2ITCC

Potassium channel kcsa-fab complex in sodium chloride
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
molecule keywords Antibody Fab fragment heavy chain
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2itcC00
4PA6A 5CBFA 1G4YB 4JTCB 4P30A 4HZ3A 2ZD9A 3ASNC 1JVMA 4RAIA 3FB8C 3OR6C 3K04A 4PDVA 3LUTB 2W0FC 4PA9A 4MS2A 3STLC 1R3IC 2EIKC 2HG5C 3AG4C 3IFXA 3LDEA 4PDLA 4XDJA 3T1CA 2WLHA 3E89A 4WFFA 4DXWA 4F4LA 3FB6C 1KKDA 5EBMC 1OCZC 5E1AC 3E8GA 4JTAB 5KUKA 2ZXWC 1OCOC 2YEVA 4MVQA 3F7VC 4QE7A 2A79B 3AG3C 2HVJC 2ITDC 3SYOA 3K03A 1ORQC 2Q67A 2WLLB 4I9WA 4XDKA 3E8FA 4G28B 3ABMC 2EIMC 3GB7C 3T4ZA 2EIJC 4ZBMA 1R3KC 3OR7C 4HYOA 4PA4A 3SPCA 3SPGA 2WLJA 2QKSA 2DYSC 2JK5C 5B1BC 3SYCA 3LDDA 4G27B 4PDMA 4RUEA 3K06A 4WFGA 2AHYA 4MVOA 2A0LA 3SPIA 4MW8A 2WLIA 4GX0A 4BW5A 2HVKC 4H33A 4H37A 4QNHB 4J9ZB 5CBHA 2R9RB 1S5HC 2IH1C 2X6AA 3ABKC 2P7TC 5BZBA 1J95A 3OUFA 5IY5C 4XDLA 4WFHA 2X6CA 3FB5C 4CBCA 2WLNA 4KFMA 3RVZA 4PA7A 4QE9A 4TWKA 2NLJC 5EC2C 4MTGA 1ZWIC 2WLMA 2ATKC 1R3LC 2K1EA 2DYRC 1M56C 4OXSA 5CBGA 3WG7C 3E83A 4P2ZA 4GX2A 4LBEC 4MVZA 2DWDC 3UKMA 3IGAC 1M57C 3FB7C 1BL8A 2BOCC 2Y69C 3RW0A 2QTOA 5J9PC 4MVMA 4MVRA 4P9PA 3K0DA 4J9YB 4MTOA 2DWEC 3SYAA 1OCCC 4MTFA 4R6ZA 2A9HA 2Q69A 3E86A 4WFEA 3K0GA 3RVYA 3UM7A 4GX5A 4EKWA 2KB1A 2IH3C 4LCUC 4RO2A 3JYCA 2Q68A 2H8PC 2WLLA 3EFFK 4MVUA 1K4DC 3STZC 4X8AA 3PJSK 3X2QC 4X89A 1XL4A 3KG2A 5B1AC 3SYQA 3ZRSA 3HPLC 1V54C 3LNMB 3SYPA 3ZJZA 1OCRC 3VOUA 3F5WC 2WLIB 3AG1C 1P7BA 3ASOC 4PDRA 1LNQA 4GX1A 4R8CA 2WLKA 3SJQC 2HFEC 3E8HA 4PA3A 4UUJC 5EBLC 3TETA 3SPHA 5KUMA 3ABLC 4MVSA 5EBWC 3RBZA 3T2MA 1R3JC 4LP8A 3F7YC 3TCUA 3K08A 1QLEC 2OCCC 3LDCA 1XL6A 3OGCC 4MSWC 4R7CA 5EC1C 3R65A 2BOBC 3E8BA 4R50A 2EINC 1K4CC 2X6BA 4MW3A 2ITCC 3SPJA 4RUFA 5EK0A 5B3SC 3AG2C 4JTDB 4P9OA 2AHZA 2Q6AA 3OUSA 2EILC 3BEHA 2HJFC 3T4DA 4X88A 1V55C
chains in the Genus database with same CATH superfamily
3N2GB 1DLBA 1BZKA 2GDSA 4DR5B 1FFXB 1M5IA 5CA1B 1JX9A 1YXBA 5LXTB 1XMOB 2OTLV 1M4UA 3MAQA 3OEHG 3CSXA 4UVBA 1THZA 2A3QA 4X1KA 1N33B 3FYIB 2PI5A 1QVGU 4K0KB 4EB6B 5IYZA 2PF4E 1GMGA 3BCCH 5B1BC 3O65A 3SYCA 4DV0B 1OCOB 4ZI7B 4LF6B 4JI6B 4YJ3B 1AR5A 2P90A 4GKKB 3ZX6A 2W0XA 4J7ZA 2AW9A 1K97A 1NR1A 4FK5C 1JA8A 2IJIA 4H37A 5HFLA 3CCSV 4UFZA 4YJ2B 2IH1C 4NR1A 2XTAA 4JI7B 4RQEA 3G6EV 1BQZA 5IE9A 1KC8W 3RVZA 3H1KH 3QNEA 4JI4O 2ATKC 2CTQA 5IDJA 5D5PA 2B9ZA 4DR1O 4WCEV 1COWG 2JGUA 3K9AA 1KP3A 5L3DA 3WB1A 3K0DA 3JSNA 1OCCC 1N36B 3TGUH 4O4LB 4JI2O 5IYZB 2QDOA 5J2UA 5KMGA 4JI5O 4X8AA 1F4MA 2QWPB 4E4EA 5GTIZ 2LQTA 3IC7A 3L74H 2OWOA 3F5WC 3AG1C 4QGPA 1KP2A 3JCZA 4BW9A 1Q43A 2YS8A 3E8HA 1LUVA 2DOSA 2JRIA 5EBWC 3LSUA 1XL6A 3JD4A 2OYQA 2QEXV 3CPWU 4LF4O 4TV9A 2ZQMA 2B1IA 2EILC 2ZNJA 2D2CB 2LO1A 1N8RW 1V9PA 4N23A 1JJOA 4RAIA 3OR6C 4CH5A 3C90A 4TQDA 3T1HB 3WFVA 4B3TO 1XNQO 2HVJC 4BAYA 5J2UB 5KMGB 4BIUA 4F6RA 3OTOO 3HKEA 4OGQB 1WB8A 2EIKB 3SPCA 1P49A 3SPGA 1JCHA 2DYSC 4LFCO 4IHJA 4J42A 2YICA 1AJNA 2ILMA 3ZRWA 4H0LB 3OMIB 1HNXO 1Z5WA 3CRMA 1PV0A 3CRAA 4N21A 4J9ZB 3KCYA 1RPOA 2FL4A 2QM4A 3OUFA 2NN4A 4TV9B 4J80A 4GUNA 1NI8A 3OM3B 2XAJA 4OXSA 3IAYA 1PL0A 4I50A 4X62O 1ZL8B 4UCOA 3ZMSA 2P67A 3B4SA 2Y69C 5JJEB 2FYUH 3JALA 2PYLA 4JF3A 2DWEC 2AXTZ 5LP6A 1RPRA 1B04A 1VF7A 3HKEB 1VQ8V 3ZHTA 4IHJB 1QLNA 4FMTA 2Y4TA 3W7WA 4JI3B 2UUCO 4HBNA 2F43G 3H1JH 2DW4A 1GM7A 1TUEB 1FJGO 1R3JC 3K08A 1IXBA 4LF5O 1FKAO 2E75B 5B1AB 4JI1B 5CB4B 4DV5O 3CXHF 3VQWA 2CE4A 2RMKB 2Q6AA 3ZMVA 1MABG 4DW0A 2M7WA 1G4YB 4JTCB 4LWSB 1CPYA 3JALB 2W0FC 1FXKC 5LHIA 5GW7A 1KKDA 4O4JA 3CXCU 5LP6B 3ZMTA 1EBOA 2EBOA 3DXRA 5FL7G 5KHGA 2A7WA 3M7MX 2Q67A 1JPXA 4JGSA 2Q7HA 4JYAO 2VQFB 4LF9O 4X65B 3LDDA 1QR8A 4WFGA 4JI4B 4KUMA 4DR1B 3JD1A 3N2KB 3TJTA 1XBLA 5E79Z 4EEQA 2P7TC 2IU0A 4DK0A 2VQEO 1FS0G 1NKDA 4PHZA 3JAKA 3B77A 4JI2B 3RYHB 2PI4A 1YZBA 3FX7A 2DYRC 1Y6XA 3RGBA 3E83A 4JI5B 4JAVA 3UO2A 2VWJA 1KUQA 3ABKB 4WBNA 3IGAC 3FB7C 4O4JB 1VQNV 3DXRB 4UB8Z 2R70A 4NTXA 2CGNA 3W7TA 3OT7A 3RVYA 1JFFA 1SZTA 1G1XB 4LCUC 4B08A 4CS2A 2XAFA 3ZEDA 1GK9A 3TXQA 4LF4B 1WN7A 1ZUQA 2UXXA 1Q8IA 3W7XA 1BHBA 2WAMA 4CS4A 2CTRA 5KA5A 5L3EA 5J2TB 4JPRA 4R50A 1XNQB 1E1RG 2X6BA 4I0XA 3WU2Z 1M9NA 1Y67A 3OTOB 4FPPA 1K5QA 4WBNB 2FKXA 4TOIA 2Y0IA 5IT9N 4LFCB 3JATB 3AG4C 4L87A 4ASUG 1VIBA 4LC1A 3A0RA 1KKCA 1YCIA 3BRCA 3ETGA 3J7AU 2YEVA 4HNAA 2A79B 1S72V 2GTSA 3K57A 4LNUB 1I94O 3ABMC 3ABTA 3T4ZA 4ZBMA 4DV6O 2WLJA 3OD4A 5KHJA 3CCQV 2RN9A 2ZT9B 4DRXA 4H13B 2F66C 1CEZA 2RCVA 3QO5A 2UUAO 4X62B 4IYIA 1S77D 2QWQB 1YF2A 4RWUA 1N0NA 1YTFD 3DC5A 1J95A 1L1FA 1NQTA 1QU7A 4WFHA 5BR8O 3O9OA 1SKVA 3LSQA 1ZWIC 4B3RO 4XBFA 4J11A 4JI0O 3AK2A 4LBEC 4FLZA 4FZ1A 4L8JA 1GN3A 3HB3B 2YEVB 1TVKA 3CCEV 1K3EA 2W6IG 3R66A 2AGAA 2F1MA 4LF5B 2UXBO 4OPHA 2UXDB 3KCXA 1Q90D 4DV5B 1O9HA 3CCJV 4DRXB 3SYPA 5GONB 1AJPA 5BY1A 5IYBO 3D36C 2GV9A 2HP8A 3MHHC 4CH4A 1WAZA 4B3SO 1ZAUA 4LP8A 2QWOB 1UJWB 3OGCC 1IBLO 3ETDA 4LH6A 4TQFA 5CA3A 2Q0AA 1IBKO 1ROPA 4MW3A 2YIBD 4NKGB 3BVOA 3ETQA 3RYCA 3B40A 3ZS8C 2XUMA 1L0NH 3L70H 4LF9B 5JQGA 1NZ6A 1Y74A 4MS2A 3STLC 1GTOA 4WFFA 4LR3A 4DV2O 2O57A 3D8CA 3F7VC 4QE7A 3ZHVA 4GZRB 1I5XA 3QTCA 1X4TA 3ASNB 2VQEB 4ZHQA 1R3KC 2YI8A 3APQA 2Y48A 2YSUB 4GYCB 2L6LA 2HR3A 3H1IH 3AG3B 4C7UA 1WA8B 1YJNV 1H2LA 3HKCA 4H33A 1M1KW 3AK1A 1DF5A 1YTFB 4W4KA 4KFMA 3GVMA 1H2MA 1Y66A 5JQGB 1W0KG 3CC7V 4FLVA 1Y74B 4Q20A 3WG7C 2Z5UA 3CCUV 3W7SA 3SJBC 2QTOA 4FLWA 2OIGA 1P7GA 4MVRA 3A0HZ 5EYPA 4DYLA 3CMEV 4ZHQB 3SDLA 1H2KA 4G2KA 3CJHA 4RO2A 2Q73A 4AI8A 4WFAV 3ZHSA 4YXWG 3SJCC 3HKCB 1GM9A 2X7RB 3TETA 1OJHA 2VWKA 3T2MA 1FFXA 3I56V 3F5TA 4JZGA 2P4KA 2XASA 3X2QB 4DK1A 5LXTA 1AI5A 1V54B 4YIOA 1OCRB 4Z1VA 4DV3O 3K5LA 1I94B 4Q6GA 3ABLB 4DV6B 2UXNA 3ZN1A 3ZCCA 3ZMZA 2YXHA 1L0LH 1Q81W 2ZE5A 3E89A 1OCZC 2IJJA 3AG2B 2H3OA 2LGQA 2P4VA 3CJHB 4I9WA 2EIMC 3GB7C 1ENVA 2EIJC 4ZKIA 1SQGA 5BR8B 2JK5C 1VMGA 1PL4A 1N0JA 1PNKA 1Y76B 1XOUA 4B3RB 5KAFZ 3RYFA 4MW8A 2IJKA 4QNHB 4Z2WA 3JARA 3MHSC 3BY6A 2X6AA 1EZJA 4UB6Z 3OW2U 5LBQA 2QJ1A 3CS5A 2IU3A 5LGTA 4O4LA 1MSDA 2UXBB 3OE7G 1NTZH 2DWDC 5IY5B 1SQBH 2ZR2A 2GSMB 2ZE6A 2ODMA 1LR1A 3GWKC 4JYYA 2KG7A 4D7SA 4DV4O 2ZR3A 4B3SB 1W0JG 3JYCA 1IBKB 3STZC 1SQVH 4YHHO 4CH3A 4IT5A 3RYFB 3VOUA 1VF6C 2N74A 1P7BA 4R8CA 4QJFB 1FXHA 3JARB 4PA3A 3U11A 5F2VO 3TCUA 2OCCC 4JASA 2EINC 1AROP 2YC0A 5LL6Y 2Q9LA 1YITV 4KHPO 4UVCA 1OCZB 2GBOA 4GCZA 4X88A 3CRCA 2HG5C 3T1CA 2EIJB 4DR6B 3HKBB 2KG7B 5A9GA 5LHHA 2ITDC 4O4HA 4U3FH 5LGUA 3C3TA 1YVWA 3A8TA 5A2QN 2ZM6O 3DTUB 2MW2B 4IL6Z 4QPKA 3L73H 4FIPC 2R9IA 2F93B 3CRQA 4X20B 1S5LZ 1M90W 4FZ0A 4TV8B 3CC2V 1TAEA 1H38A 1H2SB 4BW5A 1ZL8A 1H2NA 2LFSA 4MT8A 4F6EA 1OHHG 4FM1A 4WFBV 2XHBA 5B1BB 1NT2B 4UCUA 3UQ8A 2GTAA 1PNMA 4PA7A 4TSFG 4DR7O 2KSDA 2NLJC 3G80A 1R3LC 2JEUA 3L72H 3M8AA 1MZFA 1BL8A 1VQKV 4DW1A 1WP8A 3Q4HA 4MVMA 1EN6A 4P9PA 3RT3C 5FNVA 1EN5A 4O4HB 2ADQB 1B6QA 2V7QG 2A9HA 3J80N 2ZDIC 1WPBA 4GX5A 3CCMV 4Z1MG 2BTQA 3EFFK 2D3OW 5CB4A 4X66O 1K9MW 1SERA 4IYHA 5L3BA 1OCCB 3G6BA 2DMXA 2HHHO 2WA3A 4PDRA 3ASOC 3CE2A 4LWSA 5EBLC 2Z3YA 1RM1C 4E2LA 4FFBA 3F7YC 3BA8A 3A2FA 3THOA 3AG1B 1AVMA 3UT5A 1CXZB 5B5EZ 1IDSA 1JVMA 1EN4A 3Q4HB 3QVNA 4PA9A 2Z0AA 2ZNIA 2WSSG 4H44B 5FNVB 2DE0X 4WF9V 2RQ6A 2CH7B 3N2KA 4FLTA 1S76D 1SESA 2EILB 2R9AA 5ITZB 4IGGA 2BTQB 4G28B 1BHAA 4PD4F 1KYOF 1SQXH 3B8MA 3JD2A 3H1LH 3JD0A 1F23A 4PDMA 4NYKA 3RYHA 3CEIA 1WPXA 5JJNB 1S3JA 4FFBB 5KHHA 4LFAO 3ZHRA 1SQFA 5AG2A 2DYSB 3T1YO 5HFMA 4XDLA 3H1HH 5EZYB 3UT5B 2WLNA 4DV4B 2V1DA 4TWKA 1QQCA 2HKOA 3FD9A 4X1YA 4YHHB 4MVZA 4GLXA 1MG1A 3RN4A 2BOCC 2N05A 3JAWA 3P32A 4I4TB 1B06A 5J2TA 2QKAA 2MK3A 1K34A 1XUQA 2Y69B 1XMQO 1FXKA 4GKJO 3BHPA 3CD6V 2C2AA 3G71V 4KHPB 1IVSA 4B3MO 3AG7A 4NXMO 1ZSPA 1D5AA 4DR3O 3JATA 2NR5A 1MZEA 2PZSA 3LDCA 3E8BA 5JVDB 3UO3A 3RFRA 3I5DA 1R6TA 1GN2A 3HKDA 1E1QG 4LNUA 2ZM6B 4X1YB 3OUSA 1R6KA 3ML0A 1WB7A 4HAMA 4PA6A 1I08A 4P30A 1BSMA 3JAWB 4DO2A 1H8EG 3WB0A 4XDJA 2IW5A 3VBBA 2QR4A 3ZIAG 3CYOA 4NTWA 3AEIA 2CTWA 2Q8VA 3SYOA 4B3TB 1YJWV 2YDEA 1FXKB 5JH7B 2JS5A 3B09A 3D3IA 4DR7B 1Z5VA 1XHXA 4MVOA 2CAZC 2IJHA 1VQMV 1P4RA 2ADPA 2Q4PA 5LYJA 3EVKA 1SQQH 5CBHA 4PELA 5FLXN 1HNXB 2DQ3A 5B1NA 2JIZG 3HKDB 2UU9O 1VQOV 3FB5C 4OPAA 3K3WA 4CBCA 3JD3A 3CRRA 4UCTA 5H9CA 2ZE8A 2ETNA 1EZVH 3LNNA 3CP1A 1HR0O 4X66B 1F51A 1M57C 3I55V 5GONA 4U7OA 1AILA 2HHHB 5C93A 1NR7A 2QM7A 4D7TA 4B7KA 2DYRB 2WA4A 2L35A 3E2EA 2XAHA 2LJ2A 2WLLA 2H8PC 1K5SA 1JOYA 1XL4A 3M99B 3TK1A 2PY5A 3ICXA 4GX1A 5LYJB 2XOKG 1NH2D 4MVSA 4PI0A 2UUCB 1MSWD 1XEQA 3C3SA 2H94A 1N32O 1FJGB 3NR7A 3VQVA 5B3SC 4U7NA 4K8ZA 1AI4A 2EZPA 4DR5O 2PUSA 3CCVV 4JZ2A 4UCSA 4FLUA 1XMOO 1IBMO 1TA8A 1WA8A 2W6JG 2ZXWC 1YIJV 4JAUA 4MVQA 4LFAB 1FD9A 4K0KO 3JAMN 2WLLB 3A0BZ 4AILC 3T1YB 3CWBH 1NVPD 3AG4B 5IYDO 2X0LA 4W4LA 4D6TH 1URFA 4G27B 4KL1A 4JYAB 3SPIA 3ABMB 1EM1A 4JYCA 3K5NA 5LA6A 5FPRA 2VRZA 3FAVA 1Y4MA 4MTGA 4EFBA 1PNLA 1AP6A 2K1EA 1M56C 2DQ0A 4U3JA 1K8AW 4J9YB 4B3MB 1MOFA 4DR3B 2OIEA 3E86A 5LMUO 1XNRO 5LMNO 3UM7A 2QWRB 1MA1A 4MVUA 3K9SA 1N34O 3AK3A 4EFEA 5L3FA 2DN9A 1SA0A 2LGWA 1XILA 3FYEB 1GKFA 1QNMA 1CP9A 2YIBA 1YJ9V 5KUMA 4RQFA 5LA6B 5EC1C 2BOBC 1VARA 4J10A 5TISZ 3FAVB 4KXRA 1HDJA 1VQ7V 1K7DA 3CB2A 5DEDA 2KQXA 1WLEA 3BA9A 1GM8A 4U3JB 1RFYA 2ZD9A 2ARHA 1DGSA 4FLXA 3K04A 3BFRA 3LDEA 1Y76A 3B8NA 3ABUA 4LFBO 4JV5O 1OCOC 1S5JA 3RYIA 1WP7A 4FVMA 1XQ8A 1U96A 2JVDA 1SA0B 3P30A 4CC5A 5JCOC 1DK1A 2ZCEA 4O2BB 2QTSA 1WNSA 1SS3A 2R9RB 2UUAB 4NXNO 2UUBO 2E76B 4AHCA 1F7YA 1VQ5V 3G67A 4BR6A 2EJRA 1NTKH 1SZXA 5CBGA 2RJZA 2YI9A 2LW1A 3QO7A 5J9PC 1BMFG 2F95B 4JI0B 1FXVA 1HNZO 3RYIB 1IXMA 1JQ0A 1UPGA 5IJ9A 4LF7O 3WG7B 5B1OA 4CZZA 3OEEG 1MMMA 2Q68A 1N32B 1NS1A 3LNMB 5IYCO 1D5NA 1GN4A 3K59A 1XREA 3K5OA 1BCCH 4JI1O 1IBMB 3APOA 4DV7O 3HKBA 3DGEA 1AB3A 1IBLB 1GO3F 3ZN0A 1JR9A 2LP7A 3BAAA 5CBFA 4J7JA 1R6NA 5H6QA 2EIKC 4PDLA 5L3GA 2WLHA 2YXYA 4X20A 3FB6C 4TV8A 2AZ2A 4JTAB 5IJ9B 1Q86W 1RSOB 5C8YB 3U10A 4NTYA 4I55B 4UV9A 3G4SV 3K03A 2VQFO 4X1IA 1QCEA 4XDKA 4DV2B 5DECA 3OFNG 4X65O 2FMLA 4PA4A 2EJ7A 3E35A 1YSCA 4TT3G 3J81N 1YHQV 1YDXA 2QSAA 4LF8O 2EIMB 2ZIMA 4X1KB 2Q5ZA 2P22C 4DR2O 4O4IA 2QWNB 1P84F 3ZBHA 1GRJA 2YUAA 4O2AA 2EZOA 5LMUB 1XNRB 1VF6A 5LMNB 1UFIA 5CMUA 5B66Z 1N34B 3N27A 1K92A 3UKMA 1FFTB 1AI6A 2HJDA 1VQPV 3ETEA 1Q82W 2A06H 2OCHA 4MTFA 4X1IB 3SR2C 1BE3H 2Q69A 4DV1O 2PGGA 3PJSK 3H01A 3KG2A 5B1AC 4ICGA 1VF5B 3HPLC 1B3QA 1QHTA 3VQYA 1LNQA 2GUZA 1KQSU 4O4IB 5K1XA 3R65A 1S0VA 4LFBB 1BQ0A 2CH7A 4JV5B 4O2AB 3P3NA 3KKYA 5ITZA 5LP6C 3S3WA 3SJQC 3T4DA 4HZ3A 2OCCB 4X9QA 4DV3B 1W2BU 2EINB 4JI8O 4F4LA 4DUZO 1HP8A 4CH6A 2P6JA 4I5SA 1FAFA 1BS3A 2F4VO 4NXNB 2UUBB 1KMIZ 5EZYA 1SQPH 4K35A 3K06A 2GUZB 5IJ0A 4J7KA 2G38A 2WLIA 4GX0A 2UXCO 2ZDIA 4BIZA 2YIDA 4F6RB 3ABKC 2WWWA 4I4TA 3UCSC 1I0HA 1HNZB 5EIBD 1R1BA 4UVAA 4LF7B 4QE9A 1AR4A 1H8HG 1KECA 1NJIW 4DR4O 2WLMA 3ZRWB 4P2ZA 3W7UA 2E5LO 4OX9O 5EIBC 3SYAA 3ZRVA 2R72A 4R6ZA 3CHXA 5IWAO 2UXDO 2KB1A 2BCCH 1ZTEA 2IH3C 4DV7B 3D3QA 2FB5A 1K4DC 4I50B 5JVDA 4PV1B 5IJ0B 1PPJH 1BT8A 1GH6A 3LSSA 4BWAA 3ZJZA 4B7EA 4TUYA 4JYBA 2WLIB 2CK3G 4FM2A 2WLKA 1JMKC 4DUYO 3SPHA 4PJ0Z 5LGNA 4FFKA 4MSWC 1WJZA 1K4CC 3ASOB 2JDIG 5KX5A 1Q6IA 1RM1B 1VQ4V 3BEHA 2F23A 1AP5A 5JH7A 4AQYO 2JEXA 3QG5A 1OZ0A 3LUTB 3BABA 4ZIBA 3IFXA 1SETA 3ZHUA 3K79A 1K33A 3E8GA 4LF8B 1U97A 1NBMG 2Y0PA 3HR0A 3KZIZ 1J5EO 4J41A 3DSQA 3E8FA 5H6RA 4DR2B 4I7ZB 1M93A 3SJAC 3OR7C 1GN6A 3ZMUA 2QKSA 1L8DA 1HW7A 4TUYB 2NNUA 5L3CA 1PP9H 2N04A 1IX9A 4X64O 4YIPA 1SRYA 2AHYA 2OT5A 1IURA 3FKSG 3EHBB 1GAXA 2JJ1G 5KHKA 1N4CA 1BGYH 1Q5OA 3L71H 4QIWF 5KX5B 1AR1B 4NVPA 2JJ2G 5D5QA 4DV1B 1DTOA 3JSLA 4QPJA 3QO8A 4CS3A 4YY3O 2Y4UA 4MTOA 1OV9A 5DM6V 4BIOA 3QF7A 4MTXA 2XT9A 2QKCA 2ZE7A 2FTKA 4FJCC 2JGDA 3JAKB 5LHGA 1K73W 2KKWA 4EKWA 1A32A 3OTFA 5BMVA 1VQLV 1QVFU 2P06A 1XHZA 4FM0A 2ZIOA 1VP7A 4UUJC 1O9GA 3RBZA 2B5UA 1JFFB 4JI8B 3BPZA 5JJJB 1HNWO 2GHYA 3RWRD 4A5UB 4DUZB 2CGOA 1KB9F 2QGNA 4GT1A 1SC5B 1FPOA 4UCRA 4JTDB 1EFRG 4P9OA 2F4VB 2EULA 1ZX3A 1V55C 1RP3B 2LFRA 1KD1W 1Q3EA 3ASNC 1E79G 4PDVA 1TGOA 2QE7G 3L9DA 4DXWA 2IM9A 2ZKOA 5EBMC 5E1AC 3VQXA 2JGDB 2UXCB 4I0XB 3AG3C 5BMVB 2E74B 1AJQA 2Q7EA 3K58A 4FLYA 1MNGA 1PKXA 1HWYA 1G8MA 4RUEA 3IJ4A 1R73A 4DR4B 1Q7YW 1LUWA 2A0LA 1ZLZA 4HNAB 1X59A 1D2DA 1JJ2U 2QM8A 5H5NA 1N33O 2Q7GA 2E5LB 5BZBA 4OX9B 2VS0A 1H2GA 2IBZH 2K9PA 2BE3A 2X6CA 5IWAB 4ZOLA 3FFQA 4ABMA 2B1GA 4DV0O 4K3AA 4LF6O 1VQ9V 4JI6O 4GKKO 1QR9A 3E22A 4GX2A 1PM9A 2QA4V 3RW0A 3DC6A 1NU1H 5KA6A 4UXNA 4JI7O 1IZ3A 1US6A 4CC6A 1Z2GA 3H9VA 4DUYB 2CTPA 2BTOA 4WFEA 5JWPA 3OMAB 5CN0A 1M57B 3K5MA 2ZINA 3OMNB 3X2QC 3D36A 3TXSA 3ZRSA 2JS3A 1V54C 1OCRC 1XDCA 1XMQB 3JCUZ 2AZ0A 1TVKB 4GKJB 3S3XA 4AQYB 3SGIA 2HFEC 2M6YA 2XAGA 1N36O 3ABLC 4NXMB 1Q6HA 1QLEC 1V55B 4R7CA 4ZOLB 3MD0A 1G6UA 3U0ZA 1NTMH 2YIAA 1J5EB 3PN1A 4RUFA 5EK0A 3SPJA 1YEWA 2RDCA 3AG2C 2HLDG 3E22B 2HJFC 4JAAA 1YI2V 5LOVA 4DR6O 3FB8C 5KLVH 4UV8A 1R3IC 4X64B 5B3SB 1T5EA 2LW7A 5KUKA 2XAQA 3OGIB 4O2BA 3OAAG 4NB5A 3CMAV 1ORQC 3B2EE 1NH2B 1Q6UA 1TUBA 4PI2A 3RYCB 4HYOA 3P3PA 2OTJV 2V4DA 2ZXWB 2EX3A 1I7FA 3L75H 2PYJA 2BSKA 4KP4A 3T1HO 1SF9A 2HVKC 2XNDG 3WB2A 1DF4A 2RNBA 4YY3B 1S5HC 2HEPA 5KHIA 5IY5C 2CDYA 1F4NA 5GTHZ 3CCRV 5CA0A 1W59A 3JASA 1XI1A 4IIJA 5EC2C 4I9QA 2UU9B 3IC9A 5LOVB 4UCVA 1NVPB 1I5YA 4LH7A 3N2GA 1VEWA 2E3CA 1HR0B 5KAIZ 3CC4V 5CA1A 4K8XA 3GWOA 2WPDG 1M56B 1TUBB 1FYJA 3K0GA 1KU9A 1HNWB 1PD3A 1KBHA 4X89A 4EB6A 5BXZA 3SYQA 2BSKB 1QBZA 1QLEB 5FPOA 2PTMA 4ZI7A 2P5OA 1VQ6V 5DN6G 4YJ3A 5EYPB 3ZRXA 3ZHQA 5K1PA 3CCLV 2CUGA 4YJ2A 1RSOA 3MDSA 5C8YA 5CA0B 2DJVA 3JASB 3CX5F 2ITCC 2YXLA 3NXSA 4I55A 4IIJB 1AI7A 5JCOA 2Q0OC 2AHZA 3EXAA 4JI3O 5H2FZ
chains in the Genus database with same CATH topology
4HAMA 4PA6A 4P30A 4HZ3A 1DLBA 2OCCB 4DO2A 1W2BU 4MS2A 3STLC 2EINB 1H8EG 1GTOA 4XDJA 4WFFA 4F4LA 1JX9A 2IW5A 3VBBA 3ZIAG 2OTLV 3CYOA 3OEHG 2P6JA 3F7VC 4I5SA 4QE7A 4UVBA 3AEIA 1I5XA 1THZA 3SYOA 1YJWV 3ASNB 3FYIB 2PI5A 1QVGU 1FXKB 1R3KC 1GMGA 5B1BC 3SYCA 2Y48A 2YSUB 3D3IA 1OCOB 3K06A 2P90A 2HR3A 4MVOA 3AG3B 2IJHA 1K97A 1VQMV 1YJNV 1NR1A 1P4RA 2WLIA 4FK5C 4GX0A 4H33A 2IJIA 2ZDIA 4H37A 5HFLA 4BIZA 3CCSV 1M1KW 5CBHA 4PELA 1DF5A 2DQ3A 2IH1C 3ABKC 2WWWA 5B1NA 2JIZG 4RQEA 1YTFB 3G6EV 1VQOV 4UVAA 3FB5C 4CBCA 3K3WA 4KFMA 3RVZA 1KC8W 3JD3A 4QE9A 1H8HG 1KECA 3QNEA 1Y66A 1NJIW 5H9CA 2ATKC 2WLMA 1W0KG 3ZRWB 5IDJA 3CP1A 3CC7V 4Q20A 3WG7C 1COWG 4WCEV 4P2ZA 2Z5UA 1F51A 1M57C 3CCUV 3K9AA 3W7SA 1KP3A 3I55V 5L3DA 4U7OA 2QTOA 3W7UA 4MVRA 3K0DA 5C93A 1NR7A 2QM7A 3SYAA 3ZRVA 1OCCC 4R6ZA 2DYRB 3CMEV 3E2EA 2KB1A 2IH3C 4G2KA 2XAHA 4RO2A 2WLLA 2H8PC 1K5SA 1JOYA 1K4DC 4WFAV 4X8AA 1F4MA 1XL4A 3M99B 3TK1A 4YXWG 3LSSA 3ZJZA 3IC7A 4JYBA 3F5WC 2WLIB 3AG1C 2CK3G 4GX1A 1KP2A 2WLKA 3JCZA 1GM9A 2XOKG 2X7RB 3TETA 3E8HA 3SPHA 1NH2D 4MVSA 5EBWC 3T2MA 5LGNA 3I56V 1MSWD 2H94A 2XASA 3X2QB 4MSWC 1XL6A 1AI5A 3JD4A 1V54B 2QEXV 1K4CC 1OCRB 3CPWU 3ASOB 2JDIG 5B3SC 2ZQMA 2B1IA 4U7NA 1RM1B 1VQ4V 2EILC 3BEHA 2EZPA 1AI4A 3ABLB 2UXNA 1N8RW 3ZN1A 3CCVV 3ZCCA 4N23A 2JEXA 3ZMZA 4RAIA 1OZ0A 3OR6C 3LUTB 1Q81W 3IFXA 1SETA 3E89A 3K79A 1OCZC 1K33A 3WFVA 3E8GA 2IJJA 2W6JG 3AG2B 2ZXWC 1YIJV 4JAUA 4MVQA 1NBMG 2HVJC 2WLLB 4I9WA 4BAYA 3E8FA 5H6RA 4BIUA 2EIMC 3GB7C 1ENVA 1NVPD 2EIJC 3AG4B 2EIKB 4ZKIA 2X0LA 3OR7C 3SPCA 5IYDO 3SPGA 3ZMUA 2QKSA 1JCHA 2DYSC 2JK5C 2NNUA 5L3CA 4G27B 1PNKA 1AJNA 1SRYA 2AHYA 2OT5A 3ZRWA 3OMIB 3SPIA 3FKSG 3EHBB 4MW8A 2IJKA 3ABMB 4N21A 4QNHB 4J9ZB 1RPOA 2JJ1G 3MHSC 3BY6A 2X6AA 1EZJA 4JYCA 3OUFA 3OW2U 4QIWF 1AR1B 5LBQA 2IU3A 5LGTA 2JJ2G 1DTOA 3OM3B 2XAJA 1Y4MA 4MTGA 4OXSA 1PNLA 2K1EA 1M56C 1PL0A 3OE7G 4QPJA 3QO8A 2DWDC 3ZMSA 2DQ0A 2P67A 5IY5B 2Y69C 2ZR2A 2GSMB 1K8AW 4JF3A 4J9YB 4MTOA 1MOFA 2DWEC 5DM6V 4MTXA 2FTKA 4FJCC 1RPRA 3E86A 5LHGA 2ZR3A 1VQ8V 1K73W 3UM7A 4EKWA 1W0JG 3JYCA 1VQLV 4MVUA 3STZC 1QVFU 1QLNA 4FMTA 5L3FA 3VOUA 3W7WA 1P7BA 4R8CA 3FYEB 4QJFB 1FXHA 1GKFA 2F43G 1CP9A 2DW4A 4PA3A 4UUJC 1YJ9V 1GM7A 5KUMA 3RBZA 2B5UA 1TUEB 4RQFA 1R3JC 3TCUA 3K08A 2OCCC 5EC1C 5B1AB 2GHYA 2BOBC 4JASA 2EINC 1AROP 4GT1A 1VQ7V 1K7DA 1YITV 4UVCA 4JTDB 1EFRG 1OCZB 4P9OA 1WLEA 2Q6AA 3ZMVA 1MABG 4GCZA 1V55C 2M7WA 1GM8A 2LFRA 4X88A 1G4YB 4JTCB 2ZD9A 3ASNC 1KD1W 1E79G 1CPYA 3K04A 4PDVA 2W0FC 1FXKC 2QE7G 2HG5C 3T1CA 4DXWA 3LDEA 5LHIA 3B8NA 2EIJB 3ABUA 5GW7A 1KKDA 5EBMC 3CXCU 5E1AC 3ZMTA 1EBOA 2EBOA 5LHHA 1OCOC 5FL7G 3AG3C 2ITDC 5LGUA 2Q67A 1AJQA 3DTUB 1JPXA 4JGSA 1PKXA 1HWYA 4QPKA 4FIPC 1G8MA 2R9IA 3P30A 3LDDA 4RUEA 1QR8A 4WFGA 1R73A 4KUMA 1M90W 1Q7YW 3CC2V 2A0LA 1H38A 3JD1A 4BW5A 2LFSA 4MT8A 1JJ2U 2QM8A 1OHHG 2R9RB 4WFBV 5BZBA 2P7TC 5B1BB 2IU0A 1FS0G 1H2GA 1VQ5V 1NKDA 2X6CA 2B1GA 1PNMA 4PA7A 3B77A 4TSFG 1VQ9V 2PI4A 2NLJC 2EJRA 1QR9A 1R3LC 5CBGA 2DYRC 3E83A 2JEUA 4JAVA 4GX2A 3ABKB 3IGAC 2QA4V 3FB7C 1BL8A 1VQKV 3QO7A 3RW0A 5J9PC 1VQNV 1BMFG 4MVMA 4P9PA 5KA6A 4UXNA 1FXVA 1IXMA 1B6QA 1JQ0A 3W7TA 2V7QG 2A9HA 4WFEA 3WG7B 2ZDIC 3RVYA 3OMAB 4GX5A 1SZTA 5CN0A 5B1OA 4CZZA 3CCMV 1M57B 4LCUC 4Z1MG 3OEEG 2Q68A 3EFFK 2XAFA 2D3OW 3OMNB 1K9MW 1SERA 1GK9A 3X2QC 3D36A 3ZRSA 2UXXA 3W7XA 5L3BA 1V54C 3LNMB 2WAMA 1OCCB 5IYCO 1BHBA 5KA5A 1OCRC 5L3EA 4PDRA 3ASOC 2HFEC 5EBLC 2XAGA 2Z3YA 1RM1C 3ABLC 4E2LA 3F7YC 4JPRA 1QLEC 1V55B 4R7CA 4R50A 3DGEA 1E1RG 3MD0A 2X6BA 3AG1B 3SPJA 4RUFA 5EK0A 1GO3F 3AG2C 3ZN0A 2HLDG 1M9NA 4FPPA 1K5QA 2LP7A 2HJFC 5CBFA 1YI2V 1R6NA 1JVMA 3FB8C 5H6QA 4PA9A 2WSSG 1R3IC 2EIKC 3AG4C 4L87A 4PDLA 4LC1A 4UV8A 4ASUG 5L3GA 2WLHA 3A0RA 3ETGA 3FB6C 4WF9V 5B3SB 4JTAB 1Q86W 5KUKA 2XAQA 2YEVA 3OAAG 1S76D 1SESA 2A79B 2EILB 1S72V 4UV9A 3G4SV 3CMAV 3K03A 1ORQC 1QCEA 4XDKA 1NH2B 4G28B 1BHAA 3OFNG 3ABMC 3ABTA 3T4ZA 3B8MA 4ZBMA 4PA4A 4HYOA 3E35A 2WLJA 2OTJV 3JD2A 3CCQV 3JD0A 1F23A 2ZXWB 1YSCA 4PDMA 4TT3G 1WPXA 4KP4A 1CEZA 1S3JA 1YHQV 3QO5A 1S77D 2HVKC 2EIMB 2XNDG 1YTFD 1DF4A 1S5HC 2DYSB 5HFMA 1J95A 1L1FA 5IY5C 4XDLA 1NQTA 4WFHA 2WLNA 1F4NA 3CCRV 2EZOA 2V1DA 4TWKA 2HKOA 5CMUA 3LSQA 5EC2C 1ZWIC 4XBFA 1K92A 4LBEC 1I5YA 4MVZA 1NVPB 1MG1A 3UKMA 2BOCC 1FFTB 1AI6A 3P32A 1VQPV 3HB3B 2YEVB 3CC4V 3ETEA 1Q82W 3CCEV 4MTFA 1K3EA 2W6IG 3GWOA 2Q69A 2WPDG 1M56B 2MK3A 3K0GA 1K34A 2Y69B 1PD3A 3PJSK 3H01A 3CCJV 1FXKA 4X89A 3KG2A 3SYQA 5B1AC 3CD6V 2C2AA 3HPLC 1AJPA 1QBZA 3SYPA 1QLEB 3G71V 5IYBO 1LNQA 1VQ6V 5DN6G 3MHHC 1KQSU 3ZRXA 4LP8A 1UJWB 3CCLV 3OGCC 3LDCA 3ETDA 3R65A 5CA3A 3E8BA 1S0VA 1ROPA 4MW3A 2ITCC 3NXSA 1AI7A 1E1QG 2AHZA 3OUSA 1R6KA 3SJQC 3ML0A 3T4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PA6 A;  5CBF A;  1G4Y B;  4JTC B;  4P30 A;  4HZ3 A;  2ZD9 A;  3ASN C;  1JVM A;  4RAI A;  3FB8 C;  3OR6 C;  3K04 A;  4PDV A;  3LUT B;  2W0F C;  4PA9 A;  4MS2 A;  3STL C;  1R3I C;  2EIK C;  2HG5 C;  3AG4 C;  3IFX A;  3LDE A;  4PDL A;  4XDJ A;  3T1C A;  2WLH A;  3E89 A;  4WFF A;  4DXW A;  4F4L A;  3FB6 C;  1KKD A;  5EBM C;  1OCZ C;  5E1A C;  3E8G A;  4JTA B;  5KUK A;  2ZXW C;  1OCO C;  2YEV A;  4MVQ A;  3F7V C;  4QE7 A;  2A79 B;  3AG3 C;  2HVJ C;  2ITD C;  3SYO A;  3K03 A;  1ORQ C;  2Q67 A;  2WLL B;  4I9W A;  4XDK A;  3E8F A;  4G28 B;  3ABM C;  2EIM C;  3GB7 C;  3T4Z A;  2EIJ C;  4ZBM A;  1R3K C;  3OR7 C;  4HYO A;  4PA4 A;  3SPC A;  3SPG A;  2WLJ A;  2QKS A;  2DYS C;  2JK5 C;  5B1B C;  3SYC A;  3LDD A;  4G27 B;  4PDM A;  4RUE A;  3K06 A;  4WFG A;  2AHY A;  4MVO A;  2A0L A;  3SPI A;  4MW8 A;  2WLI A;  4GX0 A;  4BW5 A;  2HVK C;  4H33 A;  4H37 A;  4QNH B;  4J9Z B;  5CBH A;  2R9R B;  1S5H C;  2IH1 C;  2X6A A;  3ABK C;  2P7T C;  5BZB A;  1J95 A;  3OUF A;  5IY5 C;  4XDL A;  4WFH A;  2X6C A;  3FB5 C;  4CBC A;  2WLN A;  4KFM A;  3RVZ A;  4PA7 A;  4QE9 A;  4TWK A;  2NLJ C;  5EC2 C;  4MTG A;  1ZWI C;  2WLM A;  2ATK C;  1R3L C;  2K1E A;  2DYR C;  1M56 C;  4OXS A;  5CBG A;  3WG7 C;  3E83 A;  4P2Z A;  4GX2 A;  4LBE C;  4MVZ A;  2DWD C;  3UKM A;  3IGA C;  1M57 C;  3FB7 C;  1BL8 A;  2BOC C;  2Y69 C;  3RW0 A;  2QTO A;  5J9P C;  4MVM A;  4MVR A;  4P9P A;  3K0D A;  4J9Y B;  4MTO A;  2DWE C;  3SYA A;  1OCC C;  4MTF A;  4R6Z A;  2A9H A;  2Q69 A;  3E86 A;  4WFE A;  3K0G A;  3RVY A;  3UM7 A;  4GX5 A;  4EKW A;  2KB1 A;  2IH3 C;  4LCU C;  4RO2 A;  3JYC A;  2Q68 A;  2H8P C;  2WLL A;  3EFF K;  4MVU A;  1K4D C;  3STZ C;  4X8A A;  3PJS K;  3X2Q C;  4X89 A;  1XL4 A;  3KG2 A;  5B1A C;  3SYQ A;  3ZRS A;  3HPL C;  1V54 C;  3LNM B;  3SYP A;  3ZJZ A;  1OCR C;  3VOU A;  3F5W C;  2WLI B;  3AG1 C;  1P7B A;  3ASO C;  4PDR A;  1LNQ A;  4GX1 A;  4R8C A;  2WLK A;  3SJQ C;  2HFE C;  3E8H A;  4PA3 A;  4UUJ C;  5EBL C;  3TET A;  3SPH A;  5KUM A;  3ABL C;  4MVS A;  5EBW C;  3RBZ A;  3T2M A;  1R3J C;  4LP8 A;  3F7Y C;  3TCU A;  3K08 A;  1QLE C;  2OCC C;  3LDC A;  1XL6 A;  3OGC C;  4MSW C;  4R7C A;  5EC1 C;  3R65 A;  2BOB C;  3E8B A;  4R50 A;  2EIN C;  1K4C C;  2X6B A;  4MW3 A;  2ITC C;  3SPJ A;  4RUF A;  5EK0 A;  5B3S C;  3AG2 C;  4JTD B;  4P9O A;  2AHZ A;  2Q6A A;  3OUS A;  2EIL C;  3BEH A;  2HJF C;  3T4D A;  4X88 A;  1V55 C; 
#chains in the Genus database with same CATH topology
 3N2G B;  1DLB A;  1BZK A;  2GDS A;  4DR5 B;  1FFX B;  1M5I A;  5CA1 B;  1JX9 A;  1YXB A;  5LXT B;  1XMO B;  2OTL V;  1M4U A;  3MAQ A;  3OEH G;  3CSX A;  4UVB A;  1THZ A;  2A3Q A;  4X1K A;  1N33 B;  3FYI B;  2PI5 A;  1QVG U;  4K0K B;  4EB6 B;  5IYZ A;  2PF4 E;  1GMG A;  3BCC H;  5B1B C;  3O65 A;  3SYC A;  4DV0 B;  1OCO B;  4ZI7 B;  4LF6 B;  4JI6 B;  4YJ3 B;  1AR5 A;  2P90 A;  4GKK B;  3ZX6 A;  2W0X A;  4J7Z A;  2AW9 A;  1K97 A;  1NR1 A;  4FK5 C;  1JA8 A;  2IJI A;  4H37 A;  5HFL A;  3CCS V;  4UFZ A;  4YJ2 B;  2IH1 C;  4NR1 A;  2XTA A;  4JI7 B;  4RQE A;  3G6E V;  1BQZ A;  5IE9 A;  1KC8 W;  3RVZ A;  3H1K H;  3QNE A;  4JI4 O;  2ATK C;  2CTQ A;  5IDJ A;  5D5P A;  2B9Z A;  4DR1 O;  4WCE V;  1COW G;  2JGU A;  3K9A A;  1KP3 A;  5L3D A;  3WB1 A;  3K0D A;  3JSN A;  1OCC C;  1N36 B;  3TGU H;  4O4L B;  4JI2 O;  5IYZ B;  2QDO A;  5J2U A;  5KMG A;  4JI5 O;  4X8A A;  1F4M A;  2QWP B;  4E4E A;  5GTI Z;  2LQT A;  3IC7 A;  3L74 H;  2OWO A;  3F5W C;  3AG1 C;  4QGP A;  1KP2 A;  3JCZ A;  4BW9 A;  1Q43 A;  2YS8 A;  3E8H A;  1LUV A;  2DOS A;  2JRI A;  5EBW C;  3LSU A;  1XL6 A;  3JD4 A;  2OYQ A;  2QEX V;  3CPW U;  4LF4 O;  4TV9 A;  2ZQM A;  2B1I A;  2EIL C;  2ZNJ A;  2D2C B;  2LO1 A;  1N8R W;  1V9P A;  4N23 A;  1JJO A;  4RAI A;  3OR6 C;  4CH5 A;  3C90 A;  4TQD A;  3T1H B;  3WFV A;  4B3T O;  1XNQ O;  2HVJ C;  4BAY A;  5J2U B;  5KMG B;  4BIU A;  4F6R A;  3OTO O;  3HKE A;  4OGQ B;  1WB8 A;  2EIK B;  3SPC A;  1P49 A;  3SPG A;  1JCH A;  2DYS C;  4LFC O;  4IHJ A;  4J42 A;  2YIC A;  1AJN A;  2ILM A;  3ZRW A;  4H0L B;  3OMI B;  1HNX O;  1Z5W A;  3CRM A;  1PV0 A;  3CRA A;  4N21 A;  4J9Z B;  3KCY A;  1RPO A;  2FL4 A;  2QM4 A;  3OUF A;  2NN4 A;  4TV9 B;  4J80 A;  4GUN A;  1NI8 A;  3OM3 B;  2XAJ A;  4OXS A;  3IAY A;  1PL0 A;  4I50 A;  4X62 O;  1ZL8 B;  4UCO A;  3ZMS A;  2P67 A;  3B4S A;  2Y69 C;  5JJE B;  2FYU H;  3JAL A;  2PYL A;  4JF3 A;  2DWE C;  2AXT Z;  5LP6 A;  1RPR A;  1B04 A;  1VF7 A;  3HKE B;  1VQ8 V;  3ZHT A;  4IHJ B;  1QLN A;  4FMT A;  2Y4T A;  3W7W A;  4JI3 B;  2UUC O;  4HBN A;  2F43 G;  3H1J H;  2DW4 A;  1GM7 A;  1TUE B;  1FJG O;  1R3J C;  3K08 A;  1IXB A;  4LF5 O;  1FKA O;  2E75 B;  5B1A B;  4JI1 B;  5CB4 B;  4DV5 O;  3CXH F;  3VQW A;  2CE4 A;  2RMK B;  2Q6A A;  3ZMV A;  1MAB G;  4DW0 A;  2M7W A;  1G4Y B;  4JTC B;  4LWS B;  1CPY A;  3JAL B;  2W0F C;  1FXK C;  5LHI A;  5GW7 A;  1KKD A;  4O4J A;  3CXC U;  5LP6 B;  3ZMT A;  1EBO A;  2EBO A;  3DXR A;  5FL7 G;  5KHG A;  2A7W A;  3M7M X;  2Q67 A;  1JPX A;  4JGS A;  2Q7H A;  4JYA O;  2VQF B;  4LF9 O;  4X65 B;  3LDD A;  1QR8 A;  4WFG A;  4JI4 B;  4KUM A;  4DR1 B;  3JD1 A;  3N2K B;  3TJT A;  1XBL A;  5E79 Z;  4EEQ A;  2P7T C;  2IU0 A;  4DK0 A;  2VQE O;  1FS0 G;  1NKD A;  4PHZ A;  3JAK A;  3B77 A;  4JI2 B;  3RYH B;  2PI4 A;  1YZB A;  3FX7 A;  2DYR C;  1Y6X A;  3RGB A;  3E83 A;  4JI5 B;  4JAV A;  3UO2 A;  2VWJ A;  1KUQ A;  3ABK B;  4WBN A;  3IGA C;  3FB7 C;  4O4J B;  1VQN V;  3DXR B;  4UB8 Z;  2R70 A;  4NTX A;  2CGN A;  3W7T A;  3OT7 A;  3RVY A;  1JFF A;  1SZT A;  1G1X B;  4LCU C;  4B08 A;  4CS2 A;  2XAF A;  3ZED A;  1GK9 A;  3TXQ A;  4LF4 B;  1WN7 A;  1ZUQ A;  2UXX A;  1Q8I A;  3W7X A;  1BHB A;  2WAM A;  4CS4 A;  2CTR A;  5KA5 A;  5L3E A;  5J2T B;  4JPR A;  4R50 A;  1XNQ B;  1E1R G;  2X6B A;  4I0X A;  3WU2 Z;  1M9N A;  1Y67 A;  3OTO B;  4FPP A;  1K5Q A;  4WBN B;  2FKX A;  4TOI A;  2Y0I A;  5IT9 N;  4LFC B;  3JAT B;  3AG4 C;  4L87 A;  4ASU G;  1VIB A;  4LC1 A;  3A0R A;  1KKC A;  1YCI A;  3BRC A;  3ETG A;  3J7A U;  2YEV A;  4HNA A;  2A79 B;  1S72 V;  2GTS A;  3K57 A;  4LNU B;  1I94 O;  3ABM C;  3ABT A;  3T4Z A;  4ZBM A;  4DV6 O;  2WLJ A;  3OD4 A;  5KHJ A;  3CCQ V;  2RN9 A;  2ZT9 B;  4DRX A;  4H13 B;  2F66 C;  1CEZ A;  2RCV A;  3QO5 A;  2UUA O;  4X62 B;  4IYI A;  1S77 D;  2QWQ B;  1YF2 A;  4RWU A;  1N0N A;  1YTF D;  3DC5 A;  1J95 A;  1L1F A;  1NQT A;  1QU7 A;  4WFH A;  5BR8 O;  3O9O A;  1SKV A;  3LSQ A;  1ZWI C;  4B3R O;  4XBF A;  4J11 A;  4JI0 O;  3AK2 A;  4LBE C;  4FLZ A;  4FZ1 A;  4L8J A;  1GN3 A;  3HB3 B;  2YEV B;  1TVK A;  3CCE V;  1K3E A;  2W6I G;  3R66 A;  2AGA A;  2F1M A;  4LF5 B;  2UXB O;  4OPH A;  2UXD B;  3KCX A;  1Q90 D;  4DV5 B;  1O9H A;  3CCJ V;  4DRX B;  3SYP A;  5GON B;  1AJP A;  5BY1 A;  5IYB O;  3D36 C;  2GV9 A;  2HP8 A;  3MHH C;  4CH4 A;  1WAZ A;  4B3S O;  1ZAU A;  4LP8 A;  2QWO B;  1UJW B;  3OGC C;  1IBL O;  3ETD A;  4LH6 A;  4TQF A;  5CA3 A;  2Q0A A;  1IBK O;  1ROP A;  4MW3 A;  2YIB D;  4NKG B;  3BVO A;  3ETQ A;  3RYC A;  3B40 A;  3ZS8 C;  2XUM A;  1L0N H;  3L70 H;  4LF9 B;  5JQG A;  1NZ6 A;  1Y74 A;  4MS2 A;  3STL C;  1GTO A;  4WFF A;  4LR3 A;  4DV2 O;  2O57 A;  3D8C A;  3F7V C;  4QE7 A;  3ZHV A;  4GZR B;  1I5X A;  3QTC A;  1X4T A;  3ASN B;  2VQE B;  4ZHQ A;  1R3K C;  2YI8 A;  3APQ A;  2Y48 A;  2YSU B;  4GYC B;  2L6L A;  2HR3 A;  3H1I H;  3AG3 B;  4C7U A;  1WA8 B;  1YJN V;  1H2L A;  3HKC A;  4H33 A;  1M1K W;  3AK1 A;  1DF5 A;  1YTF B;  4W4K A;  4KFM A;  3GVM A;  1H2M A;  1Y66 A;  5JQG B;  1W0K G;  3CC7 V;  4FLV A;  1Y74 B;  4Q20 A;  3WG7 C;  2Z5U A;  3CCU V;  3W7S A;  3SJB C;  2QTO A;  4FLW A;  2OIG A;  1P7G A;  4MVR A;  3A0H Z;  5EYP A;  4DYL A;  3CME V;  4ZHQ B;  3SDL A;  1H2K A;  4G2K A;  3CJH A;  4RO2 A;  2Q73 A;  4AI8 A;  4WFA V;  3ZHS A;  4YXW G;  3SJC C;  3HKC B;  1GM9 A;  2X7R B;  3TET A;  1OJH A;  2VWK A;  3T2M A;  1FFX A;  3I56 V;  3F5T A;  4JZG A;  2P4K A;  2XAS A;  3X2Q B;  4DK1 A;  5LXT A;  1AI5 A;  1V54 B;  4YIO A;  1OCR B;  4Z1V A;  4DV3 O;  3K5L A;  1I94 B;  4Q6G A;  3ABL B;  4DV6 B;  2UXN A;  3ZN1 A;  3ZCC A;  3ZMZ A;  2YXH A;  1L0L H;  1Q81 W;  2ZE5 A;  3E89 A;  1OCZ C;  2IJJ A;  3AG2 B;  2H3O A;  2LGQ A;  2P4V A;  3CJH B;  4I9W A;  2EIM C;  3GB7 C;  1ENV A;  2EIJ C;  4ZKI A;  1SQG A;  5BR8 B;  2JK5 C;  1VMG A;  1PL4 A;  1N0J A;  1PNK A;  1Y76 B;  1XOU A;  4B3R B;  5KAF Z;  3RYF A;  4MW8 A;  2IJK A;  4QNH B;  4Z2W A;  3JAR A;  3MHS C;  3BY6 A;  2X6A A;  1EZJ A;  4UB6 Z;  3OW2 U;  5LBQ A;  2QJ1 A;  3CS5 A;  2IU3 A;  5LGT A;  4O4L A;  1MSD A;  2UXB B;  3OE7 G;  1NTZ H;  2DWD C;  5IY5 B;  1SQB H;  2ZR2 A;  2GSM B;  2ZE6 A;  2ODM A;  1LR1 A;  3GWK C;  4JYY A;  2KG7 A;  4D7S A;  4DV4 O;  2ZR3 A;  4B3S B;  1W0J G;  3JYC A;  1IBK B;  3STZ C;  1SQV H;  4YHH O;  4CH3 A;  4IT5 A;  3RYF B;  3VOU A;  1VF6 C;  2N74 A;  1P7B A;  4R8C A;  4QJF B;  1FXH A;  3JAR B;  4PA3 A;  3U11 A;  5F2V O;  3TCU A;  2OCC C;  4JAS A;  2EIN C;  1ARO P;  2YC0 A;  5LL6 Y;  2Q9L A;  1YIT V;  4KHP O;  4UVC A;  1OCZ B;  2GBO A;  4GCZ A;  4X88 A;  3CRC A;  2HG5 C;  3T1C A;  2EIJ B;  4DR6 B;  3HKB B;  2KG7 B;  5A9G A;  5LHH A;  2ITD C;  4O4H A;  4U3F H;  5LGU A;  3C3T A;  1YVW A;  3A8T A;  5A2Q N;  2ZM6 O;  3DTU B;  2MW2 B;  4IL6 Z;  4QPK A;  3L73 H;  4FIP C;  2R9I A;  2F93 B;  3CRQ A;  4X20 B;  1S5L Z;  1M90 W;  4FZ0 A;  4TV8 B;  3CC2 V;  1TAE A;  1H38 A;  1H2S B;  4BW5 A;  1ZL8 A;  1H2N A;  2LFS A;  4MT8 A;  4F6E A;  1OHH G;  4FM1 A;  4WFB V;  2XHB A;  5B1B B;  1NT2 B;  4UCU A;  3UQ8 A;  2GTA A;  1PNM A;  4PA7 A;  4TSF G;  4DR7 O;  2KSD A;  2NLJ C;  3G80 A;  1R3L C;  2JEU A;  3L72 H;  3M8A A;  1MZF A;  1BL8 A;  1VQK V;  4DW1 A;  1WP8 A;  3Q4H A;  4MVM A;  1EN6 A;  4P9P A;  3RT3 C;  5FNV A;  1EN5 A;  4O4H B;  2ADQ B;  1B6Q A;  2V7Q G;  2A9H A;  3J80 N;  2ZDI C;  1WPB A;  4GX5 A;  3CCM V;  4Z1M G;  2BTQ A;  3EFF K;  2D3O W;  5CB4 A;  4X66 O;  1K9M W;  1SER A;  4IYH A;  5L3B A;  1OCC B;  3G6B A;  2DMX A;  2HHH O;  2WA3 A;  4PDR A;  3ASO C;  3CE2 A;  4LWS A;  5EBL C;  2Z3Y A;  1RM1 C;  4E2L A;  4FFB A;  3F7Y C;  3BA8 A;  3A2F A;  3THO A;  3AG1 B;  1AVM A;  3UT5 A;  1CXZ B;  5B5E Z;  1IDS A;  1JVM A;  1EN4 A;  3Q4H B;  3QVN A;  4PA9 A;  2Z0A A;  2ZNI A;  2WSS G;  4H44 B;  5FNV B;  2DE0 X;  4WF9 V;  2RQ6 A;  2CH7 B;  3N2K A;  4FLT A;  1S76 D;  1SES A;  2EIL B;  2R9A A;  5ITZ B;  4IGG A;  2BTQ B;  4G28 B;  1BHA A;  4PD4 F;  1KYO F;  1SQX H;  3B8M A;  3JD2 A;  3H1L H;  3JD0 A;  1F23 A;  4PDM A;  4NYK A;  3RYH A;  3CEI A;  1WPX A;  5JJN B;  1S3J A;  4FFB B;  5KHH A;  4LFA O;  3ZHR A;  1SQF A;  5AG2 A;  2DYS B;  3T1Y O;  5HFM A;  4XDL A;  3H1H H;  5EZY B;  3UT5 B;  2WLN A;  4DV4 B;  2V1D A;  4TWK A;  1QQC A;  2HKO A;  3FD9 A;  4X1Y A;  4YHH B;  4MVZ A;  4GLX A;  1MG1 A;  3RN4 A;  2BOC C;  2N05 A;  3JAW A;  3P32 A;  4I4T B;  1B06 A;  5J2T A;  2QKA A;  2MK3 A;  1K34 A;  1XUQ A;  2Y69 B;  1XMQ O;  1FXK A;  4GKJ O;  3BHP A;  3CD6 V;  2C2A A;  3G71 V;  4KHP B;  1IVS A;  4B3M O;  3AG7 A;  4NXM O;  1ZSP A;  1D5A A;  4DR3 O;  3JAT A;  2NR5 A;  1MZE A;  2PZS A;  3LDC A;  3E8B A;  5JVD B;  3UO3 A;  3RFR A;  3I5D A;  1R6T A;  1GN2 A;  3HKD A;  1E1Q G;  4LNU A;  2ZM6 B;  4X1Y B;  3OUS A;  1R6K A;  3ML0 A;  1WB7 A;  4HAM A;  4PA6 A;  1I08 A;  4P30 A;  1BSM A;  3JAW B;  4DO2 A;  1H8E G;  3WB0 A;  4XDJ A;  2IW5 A;  3VBB A;  2QR4 A;  3ZIA G;  3CYO A;  4NTW A;  3AEI A;  2CTW A;  2Q8V A;  3SYO A;  4B3T B;  1YJW V;  2YDE A;  1FXK B;  5JH7 B;  2JS5 A;  3B09 A;  3D3I A;  4DR7 B;  1Z5V A;  1XHX A;  4MVO A;  2CAZ C;  2IJH A;  1VQM V;  1P4R A;  2ADP A;  2Q4P A;  5LYJ A;  3EVK A;  1SQQ H;  5CBH A;  4PEL A;  5FLX N;  1HNX B;  2DQ3 A;  5B1N A;  2JIZ G;  3HKD B;  2UU9 O;  1VQO V;  3FB5 C;  4OPA A;  3K3W A;  4CBC A;  3JD3 A;  3CRR A;  4UCT A;  5H9C A;  2ZE8 A;  2ETN A;  1EZV H;  3LNN A;  3CP1 A;  1HR0 O;  4X66 B;  1F51 A;  1M57 C;  3I55 V;  5GON A;  4U7O A;  1AIL A;  2HHH B;  5C93 A;  1NR7 A;  2QM7 A;  4D7T A;  4B7K A;  2DYR B;  2WA4 A;  2L35 A;  3E2E A;  2XAH A;  2LJ2 A;  2WLL A;  2H8P C;  1K5S A;  1JOY A;  1XL4 A;  3M99 B;  3TK1 A;  2PY5 A;  3ICX A;  4GX1 A;  5LYJ B;  2XOK G;  1NH2 D;  4MVS A;  4PI0 A;  2UUC B;  1MSW D;  1XEQ A;  3C3S A;  2H94 A;  1N32 O;  1FJG B;  3NR7 A;  3VQV A;  5B3S C;  4U7N A;  4K8Z A;  1AI4 A;  2EZP A;  4DR5 O;  2PUS A;  3CCV V;  4JZ2 A;  4UCS A;  4FLU A;  1XMO O;  1IBM O;  1TA8 A;  1WA8 A;  2W6J G;  2ZXW C;  1YIJ V;  4JAU A;  4MVQ A;  4LFA B;  1FD9 A;  4K0K O;  3JAM N;  2WLL B;  3A0B Z;  4AIL C;  3T1Y B;  3CWB H;  1NVP D;  3AG4 B;  5IYD O;  2X0L A;  4W4L A;  4D6T H;  1URF A;  4G27 B;  4KL1 A;  4JYA B;  3SPI A;  3ABM B;  1EM1 A;  4JYC A;  3K5N A;  5LA6 A;  5FPR A;  2VRZ A;  3FAV A;  1Y4M A;  4MTG A;  4EFB A;  1PNL A;  1AP6 A;  2K1E A;  1M56 C;  2DQ0 A;  4U3J A;  1K8A W;  4J9Y B;  4B3M B;  1MOF A;  4DR3 B;  2OIE A;  3E86 A;  5LMU O;  1XNR O;  5LMN O;  3UM7 A;  2QWR B;  1MA1 A;  4MVU A;  3K9S A;  1N34 O;  3AK3 A;  4EFE A;  5L3F A;  2DN9 A;  1SA0 A;  2LGW A;  1XIL A;  3FYE B;  1GKF A;  1QNM A;  1CP9 A;  2YIB A;  1YJ9 V;  5KUM A;  4RQF A;  5LA6 B;  5EC1 C;  2BOB C;  1VAR A;  4J10 A;  5TIS Z;  3FAV B;  4KXR A;  1HDJ A;  1VQ7 V;  1K7D A;  3CB2 A;  5DED A;  2KQX A;  1WLE A;  3BA9 A;  1GM8 A;  4U3J B;  1RFY A;  2ZD9 A;  2ARH A;  1DGS A;  4FLX A;  3K04 A;  3BFR A;  3LDE A;  1Y76 A;  3B8N A;  3ABU A;  4LFB O;  4JV5 O;  1OCO C;  1S5J A;  3RYI A;  1WP7 A;  4FVM A;  1XQ8 A;  1U96 A;  2JVD A;  1SA0 B;  3P30 A;  4CC5 A;  5JCO C;  1DK1 A;  2ZCE A;  4O2B B;  2QTS A;  1WNS A;  1SS3 A;  2R9R B;  2UUA B;  4NXN O;  2UUB O;  2E76 B;  4AHC A;  1F7Y A;  1VQ5 V;  3G67 A;  4BR6 A;  2EJR A;  1NTK H;  1SZX A;  5CBG A;  2RJZ A;  2YI9 A;  2LW1 A;  3QO7 A;  5J9P C;  1BMF G;  2F95 B;  4JI0 B;  1FXV A;  1HNZ O;  3RYI B;  1IXM A;  1JQ0 A;  1UPG A;  5IJ9 A;  4LF7 O;  3WG7 B;  5B1O A;  4CZZ A;  3OEE G;  1MMM A;  2Q68 A;  1N32 B;  1NS1 A;  3LNM B;  5IYC O;  1D5N A;  1GN4 A;  3K59 A;  1XRE A;  3K5O A;  1BCC H;  4JI1 O;  1IBM B;  3APO A;  4DV7 O;  3HKB A;  3DGE A;  1AB3 A;  1IBL B;  1GO3 F;  3ZN0 A;  1JR9 A;  2LP7 A;  3BAA A;  5CBF A;  4J7J A;  1R6N A;  5H6Q A;  2EIK C;  4PDL A;  5L3G A;  2WLH A;  2YXY A;  4X20 A;  3FB6 C;  4TV8 A;  2AZ2 A;  4JTA B;  5IJ9 B;  1Q86 W;  1RSO B;  5C8Y B;  3U10 A;  4NTY A;  4I55 B;  4UV9 A;  3G4S V;  3K03 A;  2VQF O;  4X1I A;  1QCE A;  4XDK A;  4DV2 B;  5DEC A;  3OFN G;  4X65 O;  2FML A;  4PA4 A;  2EJ7 A;  3E35 A;  1YSC A;  4TT3 G;  3J81 N;  1YHQ V;  1YDX A;  2QSA A;  4LF8 O;  2EIM B;  2ZIM A;  4X1K B;  2Q5Z A;  2P22 C;  4DR2 O;  4O4I A;  2QWN B;  1P84 F;  3ZBH A;  1GRJ A;  2YUA A;  4O2A A;  2EZO A;  5LMU B;  1XNR B;  1VF6 A;  5LMN B;  1UFI A;  5CMU A;  5B66 Z;  1N34 B;  3N27 A;  1K92 A;  3UKM A;  1FFT B;  1AI6 A;  2HJD A;  1VQP V;  3ETE A;  1Q82 W;  2A06 H;  2OCH A;  4MTF A;  4X1I B;  3SR2 C;  1BE3 H;  2Q69 A;  4DV1 O;  2PGG A;  3PJS K;  3H01 A;  3KG2 A;  5B1A C;  4ICG A;  1VF5 B;  3HPL C;  1B3Q A;  1QHT A;  3VQY A;  1LNQ A;  2GUZ A;  1KQS U;  4O4I B;  5K1X A;  3R65 A;  1S0V A;  4LFB B;  1BQ0 A;  2CH7 A;  4JV5 B;  4O2A B;  3P3N A;  3KKY A;  5ITZ A;  5LP6 C;  3S3W A;  3SJQ C;  3T4D A;  4HZ3 A;  2OCC B;  4X9Q A;  4DV3 B;  1W2B U;  2EIN B;  4JI8 O;  4F4L A;  4DUZ O;  1HP8 A;  4CH6 A;  2P6J A;  4I5S A;  1FAF A;  1BS3 A;  2F4V O;  4NXN B;  2UUB B;  1KMI Z;  5EZY A;  1SQP H;  4K35 A;  3K06 A;  2GUZ B;  5IJ0 A;  4J7K A;  2G38 A;  2WLI A;  4GX0 A;  2UXC O;  2ZDI A;  4BIZ A;  2YID A;  4F6R B;  3ABK C;  2WWW A;  4I4T A;  3UCS C;  1I0H A;  1HNZ B;  5EIB D;  1R1B A;  4UVA A;  4LF7 B;  4QE9 A;  1AR4 A;  1H8H G;  1KEC A;  1NJI W;  4DR4 O;  2WLM A;  3ZRW B;  4P2Z A;  3W7U A;  2E5L O;  4OX9 O;  5EIB C;  3SYA A;  3ZRV A;  2R72 A;  4R6Z A;  3CHX A;  5IWA O;  2UXD O;  2KB1 A;  2BCC H;  1ZTE A;  2IH3 C;  4DV7 B;  3D3Q A;  2FB5 A;  1K4D C;  4I50 B;  5JVD A;  4PV1 B;  5IJ0 B;  1PPJ H;  1BT8 A;  1GH6 A;  3LSS A;  4BWA A;  3ZJZ A;  4B7E A;  4TUY A;  4JYB A;  2WLI B;  2CK3 G;  4FM2 A;  2WLK A;  1JMK C;  4DUY O;  3SPH A;  4PJ0 Z;  5LGN A;  4FFK A;  4MSW C;  1WJZ A;  1K4C C;  3ASO B;  2JDI G;  5KX5 A;  1Q6I A;  1RM1 B;  1VQ4 V;  3BEH A;  2F23 A;  1AP5 A;  5JH7 A;  4AQY O;  2JEX A;  3QG5 A;  1OZ0 A;  3LUT B;  3BAB A;  4ZIB A;  3IFX A;  1SET A;  3ZHU A;  3K79 A;  1K33 A;  3E8G A;  4LF8 B;  1U97 A;  1NBM G;  2Y0P A;  3HR0 A;  3KZI Z;  1J5E O;  4J41 A;  3DSQ A;  3E8F A;  5H6R A;  4DR2 B;  4I7Z B;  1M93 A;  3SJA C;  3OR7 C;  1GN6 A;  3ZMU A;  2QKS A;  1L8D A;  1HW7 A;  4TUY B;  2NNU A;  5L3C A;  1PP9 H;  2N04 A;  1IX9 A;  4X64 O;  4YIP A;  1SRY A;  2AHY A;  2OT5 A;  1IUR A;  3FKS G;  3EHB B;  1GAX A;  2JJ1 G;  5KHK A;  1N4C A;  1BGY H;  1Q5O A;  3L71 H;  4QIW F;  5KX5 B;  1AR1 B;  4NVP A;  2JJ2 G;  5D5Q A;  4DV1 B;  1DTO A;  3JSL A;  4QPJ A;  3QO8 A;  4CS3 A;  4YY3 O;  2Y4U A;  4MTO A;  1OV9 A;  5DM6 V;  4BIO A;  3QF7 A;  4MTX A;  2XT9 A;  2QKC A;  2ZE7 A;  2FTK A;  4FJC C;  2JGD A;  3JAK B;  5LHG A;  1K73 W;  2KKW A;  4EKW A;  1A32 A;  3OTF A;  5BMV A;  1VQL V;  1QVF U;  2P06 A;  1XHZ A;  4FM0 A;  2ZIO A;  1VP7 A;  4UUJ C;  1O9G A;  3RBZ A;  2B5U A;  1JFF B;  4JI8 B;  3BPZ A;  5JJJ B;  1HNW O;  2GHY A;  3RWR D;  4A5U B;  4DUZ B;  2CGO A;  1KB9 F;  2QGN A;  4GT1 A;  1SC5 B;  1FPO A;  4UCR A;  4JTD B;  1EFR G;  4P9O A;  2F4V B;  2EUL A;  1ZX3 A;  1V55 C;  1RP3 B;  2LFR A;  1KD1 W;  1Q3E A;  3ASN C;  1E79 G;  4PDV A;  1TGO A;  2QE7 G;  3L9D A;  4DXW A;  2IM9 A;  2ZKO A;  5EBM C;  5E1A C;  3VQX A;  2JGD B;  2UXC B;  4I0X B;  3AG3 C;  5BMV B;  2E74 B;  1AJQ A;  2Q7E A;  3K58 A;  4FLY A;  1MNG A;  1PKX A;  1HWY A;  1G8M A;  4RUE A;  3IJ4 A;  1R73 A;  4DR4 B;  1Q7Y W;  1LUW A;  2A0L A;  1ZLZ A;  4HNA B;  1X59 A;  1D2D A;  1JJ2 U;  2QM8 A;  5H5N A;  1N33 O;  2Q7G A;  2E5L B;  5BZB A;  4OX9 B;  2VS0 A;  1H2G A;  2IBZ H;  2K9P A;  2BE3 A;  2X6C A;  5IWA B;  4ZOL A;  3FFQ A;  4ABM A;  2B1G A;  4DV0 O;  4K3A A;  4LF6 O;  1VQ9 V;  4JI6 O;  4GKK O;  1QR9 A;  3E22 A;  4GX2 A;  1PM9 A;  2QA4 V;  3RW0 A;  3DC6 A;  1NU1 H;  5KA6 A;  4UXN A;  4JI7 O;  1IZ3 A;  1US6 A;  4CC6 A;  1Z2G A;  3H9V A;  4DUY B;  2CTP A;  2BTO A;  4WFE A;  5JWP A;  3OMA B;  5CN0 A;  1M57 B;  3K5M A;  2ZIN A;  3OMN B;  3X2Q C;  3D36 A;  3TXS A;  3ZRS A;  2JS3 A;  1V54 C;  1OCR C;  1XDC A;  1XMQ B;  3JCU Z;  2AZ0 A;  1TVK B;  4GKJ B;  3S3X A;  4AQY B;  3SGI A;  2HFE C;  2M6Y A;  2XAG A;  1N36 O;  3ABL C;  4NXM B;  1Q6H A;  1QLE C;  1V55 B;  4R7C A;  4ZOL B;  3MD0 A;  1G6U A;  3U0Z A;  1NTM H;  2YIA A;  1J5E B;  3PN1 A;  4RUF A;  5EK0 A;  3SPJ A;  1YEW A;  2RDC A;  3AG2 C;  2HLD G;  3E22 B;  2HJF C;  4JAA A;  1YI2 V;  5LOV A;  4DR6 O;  3FB8 C;  5KLV H;  4UV8 A;  1R3I C;  4X64 B;  5B3S B;  1T5E A;  2LW7 A;  5KUK A;  2XAQ A;  3OGI B;  4O2B A;  3OAA G;  4NB5 A;  3CMA V;  1ORQ C;  3B2E E;  1NH2 B;  1Q6U A;  1TUB A;  4PI2 A;  3RYC B;  4HYO A;  3P3P A;  2OTJ V;  2V4D A;  2ZXW B;  2EX3 A;  1I7F A;  3L75 H;  2PYJ A;  2BSK A;  4KP4 A;  3T1H O;  1SF9 A;  2HVK C;  2XND G;  3WB2 A;  1DF4 A;  2RNB A;  4YY3 B;  1S5H C;  2HEP A;  5KHI A;  5IY5 C;  2CDY A;  1F4N A;  5GTH Z;  3CCR V;  5CA0 A;  1W59 A;  3JAS A;  1XI1 A;  4IIJ A;  5EC2 C;  4I9Q A;  2UU9 B;  3IC9 A;  5LOV B;  4UCV A;  1NVP B;  1I5Y A;  4LH7 A;  3N2G A;  1VEW A;  2E3C A;  1HR0 B;  5KAI Z;  3CC4 V;  5CA1 A;  4K8X A;  3GWO A;  2WPD G;  1M56 B;  1TUB B;  1FYJ A;  3K0G A;  1KU9 A;  1HNW B;  1PD3 A;  1KBH A;  4X89 A;  4EB6 A;  5BXZ A;  3SYQ A;  2BSK B;  1QBZ A;  1QLE B;  5FPO A;  2PTM A;  4ZI7 A;  2P5O A;  1VQ6 V;  5DN6 G;  4YJ3 A;  5EYP B;  3ZRX A;  3ZHQ A;  5K1P A;  3CCL V;  2CUG A;  4YJ2 A;  1RSO A;  3MDS A;  5C8Y A;  5CA0 B;  2DJV A;  3JAS B;  3CX5 F;  2ITC C;  2YXL A;  3NXS A;  4I55 A;  4IIJ B;  1AI7 A;  5JCO A;  2Q0O C;  2AHZ A;  3EXA A;  4JI3 O;  5H2F Z; 
#chains in the Genus database with same CATH homology
 4HAM A;  4PA6 A;  4P30 A;  4HZ3 A;  1DLB A;  2OCC B;  4DO2 A;  1W2B U;  4MS2 A;  3STL C;  2EIN B;  1H8E G;  1GTO A;  4XDJ A;  4WFF A;  4F4L A;  1JX9 A;  2IW5 A;  3VBB A;  3ZIA G;  2OTL V;  3CYO A;  3OEH G;  2P6J A;  3F7V C;  4I5S A;  4QE7 A;  4UVB A;  3AEI A;  1I5X A;  1THZ A;  3SYO A;  1YJW V;  3ASN B;  3FYI B;  2PI5 A;  1QVG U;  1FXK B;  1R3K C;  1GMG A;  5B1B C;  3SYC A;  2Y48 A;  2YSU B;  3D3I A;  1OCO B;  3K06 A;  2P90 A;  2HR3 A;  4MVO A;  3AG3 B;  2IJH A;  1K97 A;  1VQM V;  1YJN V;  1NR1 A;  1P4R A;  2WLI A;  4FK5 C;  4GX0 A;  4H33 A;  2IJI A;  2ZDI A;  4H37 A;  5HFL A;  4BIZ A;  3CCS V;  1M1K W;  5CBH A;  4PEL A;  1DF5 A;  2DQ3 A;  2IH1 C;  3ABK C;  2WWW A;  5B1N A;  2JIZ G;  4RQE A;  1YTF B;  3G6E V;  1VQO V;  4UVA A;  3FB5 C;  4CBC A;  3K3W A;  4KFM A;  3RVZ A;  1KC8 W;  3JD3 A;  4QE9 A;  1H8H G;  1KEC A;  3QNE A;  1Y66 A;  1NJI W;  5H9C A;  2ATK C;  2WLM A;  1W0K G;  3ZRW B;  5IDJ A;  3CP1 A;  3CC7 V;  4Q20 A;  3WG7 C;  1COW G;  4WCE V;  4P2Z A;  2Z5U A;  1F51 A;  1M57 C;  3CCU V;  3K9A A;  3W7S A;  1KP3 A;  3I55 V;  5L3D A;  4U7O A;  2QTO A;  3W7U A;  4MVR A;  3K0D A;  5C93 A;  1NR7 A;  2QM7 A;  3SYA A;  3ZRV A;  1OCC C;  4R6Z A;  2DYR B;  3CME V;  3E2E A;  2KB1 A;  2IH3 C;  4G2K A;  2XAH A;  4RO2 A;  2WLL A;  2H8P C;  1K5S A;  1JOY A;  1K4D C;  4WFA V;  4X8A A;  1F4M A;  1XL4 A;  3M99 B;  3TK1 A;  4YXW G;  3LSS A;  3ZJZ A;  3IC7 A;  4JYB A;  3F5W C;  2WLI B;  3AG1 C;  2CK3 G;  4GX1 A;  1KP2 A;  2WLK A;  3JCZ A;  1GM9 A;  2XOK G;  2X7R B;  3TET A;  3E8H A;  3SPH A;  1NH2 D;  4MVS A;  5EBW C;  3T2M A;  5LGN A;  3I56 V;  1MSW D;  2H94 A;  2XAS A;  3X2Q B;  4MSW C;  1XL6 A;  1AI5 A;  3JD4 A;  1V54 B;  2QEX V;  1K4C C;  1OCR B;  3CPW U;  3ASO B;  2JDI G;  5B3S C;  2ZQM A;  2B1I A;  4U7N A;  1RM1 B;  1VQ4 V;  2EIL C;  3BEH A;  2EZP A;  1AI4 A;  3ABL B;  2UXN A;  1N8R W;  3ZN1 A;  3CCV V;  3ZCC A;  4N23 A;  2JEX A;  3ZMZ A;  4RAI A;  1OZ0 A;  3OR6 C;  3LUT B;  1Q81 W;  3IFX A;  1SET A;  3E89 A;  3K79 A;  1OCZ C;  1K33 A;  3WFV A;  3E8G A;  2IJJ A;  2W6J G;  3AG2 B;  2ZXW C;  1YIJ V;  4JAU A;  4MVQ A;  1NBM G;  2HVJ C;  2WLL B;  4I9W A;  4BAY A;  3E8F A;  5H6R A;  4BIU A;  2EIM C;  3GB7 C;  1ENV A;  1NVP D;  2EIJ C;  3AG4 B;  2EIK B;  4ZKI A;  2X0L A;  3OR7 C;  3SPC A;  5IYD O;  3SPG A;  3ZMU A;  2QKS A;  1JCH A;  2DYS C;  2JK5 C;  2NNU A;  5L3C A;  4G27 B;  1PNK A;  1AJN A;  1SRY A;  2AHY A;  2OT5 A;  3ZRW A;  3OMI B;  3SPI A;  3FKS G;  3EHB B;  4MW8 A;  2IJK A;  3ABM B;  4N21 A;  4QNH B;  4J9Z B;  1RPO A;  2JJ1 G;  3MHS C;  3BY6 A;  2X6A A;  1EZJ A;  4JYC A;  3OUF A;  3OW2 U;  4QIW F;  1AR1 B;  5LBQ A;  2IU3 A;  5LGT A;  2JJ2 G;  1DTO A;  3OM3 B;  2XAJ A;  1Y4M A;  4MTG A;  4OXS A;  1PNL A;  2K1E A;  1M56 C;  1PL0 A;  3OE7 G;  4QPJ A;  3QO8 A;  2DWD C;  3ZMS A;  2DQ0 A;  2P67 A;  5IY5 B;  2Y69 C;  2ZR2 A;  2GSM B;  1K8A W;  4JF3 A;  4J9Y B;  4MTO A;  1MOF A;  2DWE C;  5DM6 V;  4MTX A;  2FTK A;  4FJC C;  1RPR A;  3E86 A;  5LHG A;  2ZR3 A;  1VQ8 V;  1K73 W;  3UM7 A;  4EKW A;  1W0J G;  3JYC A;  1VQL V;  4MVU A;  3STZ C;  1QVF U;  1QLN A;  4FMT A;  5L3F A;  3VOU A;  3W7W A;  1P7B A;  4R8C A;  3FYE B;  4QJF B;  1FXH A;  1GKF A;  2F43 G;  1CP9 A;  2DW4 A;  4PA3 A;  4UUJ C;  1YJ9 V;  1GM7 A;  5KUM A;  3RBZ A;  2B5U A;  1TUE B;  4RQF A;  1R3J C;  3TCU A;  3K08 A;  2OCC C;  5EC1 C;  5B1A B;  2GHY A;  2BOB C;  4JAS A;  2EIN C;  1ARO P;  4GT1 A;  1VQ7 V;  1K7D A;  1YIT V;  4UVC A;  4JTD B;  1EFR G;  1OCZ B;  4P9O A;  1WLE A;  2Q6A A;  3ZMV A;  1MAB G;  4GCZ A;  1V55 C;  2M7W A;  1GM8 A;  2LFR A;  4X88 A;  1G4Y B;  4JTC B;  2ZD9 A;  3ASN C;  1KD1 W;  1E79 G;  1CPY A;  3K04 A;  4PDV A;  2W0F C;  1FXK C;  2QE7 G;  2HG5 C;  3T1C A;  4DXW A;  3LDE A;  5LHI A;  3B8N A;  2EIJ B;  3ABU A;  5GW7 A;  1KKD A;  5EBM C;  3CXC U;  5E1A C;  3ZMT A;  1EBO A;  2EBO A;  5LHH A;  1OCO C;  5FL7 G;  3AG3 C;  2ITD C;  5LGU A;  2Q67 A;  1AJQ A;  3DTU B;  1JPX A;  4JGS A;  1PKX A;  1HWY A;  4QPK A;  4FIP C;  1G8M A;  2R9I A;  3P30 A;  3LDD A;  4RUE A;  1QR8 A;  4WFG A;  1R73 A;  4KUM A;  1M90 W;  1Q7Y W;  3CC2 V;  2A0L A;  1H38 A;  3JD1 A;  4BW5 A;  2LFS A;  4MT8 A;  1JJ2 U;  2QM8 A;  1OHH G;  2R9R B;  4WFB V;  5BZB A;  2P7T C;  5B1B B;  2IU0 A;  1FS0 G;  1H2G A;  1VQ5 V;  1NKD A;  2X6C A;  2B1G A;  1PNM A;  4PA7 A;  3B77 A;  4TSF G;  1VQ9 V;  2PI4 A;  2NLJ C;  2EJR A;  1QR9 A;  1R3L C;  5CBG A;  2DYR C;  3E83 A;  2JEU A;  4JAV A;  4GX2 A;  3ABK B;  3IGA C;  2QA4 V;  3FB7 C;  1BL8 A;  1VQK V;  3QO7 A;  3RW0 A;  5J9P C;  1VQN V;  1BMF G;  4MVM A;  4P9P A;  5KA6 A;  4UXN A;  1FXV A;  1IXM A;  1B6Q A;  1JQ0 A;  3W7T A;  2V7Q G;  2A9H A;  4WFE A;  3WG7 B;  2ZDI C;  3RVY A;  3OMA B;  4GX5 A;  1SZT A;  5CN0 A;  5B1O A;  4CZZ A;  3CCM V;  1M57 B;  4LCU C;  4Z1M G;  3OEE G;  2Q68 A;  3EFF K;  2XAF A;  2D3O W;  3OMN B;  1K9M W;  1SER A;  1GK9 A;  3X2Q C;  3D36 A;  3ZRS A;  2UXX A;  3W7X A;  5L3B A;  1V54 C;  3LNM B;  2WAM A;  1OCC B;  5IYC O;  1BHB A;  5KA5 A;  1OCR C;  5L3E A;  4PDR A;  3ASO C;  2HFE C;  5EBL C;  2XAG A;  2Z3Y A;  1RM1 C;  3ABL C;  4E2L A;  3F7Y C;  4JPR A;  1QLE C;  1V55 B;  4R7C A;  4R50 A;  3DGE A;  1E1R G;  3MD0 A;  2X6B A;  3AG1 B;  3SPJ A;  4RUF A;  5EK0 A;  1GO3 F;  3AG2 C;  3ZN0 A;  2HLD G;  1M9N A;  4FPP A;  1K5Q A;  2LP7 A;  2HJF C;  5CBF A;  1YI2 V;  1R6N A;  1JVM A;  3FB8 C;  5H6Q A;  4PA9 A;  2WSS G;  1R3I C;  2EIK C;  3AG4 C;  4L87 A;  4PDL A;  4LC1 A;  4UV8 A;  4ASU G;  5L3G A;  2WLH A;  3A0R A;  3ETG A;  3FB6 C;  4WF9 V;  5B3S B;  4JTA B;  1Q86 W;  5KUK A;  2XAQ A;  2YEV A;  3OAA G;  1S76 D;  1SES A;  2A79 B;  2EIL B;  1S72 V;  4UV9 A;  3G4S V;  3CMA V;  3K03 A;  1ORQ C;  1QCE A;  4XDK A;  1NH2 B;  4G28 B;  1BHA A;  3OFN G;  3ABM C;  3ABT A;  3T4Z A;  3B8M A;  4ZBM A;  4PA4 A;  4HYO A;  3E35 A;  2WLJ A;  2OTJ V;  3JD2 A;  3CCQ V;  3JD0 A;  1F23 A;  2ZXW B;  1YSC A;  4PDM A;  4TT3 G;  1WPX A;  4KP4 A;  1CEZ A;  1S3J A;  1YHQ V;  3QO5 A;  1S77 D;  2HVK C;  2EIM B;  2XND G;  1YTF D;  1DF4 A;  1S5H C;  2DYS B;  5HFM A;  1J95 A;  1L1F A;  5IY5 C;  4XDL A;  1NQT A;  4WFH A;  2WLN A;  1F4N A;  3CCR V;  2EZO A;  2V1D A;  4TWK A;  2HKO A;  5CMU A;  3LSQ A;  5EC2 C;  1ZWI C;  4XBF A;  1K92 A;  4LBE C;  1I5Y A;  4MVZ A;  1NVP B;  1MG1 A;  3UKM A;  2BOC C;  1FFT B;  1AI6 A;  3P32 A;  1VQP V;  3HB3 B;  2YEV B;  3CC4 V;  3ETE A;  1Q82 W;  3CCE V;  4MTF A;  1K3E A;  2W6I G;  3GWO A;  2Q69 A;  2WPD G;  1M56 B;  2MK3 A;  3K0G A;  1K34 A;  2Y69 B;  1PD3 A;  3PJS K;  3H01 A;  3CCJ V;  1FXK A;  4X89 A;  3KG2 A;  3SYQ A;  5B1A C;  3CD6 V;  2C2A A;  3HPL C;  1AJP A;  1QBZ A;  3SYP A;  1QLE B;  3G71 V;  5IYB O;  1LNQ A;  1VQ6 V;  5DN6 G;  3MHH C;  1KQS U;  3ZRX A;  4LP8 A;  1UJW B;  3CCL V;  3OGC C;  3LDC A;  3ETD A;  3R65 A;  5CA3 A;  3E8B A;  1S0V A;  1ROP A;  4MW3 A;  2ITC C;  3NXS A;  1AI7 A;  1E1Q G;  2AHZ A;  3OUS A;  1R6K A;  3SJQ C;  3ML0 A;  3T4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...