2ITCC

Potassium channel kcsa-fab complex in sodium chloride
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab fragment heavy chain
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2itcC00
4MVRA 4PDVA 4RAIA 2K1EA 2W0FC 3FB6C 4HYOA 3RW0A 4LBEC 4EKWA 4H33A 4F4LA 2X6CA 2EIMC 4QNHB 2AHYA 3T4ZA 3FB8C 1M56C 5J9PC 2WLNA 2YEVA 3VOUA 4G27B 5CBHA 3OR7C 2H8PC 3SYOA 3SPJA 4R7CA 3SYCA 2EILC 2EIKC 2HVJC 4LP8A 4PA9A 2P7TC 3AG2C 4R50A 2HJFC 2ITDC 4MW3A 3UM7A 4MTOA 4J9YB 3ZJZA 4MTFA 5KUMA 1ZWIC 4MVUA 4WFEA 3E8BA 4RO2A 2Q68A 4LCUC 4PA4A 4XDJA 3KG2A 2WLIA 5B1BC 4UUJC 3SYPA 5IY5C 3WG7C 2BOBC 2DYSC 2IH1C 3OGCC 2DYRC 4I9WA 4MW8A 3K06A 4R8CA 5EBWC 3TCUA 4PDRA 5EBLC 3OUSA 2Q6AA 2BOCC 4MVMA 4WFHA 3OR6C 2X6AA 4PA7A 2ZD9A 2Q69A 3AG4C 2NLJC 4MVSA 3STLC 3JYCA 3E8HA 2QKSA 3ABMC 4GX5A 2HG5C 3E8FA 3LDEA 3LNMB 4RUEA 3SPHA 5CBGA 3EFFK 1V54C 3FB7C 1OCZC 4X89A 2EINC 1K4CC 3E86A 4X8AA 1G4YB 2WLKA 3AG3C 3RBZA 4P9PA 1P7BA 3K04A 1XL6A 1QLEC 3LUTB 1OCRC 3K08A 4QE7A 4TWKA 4ZBMA 2WLHA 4QE9A 4MVOA 3GB7C 2WLIB 4XDLA 5CBFA 1ORQC 1R3IC 5B1AC 3STZC 3HPLC 1K4DC 4MTGA 2ITCC 4WFFA 1M57C 1V55C 4G28B 4X88A 5KUKA 4JTAB 2KB1A 3AG1C 4MS2A 4P30A 4CBCA 2A79B 3E8GA 3FB5C 4MVQA 3SPIA 1JVMA 4RUFA 3ABKC 5EC1C 2ATKC 1BL8A 1OCCC 2EIJC 2OCCC 2WLMA 1R3JC 2X6BA 3ASOC 4DXWA 4GX0A 1R3KC 2Q67A 3RVZA 4MVZA 3T1CA 1LNQA 4PA3A 2HVKC 3E83A 3SYAA 1KKDA 2AHZA 3E89A 3UKMA 4WFGA 4J9ZB 5EC2C 3IGAC 3K0GA 1S5HC 3BEHA 4MSWC 2IH3C 5BZBA 3K0DA 2DWDC 3SYQA 3IFXA 5B3SC 5EBMC 3F7VC 3F5WC 4KFMA 4GX1A 1J95A 3PJSK 3R65A 4BW5A 1R3LC 4GX2A 4XDKA 3ASNC 2R9RB 2WLJA 3F7YC 2QTOA 2A0LA 3LDCA 3SPCA 3RVYA 4PDMA 3ZRSA 4PDLA 4HZ3A 2A9HA 4R6ZA 3T2MA 3K03A 2Y69C 5E1AC 3ABLC 3TETA 2ZXWC 4H37A 5EK0A 2DWEC 2HFEC 3OUFA 2JK5C 3T4DA 3X2QC 4JTDB 3SJQC 3LDDA 4P2ZA 1OCOC 4P9OA 2WLLA 3SPGA 2WLLB 1XL4A 4JTCB 4OXSA 4PA6A
chains in the Genus database with same CATH superfamily
4PDVA 5JH7A 3RW0A 1RP3B 4QPKA 4F4LA 2AZ2A 2LW7A 4ZIBA 1Y66A 3FYEB 2WLNA 5B1AB 4FMTA 3OR7C 5EZYA 5JQGB 1HNXO 2EIKC 4PA9A 2BSKA 3WB0A 2N05A 3B09A 3DC5A 4UB6Z 4LWSA 3E22B 2QWRB 3ZX6A 4D6TH 1T5EA 5B1BC 3ABLB 1W0KG 3EHBB 4BIOA 1SQPH 1QCEA 1P7GA 2A06H 3O9OA 2ZR3A 3W7UA 2QKSA 2QWQB 1L8DA 3SPHA 4AILC 4NXMB 3JALB 4DR2B 3RYIA 4FLWA 3E86A 3BHPA 3CX5F 4QE7A 4FM1A 1WJZA 3CEIA 3DXRA 1Y76B 5L3CA 3HPLC 4UV9A 5IJ0A 4YJ2A 4YJ3A 2VQFB 3CRMA 2RDCA 2WA4A 4X9QA 4X66B 4GKJO 2HKOA 5EYPA 1JJOA 4O4LA 2EIJC 2FKXA 2QTSA 5H6RA 3APOA 4JAUA 4MVZA 5HFLA 4PA3A 3E83A 4UCTA 4I4TA 3E89A 3CHXA 3N27A 3K0GA 1S5HC 4DV0B 1VQ9V 3S3XA 2MW2B 1PV0A 3L71H 5GONB 2CH7A 4JASA 4ZOLA 3ZIAG 2DJVA 2HP8A 3B4SA 4GKKB 1K9MW 2ODMA 3CXHF 3HKDA 3T1YO 2JVDA 2YDEA 4WFBV 3X2QC 3I56V 1Y74A 4KHPB 4BR6A 4JI8B 3H1KH 2OCCB 1X4TA 1G6UA 3K5LA 2YI9A 3TJTA 5H9CA 1AROP 2LGQA 1IBKO 1WB8A 3CCVV 2ZNJA 4DR6O 5H5NA 4NTYA 2VRZA 4DV2O 1AVMA 2P6JA 5CBHA 3G6EV 5IJ9B 1SA0A 3F5TA 4I5SA 4CS2A 3ZJZA 3VQVA 3BPZA 4DV3O 3ZN1A 4DUYO 1YDXA 1XMOB 1P4RA 2BOBC 1Y67A 2E5LB 1Q81W 5LOVA 1OCOB 4QGPA 3W7XA 4PA7A 1WB7A 4GT1A 1B3QA 3ABMC 1Z5VA 4PD4F 1Q86W 4DR3O 1NR7A 2OYQA 4B7EA 3B77A 3N2KB 1PL4A 1QR8A 5LXTA 4DV1O 1OCRC 1VP7A 2UUAB 2WLIB 1HDJA 2GBOA 2YICA 5L3FA 4DV7B 4WFFA 4G28B 1MSDA 4FZ1A 3SJAC 1MA1A 3OMIB 2NN4A 2A79B 3CD6V 2IU3A 3ZRVA 1N33B 3CB2A 1OCCC 2UU9O 2AW9A 1DGSA 2YC0A 2IM9A 2CTPA 4GX0A 3BRCA 2IU0A 4HAMA 2D3OW 2OT5A 2HVKC 2AHZA 4D7TA 1AB3A 4FLUA 1JQ0A 3P3NA 3UO3A 2GV9A 1R3LC 4NVPA 1N34B 4PDMA 5JQGA 4PV1B 2E74B 4X65B 3JATB 3E22A 3SJQC 2ZIMA 2GTAA 2RN9A 1MMMA 4OXSA 3VQYA 1BCCH 2K1EA 3GWOA 4CH6A 4B3TB 1PP9H 2YXYA 1YJ9V 3FB8C 5B3SB 2EZOA 4YHHB 3HR0A 4JI3B 4E4EA 3QVNA 1XHXA 1N0JA 4DV4O 2RQ6A 4FLXA 1UFIA 2P22C 4PELA 4LCUC 2UXBO 3T1HB 4BIZA 2BCCH 3KG2A 2VWKA 4DYLA 4UUJC 3SYPA 4LFCB 3CC2V 3K06A 2ZNIA 3BFRA 5LGNA 4MVMA 4BW9A 4O2AB 1KU9A 3OR6C 3SJBC 3ZRWA 3STLC 2F4VB 4KUMA 4JI2O 2BTQB 4RUEA 4FLZA 4UV8A 2CTWA 1Z5WA 1ZAUA 3ETDA 4X8AA 2EIKB 4QE9A 4WCEV 4X64B 2ZIOA 1K4DC 1SETA 3JD3A 3JD4A 4JV5B 2ZM6O 5GONA 1YVWA 5B1BB 2B1GA 2M6YA 4J11A 4LFBB 1FXHA 1WA8B 3VBBA 1M56B 1IBMO 3LSSA 1P84F 3SYAA 2IH3C 5GW7A 2P5OA 4EB6B 2QM7A 5CA1A 1SZTA 2XAFA 4GZRB 3J7AU 1GM7A 1K3EA 1XHZA 3FAVB 1HP8A 1L1FA 5IJ9A 2ZKOA 2A9HA 2Y69C 1G8MA 4QIWF 2KKWA 1SF9A 3A8TA 3UCSC 2QJ1A 1GM8A 1WAZA 4NXMO 3OAAG 2KQXA 1XEQA 3ZMTA 3WFVA 4QNHB 3CSXA 2IJJA 1YIJV 2YEVA 4G27B 4UFZA 2VQEB 2HVJC 3K79A 3J80N 1QLNA 3N2KA 4W4KA 3JCZA 3S3WA 4K8ZA 4JZ2A 1YTFD 3E8BA 4DUZB 2PF4E 3IC7A 2WLIA 2IH1C 4GLXA 3X2QB 1HNZO 4UCVA 3OUSA 3K9SA 3G67A 4JI1B 4JI4B 2ZD9A 2G38A 3TGUH 2JJ2G 3JYCA 1AP6A 1H2KA 3W7TA 1NTZH 1Q6HA 3B2EE 5KA5A 4CS3A 4I9QA 1VQ6V 4GKKO 4ZBMA 1NH2D 1R3IC 2Q0OC 2UUBO 3CRRA 4PI2A 4MTGA 3CC4V 1V55C 1MOFA 4I0XB 1IBLB 3JSLA 4IIJB 1NVPD 1WNSA 5IT9N 2Q7GA 3HKEB 1XNQB 5LA6B 3FYIB 1HW7A 3CCMV 3JATA 1QVFU 3ABMB 4NTXA 3VQXA 3ETEA 1X59A 4X62O 2FB5A 1OCRB 4JI6O 1XMOO 1FYJA 1R6TA 5KX5B 4L87A 2HHHB 1M9NA 1HR0B 4LH7A 4BWAA 1NT2B 3CJHB 3L70H 2EZPA 2HFEC 4GCZA 5H2FZ 4AQYB 1OCCB 2GTSA 2WLLA 1K34A 1TA8A 3SPGA 4IYHA 4FLYA 2ADQB 1H2GA 2XAGA 4LBEC 2WPDG 4H33A 2ZE6A 1Y6XA 3QNEA 4JYCA 2AHYA 2OCHA 3OFNG 4IT5A 3BAAA 2XOKG 4JYBA 2BTQA 3SYCA 4R7CA 1BSMA 4KXRA 4DK1A 4CH5A 5B5EZ 5JJEB 3AG7A 1N33O 3ML0A 2IBZH 2DYRC 1NTKH 2RCVA 3QO5A 1RFYA 4MVSA 2P4KA 1VF6C 3FD9A 3CCSV 2QGNA 4J7KA 1SZXA 2CGOA 2W0XA 4EFBA 1V54C 1YZBA 2WLKA 3K08A 3K9AA 4X65O 5B1NA 3CS5A 4YXWG 4EB6A 3G71V 1IURA 1N32B 1IDSA 1GTOA 2DE0X 1URFA 3AG1C 3FAVA 2YIBD 1MG1A 4P30A 3NXSA 1EZVH 4B3TO 3D36A 2DQ3A 5L3DA 1WPBA 2PZSA 1LNQA 2ARHA 2VS0A 5IE9A 4IL6Z 4JI3O 5EC2C 1J5EB 1NTMH 3JD2A 3G80A 1Q5OA 2ILMA 4GX1A 3CE2A 2N74A 2FL4A 3KCXA 1FKAO 1WLEA 2WLJA 4TT3G 3OE7G 4LFCO 3LDCA 1NI8A 2LJ2A 3ZRSA 4LF5O 4FLVA 3HKCA 1YTFB 1AILA 2ZXWC 4FM2A 4RQFA 1PD3A 2PYJA 1Q43A 3N2GB 3BVOA 4P2ZA 2F4VO 3ZMZA 2UXXA 1SQBH 1OJHA 4ZKIA 5L3EA 3FB6C 4JAVA 4I55B 3UT5A 2Q7HA 3QTCA 1N36O 4LF4B 3P32A 2HR3A 4LF6B 5CN0A 4DR7B 2Y4TA 3ZS8C 2PY5A 5IDJA 1S72V 2ZCEA 3OEHG 4JV5O 2KG7B 4LP8A 2P7TC 4FK5C 2HJFC 2BE3A 1FD9A 1NH2B 4JYAB 2Y69B 3ZMSA 2F93B 2LO1A 4J7ZA 3TXQA 5IYZA 1YHQV 1NQTA 3OGCC 3OMAB 2Y0IA 2BOCC 4LF7B 4WFHA 3K5MA 1FFTB 3RWRD 2Q69A 1NVPB 2Q5ZA 4FJCC 4UCRA 4O4IB 3G4SV 3HKEA 1XREA 5LA6A 2NR5A 2X7RB 4E2LA 1G4YB 2YSUB 2WLHA 3CCLV 5BR8B 1AP5A 3CCUV 3CRCA 2ZT9B 2F66C 2KB1A 2F23A 4QPJA 2R9IA 5KX5A 3FB5C 3M7MX 4G2KA 1K33A 2ZDIA 2WLMA 2UXDB 3I5DA 2L35A 5A9GA 3PN1A 2VQEO 1IVSA 4B3MB 1ZUQA 4DW1A 4DUZO 4OPAA 1ZLZA 3KKYA 1BZKA 5KHJA 2A0LA 3L9DA 3SPCA 3CXCU 2B5UA 1V55B 3ETQA 1SERA 1PM9A 5DEDA 1YJWV 4PA6A 2W0FC 2R70A 2PUSA 2X6CA 2EIMC 2V1DA 3T4ZA 3FKSG 2ADPA 1WP8A 2DMXA 4WF9V 4N23A 1WN7A 3K5OA 3Q4HA 1I08A 1GN2A 2QM8A 1FS0G 4DV6O 4JI7B 1NKDA 1F51A 4FVMA 2AZ0A 1BE3H 1VQ8V 2QWOB 2UUCB 2OTLV 1XNQO 3IAYA 2Q0AA 4YY3B 4ZI7B 1CEZA 2CAZC 5EBLC 4MT8A 1XI1A 1JX9A 2P90A 5LL6Y 2XAHA 3EFFK 1AI5A 2XNDG 4UCUA 3RBZA 4LF9O 2HHHO 1HR0O 2GUZB 5JCOA 4FZ0A 5FPOA 1NJIW 3ABUA 3JSNA 1QVGU 4AQYO 5E79Z 1BHBA 4TQFA 3CYOA 1KUQA 5LMUO 1AR5A 1S5JA 2ZQMA 1B6QA 1D5AA 1R3JC 3ASOC 1R3KC 3N2GA 1VQ7V 5JJNB 1KKDA 5JVDB 2Y0PA 4DV5O 3CC7V 4KL1A 3IFXA 1ZL8B 3PJSK 3ASNC 4IGGA 4I7ZB 3RVYA 2IJKA 5KHIA 3D3QA 1GN6A 2KG7A 3LSUA 2M7WA 3H1HH 2YI8A 3AG1B 4OPHA 1JFFA 4H37A 2JK5C 3HB3B 3UO2A 1I94B 1NR1A 1GK9A 1BQZA 4EKWA 3RN4A 2C2AA 2XAQA 4DR1B 4O4IA 4K0KB 3SYOA 1XMQB 4FLTA 4R50A 2GSMB 3AG2C 3UM7A 4PA4A 2CGNA 2K9PA 2ZXWB 5IY5C 1IXMA 1PKXA 1Q8IA 2AXTZ 5AG2A 1NBMG 2D2CB 2FTKA 2X6AA 3JCUZ 3H9VA 4DRXB 1XUQA 4ICGA 3OTOO 2EX3A 2Q73A 4DK0A 1KBHA 3JALA 3W7SA 3ZBHA 2IJHA 1S76D 1YXBA 4TUYB 1O9HA 1Y76A 2QA4V 4EEQA 2V7QG 1Y4MA 2YUAA 1XOUA 1YI2V 3C3TA 1M5IA 4JI0B 4CBCA 1KP2A 1JVMA 2ATKC 4NXNO 4LF4O 2LFRA 2QKCA 2X6BA 4LF6O 1W0JG 4O2BB 1KD1W 2QWPB 4GYCB 4LC1A 3UKMA 5EIBC 1UPGA 4ZHQB 3TXSA 3QG5A 2WSSG 3ZHTA 3FFQA 2EJRA 2JIZG 2LQTA 1UJWB 1QHTA 2CDYA 1HNWO 3R65A 4BW5A 4XDKA 1K97A 4LH6A 2A3QA 5BMVB 2Q4PA 1K7DA 1YCIA 5E1AC 2UXCB 4JAAA 5BXZA 3T4DA 1SC5B 4FFBB 3E35A 4ZI7A 2QM4A 2YIBA 1MSWD 3OW2U 3HKBB 1DTOA 5DN6G 2Z5UA 5CB4B 2A7WA 5BR8O 5J2UB 1F4NA 2EILC 4UVCA 5IYDO 3AK3A 4MW3A 2EULA 3CCRV 1ZWIC 4TV8B 4XBFA 4JGSA 2EIJB 5LYJB 2IJIA 1Q82W 4UVBA 1SRYA 2GUZA 3WG7C 3ETGA 4LNUB 4DR2O 1FXVA 5HFMA 1VQOV 1XNRB 1PNMA 5EIBD 4JI5B 2R72A 3AG4C 2NLJC 3E8HA 4B3MO 2WAMA 2YIAA 1TUBB 1DF4A 2EIMB 1VF6A 2VQFO 1E79G 4X89A 4I50B 1K4CC 3QF7A 4F6RB 5JVDA 4X66O 4OX9B 1QQCA 3GWKC 5B1AC 1OHHG 2IW5A 3JD1A 1PNLA 2DW4A 3SJCC 4DV0O 3O65A 1IXBA 4MVQA 5ITZB 1FFXB 2EBOA 4RUFA 2Q7EA 2QDOA 2PTMA 4H0LB 1EZJA 4AHCA 1Z2GA 5B66Z 4UXNA 3ICXA 1MABG 2O57A 3K0DA 4GKJB 3CCEV 1Q3EA 5CA0B 3F5WC 4KHPO 1HWYA 4U3JB 3H1IH 2UUCO 4JI8O 2GHYA 4U7OA 1ZSPA 4YY3O 1RPRA 2BTOA 4TV9B 2MK3A 1GN3A 4WBNB 2Y4UA 5EK0A 4CZZA 1IZ3A 1XL4A 3L73H 3ASOB 4U3FH 4HYOA 3R66A 5CMUA 1F7YA 4X1IB 4LF8B 3P3PA 4DRXA 3U10A 1K5QA 1OZ0A 5GTHZ 1F23A 3VOUA 2E5LO 3ASNB 5FNVB 1IBKB 1B04A 1B06A 3OEEG 4TUYA 2PI4A 3E2EA 3L75H 1TVKB 1F4MA 3DTUB 4X20B 4O2AA 2ZINA 2JEUA 3ZMVA 3W7WA 2UUAO 4DV3B 4GX5A 3AK1A 4Z1VA 4J41A 3ZHSA 4DV7O 4B3SB 4O2BA 3M8AA 1OCZC 1JJ2U 1ZX3A 2EINC 2FMLA 3MDSA 1I5XA 4ZHQA 1R6KA 1GM9A 3AG2B 3GB7C 5KHGA 3WB1A 3CP1A 1DF5A 1SQQH 3K3WA 5LHIA 3JASB 5BMVA 4MS2A 4O4JB 4DV1B 2RMKB 5EYPB 2CUGA 4O4LB 3MD0A 2FYUH 1WA8A 4K0KO 4FFBA 1JMKC 4I4TB 1N34O 3BA9A 4NR1A 5KAFZ 3UQ8A 3QO7A 5D5QA 2UU9B 3HKBA 1KYOF 2QTOA 4ZOLB 2YXHA 5CB4A 4FPPA 5J2UA 2E76B 5J2TB 1H2SB 1RSOB 3GVMA 4TV8A 1E1RG 3ZCCA 3OUFA 4K3AA 4YHHO 5LYJA 4TOIA 3A0HZ 4DR5B 4LNUA 4PHZA 1I7FA 3OMNB 1AI6A 2OTJV 1DLBA 3T1HO 2QSAA 1TUBA 5LHHA 4O4HB 1VEWA 5CA3A 5KAIZ 4I50A 5IYBO 3B8NA 4F6RA 5IWAB 4J10A 4JI0O 5KUMA 2PI5A 4J7JA 2ETNA 4RO2A 1KKCA 1VQMV 1S77D 1RM1C 1V9PA 4Q20A 3M99B 2JS3A 4R8CA 5TISZ 2Q6AA 4DV4B 5ITZA 5KLVH 4X64O 3JAMN 4B08A 3LDEA 1MZEA 3ZEDA 3D3IA 1JA8A 4EFEA 3NR7A 3AG3C 2OIGA 1QLEC 1VQKV 2EILB 1S5LZ 3J81N 4LFBO 5CA0A 4KP4A 3STZC 3WU2Z 4U3JA 2KSDA 2F43G 3WG7B 4I0XA 3E8GA 4TV9A 4IIJA 2JEXA 5EC1C 4H13B 4WBNA 3CRQA 1WP7A 1GRJA 4B7KA 2P06A 4J9ZB 1ZTEA 3IGAC 4J42A 4YIOA 4X1IA 5FPRA 1GMGA 4GX2A 4CC6A 1IBMB 2LW1A 1GKFA 4UCOA 3AEIA 5FNVA 1COWG 3H1JH 3T2MA 1XNRO 1QBZA 3K59A 3CJHA 3ZHVA 4JI5O 1FXKC 4FIPC 3BY6A 4L8JA 5LMNB 2CTRA 1NS1A 4P9OA 2P67A 4JTCB 2Z0AA 4MVRA 1TVKA 3RYHB 1L0NH 4X20A 3ZHQA 2F95B 4OX9O 5JJJB 4PI0A 1M56C 4DW0A 4NKGB 2E3CA 2H8PC 2LP7A 3L74H 3APQA 2PYLA 2N04A 4LFAB 2QE7G 4QJFB 1PL0A 4MTFA 4JI1O 4JI4O 1YITV 2YIDA 1BGYH 2ZR2A 3H01A 2DYSC 4DR4B 1GH6A 5K1XA 2HEPA 3JASA 4PDRA 4HNAB 3D36C 4O4JA 1G1XB 3ZRWB 1AI4A 3RYFB 2GDSA 3E8FA 3LNMB 5LGUA 1AI7A 2JS5A 1HNZB 2OWOA 1IBLO 1XL6A 4BAYA 1YSCA 3THOA 3WB2A 1A32A 3JARB 2XT9A 3KZIZ 3CMAV 5KUKA 1VARA 4Z2WA 2H3OA 4NTWA 4NYKA 4CH4A 5J2TA 1RSOA 4LF8O 2UUBB 2Q67A 1RPOA 1NU1H 2H94A 3DSQA 4UB8Z 1AJNA 1FJGB 4UCSA 1KC8W 5LP6C 1OCZB 5BZBA 3RT3C 2EINB 1N8RW 5CA1B 1R1BA 2R9RB 4O4HA 1VMGA 2DYRB 3JAWB 5KHHA 3VQWA 4X62B 1M4UA 3OM3B 4CH3A 3IC9A 1M93A 4JI6B 1M90W 1EM1A 3QO8A 2YS8A 2R9AA 2XAJA 4B3SO 4RAIA 1V54B 4I55A 1I5YA 2DN9A 1W59A 3DGEA 2JDIG 1VIBA 2YEVB 3LNNA 5GTIZ 1H2LA 2Q8VA 1GN4A 4MTOA 5K1PA 1DK1A 5KA6A 1SQXH 4LR3A 1KB9F 4I9WA 4MW8A 4OGQB 5EBWC 1D5NA 2WA3A 1EN4A 2ZDIC 1KECA 5FL7G 1GAXA 1AJQA 4CS4A 1FAFA 3RYCB 1H8HG 1N32O 1XDCA 2CTQA 3G6BA 4JZGA 3K04A 3LUTB 1VQNV 1L0LH 3CRAA 1EFRG 1THZA 4IHJB 2YXLA 4X88A 1BQ0A 1RM1B 4DR5O 1J5EO 2RJZA 3SPIA 3ABKC 2HJDA 1YEWA 1KMIZ 3RFRA 2DQ0A 2Q9LA 4C7UA 2DOSA 4DXWA 3JAKB 1QU7A 3RVZA 3T1CA 1GO3F 3C3SA 4X1YB 3RYHA 4ABMA 5IWAO 3AG3B 4KFMA 3ABTA 4K35A 1QLEB 2JGDB 4Q6GA 1FPOA 2WWWA 1CP9A 1U97A 1K92A 4PDLA 1H38A 5KHKA 1Q7YW 4TSFG 1LUWA 4X1KB 1E1QG 4D7SA 4DR7O 1W2BU 4CC5A 1P49A 2WLLB 4JPRA 1BHAA 3D8CA 4LF5B 4H44B 4N21A 1I0HA 4GUNA 4HNAA 4J80A 5BY1A 1IX9A 3A0RA 4JYAO 3RYFA 4JF3A 4FM0A 1TGOA 1EN5A 1XBLA 4TQDA 4LF7O 1N36B 4J9YB 5JCOC 1K5SA 3ZRXA 2ZE5A 3JARA 1FXKB 1XILA 3TCUA 5H6QA 4B3RB 4NB5A 3A2FA 3P30A 5LGTA 2PGGA 1WPXA 2ZE7A 1LR1A 3CMEV 1BMFG 1PPJH 3CPWU 1VQ5V 5KMGB 3EVKA 1MZFA 3B40A 5CBFA 1ORQC 2UXDO 1YJNV 1O9GA 1LUVA 1HNXB 1M57C 1US6A 5FLXN 5LMNO 4JTAB 5LBQA 1S0VA 3ZMUA 2DYSB 2UXNA 3SDLA 2P4VA 3JAWA 2Y48A 2JJ1G 2OIEA 1BL8A 2XHBA 3SR2C 1SESA 3CCJV 4PJ0Z 1EBOA 4K8XA 4MSWC 2E75B 3SYQA 4LFAO 4UVAA 1CPYA 1ZL8A 5A2QN 1J95A 1S3JA 2L6LA 1VQPV 4DR4O 4HZ3A 5C8YB 3K03A 3HKCB 3H1LH 3ABLC 3TETA 2DWEC 5IYCO 1H2NA 3CCQV 1OV9A 3BCCH 3MHHC 2X0LA 3U0ZA 4JI7O 3UT5B 2NNUA 4A5UB 5C93A 4HBNA 5LP6B 1Q6IA 2XUMA 1Q6UA 5J9PC 2W6JG 3RYCA 2RNBA 2B1IA 5L3GA 3SPJA 3RGBA 2QKAA 2ITDC 1QR9A 3A0BZ 4JYYA 4U7NA 2B9ZA 1H2MA 4IYIA 1QNMA 3ZHRA 5IYZB 1SQFA 5JH7B 4IHJA 4DV6B 1D2DA 1TAEA 2F1MA 2LFSA 2W6IG 3T1YB 1FJGO 3CWBH 1ROPA 4RWUA 2JGUA 5EZYB 1VF5B 3JAKA 3FB7C 2BSKB 3JD0A 1NZ6A 4X1YA 4WFAV 4TWKA 4LWSB 4DR6B 1BS3A 4DV2B 4MVOA 1XQ8A 2JGDA 1AJPA 1R73A 2ITCC 2XASA 1BT8A 5DECA 1SS3A 4LF9B 1AR1B 2OCCC 3L72H 4DUYB 4X1KA 3OT7A 3RYIB 3K57A 4FFKA 1K73W 5LMUB 2Z3YA 3DXRB 2DWDC 2QWNB 5EBMC 4DR3B 1EN6A 1N0NA 5IJ0B 4YJ2B 4YJ3B 1K8AW 2LGWA 1I94O 3EXAA 4MTXA 5IY5B 1Q90D 4DV5B 1U96A 4R6ZA 1H8EG 1CXZB 4DR1O 3DC6A 3BA8A 4JTDB 3LDDA 2AGAA 3ABKB 4DO2A 1OCOC 1XMQO 3OD4A 1FXKA 3BABA 4W4LA 1YF2A 3AK2A 3IJ4A 1MNGA 1TUEB 3K58A 3KCYA 2CH7B 3FX7A 1SKVA 2XTAA 3Q4HB 5LHGA 3HKDB 4MVUA 4WFEA 1Y74B 2Q68A 2QR4A 4F6EA 5KMGA 4XDJA 3LSQA 4AI8A 1AR4A 2CE4A 2HLDG 2VWJA 4Z1MG 5F2VO 2HG5C 4RQEA 5CBGA 1JCHA 1SA0B 3TK1A 1KQSU 4P9PA 1P7BA 4XDLA 3OTOB 1VF7A 5L3BA 3C90A 5LOVB 2JRIA 1N4CA 3U11A 1JOYA 2V4DA 1FFXA 5C8YA 1VQ4V 2UXBB 1SQGA 4YIPA 1KP3A 4ASUG 4BIUA 5JWPA 3OTFA 5B1OA 4WFGA 5LXTB 3SGIA 3ZN0A 3OGIB 3BEHA 5B3SC 5D5PA 2UXCO 3F7VC 2ZE8A 4NXNB 4JI2B 1SQVH 5DM6V 5LP6A 2CK3G 3F7YC 2QEXV 1JPXA 1JR9A 1M57B 1R6NA 4B3RO 2EJ7A 1VQLV 3ZHUA 3B8MA 3MAQA 1JFFB 3K5NA 3AG4B 3I55V 1HNWB 2ZM6B 1PNKA 1ENVA 3MHSC 1M1KW
chains in the Genus database with same CATH topology
2XAGA 4PDVA 4RAIA 1V54B 3RW0A 4LBEC 2WPDG 4H33A 4QPKA 4F4LA 1MSWD 1I5YA 3OW2U 3QNEA 4JYCA 3DGEA 1Y66A 2JDIG 2AHYA 3OFNG 3FYEB 1DTOA 2WLNA 5B1AB 2XOKG 2Z5UA 2YEVB 5DN6G 4FMTA 3OR7C 4JYBA 3SYCA 4R7CA 1F4NA 2EILC 2EIKC 4PA9A 4UVCA 5IYDO 4MW3A 4MTOA 3CCRV 1ZWIC 5KA6A 4XBFA 3ML0A 2EIJB 4JGSA 5B1BC 2IJIA 3ABLB 1Q82W 1W0KG 4UVBA 1SRYA 3WG7C 3ETGA 2DYRC 3EHBB 1FXVA 4I9WA 4MW8A 5HFMA 1QCEA 5EBWC 1VQOV 1PNMA 2ZR3A 3W7UA 3QO5A 2ZDIC 1KECA 5FL7G 4MVSA 3AG4C 1AJQA 2NLJC 3E8HA 2QKSA 3CCSV 2WAMA 1DF4A 2EIMB 1H8HG 3SPHA 1E79G 1V54C 4X89A 1K4CC 3E86A 2WLKA 3K04A 3LUTB 3MHSC 3K08A 4QE7A 3K9AA 1VQNV 5B1NA 4YXWG 5B1AC 5L3CA 3G71V 3HPLC 4UV9A 1OHHG 2IW5A 1EFRG 1THZA 3JD1A 1PNLA 4X88A 1GTOA 1RM1B 2DW4A 3AG1C 1MG1A 4P30A 2HKOA 4MVQA 3NXSA 3SPIA 2EBOA 4RUFA 3ABKC 2EIJC 2DQ0A 3D36A 2DQ3A 1EZJA 5H6RA 5L3DA 4DXWA 4JAUA 3RVZA 4MVZA 3T1CA 1LNQA 4PA3A 4UXNA 3E83A 5HFLA 1GO3F 3E89A 5EC2C 1MABG 3K0GA 1S5HC 1VQ9V 3K0DA 3CCEV 3JD2A 3AG3B 3F5WC 4KFMA 4GX1A 3ABTA 1QLEB 1HWYA 2GHYA 1WLEA 2WWWA 4JASA 2WLJA 4TT3G 4U7OA 1CP9A 3ZIAG 3OE7G 3LDCA 1K92A 3ZRSA 4PDLA 1H38A 1RPRA 2MK3A 1K9MW 1Q7YW 4TSFG 1YTFB 2ZXWC 5EK0A 4RQFA 1PD3A 1E1QG 4WFBV 3X2QC 3I56V 1W2BU 4P2ZA 4CZZA 3ZMZA 2OCCB 2UXXA 2WLLB 1XL4A 4ZKIA 4JPRA 1BHAA 5L3EA 3ASOB 3FB6C 4HYOA 4JAVA 4N21A 1AROP 5CMUA 5H9CA 3CCVV 3P32A 2HR3A 1K5QA 3A0RA 5CN0A 1OZ0A 1F23A 4JF3A 2P6JA 3VOUA 5CBHA 5IDJA 1S72V 3OEHG 3G6EV 3ASNB 4LP8A 2P7TC 4FK5C 2HJFC 4I5SA 4J9YB 3ZJZA 3OEEG 2PI4A 1K5SA 1NH2B 3ZRXA 3E2EA 2Y69B 3ZMSA 3ZN1A 1P4RA 2BOBC 1YHQV 1FXKB 1NQTA 3OGCC 3OMAB 1F4MA 1Q81W 3DTUB 5H6QA 1OCOB 3TCUA 2BOCC 3W7XA 4WFHA 3P30A 5LGTA 4PA7A 1FFTB 2JEUA 2Q69A 1WPXA 3ZMVA 3W7WA 1NVPB 4GT1A 4FJCC 3ABMC 3G4SV 1Q86W 4GX5A 3CMEV 1NR7A 1BMFG 2X7RB 1OCZC 1JJ2U 3B77A 2EINC 4E2LA 1G4YB 1QR8A 3CPWU 2YSUB 1I5XA 1OCRC 2WLHA 1R6KA 1GM9A 3AG2B 1VQ5V 3CCLV 3GB7C 2WLIB 5CBFA 1ORQC 3CP1A 1YJNV 5L3FA 1DF5A 3K3WA 5LHIA 4WFFA 1M57C 4G28B 3CCUV 4JTAB 5LBQA 1S0VA 2KB1A 4QPJA 3ZMUA 2R9IA 3OMIB 2DYSB 2UXNA 4MS2A 2A79B 3FB5C 3CD6V 2IU3A 2Y48A 3ZRVA 4G2KA 2JJ1G 1BL8A 1K33A 1OCCC 3MD0A 2ZDIA 2WLMA 1SESA 4GX0A 2IU0A 3CCJV 1EBOA 4HAMA 2D3OW 2OT5A 2HVKC 2AHZA 4MSWC 1JQ0A 3SYQA 3QO7A 4UVAA 1CPYA 1J95A 1S3JA 1R3LC 1VQPV 2QTOA 2A0LA 4FPPA 3SPCA 4PDMA 3CXCU 2B5UA 4HZ3A 1V55B 3K03A 3ABLC 3TETA 1SERA 1E1RG 2DWEC 3ZCCA 3OUFA 5IYCO 3SJQC 3CCQV 1YJWV 4OXSA 4PA6A 2K1EA 2W0FC 3MHHC 2X0LA 3GWOA 3OMNB 1AI6A 2NNUA 2X6CA 2EIMC 2V1DA 1YJ9V 5C93A 1DLBA 2OTJV 3T4ZA 3FB8C 3FKSG 2EZOA 5B3SB 5J9PC 5LHHA 2W6JG 4WF9V 4N23A 2B1IA 5CA3A 5L3GA 3SPJA 2QM8A 1FS0G 5IYBO 2ITDC 1QR9A 3B8NA 1NKDA 1F51A 5KUMA 2PI5A 4U7NA 4PELA 4RO2A 4LCUC 1VQ8V 4BIZA 1VQMV 3KG2A 1S77D 1RM1C 2OTLV 4UUJC 3SYPA 3CC2V 4Q20A 3M99B 1CEZA 3K06A 4R8CA 5EBLC 2Q6AA 4MT8A 5LGNA 4MVMA 3OR6C 1JX9A 2LFSA 2W6IG 3ZRWA 3STLC 2P90A 1ROPA 4KUMA 3LDEA 4RUEA 2XAHA 4UV8A 3EFFK 3FB7C 3JD0A 3D3IA 1AI5A 3ETDA 4X8AA 2XNDG 3AG3C 3RBZA 4WFAV 1QLEC 1VQKV 2EILB 2EIKB 4TWKA 4QE9A 4MVOA 4KP4A 4WCEV 3STZC 1K4DC 1SETA 3JD3A 3ABUA 3JD4A 1AJPA 1NJIW 1R73A 2ITCC 1QVGU 1BHBA 2XASA 5B1BB 2F43G 3CYOA 3WG7B 2B1GA 3E8GA 2ZQMA 1B6QA 2JEXA 5EC1C 1AR1B 2OCCC 1FXHA 1R3JC 3ASOC 1R3KC 3VBBA 1M56B 3LSSA 3SYAA 1VQ7V 1KKDA 1K73W 4J9ZB 3IGAC 2Z3YA 3CC7V 2IH3C 2DWDC 3IFXA 5GW7A 5EBMC 2QM7A 1SZTA 2XAFA 3PJSK 1GMGA 4GX2A 1GM7A 3ASNC 1K3EA 1K8AW 4MTXA 5IY5B 1L1FA 3RVYA 2IJKA 1GKFA 3AEIA 2A9HA 4R6ZA 1COWG 2M7WA 3T2MA 2Y69C 1G8MA 4QIWF 1H8EG 3AG1B 1QBZA 4H37A 1FXKC 2JK5C 4FIPC 4JTDB 3BY6A 3HB3B 3LDDA 3ABKB 4DO2A 1OCOC 4P9OA 2P67A 4JTCB 1GM8A 1FXKA 1NR1A 4MVRA 1GK9A 3OAAG 4EKWA 3ZMTA 3WFVA 2C2AA 1TUEB 4QNHB 2XAQA 1YIJV 2IJJA 1M56C 2YEVA 4G27B 3SYOA 2H8PC 2LP7A 2HVJC 2GSMB 3K79A 4R50A 1QLNA 3AG2C 3UM7A 2QE7G 4QJFB 3JCZA 1PL0A 4MTFA 5LHGA 1YTFD 4MVUA 4WFEA 3E8BA 1YITV 2Q68A 4PA4A 4XDJA 3IC7A 3LSQA 2WLIA 2ZXWB 5IY5C 1IXMA 2ZR2A 3H01A 2DYSC 2IH1C 1PKXA 3X2QB 4PDRA 2HLDG 1NBMG 3OUSA 2FTKA 2X6AA 4Z1MG 2ZD9A 3ZRWB 2JJ2G 1AI4A 3JYCA 3W7TA 2HG5C 3E8FA 3LNMB 4RQEA 5CBGA 5KA5A 3W7SA 1JCHA 5LGUA 1AI7A 2IJHA 3TK1A 1S76D 1VQ6V 1KQSU 4P9PA 1P7BA 1XL6A 4ZBMA 4BAYA 2QA4V 1NH2D 1YSCA 4XDLA 1R3IC 2V7QG 1Y4MA 3CC4V 4MTGA 5L3BA 1V55C 1YI2V 3CMAV 5KUKA 1JOYA 1MOFA 4CBCA 1VQ4V 1KP2A 1JVMA 1NVPD 2ATKC 1KP3A 4ASUG 4BIUA 2LFRA 2X6BA 3FYIB 3CCMV 1W0JG 2Q67A 1KD1W 1QVFU 3ABMB 5B1OA 1RPOA 2H94A 4LC1A 3UKMA 4WFGA 3ZN0A 1AJNA 3ETEA 3BEHA 1KC8W 1OCZB 5BZBA 2WSSG 2EINB 5B3SC 2EJRA 1N8RW 2JIZG 1UJWB 3F7VC 1OCRB 5DM6V 3R65A 4BW5A 4XDKA 1K97A 2CK3G 2R9RB 3F7YC 2QEXV 1JPXA 2DYRB 1M57B 4L87A 1R6NA 1M9NA 1K7DA 5E1AC 1VQLV 3B8MA 3OM3B 2EZPA 2HFEC 3AG4B 3T4DA 3I55V 4GCZA 1M90W 1PNKA 3QO8A 1OCCB 2WLLA 3SPGA 1K34A 1ENVA 1M1KW 3E35A 2XAJA 1H2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVR A;  4PDV A;  4RAI A;  2K1E A;  2W0F C;  3FB6 C;  4HYO A;  3RW0 A;  4LBE C;  4EKW A;  4H33 A;  4F4L A;  2X6C A;  2EIM C;  4QNH B;  2AHY A;  3T4Z A;  3FB8 C;  1M56 C;  5J9P C;  2WLN A;  2YEV A;  3VOU A;  4G27 B;  5CBH A;  3OR7 C;  2H8P C;  3SYO A;  3SPJ A;  4R7C A;  3SYC A;  2EIL C;  2EIK C;  2HVJ C;  4LP8 A;  4PA9 A;  2P7T C;  3AG2 C;  4R50 A;  2HJF C;  2ITD C;  4MW3 A;  3UM7 A;  4MTO A;  4J9Y B;  3ZJZ A;  4MTF A;  5KUM A;  1ZWI C;  4MVU A;  4WFE A;  3E8B A;  4RO2 A;  2Q68 A;  4LCU C;  4PA4 A;  4XDJ A;  3KG2 A;  2WLI A;  5B1B C;  4UUJ C;  3SYP A;  5IY5 C;  3WG7 C;  2BOB C;  2DYS C;  2IH1 C;  3OGC C;  2DYR C;  4I9W A;  4MW8 A;  3K06 A;  4R8C A;  5EBW C;  3TCU A;  4PDR A;  5EBL C;  3OUS A;  2Q6A A;  2BOC C;  4MVM A;  4WFH A;  3OR6 C;  2X6A A;  4PA7 A;  2ZD9 A;  2Q69 A;  3AG4 C;  2NLJ C;  4MVS A;  3STL C;  3JYC A;  3E8H A;  2QKS A;  3ABM C;  4GX5 A;  2HG5 C;  3E8F A;  3LDE A;  3LNM B;  4RUE A;  3SPH A;  5CBG A;  3EFF K;  1V54 C;  3FB7 C;  1OCZ C;  4X89 A;  2EIN C;  1K4C C;  3E86 A;  4X8A A;  1G4Y B;  2WLK A;  3AG3 C;  3RBZ A;  4P9P A;  1P7B A;  3K04 A;  1XL6 A;  1QLE C;  3LUT B;  1OCR C;  3K08 A;  4QE7 A;  4TWK A;  4ZBM A;  2WLH A;  4QE9 A;  4MVO A;  3GB7 C;  2WLI B;  4XDL A;  5CBF A;  1ORQ C;  1R3I C;  5B1A C;  3STZ C;  3HPL C;  1K4D C;  4MTG A;  2ITC C;  4WFF A;  1M57 C;  1V55 C;  4G28 B;  4X88 A;  5KUK A;  4JTA B;  2KB1 A;  3AG1 C;  4MS2 A;  4P30 A;  4CBC A;  2A79 B;  3E8G A;  3FB5 C;  4MVQ A;  3SPI A;  1JVM A;  4RUF A;  3ABK C;  5EC1 C;  2ATK C;  1BL8 A;  1OCC C;  2EIJ C;  2OCC C;  2WLM A;  1R3J C;  2X6B A;  3ASO C;  4DXW A;  4GX0 A;  1R3K C;  2Q67 A;  3RVZ A;  4MVZ A;  3T1C A;  1LNQ A;  4PA3 A;  2HVK C;  3E83 A;  3SYA A;  1KKD A;  2AHZ A;  3E89 A;  3UKM A;  4WFG A;  4J9Z B;  5EC2 C;  3IGA C;  3K0G A;  1S5H C;  3BEH A;  4MSW C;  2IH3 C;  5BZB A;  3K0D A;  2DWD C;  3SYQ A;  3IFX A;  5B3S C;  5EBM C;  3F7V C;  3F5W C;  4KFM A;  4GX1 A;  1J95 A;  3PJS K;  3R65 A;  4BW5 A;  1R3L C;  4GX2 A;  4XDK A;  3ASN C;  2R9R B;  2WLJ A;  3F7Y C;  2QTO A;  2A0L A;  3LDC A;  3SPC A;  3RVY A;  4PDM A;  3ZRS A;  4PDL A;  4HZ3 A;  2A9H A;  4R6Z A;  3T2M A;  3K03 A;  2Y69 C;  5E1A C;  3ABL C;  3TET A;  2ZXW C;  4H37 A;  5EK0 A;  2DWE C;  2HFE C;  3OUF A;  2JK5 C;  3T4D A;  3X2Q C;  4JTD B;  3SJQ C;  3LDD A;  4P2Z A;  1OCO C;  4P9O A;  2WLL A;  3SPG A;  2WLL B;  1XL4 A;  4JTC B;  4OXS A;  4PA6 A; 
#chains in the Genus database with same CATH topology
 4PDV A;  5JH7 A;  3RW0 A;  1RP3 B;  4QPK A;  4F4L A;  2AZ2 A;  2LW7 A;  4ZIB A;  1Y66 A;  3FYE B;  2WLN A;  5B1A B;  4FMT A;  3OR7 C;  5EZY A;  5JQG B;  1HNX O;  2EIK C;  4PA9 A;  2BSK A;  3WB0 A;  2N05 A;  3B09 A;  3DC5 A;  4UB6 Z;  4LWS A;  3E22 B;  2QWR B;  3ZX6 A;  4D6T H;  1T5E A;  5B1B C;  3ABL B;  1W0K G;  3EHB B;  4BIO A;  1SQP H;  1QCE A;  1P7G A;  2A06 H;  3O9O A;  2ZR3 A;  3W7U A;  2QKS A;  2QWQ B;  1L8D A;  3SPH A;  4AIL C;  4NXM B;  3JAL B;  4DR2 B;  3RYI A;  4FLW A;  3E86 A;  3BHP A;  3CX5 F;  4QE7 A;  4FM1 A;  1WJZ A;  3CEI A;  3DXR A;  1Y76 B;  5L3C A;  3HPL C;  4UV9 A;  5IJ0 A;  4YJ2 A;  4YJ3 A;  2VQF B;  3CRM A;  2RDC A;  2WA4 A;  4X9Q A;  4X66 B;  4GKJ O;  2HKO A;  5EYP A;  1JJO A;  4O4L A;  2EIJ C;  2FKX A;  2QTS A;  5H6R A;  3APO A;  4JAU A;  4MVZ A;  5HFL A;  4PA3 A;  3E83 A;  4UCT A;  4I4T A;  3E89 A;  3CHX A;  3N27 A;  3K0G A;  1S5H C;  4DV0 B;  1VQ9 V;  3S3X A;  2MW2 B;  1PV0 A;  3L71 H;  5GON B;  2CH7 A;  4JAS A;  4ZOL A;  3ZIA G;  2DJV A;  2HP8 A;  3B4S A;  4GKK B;  1K9M W;  2ODM A;  3CXH F;  3HKD A;  3T1Y O;  2JVD A;  2YDE A;  4WFB V;  3X2Q C;  3I56 V;  1Y74 A;  4KHP B;  4BR6 A;  4JI8 B;  3H1K H;  2OCC B;  1X4T A;  1G6U A;  3K5L A;  2YI9 A;  3TJT A;  5H9C A;  1ARO P;  2LGQ A;  1IBK O;  1WB8 A;  3CCV V;  2ZNJ A;  4DR6 O;  5H5N A;  4NTY A;  2VRZ A;  4DV2 O;  1AVM A;  2P6J A;  5CBH A;  3G6E V;  5IJ9 B;  1SA0 A;  3F5T A;  4I5S A;  4CS2 A;  3ZJZ A;  3VQV A;  3BPZ A;  4DV3 O;  3ZN1 A;  4DUY O;  1YDX A;  1XMO B;  1P4R A;  2BOB C;  1Y67 A;  2E5L B;  1Q81 W;  5LOV A;  1OCO B;  4QGP A;  3W7X A;  4PA7 A;  1WB7 A;  4GT1 A;  1B3Q A;  3ABM C;  1Z5V A;  4PD4 F;  1Q86 W;  4DR3 O;  1NR7 A;  2OYQ A;  4B7E A;  3B77 A;  3N2K B;  1PL4 A;  1QR8 A;  5LXT A;  4DV1 O;  1OCR C;  1VP7 A;  2UUA B;  2WLI B;  1HDJ A;  2GBO A;  2YIC A;  5L3F A;  4DV7 B;  4WFF A;  4G28 B;  1MSD A;  4FZ1 A;  3SJA C;  1MA1 A;  3OMI B;  2NN4 A;  2A79 B;  3CD6 V;  2IU3 A;  3ZRV A;  1N33 B;  3CB2 A;  1OCC C;  2UU9 O;  2AW9 A;  1DGS A;  2YC0 A;  2IM9 A;  2CTP A;  4GX0 A;  3BRC A;  2IU0 A;  4HAM A;  2D3O W;  2OT5 A;  2HVK C;  2AHZ A;  4D7T A;  1AB3 A;  4FLU A;  1JQ0 A;  3P3N A;  3UO3 A;  2GV9 A;  1R3L C;  4NVP A;  1N34 B;  4PDM A;  5JQG A;  4PV1 B;  2E74 B;  4X65 B;  3JAT B;  3E22 A;  3SJQ C;  2ZIM A;  2GTA A;  2RN9 A;  1MMM A;  4OXS A;  3VQY A;  1BCC H;  2K1E A;  3GWO A;  4CH6 A;  4B3T B;  1PP9 H;  2YXY A;  1YJ9 V;  3FB8 C;  5B3S B;  2EZO A;  4YHH B;  3HR0 A;  4JI3 B;  4E4E A;  3QVN A;  1XHX A;  1N0J A;  4DV4 O;  2RQ6 A;  4FLX A;  1UFI A;  2P22 C;  4PEL A;  4LCU C;  2UXB O;  3T1H B;  4BIZ A;  2BCC H;  3KG2 A;  2VWK A;  4DYL A;  4UUJ C;  3SYP A;  4LFC B;  3CC2 V;  3K06 A;  2ZNI A;  3BFR A;  5LGN A;  4MVM A;  4BW9 A;  4O2A B;  1KU9 A;  3OR6 C;  3SJB C;  3ZRW A;  3STL C;  2F4V B;  4KUM A;  4JI2 O;  2BTQ B;  4RUE A;  4FLZ A;  4UV8 A;  2CTW A;  1Z5W A;  1ZAU A;  3ETD A;  4X8A A;  2EIK B;  4QE9 A;  4WCE V;  4X64 B;  2ZIO A;  1K4D C;  1SET A;  3JD3 A;  3JD4 A;  4JV5 B;  2ZM6 O;  5GON A;  1YVW A;  5B1B B;  2B1G A;  2M6Y A;  4J11 A;  4LFB B;  1FXH A;  1WA8 B;  3VBB A;  1M56 B;  1IBM O;  3LSS A;  1P84 F;  3SYA A;  2IH3 C;  5GW7 A;  2P5O A;  4EB6 B;  2QM7 A;  5CA1 A;  1SZT A;  2XAF A;  4GZR B;  3J7A U;  1GM7 A;  1K3E A;  1XHZ A;  3FAV B;  1HP8 A;  1L1F A;  5IJ9 A;  2ZKO A;  2A9H A;  2Y69 C;  1G8M A;  4QIW F;  2KKW A;  1SF9 A;  3A8T A;  3UCS C;  2QJ1 A;  1GM8 A;  1WAZ A;  4NXM O;  3OAA G;  2KQX A;  1XEQ A;  3ZMT A;  3WFV A;  4QNH B;  3CSX A;  2IJJ A;  1YIJ V;  2YEV A;  4G27 B;  4UFZ A;  2VQE B;  2HVJ C;  3K79 A;  3J80 N;  1QLN A;  3N2K A;  4W4K A;  3JCZ A;  3S3W A;  4K8Z A;  4JZ2 A;  1YTF D;  3E8B A;  4DUZ B;  2PF4 E;  3IC7 A;  2WLI A;  2IH1 C;  4GLX A;  3X2Q B;  1HNZ O;  4UCV A;  3OUS A;  3K9S A;  3G67 A;  4JI1 B;  4JI4 B;  2ZD9 A;  2G38 A;  3TGU H;  2JJ2 G;  3JYC A;  1AP6 A;  1H2K A;  3W7T A;  1NTZ H;  1Q6H A;  3B2E E;  5KA5 A;  4CS3 A;  4I9Q A;  1VQ6 V;  4GKK O;  4ZBM A;  1NH2 D;  1R3I C;  2Q0O C;  2UUB O;  3CRR A;  4PI2 A;  4MTG A;  3CC4 V;  1V55 C;  1MOF A;  4I0X B;  1IBL B;  3JSL A;  4IIJ B;  1NVP D;  1WNS A;  5IT9 N;  2Q7G A;  3HKE B;  1XNQ B;  5LA6 B;  3FYI B;  1HW7 A;  3CCM V;  3JAT A;  1QVF U;  3ABM B;  4NTX A;  3VQX A;  3ETE A;  1X59 A;  4X62 O;  2FB5 A;  1OCR B;  4JI6 O;  1XMO O;  1FYJ A;  1R6T A;  5KX5 B;  4L87 A;  2HHH B;  1M9N A;  1HR0 B;  4LH7 A;  4BWA A;  1NT2 B;  3CJH B;  3L70 H;  2EZP A;  2HFE C;  4GCZ A;  5H2F Z;  4AQY B;  1OCC B;  2GTS A;  2WLL A;  1K34 A;  1TA8 A;  3SPG A;  4IYH A;  4FLY A;  2ADQ B;  1H2G A;  2XAG A;  4LBE C;  2WPD G;  4H33 A;  2ZE6 A;  1Y6X A;  3QNE A;  4JYC A;  2AHY A;  2OCH A;  3OFN G;  4IT5 A;  3BAA A;  2XOK G;  4JYB A;  2BTQ A;  3SYC A;  4R7C A;  1BSM A;  4KXR A;  4DK1 A;  4CH5 A;  5B5E Z;  5JJE B;  3AG7 A;  1N33 O;  3ML0 A;  2IBZ H;  2DYR C;  1NTK H;  2RCV A;  3QO5 A;  1RFY A;  4MVS A;  2P4K A;  1VF6 C;  3FD9 A;  3CCS V;  2QGN A;  4J7K A;  1SZX A;  2CGO A;  2W0X A;  4EFB A;  1V54 C;  1YZB A;  2WLK A;  3K08 A;  3K9A A;  4X65 O;  5B1N A;  3CS5 A;  4YXW G;  4EB6 A;  3G71 V;  1IUR A;  1N32 B;  1IDS A;  1GTO A;  2DE0 X;  1URF A;  3AG1 C;  3FAV A;  2YIB D;  1MG1 A;  4P30 A;  3NXS A;  1EZV H;  4B3T O;  3D36 A;  2DQ3 A;  5L3D A;  1WPB A;  2PZS A;  1LNQ A;  2ARH A;  2VS0 A;  5IE9 A;  4IL6 Z;  4JI3 O;  5EC2 C;  1J5E B;  1NTM H;  3JD2 A;  3G80 A;  1Q5O A;  2ILM A;  4GX1 A;  3CE2 A;  2N74 A;  2FL4 A;  3KCX A;  1FKA O;  1WLE A;  2WLJ A;  4TT3 G;  3OE7 G;  4LFC O;  3LDC A;  1NI8 A;  2LJ2 A;  3ZRS A;  4LF5 O;  4FLV A;  3HKC A;  1YTF B;  1AIL A;  2ZXW C;  4FM2 A;  4RQF A;  1PD3 A;  2PYJ A;  1Q43 A;  3N2G B;  3BVO A;  4P2Z A;  2F4V O;  3ZMZ A;  2UXX A;  1SQB H;  1OJH A;  4ZKI A;  5L3E A;  3FB6 C;  4JAV A;  4I55 B;  3UT5 A;  2Q7H A;  3QTC A;  1N36 O;  4LF4 B;  3P32 A;  2HR3 A;  4LF6 B;  5CN0 A;  4DR7 B;  2Y4T A;  3ZS8 C;  2PY5 A;  5IDJ A;  1S72 V;  2ZCE A;  3OEH G;  4JV5 O;  2KG7 B;  4LP8 A;  2P7T C;  4FK5 C;  2HJF C;  2BE3 A;  1FD9 A;  1NH2 B;  4JYA B;  2Y69 B;  3ZMS A;  2F93 B;  2LO1 A;  4J7Z A;  3TXQ A;  5IYZ A;  1YHQ V;  1NQT A;  3OGC C;  3OMA B;  2Y0I A;  2BOC C;  4LF7 B;  4WFH A;  3K5M A;  1FFT B;  3RWR D;  2Q69 A;  1NVP B;  2Q5Z A;  4FJC C;  4UCR A;  4O4I B;  3G4S V;  3HKE A;  1XRE A;  5LA6 A;  2NR5 A;  2X7R B;  4E2L A;  1G4Y B;  2YSU B;  2WLH A;  3CCL V;  5BR8 B;  1AP5 A;  3CCU V;  3CRC A;  2ZT9 B;  2F66 C;  2KB1 A;  2F23 A;  4QPJ A;  2R9I A;  5KX5 A;  3FB5 C;  3M7M X;  4G2K A;  1K33 A;  2ZDI A;  2WLM A;  2UXD B;  3I5D A;  2L35 A;  5A9G A;  3PN1 A;  2VQE O;  1IVS A;  4B3M B;  1ZUQ A;  4DW1 A;  4DUZ O;  4OPA A;  1ZLZ A;  3KKY A;  1BZK A;  5KHJ A;  2A0L A;  3L9D A;  3SPC A;  3CXC U;  2B5U A;  1V55 B;  3ETQ A;  1SER A;  1PM9 A;  5DED A;  1YJW V;  4PA6 A;  2W0F C;  2R70 A;  2PUS A;  2X6C A;  2EIM C;  2V1D A;  3T4Z A;  3FKS G;  2ADP A;  1WP8 A;  2DMX A;  4WF9 V;  4N23 A;  1WN7 A;  3K5O A;  3Q4H A;  1I08 A;  1GN2 A;  2QM8 A;  1FS0 G;  4DV6 O;  4JI7 B;  1NKD A;  1F51 A;  4FVM A;  2AZ0 A;  1BE3 H;  1VQ8 V;  2QWO B;  2UUC B;  2OTL V;  1XNQ O;  3IAY A;  2Q0A A;  4YY3 B;  4ZI7 B;  1CEZ A;  2CAZ C;  5EBL C;  4MT8 A;  1XI1 A;  1JX9 A;  2P90 A;  5LL6 Y;  2XAH A;  3EFF K;  1AI5 A;  2XND G;  4UCU A;  3RBZ A;  4LF9 O;  2HHH O;  1HR0 O;  2GUZ B;  5JCO A;  4FZ0 A;  5FPO A;  1NJI W;  3ABU A;  3JSN A;  1QVG U;  4AQY O;  5E79 Z;  1BHB A;  4TQF A;  3CYO A;  1KUQ A;  5LMU O;  1AR5 A;  1S5J A;  2ZQM A;  1B6Q A;  1D5A A;  1R3J C;  3ASO C;  1R3K C;  3N2G A;  1VQ7 V;  5JJN B;  1KKD A;  5JVD B;  2Y0P A;  4DV5 O;  3CC7 V;  4KL1 A;  3IFX A;  1ZL8 B;  3PJS K;  3ASN C;  4IGG A;  4I7Z B;  3RVY A;  2IJK A;  5KHI A;  3D3Q A;  1GN6 A;  2KG7 A;  3LSU A;  2M7W A;  3H1H H;  2YI8 A;  3AG1 B;  4OPH A;  1JFF A;  4H37 A;  2JK5 C;  3HB3 B;  3UO2 A;  1I94 B;  1NR1 A;  1GK9 A;  1BQZ A;  4EKW A;  3RN4 A;  2C2A A;  2XAQ A;  4DR1 B;  4O4I A;  4K0K B;  3SYO A;  1XMQ B;  4FLT A;  4R50 A;  2GSM B;  3AG2 C;  3UM7 A;  4PA4 A;  2CGN A;  2K9P A;  2ZXW B;  5IY5 C;  1IXM A;  1PKX A;  1Q8I A;  2AXT Z;  5AG2 A;  1NBM G;  2D2C B;  2FTK A;  2X6A A;  3JCU Z;  3H9V A;  4DRX B;  1XUQ A;  4ICG A;  3OTO O;  2EX3 A;  2Q73 A;  4DK0 A;  1KBH A;  3JAL A;  3W7S A;  3ZBH A;  2IJH A;  1S76 D;  1YXB A;  4TUY B;  1O9H A;  1Y76 A;  2QA4 V;  4EEQ A;  2V7Q G;  1Y4M A;  2YUA A;  1XOU A;  1YI2 V;  3C3T A;  1M5I A;  4JI0 B;  4CBC A;  1KP2 A;  1JVM A;  2ATK C;  4NXN O;  4LF4 O;  2LFR A;  2QKC A;  2X6B A;  4LF6 O;  1W0J G;  4O2B B;  1KD1 W;  2QWP B;  4GYC B;  4LC1 A;  3UKM A;  5EIB C;  1UPG A;  4ZHQ B;  3TXS A;  3QG5 A;  2WSS G;  3ZHT A;  3FFQ A;  2EJR A;  2JIZ G;  2LQT A;  1UJW B;  1QHT A;  2CDY A;  1HNW O;  3R65 A;  4BW5 A;  4XDK A;  1K97 A;  4LH6 A;  2A3Q A;  5BMV B;  2Q4P A;  1K7D A;  1YCI A;  5E1A C;  2UXC B;  4JAA A;  5BXZ A;  3T4D A;  1SC5 B;  4FFB B;  3E35 A;  4ZI7 A;  2QM4 A;  2YIB A;  1MSW D;  3OW2 U;  3HKB B;  1DTO A;  5DN6 G;  2Z5U A;  5CB4 B;  2A7W A;  5BR8 O;  5J2U B;  1F4N A;  2EIL C;  4UVC A;  5IYD O;  3AK3 A;  4MW3 A;  2EUL A;  3CCR V;  1ZWI C;  4TV8 B;  4XBF A;  4JGS A;  2EIJ B;  5LYJ B;  2IJI A;  1Q82 W;  4UVB A;  1SRY A;  2GUZ A;  3WG7 C;  3ETG A;  4LNU B;  4DR2 O;  1FXV A;  5HFM A;  1VQO V;  1XNR B;  1PNM A;  5EIB D;  4JI5 B;  2R72 A;  3AG4 C;  2NLJ C;  3E8H A;  4B3M O;  2WAM A;  2YIA A;  1TUB B;  1DF4 A;  2EIM B;  1VF6 A;  2VQF O;  1E79 G;  4X89 A;  4I50 B;  1K4C C;  3QF7 A;  4F6R B;  5JVD A;  4X66 O;  4OX9 B;  1QQC A;  3GWK C;  5B1A C;  1OHH G;  2IW5 A;  3JD1 A;  1PNL A;  2DW4 A;  3SJC C;  4DV0 O;  3O65 A;  1IXB A;  4MVQ A;  5ITZ B;  1FFX B;  2EBO A;  4RUF A;  2Q7E A;  2QDO A;  2PTM A;  4H0L B;  1EZJ A;  4AHC A;  1Z2G A;  5B66 Z;  4UXN A;  3ICX A;  1MAB G;  2O57 A;  3K0D A;  4GKJ B;  3CCE V;  1Q3E A;  5CA0 B;  3F5W C;  4KHP O;  1HWY A;  4U3J B;  3H1I H;  2UUC O;  4JI8 O;  2GHY A;  4U7O A;  1ZSP A;  4YY3 O;  1RPR A;  2BTO A;  4TV9 B;  2MK3 A;  1GN3 A;  4WBN B;  2Y4U A;  5EK0 A;  4CZZ A;  1IZ3 A;  1XL4 A;  3L73 H;  3ASO B;  4U3F H;  4HYO A;  3R66 A;  5CMU A;  1F7Y A;  4X1I B;  4LF8 B;  3P3P A;  4DRX A;  3U10 A;  1K5Q A;  1OZ0 A;  5GTH Z;  1F23 A;  3VOU A;  2E5L O;  3ASN B;  5FNV B;  1IBK B;  1B04 A;  1B06 A;  3OEE G;  4TUY A;  2PI4 A;  3E2E A;  3L75 H;  1TVK B;  1F4M A;  3DTU B;  4X20 B;  4O2A A;  2ZIN A;  2JEU A;  3ZMV A;  3W7W A;  2UUA O;  4DV3 B;  4GX5 A;  3AK1 A;  4Z1V A;  4J41 A;  3ZHS A;  4DV7 O;  4B3S B;  4O2B A;  3M8A A;  1OCZ C;  1JJ2 U;  1ZX3 A;  2EIN C;  2FML A;  3MDS A;  1I5X A;  4ZHQ A;  1R6K A;  1GM9 A;  3AG2 B;  3GB7 C;  5KHG A;  3WB1 A;  3CP1 A;  1DF5 A;  1SQQ H;  3K3W A;  5LHI A;  3JAS B;  5BMV A;  4MS2 A;  4O4J B;  4DV1 B;  2RMK B;  5EYP B;  2CUG A;  4O4L B;  3MD0 A;  2FYU H;  1WA8 A;  4K0K O;  4FFB A;  1JMK C;  4I4T B;  1N34 O;  3BA9 A;  4NR1 A;  5KAF Z;  3UQ8 A;  3QO7 A;  5D5Q A;  2UU9 B;  3HKB A;  1KYO F;  2QTO A;  4ZOL B;  2YXH A;  5CB4 A;  4FPP A;  5J2U A;  2E76 B;  5J2T B;  1H2S B;  1RSO B;  3GVM A;  4TV8 A;  1E1R G;  3ZCC A;  3OUF A;  4K3A A;  4YHH O;  5LYJ A;  4TOI A;  3A0H Z;  4DR5 B;  4LNU A;  4PHZ A;  1I7F A;  3OMN B;  1AI6 A;  2OTJ V;  1DLB A;  3T1H O;  2QSA A;  1TUB A;  5LHH A;  4O4H B;  1VEW A;  5CA3 A;  5KAI Z;  4I50 A;  5IYB O;  3B8N A;  4F6R A;  5IWA B;  4J10 A;  4JI0 O;  5KUM A;  2PI5 A;  4J7J A;  2ETN A;  4RO2 A;  1KKC A;  1VQM V;  1S77 D;  1RM1 C;  1V9P A;  4Q20 A;  3M99 B;  2JS3 A;  4R8C A;  5TIS Z;  2Q6A A;  4DV4 B;  5ITZ A;  5KLV H;  4X64 O;  3JAM N;  4B08 A;  3LDE A;  1MZE A;  3ZED A;  3D3I A;  1JA8 A;  4EFE A;  3NR7 A;  3AG3 C;  2OIG A;  1QLE C;  1VQK V;  2EIL B;  1S5L Z;  3J81 N;  4LFB O;  5CA0 A;  4KP4 A;  3STZ C;  3WU2 Z;  4U3J A;  2KSD A;  2F43 G;  3WG7 B;  4I0X A;  3E8G A;  4TV9 A;  4IIJ A;  2JEX A;  5EC1 C;  4H13 B;  4WBN A;  3CRQ A;  1WP7 A;  1GRJ A;  4B7K A;  2P06 A;  4J9Z B;  1ZTE A;  3IGA C;  4J42 A;  4YIO A;  4X1I A;  5FPR A;  1GMG A;  4GX2 A;  4CC6 A;  1IBM B;  2LW1 A;  1GKF A;  4UCO A;  3AEI A;  5FNV A;  1COW G;  3H1J H;  3T2M A;  1XNR O;  1QBZ A;  3K59 A;  3CJH A;  3ZHV A;  4JI5 O;  1FXK C;  4FIP C;  3BY6 A;  4L8J A;  5LMN B;  2CTR A;  1NS1 A;  4P9O A;  2P67 A;  4JTC B;  2Z0A A;  4MVR A;  1TVK A;  3RYH B;  1L0N H;  4X20 A;  3ZHQ A;  2F95 B;  4OX9 O;  5JJJ B;  4PI0 A;  1M56 C;  4DW0 A;  4NKG B;  2E3C A;  2H8P C;  2LP7 A;  3L74 H;  3APQ A;  2PYL A;  2N04 A;  4LFA B;  2QE7 G;  4QJF B;  1PL0 A;  4MTF A;  4JI1 O;  4JI4 O;  1YIT V;  2YID A;  1BGY H;  2ZR2 A;  3H01 A;  2DYS C;  4DR4 B;  1GH6 A;  5K1X A;  2HEP A;  3JAS A;  4PDR A;  4HNA B;  3D36 C;  4O4J A;  1G1X B;  3ZRW B;  1AI4 A;  3RYF B;  2GDS A;  3E8F A;  3LNM B;  5LGU A;  1AI7 A;  2JS5 A;  1HNZ B;  2OWO A;  1IBL O;  1XL6 A;  4BAY A;  1YSC A;  3THO A;  3WB2 A;  1A32 A;  3JAR B;  2XT9 A;  3KZI Z;  3CMA V;  5KUK A;  1VAR A;  4Z2W A;  2H3O A;  4NTW A;  4NYK A;  4CH4 A;  5J2T A;  1RSO A;  4LF8 O;  2UUB B;  2Q67 A;  1RPO A;  1NU1 H;  2H94 A;  3DSQ A;  4UB8 Z;  1AJN A;  1FJG B;  4UCS A;  1KC8 W;  5LP6 C;  1OCZ B;  5BZB A;  3RT3 C;  2EIN B;  1N8R W;  5CA1 B;  1R1B A;  2R9R B;  4O4H A;  1VMG A;  2DYR B;  3JAW B;  5KHH A;  3VQW A;  4X62 B;  1M4U A;  3OM3 B;  4CH3 A;  3IC9 A;  1M93 A;  4JI6 B;  1M90 W;  1EM1 A;  3QO8 A;  2YS8 A;  2R9A A;  2XAJ A;  4B3S O;  4RAI A;  1V54 B;  4I55 A;  1I5Y A;  2DN9 A;  1W59 A;  3DGE A;  2JDI G;  1VIB A;  2YEV B;  3LNN A;  5GTI Z;  1H2L A;  2Q8V A;  1GN4 A;  4MTO A;  5K1P A;  1DK1 A;  5KA6 A;  1SQX H;  4LR3 A;  1KB9 F;  4I9W A;  4MW8 A;  4OGQ B;  5EBW C;  1D5N A;  2WA3 A;  1EN4 A;  2ZDI C;  1KEC A;  5FL7 G;  1GAX A;  1AJQ A;  4CS4 A;  1FAF A;  3RYC B;  1H8H G;  1N32 O;  1XDC A;  2CTQ A;  3G6B A;  4JZG A;  3K04 A;  3LUT B;  1VQN V;  1L0L H;  3CRA A;  1EFR G;  1THZ A;  4IHJ B;  2YXL A;  4X88 A;  1BQ0 A;  1RM1 B;  4DR5 O;  1J5E O;  2RJZ A;  3SPI A;  3ABK C;  2HJD A;  1YEW A;  1KMI Z;  3RFR A;  2DQ0 A;  2Q9L A;  4C7U A;  2DOS A;  4DXW A;  3JAK B;  1QU7 A;  3RVZ A;  3T1C A;  1GO3 F;  3C3S A;  4X1Y B;  3RYH A;  4ABM A;  5IWA O;  3AG3 B;  4KFM A;  3ABT A;  4K35 A;  1QLE B;  2JGD B;  4Q6G A;  1FPO A;  2WWW A;  1CP9 A;  1U97 A;  1K92 A;  4PDL A;  1H38 A;  5KHK A;  1Q7Y W;  4TSF G;  1LUW A;  4X1K B;  1E1Q G;  4D7S A;  4DR7 O;  1W2B U;  4CC5 A;  1P49 A;  2WLL B;  4JPR A;  1BHA A;  3D8C A;  4LF5 B;  4H44 B;  4N21 A;  1I0H A;  4GUN A;  4HNA A;  4J80 A;  5BY1 A;  1IX9 A;  3A0R A;  4JYA O;  3RYF A;  4JF3 A;  4FM0 A;  1TGO A;  1EN5 A;  1XBL A;  4TQD A;  4LF7 O;  1N36 B;  4J9Y B;  5JCO C;  1K5S A;  3ZRX A;  2ZE5 A;  3JAR A;  1FXK B;  1XIL A;  3TCU A;  5H6Q A;  4B3R B;  4NB5 A;  3A2F A;  3P30 A;  5LGT A;  2PGG A;  1WPX A;  2ZE7 A;  1LR1 A;  3CME V;  1BMF G;  1PPJ H;  3CPW U;  1VQ5 V;  5KMG B;  3EVK A;  1MZF A;  3B40 A;  5CBF A;  1ORQ C;  2UXD O;  1YJN V;  1O9G A;  1LUV A;  1HNX B;  1M57 C;  1US6 A;  5FLX N;  5LMN O;  4JTA B;  5LBQ A;  1S0V A;  3ZMU A;  2DYS B;  2UXN A;  3SDL A;  2P4V A;  3JAW A;  2Y48 A;  2JJ1 G;  2OIE A;  1BL8 A;  2XHB A;  3SR2 C;  1SES A;  3CCJ V;  4PJ0 Z;  1EBO A;  4K8X A;  4MSW C;  2E75 B;  3SYQ A;  4LFA O;  4UVA A;  1CPY A;  1ZL8 A;  5A2Q N;  1J95 A;  1S3J A;  2L6L A;  1VQP V;  4DR4 O;  4HZ3 A;  5C8Y B;  3K03 A;  3HKC B;  3H1L H;  3ABL C;  3TET A;  2DWE C;  5IYC O;  1H2N A;  3CCQ V;  1OV9 A;  3BCC H;  3MHH C;  2X0L A;  3U0Z A;  4JI7 O;  3UT5 B;  2NNU A;  4A5U B;  5C93 A;  4HBN A;  5LP6 B;  1Q6I A;  2XUM A;  1Q6U A;  5J9P C;  2W6J G;  3RYC A;  2RNB A;  2B1I A;  5L3G A;  3SPJ A;  3RGB A;  2QKA A;  2ITD C;  1QR9 A;  3A0B Z;  4JYY A;  4U7N A;  2B9Z A;  1H2M A;  4IYI A;  1QNM A;  3ZHR A;  5IYZ B;  1SQF A;  5JH7 B;  4IHJ A;  4DV6 B;  1D2D A;  1TAE A;  2F1M A;  2LFS A;  2W6I G;  3T1Y B;  1FJG O;  3CWB H;  1ROP A;  4RWU A;  2JGU A;  5EZY B;  1VF5 B;  3JAK A;  3FB7 C;  2BSK B;  3JD0 A;  1NZ6 A;  4X1Y A;  4WFA V;  4TWK A;  4LWS B;  4DR6 B;  1BS3 A;  4DV2 B;  4MVO A;  1XQ8 A;  2JGD A;  1AJP A;  1R73 A;  2ITC C;  2XAS A;  1BT8 A;  5DEC A;  1SS3 A;  4LF9 B;  1AR1 B;  2OCC C;  3L72 H;  4DUY B;  4X1K A;  3OT7 A;  3RYI B;  3K57 A;  4FFK A;  1K73 W;  5LMU B;  2Z3Y A;  3DXR B;  2DWD C;  2QWN B;  5EBM C;  4DR3 B;  1EN6 A;  1N0N A;  5IJ0 B;  4YJ2 B;  4YJ3 B;  1K8A W;  2LGW A;  1I94 O;  3EXA A;  4MTX A;  5IY5 B;  1Q90 D;  4DV5 B;  1U96 A;  4R6Z A;  1H8E G;  1CXZ B;  4DR1 O;  3DC6 A;  3BA8 A;  4JTD B;  3LDD A;  2AGA A;  3ABK B;  4DO2 A;  1OCO C;  1XMQ O;  3OD4 A;  1FXK A;  3BAB A;  4W4L A;  1YF2 A;  3AK2 A;  3IJ4 A;  1MNG A;  1TUE B;  3K58 A;  3KCY A;  2CH7 B;  3FX7 A;  1SKV A;  2XTA A;  3Q4H B;  5LHG A;  3HKD B;  4MVU A;  4WFE A;  1Y74 B;  2Q68 A;  2QR4 A;  4F6E A;  5KMG A;  4XDJ A;  3LSQ A;  4AI8 A;  1AR4 A;  2CE4 A;  2HLD G;  2VWJ A;  4Z1M G;  5F2V O;  2HG5 C;  4RQE A;  5CBG A;  1JCH A;  1SA0 B;  3TK1 A;  1KQS U;  4P9P A;  1P7B A;  4XDL A;  3OTO B;  1VF7 A;  5L3B A;  3C90 A;  5LOV B;  2JRI A;  1N4C A;  3U11 A;  1JOY A;  2V4D A;  1FFX A;  5C8Y A;  1VQ4 V;  2UXB B;  1SQG A;  4YIP A;  1KP3 A;  4ASU G;  4BIU A;  5JWP A;  3OTF A;  5B1O A;  4WFG A;  5LXT B;  3SGI A;  3ZN0 A;  3OGI B;  3BEH A;  5B3S C;  5D5P A;  2UXC O;  3F7V C;  2ZE8 A;  4NXN B;  4JI2 B;  1SQV H;  5DM6 V;  5LP6 A;  2CK3 G;  3F7Y C;  2QEX V;  1JPX A;  1JR9 A;  1M57 B;  1R6N A;  4B3R O;  2EJ7 A;  1VQL V;  3ZHU A;  3B8M A;  3MAQ A;  1JFF B;  3K5N A;  3AG4 B;  3I55 V;  1HNW B;  2ZM6 B;  1PNK A;  1ENV A;  3MHS C;  1M1K W; 
#chains in the Genus database with same CATH homology
 2XAG A;  4PDV A;  4RAI A;  1V54 B;  3RW0 A;  4LBE C;  2WPD G;  4H33 A;  4QPK A;  4F4L A;  1MSW D;  1I5Y A;  3OW2 U;  3QNE A;  4JYC A;  3DGE A;  1Y66 A;  2JDI G;  2AHY A;  3OFN G;  3FYE B;  1DTO A;  2WLN A;  5B1A B;  2XOK G;  2Z5U A;  2YEV B;  5DN6 G;  4FMT A;  3OR7 C;  4JYB A;  3SYC A;  4R7C A;  1F4N A;  2EIL C;  2EIK C;  4PA9 A;  4UVC A;  5IYD O;  4MW3 A;  4MTO A;  3CCR V;  1ZWI C;  5KA6 A;  4XBF A;  3ML0 A;  2EIJ B;  4JGS A;  5B1B C;  2IJI A;  3ABL B;  1Q82 W;  1W0K G;  4UVB A;  1SRY A;  3WG7 C;  3ETG A;  2DYR C;  3EHB B;  1FXV A;  4I9W A;  4MW8 A;  5HFM A;  1QCE A;  5EBW C;  1VQO V;  1PNM A;  2ZR3 A;  3W7U A;  3QO5 A;  2ZDI C;  1KEC A;  5FL7 G;  4MVS A;  3AG4 C;  1AJQ A;  2NLJ C;  3E8H A;  2QKS A;  3CCS V;  2WAM A;  1DF4 A;  2EIM B;  1H8H G;  3SPH A;  1E79 G;  1V54 C;  4X89 A;  1K4C C;  3E86 A;  2WLK A;  3K04 A;  3LUT B;  3MHS C;  3K08 A;  4QE7 A;  3K9A A;  1VQN V;  5B1N A;  4YXW G;  5B1A C;  5L3C A;  3G71 V;  3HPL C;  4UV9 A;  1OHH G;  2IW5 A;  1EFR G;  1THZ A;  3JD1 A;  1PNL A;  4X88 A;  1GTO A;  1RM1 B;  2DW4 A;  3AG1 C;  1MG1 A;  4P30 A;  2HKO A;  4MVQ A;  3NXS A;  3SPI A;  2EBO A;  4RUF A;  3ABK C;  2EIJ C;  2DQ0 A;  3D36 A;  2DQ3 A;  1EZJ A;  5H6R A;  5L3D A;  4DXW A;  4JAU A;  3RVZ A;  4MVZ A;  3T1C A;  1LNQ A;  4PA3 A;  4UXN A;  3E83 A;  5HFL A;  1GO3 F;  3E89 A;  5EC2 C;  1MAB G;  3K0G A;  1S5H C;  1VQ9 V;  3K0D A;  3CCE V;  3JD2 A;  3AG3 B;  3F5W C;  4KFM A;  4GX1 A;  3ABT A;  1QLE B;  1HWY A;  2GHY A;  1WLE A;  2WWW A;  4JAS A;  2WLJ A;  4TT3 G;  4U7O A;  1CP9 A;  3ZIA G;  3OE7 G;  3LDC A;  1K92 A;  3ZRS A;  4PDL A;  1H38 A;  1RPR A;  2MK3 A;  1K9M W;  1Q7Y W;  4TSF G;  1YTF B;  2ZXW C;  5EK0 A;  4RQF A;  1PD3 A;  1E1Q G;  4WFB V;  3X2Q C;  3I56 V;  1W2B U;  4P2Z A;  4CZZ A;  3ZMZ A;  2OCC B;  2UXX A;  2WLL B;  1XL4 A;  4ZKI A;  4JPR A;  1BHA A;  5L3E A;  3ASO B;  3FB6 C;  4HYO A;  4JAV A;  4N21 A;  1ARO P;  5CMU A;  5H9C A;  3CCV V;  3P32 A;  2HR3 A;  1K5Q A;  3A0R A;  5CN0 A;  1OZ0 A;  1F23 A;  4JF3 A;  2P6J A;  3VOU A;  5CBH A;  5IDJ A;  1S72 V;  3OEH G;  3G6E V;  3ASN B;  4LP8 A;  2P7T C;  4FK5 C;  2HJF C;  4I5S A;  4J9Y B;  3ZJZ A;  3OEE G;  2PI4 A;  1K5S A;  1NH2 B;  3ZRX A;  3E2E A;  2Y69 B;  3ZMS A;  3ZN1 A;  1P4R A;  2BOB C;  1YHQ V;  1FXK B;  1NQT A;  3OGC C;  3OMA B;  1F4M A;  1Q81 W;  3DTU B;  5H6Q A;  1OCO B;  3TCU A;  2BOC C;  3W7X A;  4WFH A;  3P30 A;  5LGT A;  4PA7 A;  1FFT B;  2JEU A;  2Q69 A;  1WPX A;  3ZMV A;  3W7W A;  1NVP B;  4GT1 A;  4FJC C;  3ABM C;  3G4S V;  1Q86 W;  4GX5 A;  3CME V;  1NR7 A;  1BMF G;  2X7R B;  1OCZ C;  1JJ2 U;  3B77 A;  2EIN C;  4E2L A;  1G4Y B;  1QR8 A;  3CPW U;  2YSU B;  1I5X A;  1OCR C;  2WLH A;  1R6K A;  1GM9 A;  3AG2 B;  1VQ5 V;  3CCL V;  3GB7 C;  2WLI B;  5CBF A;  1ORQ C;  3CP1 A;  1YJN V;  5L3F A;  1DF5 A;  3K3W A;  5LHI A;  4WFF A;  1M57 C;  4G28 B;  3CCU V;  4JTA B;  5LBQ A;  1S0V A;  2KB1 A;  4QPJ A;  3ZMU A;  2R9I A;  3OMI B;  2DYS B;  2UXN A;  4MS2 A;  2A79 B;  3FB5 C;  3CD6 V;  2IU3 A;  2Y48 A;  3ZRV A;  4G2K A;  2JJ1 G;  1BL8 A;  1K33 A;  1OCC C;  3MD0 A;  2ZDI A;  2WLM A;  1SES A;  4GX0 A;  2IU0 A;  3CCJ V;  1EBO A;  4HAM A;  2D3O W;  2OT5 A;  2HVK C;  2AHZ A;  4MSW C;  1JQ0 A;  3SYQ A;  3QO7 A;  4UVA A;  1CPY A;  1J95 A;  1S3J A;  1R3L C;  1VQP V;  2QTO A;  2A0L A;  4FPP A;  3SPC A;  4PDM A;  3CXC U;  2B5U A;  4HZ3 A;  1V55 B;  3K03 A;  3ABL C;  3TET A;  1SER A;  1E1R G;  2DWE C;  3ZCC A;  3OUF A;  5IYC O;  3SJQ C;  3CCQ V;  1YJW V;  4OXS A;  4PA6 A;  2K1E A;  2W0F C;  3MHH C;  2X0L A;  3GWO A;  3OMN B;  1AI6 A;  2NNU A;  2X6C A;  2EIM C;  2V1D A;  1YJ9 V;  5C93 A;  1DLB A;  2OTJ V;  3T4Z A;  3FB8 C;  3FKS G;  2EZO A;  5B3S B;  5J9P C;  5LHH A;  2W6J G;  4WF9 V;  4N23 A;  2B1I A;  5CA3 A;  5L3G A;  3SPJ A;  2QM8 A;  1FS0 G;  5IYB O;  2ITD C;  1QR9 A;  3B8N A;  1NKD A;  1F51 A;  5KUM A;  2PI5 A;  4U7N A;  4PEL A;  4RO2 A;  4LCU C;  1VQ8 V;  4BIZ A;  1VQM V;  3KG2 A;  1S77 D;  1RM1 C;  2OTL V;  4UUJ C;  3SYP A;  3CC2 V;  4Q20 A;  3M99 B;  1CEZ A;  3K06 A;  4R8C A;  5EBL C;  2Q6A A;  4MT8 A;  5LGN A;  4MVM A;  3OR6 C;  1JX9 A;  2LFS A;  2W6I G;  3ZRW A;  3STL C;  2P90 A;  1ROP A;  4KUM A;  3LDE A;  4RUE A;  2XAH A;  4UV8 A;  3EFF K;  3FB7 C;  3JD0 A;  3D3I A;  1AI5 A;  3ETD A;  4X8A A;  2XND G;  3AG3 C;  3RBZ A;  4WFA V;  1QLE C;  1VQK V;  2EIL B;  2EIK B;  4TWK A;  4QE9 A;  4MVO A;  4KP4 A;  4WCE V;  3STZ C;  1K4D C;  1SET A;  3JD3 A;  3ABU A;  3JD4 A;  1AJP A;  1NJI W;  1R73 A;  2ITC C;  1QVG U;  1BHB A;  2XAS A;  5B1B B;  2F43 G;  3CYO A;  3WG7 B;  2B1G A;  3E8G A;  2ZQM A;  1B6Q A;  2JEX A;  5EC1 C;  1AR1 B;  2OCC C;  1FXH A;  1R3J C;  3ASO C;  1R3K C;  3VBB A;  1M56 B;  3LSS A;  3SYA A;  1VQ7 V;  1KKD A;  1K73 W;  4J9Z B;  3IGA C;  2Z3Y A;  3CC7 V;  2IH3 C;  2DWD C;  3IFX A;  5GW7 A;  5EBM C;  2QM7 A;  1SZT A;  2XAF A;  3PJS K;  1GMG A;  4GX2 A;  1GM7 A;  3ASN C;  1K3E A;  1K8A W;  4MTX A;  5IY5 B;  1L1F A;  3RVY A;  2IJK A;  1GKF A;  3AEI A;  2A9H A;  4R6Z A;  1COW G;  2M7W A;  3T2M A;  2Y69 C;  1G8M A;  4QIW F;  1H8E G;  3AG1 B;  1QBZ A;  4H37 A;  1FXK C;  2JK5 C;  4FIP C;  4JTD B;  3BY6 A;  3HB3 B;  3LDD A;  3ABK B;  4DO2 A;  1OCO C;  4P9O A;  2P67 A;  4JTC B;  1GM8 A;  1FXK A;  1NR1 A;  4MVR A;  1GK9 A;  3OAA G;  4EKW A;  3ZMT A;  3WFV A;  2C2A A;  1TUE B;  4QNH B;  2XAQ A;  1YIJ V;  2IJJ A;  1M56 C;  2YEV A;  4G27 B;  3SYO A;  2H8P C;  2LP7 A;  2HVJ C;  2GSM B;  3K79 A;  4R50 A;  1QLN A;  3AG2 C;  3UM7 A;  2QE7 G;  4QJF B;  3JCZ A;  1PL0 A;  4MTF A;  5LHG A;  1YTF D;  4MVU A;  4WFE A;  3E8B A;  1YIT V;  2Q68 A;  4PA4 A;  4XDJ A;  3IC7 A;  3LSQ A;  2WLI A;  2ZXW B;  5IY5 C;  1IXM A;  2ZR2 A;  3H01 A;  2DYS C;  2IH1 C;  1PKX A;  3X2Q B;  4PDR A;  2HLD G;  1NBM G;  3OUS A;  2FTK A;  2X6A A;  4Z1M G;  2ZD9 A;  3ZRW B;  2JJ2 G;  1AI4 A;  3JYC A;  3W7T A;  2HG5 C;  3E8F A;  3LNM B;  4RQE A;  5CBG A;  5KA5 A;  3W7S A;  1JCH A;  5LGU A;  1AI7 A;  2IJH A;  3TK1 A;  1S76 D;  1VQ6 V;  1KQS U;  4P9P A;  1P7B A;  1XL6 A;  4ZBM A;  4BAY A;  2QA4 V;  1NH2 D;  1YSC A;  4XDL A;  1R3I C;  2V7Q G;  1Y4M A;  3CC4 V;  4MTG A;  5L3B A;  1V55 C;  1YI2 V;  3CMA V;  5KUK A;  1JOY A;  1MOF A;  4CBC A;  1VQ4 V;  1KP2 A;  1JVM A;  1NVP D;  2ATK C;  1KP3 A;  4ASU G;  4BIU A;  2LFR A;  2X6B A;  3FYI B;  3CCM V;  1W0J G;  2Q67 A;  1KD1 W;  1QVF U;  3ABM B;  5B1O A;  1RPO A;  2H94 A;  4LC1 A;  3UKM A;  4WFG A;  3ZN0 A;  1AJN A;  3ETE A;  3BEH A;  1KC8 W;  1OCZ B;  5BZB A;  2WSS G;  2EIN B;  5B3S C;  2EJR A;  1N8R W;  2JIZ G;  1UJW B;  3F7V C;  1OCR B;  5DM6 V;  3R65 A;  4BW5 A;  4XDK A;  1K97 A;  2CK3 G;  2R9R B;  3F7Y C;  2QEX V;  1JPX A;  2DYR B;  1M57 B;  4L87 A;  1R6N A;  1M9N A;  1K7D A;  5E1A C;  1VQL V;  3B8M A;  3OM3 B;  2EZP A;  2HFE C;  3AG4 B;  3T4D A;  3I55 V;  4GCZ A;  1M90 W;  1PNK A;  3QO8 A;  1OCC B;  2WLL A;  3SPG A;  1K34 A;  1ENV A;  1M1K W;  3E35 A;  2XAJ A;  1H2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...