 5KMGA 1KUQA 4I4TA 5KUMA 3ZS8C 4ZOLA 4ZHQA 1WA8A 5JH7B 3EVKA 3JALB 1TUBB 2QSAA 4NXNB 1XNQO 3IC7A 2H3OA 2X7RB 3RYCB 2Q7GA 3E22B 1FPOA 1I94O 1EBOA 3K03A 4U3JA 4DV0B 3K0DA 2GUZB 4WFHA 5JQGA 5DECA 3G6BA 4X88A 4TV9A 1QQCA 4QE7A 5JCOC 1XMQB 3SPIA 2W0XA 1Z5VA 2GTSA 3K9AA 3ZN0A 4DR4O 1KBHA 3SJAC 2Q0AA 2HFEC 2WLIA 1EZVH 3C3TA 3OTFA 3UKMA 2BSKB 3OEHG 1TVKA 1RFYA 5BXZA 4OX9B 2AHZA 1SC5B 1PNMA 4RAIA 2Q4PA 2UXNA 3SR2C 2D2CB 3L73H 2JDIG 2HJDA 1SQFA 4F6RA 3SYAA 2UUCB 1XQ8A 3CCRV 1IBLB 3CRMA 4YHHB 2JEXA 4B7KA 1FAFA 4H33A 4PI0A 1I5XA 5LHGA 2MK3A 3CCEV 1SQGA 3T4ZA 4TUYB 4B3MO 2P22C 4IL6Z 4FLTA 1DK1A 2EIKC 2XAJA 4B3TO 3RYFA 3M99B 2BE3A 2HG5C 2OTJV 3B8NA 1F7YA 4GZRB 1FXKA 4FVMA 4FM2A 3BVOA 2ZXWC 1LR1A 5KA6A 2DQ3A 1FYJA 1S5HC 1HR0B 2LQTA 4NTXA 1H2GA 3K59A 3I55V 1VARA 2P06A 4PDLA 3SPJA 2ZE8A 4I0XA 4BAYA 1FD9A 3ETDA 2DMXA 4N21A 5EBMC 4WBNA 2VQEB 1R6NA 2ZE5A 4JI8O 5KHIA 5BY1A 5EIBC 1HNXO 1IBMO 4JV5B 3B09A 4R6ZA 2BTQB 5B1NA 3JAWA 2PY5A 1DF5A 5IYDO 4WCEV 1VP7A 2A9HA 1AVMA 3ZX6A 2Q5ZA 2GSMB 3HKDA 2YUAA 1D5AA 4FM0A 3W7WA 2AZ2A 2BCCH 1AB3A 2YIBD 4EEQA 4ZKIA 5CBGA 3UQ8A 2PUSA 2JJ1G 3JATB 3DXRA 4FJCC 2EILB 4UCTA 1FXHA 3E8FA 3JAMN 1YJWV 2KG7A 2K1EA 2Y0IA 3HKEA 3ZMUA 3ASNB 2NLJC 4LF6B 2H94A 3CRRA 3LNNA 4DV4O 1N34O 4NYKA 2RN9A 2PGGA 1OCCC 1SQQH 1ORQC 3L70H 3A0BZ 2NN4A 4X64B 3BY6A 5H6QA 1PM9A 4XDJA 3E2EA 3JD1A 5LMNB 2IH3C 4RUEA 3SJCC 4MTOA 2UXDO 1NVPB 2R72A 3ABLC 2RCVA 3LNMB 5EC2C 2BTOA 1Q81W 1VQKV 1D5NA 4MW3A 1ZAUA 2JGDA 5LYJB 3QVNA 4PA6A 2JK5C 4DR5B 2GBOA 5KAIZ 3PN1A 2QE7G 1VQNV 3FYIB 3UT5A 4UCOA 1R73A 3SYCA 3LSSA 1K73W 3K06A 1RPOA 4DR7B 1IVSA 1MG1A 2JGDB 3SJQC 3D8CA 3ZRSA 4LF4O 3L75H 3TXSA 1YHQV 2XOKG 2OIEA 3H9VA 4JI7O 4DV5O 4KHPB 1JMKC 4F6RB 2IM9A 5H2FZ 2UUBO 1M57B 4H13B 1KU9A 3LSUA 4FIPC 2UUAB 5CN0A 1IURA 2AGAA 1OHHG 5IWAB 1AJNA 3FB8C 3U0ZA 1FFXB 3F5TA 3TGUH 4U7OA 3G80A 2FMLA 4I50B 2P5OA 1ZWIC 1GMGA 3BA8A 3W7TA 3DSQA 3T1HO 1UJWB 3SPHA 5LA6A 4CBCA 2EJ7A 4B3RB 4TSFG 4DV1O 1FKAO 1RPRA 2OCHA 1N32O 3GWKC 4EB6B 3IC9A 1S3JA 5EZYA 4DR2O 1DTOA 4GKJB 1CP9A 5JH7A 1R6KA 4FFKA 1GM8A 2ZE7A 1ZL8A 2WSSG 3ABMC 4LFAO 4I0XB 1AJPA 3KZIZ 2YC0A 1YITV 5LYJA 2W6JG 3SYPA 2O57A 1VF6C 3WB2A 3JD2A 3RYCA 4BIOA 3BEHA 3ZMTA 2N04A 1NTMH 2EZPA 5KUKA 5KLVH 4G27B 4X1YA 2VQFO 4J9YB 4PV1B 3LUTB 3CC4V 5B5EZ 1OCCB 3B8MA 4KHPO 1NR1A 1GN6A 4O4JB 4B08A 2A3QA 1XHZA 2XT9A 4QNHB 1H2NA 4QE9A 1VQ6V 3N27A 2WLLB 2EIJB 4D7TA 4AQYO 1QBZA 4LC1A 5LP6A 1P7GA 4BIZA 5IJ9A 3AG1B 2ZIMA 4DV2B 4DUZB 4AHCA 2F66C 1HP8A 3JSLA 1WNSA 4X1KA 2EBOA 3F7YC 4JTCB 2V1DA 1V55B 2BOCC 1THZA 3WG7B 4ICGA 4J41A 1XREA 4F4LA 2QKSA 5ITZB 4ZOLB 1P7BA 5CBHA 1XUQA 3HR0A 2E3CA 5D5QA 5K1PA 3OMAB 2XAQA 1XMQO 3MD0A 4OXSA 3ZHQA 3BFRA 1SKVA 3K3WA 5IYZB 2WLIB 2FKXA 5L3FA 4B3SB 1Y6XA 1ZLZA 1NZ6A 2AZ0A 1XEQA 3R65A 3KCYA 4G2KA 2WLHA 4FFBB 2L35A 5KMGB 2XHBA 1JVMA 3FAVB 3PJSK 4AI8A 2KQXA 2F4VB 4P9OA 1XMOO 4UVBA 4DR2B 1VQMV 3BAAA 4X64O 3OUSA 4H44B 4O4HA 4RO2A 4MTGA 4B3TB 5LGNA 4DR3O 3AG7A 5B1BB 4X9QA 2AXTZ 4Z2WA 1IDSA 1P4RA 2CDYA 3O9OA 2EIMC 1T5EA 3G6EV 4UV8A 1IZ3A 2ADPA 1TUBA 3E8GA 4QGPA 3VOUA 3OEEG 3CCQV 3RYHB 4JZ2A 3T1YO 3L74H 5EBWC 4MVMA 3ABMB 4KFMA 1B3QA 4FFBA 4LF5B 4LFBB 4RQEA 2PI5A 3L71H 3ZRWA 1SQVH 3KCXA 2D3OW 5BMVB 4R8CA 4B3MB 2HKOA 3AG2C 3ZN1A 3CD6V 4O4LA 1SERA 4K0KO 1QVFU 4TV9B 2FYUH 2CE4A 2X6AA 5KX5A 1XL6A 1VQOV 1VEWA 2DJVA 3VQWA 3ZJZA 1B04A 4QPKA 4RQFA 1MNGA 1SZTA 5B1AB 3SGIA 2YI8A 2YIBA 3DXRB 1ROPA 5IE9A 3WU2Z 3OMIB 1VQ5V 2HVJC 1J5EO 1YF2A 4PDMA 3GWOA 2GTAA 2IJKA 4NB5A 3E89A 1AI5A 4YIOA 5FL7G 4DR1B 1H8HG 4Q20A 4JF3A 2BTQA 2WLNA 3JALA 3ABLB 4ZHQB 1QVGU 4ZI7A 3TXQA 5CBFA 3DTUB 3APQA 4DV3B 4MVZA 3QTCA 4R50A 3VQXA 1AP5A 2QKCA 1VQ7V 1M90W 2A06H 4LFAB 4KP4A 3T1YB 1Q7YW 1Q6IA 3CYOA 2QA4V 4NKGB 3ICXA 2YI9A 5BMVA 3A8TA 1Y67A 5A9GA 3BA9A 2RDCA 5DEDA 1S77D 2WLLA 3JARA 4JASA 1Y74A 2YXHA 3E8HA 2QWNB 1VMGA 2Q6AA 3CRAA 4JI3O 2Y69B 3P30A 1JCHA 2ODMA 2RMKB 3OUFA 2K9PA 5LMNO 5KHKA 4TUYA 4NR1A 4PA3A 4DRXA 4L87A 4FZ0A 5IJ0B 1KQSU 5H9CA 1NI8A 3A0HZ 2XAGA 1M4UA 1BL8A 2WLKA 4GX1A 3BPZA 5JJNB 3QO7A 3MDSA 1JX9A 1YI2V 1NH2D 4JYYA 1RSOA 1PL4A 4LFCO 2YXLA 3OT7A 3CCVV 4GX0A 1KKCA 1PKXA 3OW2U 3I56V 5H6RA 1OCOB 3C3SA 5GTHZ 4ZI7B 1XNRO 1RP3B 2QM8A 1KP2A 1F23A 1JJ2U 3SDLA 2ZM6B 3G4SV 2ZT9B 4NXMB 5J2TB 1PL0A 2ZNJA 4PD4F 1I5YA 1GK9A 3G67A 1QR8A 3ZRVA 4NTYA 3WB1A 1HNZB 5B3SB 4BW5A 4DV7O 5JQGB 3ASNC 2EILC 4U3JB 4DO2A 4GX5A 5IJ0A 1I94B 3JD4A 4FM1A 2IJJA 4CH6A 5IT9N 3UT5B 4KL1A 2QWPB 3N2KA 1L0LH 1EN6A 3GB7C 4IGGA 3N2GA 3B4SA 4JI1O 4DR1O 3FFQA 2NNUA 5KAFZ 1BGYH 1AROP 4EB6A 1URFA 4AILC 2ITCC 5FLXN 5IYBO 1BSMA 3FB6C 5LOVA 3ZEDA 1V9PA 1GN3A 1M93A 2F95B 1BS3A 1MABG 1K34A 5JJEB 3ZHUA 1UFIA 5BR8O 5B1OA 4CS4A 2UUCO 4HYOA 2NR5A 2HVKC 3JAWB 2DYRB 5BZBA 2P6JA 5GW7A 3RYHA 4O4JA 3S3WA 4MTFA 1SETA 2VQEO 3N2KB 1WLEA 3P3NA
chains in the Genus database with same CATH topology
3JYCA 1RPRA 3AG4C 3ZRWB 2ZR2A 1S3JA 2Q68A 1DTOA 4MT8A 1KKDA 3OM3B 4WFEA 1CP9A 4HZ3A 2Z3YA 2Y48A 3CC7V 1H38A 1R6KA 1JOYA 1OCRC 1GM8A 1SESA 3STZC 1M56C 2DWDC 3G71V 4PA4A 2WSSG 3ABMC 5LGUA 1AI7A 1M56B 2DW4A 2DYSB 1AJPA 1YITV 1S72V 2HJFC 4WF9V 2W6JG 3SYPA 1B6QA 4WFFA 3A0RA 3JD2A 2V7QG 1VQ9V 1OCZB 1QLEC 2JIZG 1ENVA 2DYRC 3BEHA 3ZMTA 1NKDA 5L3EA 2P90A 1OCZC 1QLEB 4G28B 1K5SA 1K7DA 3RVYA 2EZPA 1K4DC 5KUKA 3LSQA 4G27B 4WFBV 1YJ9V 4J9YB 3LUTB 1AJQA 3CC4V 1OCCB 3AEIA 4H37A 4R7CA 3WFVA 3B8MA 3RVZA 1K8AW 1G4YB 2ZQMA 2B1IA 1NR1A 1Y4MA 5L3BA 1EFRG 4QNHB 4QE9A 2A0LA 1VQ6V 2WLLB 2ZD9A 1GM9A 2EIJB 4JTDB 4UUJC 5LHIA 4X8AA 1QBZA 4LC1A 3D3IA 1MOFA 4BIZA 3AG1B 3K08A 1FXVA 5LBQA 3QO5A 4J9ZB 2X0LA 3ABTA 4P2ZA 2EBOA 3F7YC 4BIUA 4UV9A 4JTCB 1KP3A 2IH1C 2V1DA 1V54C 5DM6V 3JD0A 1V55B 4XDKA 2BOCC 3X2QB 1THZA 3B77A 3WG7B 3K04A 1YSCA 2IU3A 4F4LA 2QKSA 1K92A 1QLNA 5B3SC 4TWKA 3ZIAG 5IYCO 3CCJV 5IY5B 1P7BA 5CBHA 4RUFA 1E1QG 3OMNB 1R3KC 2EZOA 2M7WA 2XNDG 3ABKC 4JGSA 3OMAB 1PNKA 2F43G 2XAQA 3ABKB 3SPCA 3MD0A 4OXSA 1FXKB 3OAAG 3K0GA 1VQLV 1E79G 5L3CA 2YSUB 1F4NA 1XL4A 3K3WA 4GX2A 2X6CA 1K4CC 2WLIB 1R3LC 5L3FA 3TK1A 2LP7A 2R9RB 1VQ8V 2B1GA 1GO3F 3ETGA 1NQTA 1J95A 4LCUC 3R65A 5IDJA 1WPXA 4G2KA 4XBFA 1F51A 2WLHA 2P7TC 4LP8A 5HFLA 3CMAV 1JVMA 1V54B 4TT3G 5L3GA 2GHYA 3H01A 4JPRA 3CCUV 3PJSK 2OT5A 1YTFB 1OCOC 1KD1W 1QCEA 3RW0A 1NBMG 1S76D 3ASOC 1HWYA 1OCRB 4MW8A 3TCUA 2Q69A 4P9OA 3ASOB 3FKSG 3AG2B 4UVBA 1FXKC 5IY5C 5J9PC 3CMEV 1EZJA 3F7VC 1F4MA 3ETEA 1VQMV 1AI4A 2A79B 2DWEC 2JJ2G 1S0VA 3AG4B 4MVQA 1K33A 3LDEA 2OTLV 2PI4A 3OUSA 3CCSV 2XASA 4I5SA 1QR9A 3WG7C 5KUMA 1K9MW 4RO2A 3RBZA 4MTGA 2R9IA 2B5UA 5EK0A 5LGNA 5B1BB 1PNLA 1P4RA 1BHAA 3IC7A 3OGCC 2EIMC 2X7RB 3G6EV 1EBOA 3HB3B 3K03A 4UV8A 3K0DA 4Z1MG 4WFHA 3IGAC 2LFRA 3E8GA 3MHSC 3SPGA 4X88A 4UXNA 3OEEG 3VOUA 3LDDA 4FPPA 2FTKA 4QE7A 3CCQV 3SPIA 5CA3A 2AHYA 3ZN0A 1FS0G 3K9AA 5EBWC 1E1RG 3JCZA 1AI6A 3AG3C 1PD3A 2HFEC 2WLIA 1RM1C 3K79A 4MVMA 3ABMB 2BOBC 1SRYA 4KFMA 3UKMA 1N8RW 3OEHG 3DGEA 4RQEA 5L3DA 2PI5A 4MVOA 5EC1C 2AHZA 1PNMA 4RAIA 1M9NA 3ZRWA 3W7UA 2D3OW 4JAUA 2UXNA 4R8CA 1RM1B 2HKOA 3AG2C 2EINB 3OE7G 3ZN1A 3CD6V 2IW5A 3STLC 2JDIG 2EIMB 1SERA 4GT1A 1QVFU 3E35A 2ZXWB 2QTOA 3E86A 3SYAA 1LNQA 2X6AA 1K5QA 5B1BC 1DF4A 3CCRV 3ZMZA 1XL6A 1VQOV 3ABUA 3W7SA 4WFGA 3IFXA 3FB5C 1K3EA 2EINC 2JEXA 1CPYA 3ZJZA 1L1FA 4PA7A 4H33A 2UXXA 4KUMA 2LFSA 1I5XA 4QPKA 5LHGA 4RQFA 2MK3A 2WPDG 3SYQA 3CXCU 3CCEV 1IXMA 1SZTA 5B1AB 4DXWA 3T4ZA 3CCLV 1BHBA 5DN6G 2EIKC 1AR1B 2XAJA 1MSWD 1ROPA 2WLJA 3M99B 4HAMA 1CEZA 1R3JC 3OMIB 2HG5C 4WFAV 1VQ5V 2OTJV 3B8NA 3CP1A 2HVJC 1FXKA 4PDMA 3GWOA 2ZXWC 2IJKA 1W2BU 2C2AA 2X6BA 3E89A 4PDVA 1AI5A 5KA6A 2DQ3A 5FL7G 1Q82W 1KC8W 3W7XA 1H8HG 4Q20A 4JF3A 1S5HC 3F5WC 1YIJV 2Z5UA 1H2GA 3E8BA 2WLNA 3ABLB 3I55V 2HLDG 2ATKC 3E83A 4PDLA 3SPJA 3ZRXA 5HFMA 1QVGU 4LBEC 4BAYA 4I9WA 5CBFA 3DTUB 4PELA 3ETDA 2Q67A 4MVZA 4N21A 2OCCC 5EBMC 5CMUA 4YXWG 3CCMV 4MVSA 4R50A 3T1CA 1R6NA 4N23A 4ASUG 5EBLC 1M90W 1VQ7V 2EIJC 1W0KG 4KP4A 1Q7YW 2ZR3A 4FMTA 3CYOA 2XAHA 4MSWC 4ZBMA 2QA4V 2WLMA 3LDCA 4R6ZA 5B1NA 2HR3A 1DF5A 5IYDO 4WCEV 5LHHA 4JAVA 2A9HA 2WLLA 1S77D 3FYEB 3AG3B 4JASA 4JYBA 3E8HA 4MTXA 2GSMB 1YTFD 3W7WA 2Q6AA 1NVPD 2Y69B 2YEVB 3VBBA 2IJHA 2DYSC 1VQ4V 3SYOA 4ZKIA 2IJIA 5CBGA 3EHBB 1YJNV 1V55C 2JJ1G 3P30A 3T2MA 3KG2A 1JCHA 3OUFA 4FJCC 2ZDIC 2EILB 1FXHA 5C93A 4PA3A 4MVUA 3E8FA 4L87A 1KQSU 5H9CA 1YJWV 2ITDC 1FFTB 2K1EA 1BL8A 2XAGA 3NXSA 3ZMUA 1GKFA 3ASNB 1NH2B 2NLJC 4CZZA 3QO8A 2WLKA 4GX1A 2H94A 3QO7A 2DQ0A 1JX9A 2W6IG 1YI2V 1KECA 1NH2D 1OCCC 1ORQC 2H8PC 3CCVV 4X89A 4GX0A 1COWG 3ZCCA 5E1AC 1PKXA 4MVRA 3BY6A 3EFFK 3I56V 3OW2U 1TUEB 1GTOA 5H6RA 5H6QA 4XDJA 3E2EA 3JD1A 1GM7A 1OCOB 1M57C 2IH3C 4RUEA 1OZ0A 4JYCA 4EKWA 2P67A 4MTOA 3OR6C 2QM8A 1KP2A 1F23A 1NVPB 1JJ2U 2Y69C 3ABLC 3LNMB 5EC2C 4E2LA 3G4SV 1Q81W 1VQKV 1PL0A 4MW3A 2QEXV 1NR7A 2EIKB 1I5YA 1GK9A 3AG1C 1QR8A 2EJRA 3ZRVA 1M1KW 5B3SB 1Q86W 4PA6A 2W0FC 4BW5A 4QIWF 2JK5C 5LGTA 3D36A 3ASNC 2EILC 2QE7G 4DO2A 4GX5A 1VQNV 4QJFB 3FYIB 2CK3G 3X2QC 1R73A 1Y66A 2JEUA 5B1AC 4UVAA 3MHHC 3SYCA 3LSSA 1JPXA 1JQ0A 4UVCA 1G8MA 3HPLC 3OR7C 1K73W 3JD4A 3JD3A 3K06A 1RPOA 2IJJA 1MG1A 2XAFA 3QNEA 3SJQC 3ZRSA 1NJIW 4PA9A 3TETA 4QPJA 1YHQV 3GB7C 2XOKG 5KA5A 1H8EG 2NNUA 1AROP 4P9PA 1M57B 2ITCC 3UM7A 5IYBO 4FIPC 5CN0A 3FB6C 1R3IC 1OHHG 1AJNA 2WAMA 2ZDIA 3FB8C 4FK5C 1MABG 3CPWU 2WWWA 3FB7C 4U7OA 1K34A 4GCZA 1ZWIC 2OCCB 1K97A 4JTAB 5B1OA 1BMFG 4XDLA 4HYOA 3CC2V 3ML0A 2HVKC 1GMGA 2DYRB 2YEVA 3P32A 1VQPV 5BZBA 3W7TA 2P6JA 5GW7A 3OFNG 4U7NA 1UJWB 4P30A 1W0JG 1DLBA 2IU0A 3SPHA 3ZMSA 2QM7A 3ZMVA 4CBCA 4MTFA 1SETA 2KB1A 3T4DA 4TSFG 1WLEA 4MS2A 4PDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIN C;  4GX0 A;  3ZJZ A;  3JYC A;  5E1A C;  4PA7 A;  4H33 A;  3AG4 C;  4MVR A;  1XL4 A;  3EFF K;  3SYQ A;  2Q68 A;  4GX2 A;  2X6C A;  1K4C C;  4XDJ A;  1KKD A;  4WFE A;  2WLI B;  1R3L C;  4HZ3 A;  3T4Z A;  4DXW A;  1M57 C;  2IH3 C;  4RUE A;  2R9R B;  1OCR C;  1J95 A;  2EIK C;  3R65 A;  4LCU C;  4EKW A;  3STZ C;  2WLJ A;  1M56 C;  2DWD C;  2WLH A;  2P7T C;  4MTO A;  3OR6 C;  3ABM C;  4LP8 A;  4PA4 A;  1R3J C;  2HG5 C;  1JVM A;  2Y69 C;  3ABL C;  2HVJ C;  3PJS K;  3LNM B;  2HJF C;  3SYP A;  1OCO C;  5EC2 C;  4PDM A;  3RW0 A;  4WFF A;  2ZXW C;  4MW3 A;  3ASO C;  4MW8 A;  2X6B A;  2Q69 A;  3E89 A;  4P9O A;  4PDV A;  3TCU A;  3AG1 C;  1QLE C;  3BEH A;  2DYR C;  4PA6 A;  2W0F C;  1S5H C;  3F5W C;  4BW5 A;  5IY5 C;  5J9P C;  3F7V C;  4G28 B;  1OCZ C;  2JK5 C;  2WLN A;  3E8B A;  2A79 B;  2DWE C;  3ASN C;  3RVY A;  1K4D C;  2ATK C;  2EIL C;  5KUK A;  3E83 A;  4MVQ A;  4PDL A;  4GX5 A;  3SPJ A;  3LDE A;  4LBE C;  3OUS A;  4G27 B;  4J9Y B;  4I9W A;  5CBF A;  3X2Q C;  3WG7 C;  3LUT B;  5B1A C;  5KUM A;  3SYC A;  2Q67 A;  3HPL C;  3OR7 C;  4MVZ A;  2OCC C;  4RO2 A;  5EBM C;  4H37 A;  3RBZ A;  3K06 A;  4MTG A;  4R7C A;  5EK0 A;  4MVS A;  4R50 A;  3RVZ A;  1G4Y B;  3SJQ C;  3T1C A;  3ZRS A;  3FB5 C;  5EBL C;  4PA9 A;  3TET A;  3OGC C;  2EIJ C;  2EIM C;  4QNH B;  4QE9 A;  3GB7 C;  2A0L A;  3K03 A;  4MSW C;  2WLL B;  2ZD9 A;  3K0D A;  2WLM A;  4ZBM A;  3LDC A;  4JTD B;  4R6Z A;  3IGA C;  4UUJ C;  4WFH A;  4X89 A;  4X8A A;  3E8G A;  3SPG A;  4X88 A;  3VOU A;  4PDR A;  3LDD A;  4P9P A;  4QE7 A;  2A9H A;  2WLL A;  3SPI A;  2ITC C;  2AHY A;  3K08 A;  5EBW C;  3UM7 A;  3E8H A;  3AG3 C;  1R3I C;  3FB6 C;  2HFE C;  2WLI A;  4J9Z B;  4MVM A;  4P2Z A;  2BOB C;  3F7Y C;  2Q6A A;  3FB8 C;  4JTC B;  4KFM A;  2IH1 C;  1V54 C;  3UKM A;  2DYS C;  4XDK A;  3SYO A;  2BOC C;  3FB7 C;  5CBG A;  4MVO A;  5EC1 C;  3K04 A;  2AHZ A;  1V55 C;  4RAI A;  1ZWI C;  3T2M A;  4JTA B;  3KG2 A;  3OUF A;  4XDL A;  4HYO A;  4R8C A;  4F4L A;  4PA3 A;  4MVU A;  2QKS A;  3AG2 C;  2HVK C;  2YEV A;  3E8F A;  4TWK A;  5B3S C;  5BZB A;  3STL C;  2ITD C;  1P7B A;  5CBH A;  2K1E A;  1BL8 A;  4RUF A;  2NLJ C;  1R3K C;  2WLK A;  2QTO A;  3ABK C;  4GX1 A;  4P30 A;  3E86 A;  3SPH A;  1LNQ A;  2X6A A;  3SYA A;  4CBC A;  5B1B C;  4MTF A;  3SPC A;  1XL6 A;  2KB1 A;  3T4D A;  4OXS A;  4WFG A;  1OCC C;  3IFX A;  4MS2 A;  1ORQ C;  2H8P C;  3K0G A; 
#chains in the Genus database with same CATH topology
 3H1L H;  1VF7 A;  4DK0 A;  4JI5 B;  1NT2 B;  1KKD A;  1R6T A;  2E74 B;  5LOV B;  4J7K A;  1OCR C;  1IX9 A;  1BZK A;  2FL4 A;  4PA4 A;  5LGU A;  3IAY A;  1AI7 A;  2DW4 A;  1AP6 A;  1S72 V;  4WF9 V;  2XUM A;  3OTO O;  1GAX A;  1N36 B;  4JYA O;  3A0R A;  2V7Q G;  1OCZ B;  1QLE C;  1ENV A;  1NKD A;  1OCZ C;  1QLE B;  1XNQ B;  1Q43 A;  1SQB H;  1US6 A;  4DV0 O;  3K5N A;  3L9D A;  3CEI A;  2ZQM A;  5IYZ A;  1Y4M A;  1Q3E A;  1NTZ H;  2A0L A;  1GM9 A;  3RWR D;  3UCS C;  5LHI A;  3H1J H;  4X65 B;  2ZKO A;  1XMO B;  1MOF A;  4IYH A;  1ZTE A;  4J9Z B;  2X0L A;  4P2Z A;  3B2E E;  1KP3 A;  4I4T B;  1V54 C;  1WJZ A;  1QHT A;  1A32 A;  2QKA A;  2YIC A;  4O2A B;  2HEP A;  4UB6 Z;  1JFF A;  4CH4 A;  2JVD A;  4FLX A;  2UXB O;  1K92 A;  1X59 A;  5B3S C;  3CCJ V;  5FNV B;  3K58 A;  3OMN B;  2M7W A;  1YZB A;  1PNK A;  4J7J A;  4JAA A;  3K5O A;  1FXK B;  2JS5 A;  3K0G A;  1SQP H;  2YXY A;  4LH6 A;  5L3C A;  4DV6 B;  3J80 N;  1SZX A;  2X6C A;  4GX2 A;  4DW0 A;  3CHX A;  4GUN A;  1R3L C;  4O4I A;  3TK1 A;  3ETG A;  1KYO F;  1I0H A;  4CS2 A;  5IDJ A;  4X1Y B;  1MZE A;  1AR4 A;  1F51 A;  2P7T C;  2UUA O;  4DUZ O;  4O4L B;  3DC5 A;  2F93 B;  5L3G A;  4JPR A;  4E4E A;  2OYQ A;  1AR5 A;  1GRJ A;  1QCE A;  1NBM G;  1S76 D;  3ASO C;  3M8A A;  2Q69 A;  3ASO B;  4AQY B;  5J9P C;  3CME V;  2JJ2 G;  2ZE6 A;  1S0V A;  4MVQ A;  3CB2 A;  3CCS V;  4I5S A;  4LR3 A;  1QR9 A;  4GKK B;  3WG7 C;  4I7Z B;  1IBK B;  2RQ6 A;  2B5U A;  5EK0 A;  1Q6H A;  1BHA A;  1WN7 A;  5GON A;  4Z1M G;  3IGA C;  1R1B A;  3SPG A;  3MHS C;  3APO A;  4YY3 B;  1HW7 A;  1SA0 B;  4A5U B;  1OV9 A;  2FTK A;  3EXA A;  3RT3 C;  5CA3 A;  2HP8 A;  4OPA A;  5D5P A;  1YXB A;  1FS0 G;  1E1R G;  3JCZ A;  4H0L B;  1AI6 A;  4DV7 B;  1RM1 C;  1SF9 A;  3K79 A;  5AG2 A;  2JRI A;  2BOB C;  1SRY A;  2Z0A A;  3DGE A;  4MVO A;  5EC1 C;  2CTW A;  1PP9 H;  3W7U A;  1IXB A;  1RM1 B;  5B66 Z;  2EIN B;  2IW5 A;  3STL C;  4GT1 A;  4JI2 O;  3E35 A;  4NVP A;  2ZXW B;  2QTO A;  1LNQ A;  1BT8 A;  1K5Q A;  3KKY A;  5B1B C;  3ZMZ A;  3FD9 A;  3M7M X;  3ABU A;  4UCV A;  4WFG A;  3FB5 C;  2EIN C;  1CPY A;  4PA7 A;  2UXX A;  4YJ3 A;  4KUM A;  1XBL A;  1SA0 A;  2WPD G;  3SYQ A;  2E5L B;  1IXM A;  3CCL V;  1MSW D;  2RNB A;  5EYP A;  4HAM A;  4WFA V;  2KKW A;  3CRC A;  1KMI Z;  4TV8 B;  4BR6 A;  3JAK A;  4HBN A;  1Y74 B;  2Q7H A;  4DV5 B;  3RYF B;  1W2B U;  2C2A A;  2X6B A;  4PDV A;  2VQF B;  1KC8 W;  2UXC B;  1YDX A;  3P3P A;  3F5W C;  1U96 A;  1YIJ V;  2HLD G;  3BAB A;  4EFE A;  3ZRX A;  5HFM A;  4LBE C;  2Q67 A;  2OCC C;  5CMU A;  4MVS A;  2ILM A;  3T1C A;  2YDE A;  4ASU G;  1X4T A;  3CRQ A;  3ZHR A;  1W0K G;  3HKC A;  2LGQ A;  2ZR3 A;  4FMT A;  3T1H B;  4ZBM A;  2XAH A;  4MSW C;  1O9H A;  5A2Q N;  2WLM A;  3LDC A;  4W4L A;  3IJ4 A;  5LHH A;  4JAV A;  3AG3 B;  5ITZ A;  4JYB A;  1HR0 O;  4DUY B;  3JAS A;  4LF8 O;  1N32 B;  2YEV B;  2IJH A;  2DYS C;  1VQ4 V;  1BE3 H;  3EHB B;  1YJN V;  1V55 C;  5FNV A;  4FLY A;  3T2M A;  1N0J A;  3D3Q A;  2PTM A;  3H1I H;  2ITD C;  1NH2 B;  4X65 O;  1GKF A;  4CZZ A;  3QO8 A;  2DQ0 A;  2W6I G;  3HKE B;  1KEC A;  2H8P C;  4X89 A;  3QF7 A;  3ZCC A;  5E1A C;  4IYI A;  4MVR A;  1CXZ B;  1P49 A;  2CH7 A;  1GTO A;  5LXT A;  4WBN B;  4X62 O;  2UXB B;  4ABM A;  5LA6 B;  3JAS B;  1YVW A;  2GDS A;  4J80 A;  3OR6 C;  2ETN A;  1N0N A;  4GYC B;  2Y69 C;  1N33 B;  4E2L A;  2CH7 B;  4YJ2 A;  2QEX V;  1NR7 A;  2EIK B;  3HKC B;  2Q8V A;  1XDC A;  1Q86 W;  3N2G B;  2E5L O;  5LGT A;  3D36 A;  3CSX A;  1Q5O A;  4QJF B;  4JI5 O;  3X2Q C;  2JEU A;  5B1A C;  3MHH C;  1JPX A;  1G8M A;  5F2V O;  1Q8I A;  3QNE A;  2XAF A;  3ZHS A;  4HNA B;  3JAR B;  5KA5 A;  4IHJ A;  5FPR A;  1H8E G;  2CTP A;  2DE0 X;  4NXN O;  1MA1 A;  3DC6 A;  2KSD A;  3D36 C;  1GN2 A;  4J11 A;  1HNW O;  2Q0O C;  3JSN A;  2Q7E A;  4DW1 A;  1R3I C;  3K5M A;  2QGN A;  1J5E B;  2WAM A;  3CJH B;  4FK5 C;  4I50 A;  2Y0P A;  3CPW U;  2CTQ A;  4GKK O;  2LW7 A;  3FB7 C;  1Y76 B;  4DR6 B;  4KXR A;  1BMF G;  4YJ2 B;  2F23 A;  1VF5 B;  4X66 B;  3CC2 V;  2YEV A;  3P32 A;  4U7N A;  4P30 A;  3ZMS A;  2QM7 A;  3JCU Z;  2OIG A;  2GUZ A;  3T4D A;  4JYA B;  3K5L A;  5KHH A;  4PDR A;  3JYC A;  3AG4 C;  1Y76 A;  3FX7 A;  1JR9 A;  1Z2G A;  4B3S O;  2Q68 A;  4MT8 A;  4WFE A;  4OPH A;  4HZ3 A;  2Z3Y A;  2R70 A;  2Y48 A;  5KHG A;  3CJH A;  3CC7 V;  4C7U A;  4K8Z A;  1WB8 A;  2HHH B;  4FLV A;  2DOS A;  2DYS B;  2P4V A;  4UCR A;  1LUV A;  1B6Q A;  4X20 B;  2OWO A;  5GON B;  1AIL A;  1QNM A;  2DYR C;  5L3E A;  2P90 A;  4G28 B;  4JI0 O;  4O2B A;  3UO3 A;  3RVY A;  1K4D C;  4DV6 O;  3LSQ A;  1YJ9 V;  1M5I A;  5EYP B;  1Q6U A;  1AJQ A;  4UCS A;  3AEI A;  3WFV A;  3A2F A;  1IBL O;  1K8A W;  1XHX A;  3VQY A;  5KX5 B;  1OJH A;  1HNW B;  1ZSP A;  3VQV A;  1EN5 A;  2ZD9 A;  4LF9 B;  4K35 A;  3D3I A;  1N4C A;  1NTK H;  2KG7 B;  4X20 A;  1FXV A;  3QO5 A;  4LF5 O;  4LFB O;  3QG5 A;  5DM6 V;  1NS1 A;  1N36 O;  1EM1 A;  4K0K B;  3K04 A;  5JWP A;  3RFR A;  1W59 A;  1YSC A;  2IU3 A;  1QLN A;  3Q4H A;  3ZIA G;  2ZCE A;  1H2M A;  5IY5 B;  5K1X A;  4D6T H;  2B9Z A;  2YID A;  1E1Q G;  1R3K C;  2EZO A;  1DGS A;  2XND G;  3BHP A;  3ABK C;  1GH6 A;  3SPC A;  3ABK B;  3H1H H;  1Q90 D;  3BRC A;  3RYI A;  2UU9 B;  4LF7 O;  1VQL V;  4JI8 B;  2ZIN A;  1TVK B;  1XOU A;  1MMM A;  4DV1 B;  4LF6 O;  4OGQ B;  4DK1 A;  2YSU B;  1F4N A;  1XNR B;  3AK1 A;  1IBM B;  4JV5 O;  3ZBH A;  4JI6 O;  2G38 A;  1L8D A;  1VQ8 V;  1S5J A;  1XIL A;  1GO3 F;  4LCU C;  4DR3 B;  2VRZ A;  2CAZ C;  4XBF A;  2LGW A;  4I55 B;  3CMA V;  1V54 B;  3H1K H;  3UO2 A;  4TT3 G;  2GHY A;  4O4I B;  3CCU V;  2OT5 A;  4PJ0 Z;  1YTF B;  1OCO C;  1O9G A;  4MW8 A;  4U3F H;  2M6Y A;  5CB4 B;  5BR8 B;  1EZJ A;  3F7V C;  2PF4 E;  3ETQ A;  3ETE A;  2A79 B;  2ZNI A;  3NR7 A;  1K33 A;  3LDE A;  2QWO B;  4YIP A;  4HNA A;  1K9M W;  5LMU O;  3RBZ A;  2R9I A;  1PNL A;  1WPB A;  3OGC C;  3AK3 A;  3HB3 B;  4UCU A;  1P84 F;  2ARH A;  2LFR A;  4TV8 A;  4LF4 B;  4UXN A;  3LDD A;  4FPP A;  1LUW A;  4L8J A;  2UXC O;  4EFB A;  2AHY A;  3AG3 C;  1PD3 A;  1H2S B;  1I08 A;  2E75 B;  4DUY O;  4UB8 Z;  1N8R W;  2CGN A;  4LNU A;  1KB9 F;  5L3D A;  4PHZ A;  1M9N A;  3SJB C;  4JAU A;  4PI2 A;  2WA4 A;  2ADQ B;  5LP6 B;  3U11 A;  3OE7 G;  4LFC B;  5LXT B;  2EIM B;  4NXM O;  3E86 A;  3K57 A;  4DR4 B;  1FFX A;  1DF4 A;  2R9A A;  3W7S A;  2JGU A;  3IFX A;  1K3E A;  1L1F A;  3HKB B;  2LFS A;  3Q4H B;  3CXC U;  4DR6 O;  5TIS Z;  2ZIO A;  1WA8 B;  4DXW A;  1BHB A;  3U10 A;  4O2B B;  4Q6G A;  5DN6 G;  5J2U A;  3OD4 A;  3BCC H;  4FZ1 A;  1AR1 B;  2WLJ A;  1NU1 H;  1CEZ A;  4X66 O;  1R3J C;  4CC6 A;  3CP1 A;  3CWB H;  1JA8 A;  4IIJ A;  1FJG O;  2V4D A;  2YIA A;  1Q82 W;  3W7X A;  2F4V O;  4YY3 O;  2Z5U A;  3E8B A;  4RWU A;  4DYL A;  2ATK C;  3E83 A;  4JI3 B;  4I9W A;  4W4K A;  4PEL A;  2N05 A;  4DV4 B;  1N34 B;  4YXW G;  3CCM V;  2LW1 A;  4N23 A;  4I55 A;  3ZHT A;  5EBL C;  1ZUQ A;  2EIJ C;  1H2L A;  1WP8 A;  2HR3 A;  1U97 A;  2PYJ A;  3RGB A;  3FYE B;  2CTR A;  4I9Q A;  4MTX A;  3RYI B;  1YTF D;  4TOI A;  3GVM A;  4X1I A;  1NVP D;  3VBB A;  4OX9 O;  1ZL8 B;  2RJZ A;  2A7W A;  3SYO A;  2VWK A;  2IJI A;  5JVD B;  2E76 B;  1WP7 A;  1WAZ A;  3KG2 A;  5CA0 A;  4X62 B;  2ZDI C;  5C93 A;  2QR4 A;  2VWJ A;  4MVU A;  1RSO B;  4JI7 B;  1FFT B;  3NXS A;  3J81 N;  5JCO A;  4LH7 A;  1N33 O;  5EIB D;  1YEW A;  1COW G;  1I7F A;  1JFF B;  5IJ9 B;  3C90 A;  3EFF K;  2PYL A;  1TUE B;  5JVD A;  4K8X A;  1GM7 A;  1PV0 A;  1M57 C;  1OZ0 A;  4JYC A;  4EKW A;  2UUB B;  4X1I B;  5EZY B;  2P67 A;  3R66 A;  2HHH O;  5E79 Z;  5IWA O;  3OTO B;  1YCI A;  3K9S A;  1HNX B;  3CE2 A;  4LF8 B;  4B3R O;  2UU9 O;  4LF7 B;  2QJ1 A;  3THO A;  3AG1 C;  2EJR A;  1M1K W;  4FLZ A;  4ZIB A;  2FB5 A;  2W0F C;  4FLU A;  4QIW F;  4IHJ B;  3JAT A;  5FPO A;  3ZHV A;  1VF6 A;  4B7E A;  4TQF A;  2CK3 G;  1Y66 A;  4Z1V A;  4JI6 B;  4UVA A;  1JQ0 A;  4UVC A;  3HPL C;  3OR7 C;  3JD3 A;  5GTI Z;  1TAE A;  4K3A A;  5JJJ B;  1NJI W;  5J2T A;  4PA9 A;  3TET A;  1B06 A;  5C8Y B;  4QPJ A;  3AK2 A;  4DV3 O;  2WA3 A;  4F6E A;  3RN4 A;  2L6L A;  2VS0 A;  4P9P A;  5CA1 A;  1TGO A;  1MZF A;  4YJ3 B;  4NTW A;  3UM7 A;  4J7Z A;  4CH5 A;  2LJ2 A;  2JS3 A;  4YHH O;  5LMU B;  2ZDI A;  1EN4 A;  4FLW A;  3L72 H;  2WWW A;  4BWA A;  2DN9 A;  1WB7 A;  4IT5 A;  1XI1 A;  4GCZ A;  2OCC B;  1K97 A;  4JTA B;  4CC5 A;  4XDL A;  4CS3 A;  3ML0 A;  1VQP V;  5CA1 B;  3I5D A;  3OFN G;  2MW2 B;  4JI4 B;  4DRX B;  1W0J G;  1DLB A;  2QWR B;  2IU0 A;  4GLX A;  2N74 A;  3ZMV A;  2KB1 A;  4J42 A;  4MS2 A;  1MSD A;  1KD1 W;  2Y4T A;  4D7S A;  2Y4U A;  5LL6 Y;  2F1M A;  3ZRW B;  1H2K A;  3CXH F;  2ZR2 A;  1L0N H;  3OM3 B;  1H38 A;  2QDO A;  1JOY A;  2XTA A;  4UFZ A;  1SES A;  4DR7 O;  3STZ C;  1M56 C;  2DWD C;  3G71 V;  4O2A A;  5KHJ A;  1BCC H;  2EX3 A;  1M56 B;  1BQZ A;  1SQX H;  1TA8 A;  2HJF C;  3TJT A;  2AW9 A;  4WFF A;  3J7A U;  3HKB A;  5C8Y A;  1VQ9 V;  2JIZ G;  4IIJ B;  1HNZ O;  1K5S A;  1K7D A;  4CH3 A;  2ZM6 O;  4WFB V;  3B40 A;  4JZG A;  1IBK O;  2EUL A;  3CS5 A;  2QTS A;  3CX5 F;  4H37 A;  4R7C A;  3S3X A;  3RVZ A;  1PPJ H;  1G4Y B;  2B1I A;  3MAQ A;  5L3B A;  1EFR G;  5CB4 A;  1G1X B;  4LWS B;  4JTD B;  4UUJ C;  5H5N A;  4X8A A;  1SS3 A;  3K08 A;  2P4K A;  2LO1 A;  3JAK B;  3OGI B;  5LBQ A;  1G6U A;  5CA0 B;  1QU7 A;  3ABT A;  4BIU A;  4UV9 A;  2IH1 C;  3JD0 A;  4XDK A;  3X2Q B;  3B77 A;  1JJO A;  2GV9 A;  2IBZ H;  2QM4 A;  4TWK A;  5IYC O;  4JI2 B;  4RUF A;  5LP6 C;  2Q73 A;  1ZX3 A;  1UPG A;  2CUG A;  2UXD B;  1D2D A;  4JI1 B;  1S5L Z;  2PZS A;  4JGS A;  3WB0 A;  4BW9 A;  2F43 G;  4J10 A;  3OAA G;  3HKD B;  4DR5 O;  2CGO A;  4LNU B;  1E79 G;  4GKJ O;  1XL4 A;  4JI0 B;  1K4C C;  3FAV A;  2LP7 A;  2R9R B;  2B1G A;  4TQD A;  1NQT A;  1J95 A;  4LWS A;  4X1K B;  1WPX A;  4O4H B;  2BSK A;  4LP8 A;  1BQ0 A;  2Q9L A;  1Z5W A;  2QWQ B;  5HFL A;  4JI4 O;  1VIB A;  3H01 A;  1HDJ A;  3O65 A;  3RW0 A;  1HWY A;  1OCR B;  3TCU A;  4LF9 O;  3FKS G;  3AG2 B;  1FJG B;  1FXK C;  5IY5 C;  4DV2 O;  1F4M A;  1AI4 A;  2DWE C;  3E22 A;  3AG4 B;  1GN4 A;  2YS8 A;  2OTL V;  2PI4 A;  2XAS A;  5J2U B;  5KMG A;  1KUQ A;  4I4T A;  5KUM A;  3ZS8 C;  4ZOL A;  4ZHQ A;  1WA8 A;  5JH7 B;  3EVK A;  3JAL B;  1TUB B;  2QSA A;  4NXN B;  1XNQ O;  3IC7 A;  2H3O A;  2X7R B;  3RYC B;  2Q7G A;  3E22 B;  1FPO A;  1I94 O;  1EBO A;  3K03 A;  4U3J A;  4DV0 B;  3K0D A;  2GUZ B;  4WFH A;  5JQG A;  5DEC A;  3G6B A;  4X88 A;  4TV9 A;  1QQC A;  4QE7 A;  5JCO C;  1XMQ B;  3SPI A;  2W0X A;  1Z5V A;  2GTS A;  3K9A A;  3ZN0 A;  4DR4 O;  1KBH A;  3SJA C;  2Q0A A;  2HFE C;  2WLI A;  1EZV H;  3C3T A;  3OTF A;  3UKM A;  2BSK B;  3OEH G;  1TVK A;  1RFY A;  5BXZ A;  4OX9 B;  2AHZ A;  1SC5 B;  1PNM A;  4RAI A;  2Q4P A;  2UXN A;  3SR2 C;  2D2C B;  3L73 H;  2JDI G;  2HJD A;  1SQF A;  4F6R A;  3SYA A;  2UUC B;  1XQ8 A;  3CCR V;  1IBL B;  3CRM A;  4YHH B;  2JEX A;  4B7K A;  1FAF A;  4H33 A;  4PI0 A;  1I5X A;  5LHG A;  2MK3 A;  3CCE V;  1SQG A;  3T4Z A;  4TUY B;  4B3M O;  2P22 C;  4IL6 Z;  4FLT A;  1DK1 A;  2EIK C;  2XAJ A;  4B3T O;  3RYF A;  3M99 B;  2BE3 A;  2HG5 C;  2OTJ V;  3B8N A;  1F7Y A;  4GZR B;  1FXK A;  4FVM A;  4FM2 A;  3BVO A;  2ZXW C;  1LR1 A;  5KA6 A;  2DQ3 A;  1FYJ A;  1S5H C;  1HR0 B;  2LQT A;  4NTX A;  1H2G A;  3K59 A;  3I55 V;  1VAR A;  2P06 A;  4PDL A;  3SPJ A;  2ZE8 A;  4I0X A;  4BAY A;  1FD9 A;  3ETD A;  2DMX A;  4N21 A;  5EBM C;  4WBN A;  2VQE B;  1R6N A;  2ZE5 A;  4JI8 O;  5KHI A;  5BY1 A;  5EIB C;  1HNX O;  1IBM O;  4JV5 B;  3B09 A;  4R6Z A;  2BTQ B;  5B1N A;  3JAW A;  2PY5 A;  1DF5 A;  5IYD O;  4WCE V;  1VP7 A;  2A9H A;  1AVM A;  3ZX6 A;  2Q5Z A;  2GSM B;  3HKD A;  2YUA A;  1D5A A;  4FM0 A;  3W7W A;  2AZ2 A;  2BCC H;  1AB3 A;  2YIB D;  4EEQ A;  4ZKI A;  5CBG A;  3UQ8 A;  2PUS A;  2JJ1 G;  3JAT B;  3DXR A;  4FJC C;  2EIL B;  4UCT A;  1FXH A;  3E8F A;  3JAM N;  1YJW V;  2KG7 A;  2K1E A;  2Y0I A;  3HKE A;  3ZMU A;  3ASN B;  2NLJ C;  4LF6 B;  2H94 A;  3CRR A;  3LNN A;  4DV4 O;  1N34 O;  4NYK A;  2RN9 A;  2PGG A;  1OCC C;  1SQQ H;  1ORQ C;  3L70 H;  3A0B Z;  2NN4 A;  4X64 B;  3BY6 A;  5H6Q A;  1PM9 A;  4XDJ A;  3E2E A;  3JD1 A;  5LMN B;  2IH3 C;  4RUE A;  3SJC C;  4MTO A;  2UXD O;  1NVP B;  2R72 A;  3ABL C;  2RCV A;  3LNM B;  5EC2 C;  2BTO A;  1Q81 W;  1VQK V;  1D5N A;  4MW3 A;  1ZAU A;  2JGD A;  5LYJ B;  3QVN A;  4PA6 A;  2JK5 C;  4DR5 B;  2GBO A;  5KAI Z;  3PN1 A;  2QE7 G;  1VQN V;  3FYI B;  3UT5 A;  4UCO A;  1R73 A;  3SYC A;  3LSS A;  1K73 W;  3K06 A;  1RPO A;  4DR7 B;  1IVS A;  1MG1 A;  2JGD B;  3SJQ C;  3D8C A;  3ZRS A;  4LF4 O;  3L75 H;  3TXS A;  1YHQ V;  2XOK G;  2OIE A;  3H9V A;  4JI7 O;  4DV5 O;  4KHP B;  1JMK C;  4F6R B;  2IM9 A;  5H2F Z;  2UUB O;  1M57 B;  4H13 B;  1KU9 A;  3LSU A;  4FIP C;  2UUA B;  5CN0 A;  1IUR A;  2AGA A;  1OHH G;  5IWA B;  1AJN A;  3FB8 C;  3U0Z A;  1FFX B;  3F5T A;  3TGU H;  4U7O A;  3G80 A;  2FML A;  4I50 B;  2P5O A;  1ZWI C;  1GMG A;  3BA8 A;  3W7T A;  3DSQ A;  3T1H O;  1UJW B;  3SPH A;  5LA6 A;  4CBC A;  2EJ7 A;  4B3R B;  4TSF G;  4DV1 O;  1FKA O;  1RPR A;  2OCH A;  1N32 O;  3GWK C;  4EB6 B;  3IC9 A;  1S3J A;  5EZY A;  4DR2 O;  1DTO A;  4GKJ B;  1CP9 A;  5JH7 A;  1R6K A;  4FFK A;  1GM8 A;  2ZE7 A;  1ZL8 A;  2WSS G;  3ABM C;  4LFA O;  4I0X B;  1AJP A;  3KZI Z;  2YC0 A;  1YIT V;  5LYJ A;  2W6J G;  3SYP A;  2O57 A;  1VF6 C;  3WB2 A;  3JD2 A;  3RYC A;  4BIO A;  3BEH A;  3ZMT A;  2N04 A;  1NTM H;  2EZP A;  5KUK A;  5KLV H;  4G27 B;  4X1Y A;  2VQF O;  4J9Y B;  4PV1 B;  3LUT B;  3CC4 V;  5B5E Z;  1OCC B;  3B8M A;  4KHP O;  1NR1 A;  1GN6 A;  4O4J B;  4B08 A;  2A3Q A;  1XHZ A;  2XT9 A;  4QNH B;  1H2N A;  4QE9 A;  1VQ6 V;  3N27 A;  2WLL B;  2EIJ B;  4D7T A;  4AQY O;  1QBZ A;  4LC1 A;  5LP6 A;  1P7G A;  4BIZ A;  5IJ9 A;  3AG1 B;  2ZIM A;  4DV2 B;  4DUZ B;  4AHC A;  2F66 C;  1HP8 A;  3JSL A;  1WNS A;  4X1K A;  2EBO A;  3F7Y C;  4JTC B;  2V1D A;  1V55 B;  2BOC C;  1THZ A;  3WG7 B;  4ICG A;  4J41 A;  1XRE A;  4F4L A;  2QKS A;  5ITZ B;  4ZOL B;  1P7B A;  5CBH A;  1XUQ A;  3HR0 A;  2E3C A;  5D5Q A;  5K1P A;  3OMA B;  2XAQ A;  1XMQ O;  3MD0 A;  4OXS A;  3ZHQ A;  3BFR A;  1SKV A;  3K3W A;  5IYZ B;  2WLI B;  2FKX A;  5L3F A;  4B3S B;  1Y6X A;  1ZLZ A;  1NZ6 A;  2AZ0 A;  1XEQ A;  3R65 A;  3KCY A;  4G2K A;  2WLH A;  4FFB B;  2L35 A;  5KMG B;  2XHB A;  1JVM A;  3FAV B;  3PJS K;  4AI8 A;  2KQX A;  2F4V B;  4P9O A;  1XMO O;  4UVB A;  4DR2 B;  1VQM V;  3BAA A;  4X64 O;  3OUS A;  4H44 B;  4O4H A;  4RO2 A;  4MTG A;  4B3T B;  5LGN A;  4DR3 O;  3AG7 A;  5B1B B;  4X9Q A;  2AXT Z;  4Z2W A;  1IDS A;  1P4R A;  2CDY A;  3O9O A;  2EIM C;  1T5E A;  3G6E V;  4UV8 A;  1IZ3 A;  2ADP A;  1TUB A;  3E8G A;  4QGP A;  3VOU A;  3OEE G;  3CCQ V;  3RYH B;  4JZ2 A;  3T1Y O;  3L74 H;  5EBW C;  4MVM A;  3ABM B;  4KFM A;  1B3Q A;  4FFB A;  4LF5 B;  4LFB B;  4RQE A;  2PI5 A;  3L71 H;  3ZRW A;  1SQV H;  3KCX A;  2D3O W;  5BMV B;  4R8C A;  4B3M B;  2HKO A;  3AG2 C;  3ZN1 A;  3CD6 V;  4O4L A;  1SER A;  4K0K O;  1QVF U;  4TV9 B;  2FYU H;  2CE4 A;  2X6A A;  5KX5 A;  1XL6 A;  1VQO V;  1VEW A;  2DJV A;  3VQW A;  3ZJZ A;  1B04 A;  4QPK A;  4RQF A;  1MNG A;  1SZT A;  5B1A B;  3SGI A;  2YI8 A;  2YIB A;  3DXR B;  1ROP A;  5IE9 A;  3WU2 Z;  3OMI B;  1VQ5 V;  2HVJ C;  1J5E O;  1YF2 A;  4PDM A;  3GWO A;  2GTA A;  2IJK A;  4NB5 A;  3E89 A;  1AI5 A;  4YIO A;  5FL7 G;  4DR1 B;  1H8H G;  4Q20 A;  4JF3 A;  2BTQ A;  2WLN A;  3JAL A;  3ABL B;  4ZHQ B;  1QVG U;  4ZI7 A;  3TXQ A;  5CBF A;  3DTU B;  3APQ A;  4DV3 B;  4MVZ A;  3QTC A;  4R50 A;  3VQX A;  1AP5 A;  2QKC A;  1VQ7 V;  1M90 W;  2A06 H;  4LFA B;  4KP4 A;  3T1Y B;  1Q7Y W;  1Q6I A;  3CYO A;  2QA4 V;  4NKG B;  3ICX A;  2YI9 A;  5BMV A;  3A8T A;  1Y67 A;  5A9G A;  3BA9 A;  2RDC A;  5DED A;  1S77 D;  2WLL A;  3JAR A;  4JAS A;  1Y74 A;  2YXH A;  3E8H A;  2QWN B;  1VMG A;  2Q6A A;  3CRA A;  4JI3 O;  2Y69 B;  3P30 A;  1JCH A;  2ODM A;  2RMK B;  3OUF A;  2K9P A;  5LMN O;  5KHK A;  4TUY A;  4NR1 A;  4PA3 A;  4DRX A;  4L87 A;  4FZ0 A;  5IJ0 B;  1KQS U;  5H9C A;  1NI8 A;  3A0H Z;  2XAG A;  1M4U A;  1BL8 A;  2WLK A;  4GX1 A;  3BPZ A;  5JJN B;  3QO7 A;  3MDS A;  1JX9 A;  1YI2 V;  1NH2 D;  4JYY A;  1RSO A;  1PL4 A;  4LFC O;  2YXL A;  3OT7 A;  3CCV V;  4GX0 A;  1KKC A;  1PKX A;  3OW2 U;  3I56 V;  5H6R A;  1OCO B;  3C3S A;  5GTH Z;  4ZI7 B;  1XNR O;  1RP3 B;  2QM8 A;  1KP2 A;  1F23 A;  1JJ2 U;  3SDL A;  2ZM6 B;  3G4S V;  2ZT9 B;  4NXM B;  5J2T B;  1PL0 A;  2ZNJ A;  4PD4 F;  1I5Y A;  1GK9 A;  3G67 A;  1QR8 A;  3ZRV A;  4NTY A;  3WB1 A;  1HNZ B;  5B3S B;  4BW5 A;  4DV7 O;  5JQG B;  3ASN C;  2EIL C;  4U3J B;  4DO2 A;  4GX5 A;  5IJ0 A;  1I94 B;  3JD4 A;  4FM1 A;  2IJJ A;  4CH6 A;  5IT9 N;  3UT5 B;  4KL1 A;  2QWP B;  3N2K A;  1L0L H;  1EN6 A;  3GB7 C;  4IGG A;  3N2G A;  3B4S A;  4JI1 O;  4DR1 O;  3FFQ A;  2NNU A;  5KAF Z;  1BGY H;  1ARO P;  4EB6 A;  1URF A;  4AIL C;  2ITC C;  5FLX N;  5IYB O;  1BSM A;  3FB6 C;  5LOV A;  3ZED A;  1V9P A;  1GN3 A;  1M93 A;  2F95 B;  1BS3 A;  1MAB G;  1K34 A;  5JJE B;  3ZHU A;  1UFI A;  5BR8 O;  5B1O A;  4CS4 A;  2UUC O;  4HYO A;  2NR5 A;  2HVK C;  3JAW B;  2DYR B;  5BZB A;  2P6J A;  5GW7 A;  3RYH A;  4O4J A;  3S3W A;  4MTF A;  1SET A;  2VQE O;  3N2K B;  1WLE A;  3P3N A; 
#chains in the Genus database with same CATH homology
 3JYC A;  1RPR A;  3AG4 C;  3ZRW B;  2ZR2 A;  1S3J A;  2Q68 A;  1DTO A;  4MT8 A;  1KKD A;  3OM3 B;  4WFE A;  1CP9 A;  4HZ3 A;  2Z3Y A;  2Y48 A;  3CC7 V;  1H38 A;  1R6K A;  1JOY A;  1OCR C;  1GM8 A;  1SES A;  3STZ C;  1M56 C;  2DWD C;  3G71 V;  4PA4 A;  2WSS G;  3ABM C;  5LGU A;  1AI7 A;  1M56 B;  2DW4 A;  2DYS B;  1AJP A;  1YIT V;  1S72 V;  2HJF C;  4WF9 V;  2W6J G;  3SYP A;  1B6Q A;  4WFF A;  3A0R A;  3JD2 A;  2V7Q G;  1VQ9 V;  1OCZ B;  1QLE C;  2JIZ G;  1ENV A;  2DYR C;  3BEH A;  3ZMT A;  1NKD A;  5L3E A;  2P90 A;  1OCZ C;  1QLE B;  4G28 B;  1K5S A;  1K7D A;  3RVY A;  2EZP A;  1K4D C;  5KUK A;  3LSQ A;  4G27 B;  4WFB V;  1YJ9 V;  4J9Y B;  3LUT B;  1AJQ A;  3CC4 V;  1OCC B;  3AEI A;  4H37 A;  4R7C A;  3WFV A;  3B8M A;  3RVZ A;  1K8A W;  1G4Y B;  2ZQM A;  2B1I A;  1NR1 A;  1Y4M A;  5L3B A;  1EFR G;  4QNH B;  4QE9 A;  2A0L A;  1VQ6 V;  2WLL B;  2ZD9 A;  1GM9 A;  2EIJ B;  4JTD B;  4UUJ C;  5LHI A;  4X8A A;  1QBZ A;  4LC1 A;  3D3I A;  1MOF A;  4BIZ A;  3AG1 B;  3K08 A;  1FXV A;  5LBQ A;  3QO5 A;  4J9Z B;  2X0L A;  3ABT A;  4P2Z A;  2EBO A;  3F7Y C;  4BIU A;  4UV9 A;  4JTC B;  1KP3 A;  2IH1 C;  2V1D A;  1V54 C;  5DM6 V;  3JD0 A;  1V55 B;  4XDK A;  2BOC C;  3X2Q B;  1THZ A;  3B77 A;  3WG7 B;  3K04 A;  1YSC A;  2IU3 A;  4F4L A;  2QKS A;  1K92 A;  1QLN A;  5B3S C;  4TWK A;  3ZIA G;  5IYC O;  3CCJ V;  5IY5 B;  1P7B A;  5CBH A;  4RUF A;  1E1Q G;  3OMN B;  1R3K C;  2EZO A;  2M7W A;  2XND G;  3ABK C;  4JGS A;  3OMA B;  1PNK A;  2F43 G;  2XAQ A;  3ABK B;  3SPC A;  3MD0 A;  4OXS A;  1FXK B;  3OAA G;  3K0G A;  1VQL V;  1E79 G;  5L3C A;  2YSU B;  1F4N A;  1XL4 A;  3K3W A;  4GX2 A;  2X6C A;  1K4C C;  2WLI B;  1R3L C;  5L3F A;  3TK1 A;  2LP7 A;  2R9R B;  1VQ8 V;  2B1G A;  1GO3 F;  3ETG A;  1NQT A;  1J95 A;  4LCU C;  3R65 A;  5IDJ A;  1WPX A;  4G2K A;  4XBF A;  1F51 A;  2WLH A;  2P7T C;  4LP8 A;  5HFL A;  3CMA V;  1JVM A;  1V54 B;  4TT3 G;  5L3G A;  2GHY A;  3H01 A;  4JPR A;  3CCU V;  3PJS K;  2OT5 A;  1YTF B;  1OCO C;  1KD1 W;  1QCE A;  3RW0 A;  1NBM G;  1S76 D;  3ASO C;  1HWY A;  1OCR B;  4MW8 A;  3TCU A;  2Q69 A;  4P9O A;  3ASO B;  3FKS G;  3AG2 B;  4UVB A;  1FXK C;  5IY5 C;  5J9P C;  3CME V;  1EZJ A;  3F7V C;  1F4M A;  3ETE A;  1VQM V;  1AI4 A;  2A79 B;  2DWE C;  2JJ2 G;  1S0V A;  3AG4 B;  4MVQ A;  1K33 A;  3LDE A;  2OTL V;  2PI4 A;  3OUS A;  3CCS V;  2XAS A;  4I5S A;  1QR9 A;  3WG7 C;  5KUM A;  1K9M W;  4RO2 A;  3RBZ A;  4MTG A;  2R9I A;  2B5U A;  5EK0 A;  5LGN A;  5B1B B;  1PNL A;  1P4R A;  1BHA A;  3IC7 A;  3OGC C;  2EIM C;  2X7R B;  3G6E V;  1EBO A;  3HB3 B;  3K03 A;  4UV8 A;  3K0D A;  4Z1M G;  4WFH A;  3IGA C;  2LFR A;  3E8G A;  3MHS C;  3SPG A;  4X88 A;  4UXN A;  3OEE G;  3VOU A;  3LDD A;  4FPP A;  2FTK A;  4QE7 A;  3CCQ V;  3SPI A;  5CA3 A;  2AHY A;  3ZN0 A;  1FS0 G;  3K9A A;  5EBW C;  1E1R G;  3JCZ A;  1AI6 A;  3AG3 C;  1PD3 A;  2HFE C;  2WLI A;  1RM1 C;  3K79 A;  4MVM A;  3ABM B;  2BOB C;  1SRY A;  4KFM A;  3UKM A;  1N8R W;  3OEH G;  3DGE A;  4RQE A;  5L3D A;  2PI5 A;  4MVO A;  5EC1 C;  2AHZ A;  1PNM A;  4RAI A;  1M9N A;  3ZRW A;  3W7U A;  2D3O W;  4JAU A;  2UXN A;  4R8C A;  1RM1 B;  2HKO A;  3AG2 C;  2EIN B;  3OE7 G;  3ZN1 A;  3CD6 V;  2IW5 A;  3STL C;  2JDI G;  2EIM B;  1SER A;  4GT1 A;  1QVF U;  3E35 A;  2ZXW B;  2QTO A;  3E86 A;  3SYA A;  1LNQ A;  2X6A A;  1K5Q A;  5B1B C;  1DF4 A;  3CCR V;  3ZMZ A;  1XL6 A;  1VQO V;  3ABU A;  3W7S A;  4WFG A;  3IFX A;  3FB5 C;  1K3E A;  2EIN C;  2JEX A;  1CPY A;  3ZJZ A;  1L1F A;  4PA7 A;  4H33 A;  2UXX A;  4KUM A;  2LFS A;  1I5X A;  4QPK A;  5LHG A;  4RQF A;  2MK3 A;  2WPD G;  3SYQ A;  3CXC U;  3CCE V;  1IXM A;  1SZT A;  5B1A B;  4DXW A;  3T4Z A;  3CCL V;  1BHB A;  5DN6 G;  2EIK C;  1AR1 B;  2XAJ A;  1MSW D;  1ROP A;  2WLJ A;  3M99 B;  4HAM A;  1CEZ A;  1R3J C;  3OMI B;  2HG5 C;  4WFA V;  1VQ5 V;  2OTJ V;  3B8N A;  3CP1 A;  2HVJ C;  1FXK A;  4PDM A;  3GWO A;  2ZXW C;  2IJK A;  1W2B U;  2C2A A;  2X6B A;  3E89 A;  4PDV A;  1AI5 A;  5KA6 A;  2DQ3 A;  5FL7 G;  1Q82 W;  1KC8 W;  3W7X A;  1H8H G;  4Q20 A;  4JF3 A;  1S5H C;  3F5W C;  1YIJ V;  2Z5U A;  1H2G A;  3E8B A;  2WLN A;  3ABL B;  3I55 V;  2HLD G;  2ATK C;  3E83 A;  4PDL A;  3SPJ A;  3ZRX A;  5HFM A;  1QVG U;  4LBE C;  4BAY A;  4I9W A;  5CBF A;  3DTU B;  4PEL A;  3ETD A;  2Q67 A;  4MVZ A;  4N21 A;  2OCC C;  5EBM C;  5CMU A;  4YXW G;  3CCM V;  4MVS A;  4R50 A;  3T1C A;  1R6N A;  4N23 A;  4ASU G;  5EBL C;  1M90 W;  1VQ7 V;  2EIJ C;  1W0K G;  4KP4 A;  1Q7Y W;  2ZR3 A;  4FMT A;  3CYO A;  2XAH A;  4MSW C;  4ZBM A;  2QA4 V;  2WLM A;  3LDC A;  4R6Z A;  5B1N A;  2HR3 A;  1DF5 A;  5IYD O;  4WCE V;  5LHH A;  4JAV A;  2A9H A;  2WLL A;  1S77 D;  3FYE B;  3AG3 B;  4JAS A;  4JYB A;  3E8H A;  4MTX A;  2GSM B;  1YTF D;  3W7W A;  2Q6A A;  1NVP D;  2Y69 B;  2YEV B;  3VBB A;  2IJH A;  2DYS C;  1VQ4 V;  3SYO A;  4ZKI A;  2IJI A;  5CBG A;  3EHB B;  1YJN V;  1V55 C;  2JJ1 G;  3P30 A;  3T2M A;  3KG2 A;  1JCH A;  3OUF A;  4FJC C;  2ZDI C;  2EIL B;  1FXH A;  5C93 A;  4PA3 A;  4MVU A;  3E8F A;  4L87 A;  1KQS U;  5H9C A;  1YJW V;  2ITD C;  1FFT B;  2K1E A;  1BL8 A;  2XAG A;  3NXS A;  3ZMU A;  1GKF A;  3ASN B;  1NH2 B;  2NLJ C;  4CZZ A;  3QO8 A;  2WLK A;  4GX1 A;  2H94 A;  3QO7 A;  2DQ0 A;  1JX9 A;  2W6I G;  1YI2 V;  1KEC A;  1NH2 D;  1OCC C;  1ORQ C;  2H8P C;  3CCV V;  4X89 A;  4GX0 A;  1COW G;  3ZCC A;  5E1A C;  1PKX A;  4MVR A;  3BY6 A;  3EFF K;  3I56 V;  3OW2 U;  1TUE B;  1GTO A;  5H6R A;  5H6Q A;  4XDJ A;  3E2E A;  3JD1 A;  1GM7 A;  1OCO B;  1M57 C;  2IH3 C;  4RUE A;  1OZ0 A;  4JYC A;  4EKW A;  2P67 A;  4MTO A;  3OR6 C;  2QM8 A;  1KP2 A;  1F23 A;  1NVP B;  1JJ2 U;  2Y69 C;  3ABL C;  3LNM B;  5EC2 C;  4E2L A;  3G4S V;  1Q81 W;  1VQK V;  1PL0 A;  4MW3 A;  2QEX V;  1NR7 A;  2EIK B;  1I5Y A;  1GK9 A;  3AG1 C;  1QR8 A;  2EJR A;  3ZRV A;  1M1K W;  5B3S B;  1Q86 W;  4PA6 A;  2W0F C;  4BW5 A;  4QIW F;  2JK5 C;  5LGT A;  3D36 A;  3ASN C;  2EIL C;  2QE7 G;  4DO2 A;  4GX5 A;  1VQN V;  4QJF B;  3FYI B;  2CK3 G;  3X2Q C;  1R73 A;  1Y66 A;  2JEU A;  5B1A C;  4UVA A;  3MHH C;  3SYC A;  3LSS A;  1JPX A;  1JQ0 A;  4UVC A;  1G8M A;  3HPL C;  3OR7 C;  1K73 W;  3JD4 A;  3JD3 A;  3K06 A;  1RPO A;  2IJJ A;  1MG1 A;  2XAF A;  3QNE A;  3SJQ C;  3ZRS A;  1NJI W;  4PA9 A;  3TET A;  4QPJ A;  1YHQ V;  3GB7 C;  2XOK G;  5KA5 A;  1H8E G;  2NNU A;  1ARO P;  4P9P A;  1M57 B;  2ITC C;  3UM7 A;  5IYB O;  4FIP C;  5CN0 A;  3FB6 C;  1R3I C;  1OHH G;  1AJN A;  2WAM A;  2ZDI A;  3FB8 C;  4FK5 C;  1MAB G;  3CPW U;  2WWW A;  3FB7 C;  4U7O A;  1K34 A;  4GCZ A;  1ZWI C;  2OCC B;  1K97 A;  4JTA B;  5B1O A;  1BMF G;  4XDL A;  4HYO A;  3CC2 V;  3ML0 A;  2HVK C;  1GMG A;  2DYR B;  2YEV A;  3P32 A;  1VQP V;  5BZB A;  3W7T A;  2P6J A;  5GW7 A;  3OFN G;  4U7N A;  1UJW B;  4P30 A;  1W0J G;  1DLB A;  2IU0 A;  3SPH A;  3ZMS A;  2QM7 A;  3ZMV A;  4CBC A;  4MTF A;  1SET A;  2KB1 A;  3T4D A;  4TSF G;  1WLE A;  4MS2 A;  4PDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...