2ITDA

Potassium channel kcsa-fab complex in barium chloride
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
molecule tags Membrane protein
source organism Streptomyces lividans
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2itdA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2itdA02
4OZIA 1HWGB 1QYGH 2FYYB 2A9ML 1XGPA 2RHEA 3SGJC 2MCPL 1B3JA 3U1SL 1N5AA 2MJWA 4YEEA 3E1F1 5MP6L 3TP4A 4QRTA 1MAJA 3OX8A 5GGUB 3NTCH 3ETBF 1A8JH 2NY6B 1E4XL 4HZLB 5F8QC 3QEQD 5E8OB 3LPFA 3C2AH 1A0QH 3HTLX 4KQ4H 1GC1C 5I2IA 5GRYA 1MPAL 4OZHB 4TQEL 3QIWB 5I19H 3TO2A 4EVNB 5IMLA 5AUMA 4U1IA 1KBGL 4GS7B 5J6GA 5IW1A 3U36B 5E9DD 3PJSB 3K8MA 5ALCL 2G9HB 4N8VB 3SDCC 2YXFA 3R0MA 4ERSL 1F2XK 1P1ZB 3ARBC 4P48A 3JWOL 3LV3B 5CSZA 3DV6B 4MJIB 1RULL 1AC6A 3QCVL 4AH2A 3FQUA 5BZWB 1UA6L 4PJ7B 1BZQK 5J89A 2DS4A 4TN9A 2EIZA 2ZNXA 4I3SL 1JGVH 2I9LA 1FFOB 3S5LA 1WBZA 3INUH 4LQ1A 1ZV5A 3TZVC 1DLHB 3MSPA 1JMXA 4NQUA 1IEHA 4FQ2L 3QDME 1HSAA 3CFJB 2VDQL 4EI6A 5HD8D 2CIKA 1KB5B 3IU4L 3QQNA 4XCFL 3G6AA 4LPYA 1XF1A 3OXRA 4Q9CA 3RWGA 2BSSB 1G1YA 1NGYB 1WIOA 2A74A 4M7KH 3EOAA 1MRFH 1N59B 1CFNB 2YMXL 5EIVA 3GM8A 4KV5F 3KR3L 4MLIA 4BFEA 5GISL 4XHJD 1UACL 1D5XA 4MSWB 4OIIL 4DCQA 1ORQA 1IEAB 2EKSA 2WINB 3UYPA 2WBJA 3QG6A 5DRZB 4C57C 3GBML 1RUAL 3ARGA 1PEZA 4TNVF 1SBBA 4XPBL 4H25A 3WFCL 4FNLL 5FGBA 3QAZB 1V05A 3UO1L 3VXSE 1MOEA 4GXUM 5HYQB 4P46C 4U6VH 5EWIL 1RZ8A 3LKRA 4J4PA 2DJUA 5F21B 3T77A 1YEKH 1NGQL 1QZ1A 2Y9RT 1XIWD 3BJ91 1ZGLP 4NN7C 1E0OB 3G08B 6CGTA 4WTZA 3KYMB 4XWGH 5IB1A 1FCGA 3S3SA 4GKNA 5FGCE 1J0IA 4RFOL 5ITFA 3S35L 4N1CA 5DK2A 3KYOB 4RRPA 4U1MB 1BGXL 4NRYA 1U8JB 2PXYA 1KLGB 1ND0A 4F7CA 3ILPB 1I8LC 1GZQA 1I3RB 4N5EC 1AHWA 1DN2A 5E70A 5LAXB 2DIBA 1FDLH 3FRPA 4D9QE 3BP5A 2VIRB 4NWUL 4RMWA 5DXWA 2V17L 4MVBD 1MI5B 3UBXI 4LVEA 4XXCA 3GRWL 4MWFB 1MFAL 4LPXA 2A38A 3Q3GB 1K8DB 4YC2C 4XPHL 4QRRD 1BECA 3L5JA 4UOJA 1IAII 5DC9B 3TZVA 1TZIA 3HC3L 3O6FC 4AIZA 3L7FB 1G6RL 1XF3B 3DSFH 5DHVB 5I1GL 2YPLE 1N6QL 2PO6D 4FZEL 3ARZA 1IZJA 3QYCA 4U1HB 3SE3C 3I6LD 4EUPG 2BSRB 4P2OA 2M1KA 1ERNA 5HYQA 1YEKL 4JKPH 4U1GB 1U3JA 1YY9D 1D6VH 4TSCL 4H5SA 4E9LA 3C9NB 1IKFL 4JO2L 3UJIL 3SY0A 3BH9A 1VGKA 5CZXD 4XVUD 1KT2A 1BEYH 2C7UA 1G1CA 1F6AB 1UB5A 1QHOA 2APWA 3HE6D 5KS9B 1CWVA 3QEGL 3TM6A 4RGOH 3AMKA 3IF1B 2X42A 4LNVA 4XNXH 1NL0H 4Y4FC 3GSRB 5GSRB 3RVXC 1KJVB 3V8CA 2DLTA 3RU8L 5CD3A 2A74B 1A7OH 3JTSA 5F3BA 1R3HA 2VXQL 5SWQB 2Z92A 1SHMA 4NNYB 3RNKA 2PNDA 5ANMA 1FZJA 1YPZA 1YEIL 1P6AB 2HTLD 3QIBA 1YECH 5GGTA 3ZDYF 1MQKH 2OQJA 1IGIL 4HLJA 4RFEA 3LS5L 1LEKB 4A6YB 2VWEE 1YN7B 2R2EA 5DEZA 3MNWA 4HFWB 4MA8L 1HHKB 1IGYA 4ODBD 1CE6B 4G8FB 4J2XA 3LKNB 4H8WL 1Z3GH 3KLDA 4HIIB 3DV6A 4TUJA 5D8JH 4YDLB 5ESVA 1JGVL 4BSWB 4GOSA 1DQQA 4LL9A 2GK0A 5F7WC 4WO4C 1OD7A 2XIDA 4OF8A 1QO3B 1JVKA 4JR9L 1CCZA 5CJOH 5J6GB 1KTDA 5D71L 2DQDH 3LVEA 4V2BA 2VZVA 3P2TA 3KLHD 2GJ6B 4EUPA 3ARDA 5CD5C 3GIVA 1XGUA 4JM4L 4PJIF 1U6AL 3MBEA 4OLXH 5EWIH 3GM0A 3EJZC 4WY7L 3O6FA 4KMQA 3R4DA 1EBPA 3BH8A 1Z5LB 4ZSOB 4L8CA 5AAMA 4XTRD 5D2LF 2CJUH 5C08D 3B9KA 4XCNB 2D9CA 1P4IL 4LRNH 4P2OC 4WEBH 5C0FA 1PZUB 3RWJB 1MQKL 3CSGA 3QDJA 1FYTD 4YO0B 4U1HA 3P9LA 2ZNWA 1DBMH 3UTSB 2E7BA 2BP3A 4PV9A 2R23A 4E0RB 4XP9H 3FRPG 4OF0A 3WDHA 1AR1D 1TNNA 4KMLB 4MNHA 1WQVT 5GXBB 5D6CA 1N8ZB 4JFZL 1J11A 4MLSA 1JBJA 3B2VL 3P9LB 3QUMA 2X10A 5DK0A 2DQJH 4XPBH 1WFOA 4WUUB 2IC2A 1FZKB 5J12C 4K3EH 4YK4B 3TBWA 4JZJA 4K7PY 3GSOB 2BHZA 2VISA 3UTSE 1NAKH 3EJYC 3O3BB 4GAGL 3O6FB 4U1JB 3Q48A 3QIWC 3AREA 3UTPE 5CIPB 1I1AA 3KPRD 1XGYL 1N5YL 2HRLA 4R97C 1I9EA 2OTWA 2NY3D 4DWHA 2D0HA 2GJ6A 5E1HB 2P5WE 1EAPB 2W91A 3F7VA 1CDIA 5DJ8B 2PXYD 4CRPA 3UX9B 1CGXA 4Y5XB 3G08A 4FTVA 4PJ5B 3VGHA 3MRCB 2YWYA 4K3JL 2FHCA 2X05A 3KPRE 2I24N 1OF2A 2AK4E 3EO0B 4U1NB 3MLRH 1RU9L 4QRSB 5FCSH 3IXTA 5I75C 2WAHA 2VRAA 1JGDA 2X9WA 3CXHK 4HUVB 2N56A 2R1YA 3DNKA 5E99H 3KLSA 5IB5B 3X3FH 2R8SL 3HCVA 4LSPH 5L0QB 1V8HA 3KYNA 2J8UE 4BELD 2AJSH 1S7TA 2HJLB 2PCPA 3MLPA 3T3ME 2FJHA 1UCBL 5DRXB 1QLEH 3GNMH 1U2CA 3HPJB 4P3CH 3RWHA 5FF6A 5IBTH 2R2CA 3FFDB 1CGUA 4KDVA 1ORQB 3R1GL 2IBGA 1XMWA 4GRLC 1NPUA 4L4JA 1FZMA 2DYPA 3EOTH 4OGYH 4Z77B 4MQTB 4XNMB 3BX7C 1HILA 2WIIB 3EOAB 4QT5B 2Y7QB 3WSQL 2ICES 1TETL 1N0XH 1PJ9A 1BFVL 4QOKD 4D9RD 3MRLA 3QDGD 4BFGA 3CVHA 5TFSH 5C92A 5ADPH 1I8KB 2A6IB 4ONFH 4ZOEA 1T03H 1MJJA 3DBXA 3ZHLA 3WIHA 3RI5K 4TTDC 3RAJL 2IH3A 5I1HH 3T8XA 1Q9LB 4U1JA 1MJ7L 3PWPB 2CRMA 4NRZA 4G8IA 5D5ME 4H5SB 5FUOL 3RX8A 3EYQC 1TQBC 5IESH 4MXVF 4XNQB 4JG1L 2QSVA 5K59E 2X9YA 1A5FL 2FDBP 3FT4B 3KS0J 1QQDB 3S88L 2CRIA 3QFJB 4J6RL 2W0FA 5DHYA 4L8DB 4GKZA 2MHAA 4GUPA 4NHCL 1YEFH 5IK3B 4JFPA 4QHMA 4LU5H 4X7FC 4PREB 3MXWH 3TV3H 1VGEH 2E3VA 3N85H 3VWKC 4LCCA 5HHNA 4GUPB 3TC9A 3MRHB 3ULVH 1QG3A 3HS0A 4QHKJ 5CBEB 1G7JB 4Y1AE 4GW4B 5C6TH 1S5IH 2GUOB 5MENE 4ODSH 4JDZB 3C5JA 4HKJB 4AENB 4HF5L 5CGYC 2CK2A 3IJSA 1FHGA 2HFFA 4NT6A 4X7SH 3UDWA 4ETYA 3OPZL 4LDEB 4X6DA 1J0HA 5EO1B 4U1MA 3ULUF 1GRWA 5I1HL 3MLTA 5F9DC 1IC4H 1E28A 3W9EB 5I1KL 1I7ZB 2NY0B 4APQB 2EXWC 2VYRE 1EPFA 3DO3A 1Q1JL 2DWEB 1FZMB 3TPUA 5EORH 4CMMA 3PL6B 2GJ6D 4TPRH 5IHLB 3PGFL 1FFPB 4QCIB 4JFOB 4KKAC 4PJHE 5A2LH 3LKNA 1KIPA 3G6JA 3HNSL 3GMRA 1BLNA 5D7LE 3QNXA 1XEDA 4PGBA 2X4PB 2VXTH 3CU1A 1BBJA 4JKKA 1YMME 4Y4FB 1SEBB 1ZT4B 2ENSA 2BNRD 4OBRA 1RVFL 1H3PH 5IFHL 4KK5D 2OBGA 1MY7A 3BE1H 1LP9E 2DLIA 2VZ3A 3RY6A 1A3LL 2OMBA 5HVGB 3BZEA 4YXHH 5BRZD 5E03A 4QOKB 5IVOA 3MV11 1QBMH 4OFIA 3H7LA 4G7VL 4MJ5B 1T0MA 1MVUA 4LLUA 2XY2A 1YMMD 2DBLH 7CGTA 5J9PA 1OAKL 2HFGL 4XCCL 4D0BB 2WK2A 1FN4A 1IAIL 2NYYC 2V5RA 4XAKE 1W8OA 3F7RA 4AIXA 4NGHL 2FJGB 5M95B 3QZWG 3OZ9L 4ELKB 2OJZL 2VO5A 4ZSOE 1EFQA 4UIMA 3S5LB 1ZS8A 4F57L 1FFNA 2VISB 4L8SC 1U8HB 5ISZE 1X6NA 3B8YA 1A6PA 3C87A 3GMOA 4G8GE 4CMMB 1H3UA 5T1KD 3VXME 4EN3B 4DQOH 3QCVH 1ZANH 3AU1A 4WU7B 1FVDB 1IAIM 3VD3A 1U8QA 3GI8H 4L3EE 4LSTL 4JQVA 2LU7A 3OL2A 3C5ZD 4LF3A 4X6CB 3H3KA 5FKPA 3SQOH 1G9NC 5E8NB 1TQBB 4FZ8L 5EZJA 3SCMC 1A7BA 2PKDA 5C0NC 1DBML 1UKTA 1CQKA 2QHLA 2XT1B 1ADQA 25C8L 2OM5A 1R3LB 1S7XB 3HN3A 1TZHB 3F5WB 1VENA 3Q5TA 4QTIL 4P2QB 2D7MA 4N0UB 2FBJH 4JFXA 4NC1E 2YK1H 4YXLL 4TVSa 4KRLB 3AVEA 1AGCB 3RKDD 2VXUH 1HHIA 1BVLA 1P4IH 4LRNL 5JHDD 3RPIA 2R4RH 2K7QA 4OB5L 2P5WB 5IIEB 4G5ZH 1R3LA 1LP9A 1A1NB 2EDEA 5DC4B 4FXLA 4Y8AA 5EOCH 3HUJB 5LWYH 2QSCL 1IBGH 4PUBH 1O7SA 4JFQB 4YWGL 1KGCD 3MA7B 1YNKH 5ITFB 1I1AC 1J1PL 2DDQL 4LF3B 4X6CA 4WI6A 3RZCC 1T1XA 3MO1B 2AJVH 3CFEA 4DGIH 1KSRA 4N0UE 4BA8A 1X5IA 3VI4E 4ZXBA 4XVSH 2W0FB 3TJEL 4JPIB 3D85D 1GZPA 5DQJB 4ZAKB 1A7PH 3GI9L 4X0KA 1KNOA 1UH3A 4NSKA 4Z7UA 2EDXA 5I1AB 3UPRB 5I1EH 2H3NA 1H0DB 4QRPD 5FKAA 3PWPA 3HNSH 1PG7L 1JZ5A 3WLBB 3QXDB 5E9DB 2Q87A 1J8HA 4JVUA 1KELL 4KJPD 2F9BT 4NZRH 4BM7A 3J7HA 3QIUB 3QB7C 4TUKL 3QO0B 3CFBB 3GSNB 3TA3D 1GOHA 5CS7A 4LCUB 3MROA 4PLKD 4MJ5A 4HS3A 2FJFA 4NQDA 4CADB 4AZ8A 3N1PC 6FABH 3VD5A 3HC4L 4H26A 5DMKB 4JR9H 2D2OA 2YZ1A 1HSAB 3CFJA 5F93C 2NY1C 5F9JA 3SJVE 4V1DE 1H15B 1GCFA 4HH9B 4NKOB 4WGWB 2ICWI 5FIEA 3T3MF 4KGJA 3UPRA 2H45A 2FD6H 4GH7B 4OAWB 4YJZL 2J8UF 3S6CA 5D7IF 2P5ED 4Z7WF 3RX5A 2X89D 4KQ3H 3MUJA 3FB8A 1YY8A 4CDGC 4ZXBB 4YR6A 2EC9T 1DUZB 3VXQA 3RWFB 5JA9A 2E7LA 3RIFK 2J3SA 1H3VA 1JCKA 1RHFA 5JO5B 2OL3A 1E28B 1MSPA 5DJ8A 1MFBL 4DZBA 1EJOH 5J8OA 4ODXB 4FS0A 3OHXA 1PD6A 5INDB 3IETB 1TXKA 1A1NA 4HT1H 5SWZE 3O4OB 4YPGB 2G60L 4GBXD 4OUUA 5ALCH 1JUFB 3MUY1 2QADC 1LK3L 4M5YL 4XPHH 1IVLA 1KCKA 2NPLX 2AI0H 4D94A 3ZDXE 3AS1A 1RK1B 1G9ML 4KTEH 5IOPB 2RGSA 4F15B 3L3KB 4NKQB 2YS4A 1BX2A 1J10A 4HKJA 3GGWB 2VB5A 1VKXA 4P2YA 3DUSB 1ND0B 1G7JA 3HC4H 3N50A 4JG0L 5EC1B 5TF1H 4KVCH 4NRYB 4F37F 1LHZA 4NQCA 5BZDB 2WUCH 3HMWL 5DD1L 5E2TH 1L6ZA 2GCYB 3WE6B 3V5DA 5FKPB 4C4KT 3TNMA 4NKDB 2PYEB 2QHRL 2GTWB 5FDYA 5GRZA 1DP0A 1CBVL 5KZCD 1U8QB 3IDYC 4KVNH 3VXOB 1T7YA 1XGQA 3EJYD 3GO1H 5BVJA 5DJZB 3EAKA 3MPCA 7FABL 1KLFA 2F53D 1KXVC 3LN4A 4P23B 4PJDE 4YBQC 3NFNB 2UYLB 4NO2A 5FK9B 2VOTA 3C8HA 4PJXE 1I1RA 2O93L 1KEGH 4RDQG 5CIPH 1G0DA 1A6UL 4YHLL 1ZS8B 4DQOL 2ARWA 2BSED 4OM1L 5K9JH 1DBKH 4C83B 3JWDH 1Q9OA 1UADC 4PRIE 2WLYA 2BY3A 2OTUA 4XVSL 3TJEH 1DQDL 1A22B 2O61A 2E5EA 2W9DH 3TYGH 4F2MA 1AQKL 1ZGLM 1FAIL 3MLWL 1QKZL 4MNGE 1MCBA 1IL1A 1AP2B 1J12A 1G0XA 2BSSA 4LLYA 1NUNB 1UWGH 4PJXB 4BQ9A 5C0JB 4NNPL 5DA4A 2J5LC 4NO0B 2DF3A 5FYLD 1UJ3C 4MB5A 3HE6B 2WMPA 5FO8B 1CTNA 1IGYB 1X9QA 5F89A 3DLQR 1ED3B 1G7QA 5DD0H 3VXNA 3NCYP 1DUYB 4M1GH 3L3GA 4I3RH 1C7SA 4DKEH 1OP9A 4U1NA 4NO0A 3HAEA 5DUMH 2A2QT 2CKNA 1ZLVH 4LRIA 4ZTPL 3ZDYE 4PRAB 2NTFB 3S5LG 1EV2E 3FT3A 4NO3A 3QI9D 5AYUL 1V7ML 1JF1A 3MODH 4U7SA 1U8NA 1AGEA 3GRWH 4HWBH 1A6TA 1HE7A 4HPYH 3TO2B 5IMLB 1MRDH 1F3DH 4P49A 4Z7NE 3O3EA 1JGLH 3E2HC 5I2IB 1TCRB 2AK4B 1A6AB 4WEBL 1WISA 3KPNA 3SKUD 1HI6B 5D7KD 2YZ8A 5CIPA 1YEJH 5F3HA 3QUZB 2BOBA 4QLRA 4UIKH 2E9WA 3EZJB 1IKNC 1AE6L 1F8TH 1I1FB 8CGTA 3HHRB 1YEDB 4R2GD 5GIRA 4OI7A 3RWCB 2JJSA 4ZUUA 2I9TA 4KXZI 1U93B 5DYOB 2BNQD 2FBJL 5HHME 4L4VD 3ARYA 1LO5B 2OJEB 2QQKL 3VDBA 5TDPA 3IVKB 1ONQA 4D0CB 2VWEC 3DROA 4EXPX 4X8JB 3K3QA 1G9EA 2A6KA 4DGVH 2LQRA 1FVEA 4XXCC 3DECA 2X4UA 2GQHA 3QIBC 1JRHL 3VFVB 1SQ2N 1JTPA 5D1ZA 3UTSA 3FT2B 4OJFL 4M62H 2DQIH 5L9DH 3MCKA 5FDWA 3KVQA 4YFLF 1EH9A 1GSMA 1VKXB 5F9WC 1DBJH 1KCUL 4EQ2A 3NH7H 1QRNA 2YBRB 3RGHA 4X6BB 4JZJC 2Y4SA 1UCTA 1Y0LA 3O3UN 4JB9L 4PJDA 4S1SL 4XP6L 3V52L 4GMTL 4JHWH 5ECJE 3CXDL 3MV9E 4IMLB 3EYVB 5EUOB 1FC2D 4OTXL 1QBAA 1MHCB 1QFOA 4JRXE 2H9GA 3ARDB 2HH0H 4YHNB 3CDFA 2CO6B 2IQ9H 5IVXA 3GMMB 4PG2C 3MRLB 2AP2A 4PJIB 3NN8B 4KKAD 3VMOA 1AQKH 1WZMA 4PGCA 1VERA 3L95B 4Z77A 3QDMD 3QXAA 4Y5YA 1JTTA 3MRBB 1NBYA 3TN0D 5LJYH 1J88A 3GSXA 1U91B 4BK5A 1U41A 3M17B 4IOSD 4RISH 1OGAE 4G43B 2YXMA 4X7TB 1ZLVK 4EKXA 2XY1A 3ARGB 2FH6A 1FRGH 4RWYH 3H9YA 3HR5B 1BJ8A 1PZ5A 5F9JB 5DUPH 3ROOA 4MQXD 4OCXL 2VERN 3F6IA 1OT1A 3QXTA 1U8IB 3KWWB 4AL8H 3T2OA 3SKOA 5SWQA 1C1EL 4HIEA 2X4NB 2EZ0C 2VH5L 4J8RA 2GFBA 1HH6A 4LCWB 3QO0A 4C55A 5KSVB 5FO9A 1FO0L 3VXSD 4TVPL 3T04D 3G6AB 3VCLA 4P23D 4HS6B 1C16A 1H3GA 3KPSA 2X70A 5I66A 4ONGL 3G04A 3WO4C 4Z8FL 5E4EB 1FG9C 2IADB 4G8EB 4I4WB 1NGZB 1OAYH 1UH4A 4HF5H 3SDAA 2LAGB 5GS1B 1NLDH 25C8H 4YNYB 2FCBA 3BT2L 5GRXG 2H1PH 4Z7WE 4DN4H 3QRGL 1A0QL 4KQ4L 3IT8D 4UQ2B 4PJBE 2AJUH 4RQQB 4LMQE 2FX9L 3GMNA 4I0PD 1JMZA 4P5KA 2AKRB 1IC7L 4GXVH 1MEXH 4MXWH 4NCDA 4J3UA 3DI3B 3HFML 3FN0H 4PV9B 1I9JL 1HHJB 1OTTC 4PG2A 4BSJA 3TWCL 2ITDA 1F58L 1QLEL 2P5WA 4NQDE 1JHKL 5JW4M 1NC2D 3O0RH 2QQKH 3L1OH 4UV7L 4X80L 3SGDH 4N0UA 3ARDD 3MA9H 4GG8B 1QSED 2ADIB 3IFNH 5TQ0H 3ZT7A 4LLAA 5I0DA 4CW1B 3QO1B 3L3JA 4TSCH 4BSVB 4EUPB 3CIQA 1AE6H 1F8TL 5ETUB 4ONGH 3O6LH 2DIAA 4K3GA 3O45A 2F53A 3QI9B 5DHVH 1TNMA 2C3HA 5IB1B 2IQAB 3MBXL 5EOQL 1IC5H 2N7BA 4IOFC 1DVFD 5E8PA 1G7HB 1FG2B 3PQYE 3UXFA 3CUPB 4YR6B 5HHOA 3V6FA 1P53A 3VA2C 4KI5C 1JHLL 5D9SA 1M1SA 3UTTB 4TNVK 1CG9A 3THML 1GVIA 3VU2A 1W72H 4XMPL 3DXAD 3LIZH 5JOEA 3S88H 1HHKA 4Z7VA 3AFLA 4ZS7L 2ITCA 3NH7L 4N0RA 4FNLH 4OZHF 1QFWL 4YBLC 5T1DL 1FNAA 4K8RH 2ADJB 4X4XA 4WHTB 2YD7A 1U92A 2HWZL 3K46A 1BPVA 3AXLA 1HOCA 1MNUL 3QR2A 4MB3A 1ZT7B 2Q7YB 1T0MB 3WFDL 3WIIH 2OI9B 1DE4A 4M6NL 1KJVA 2WIMA 3KXFD 4MA7H 2Z8VC 3S35H 3GSRA 1NH6A 1FNEB 3OQ3B 3H3BC 1JPST 4HXAH 4OD2A 1MJ8L 1MUJB 3CX5J 1SEQH 5DO2D 2BOCB 1CYGA 1DL7L 1Q0YH 4OF7A 5EBLB 5DMIH 4L8SA 5HHQB 3KXFE 4JFDD 4TUOB 1MCQA 1NGXA 2XNAB 4PJXF 1CFVH 4NM4L 2NXYD 4GRLA 1OHQA 3ZKXC 1KPUB 3RHWK 2KZWA 1Z9OA 3IJYB 4L9LC 1S9VA 1VFBA 2F58L 2EDRA 1TENA 1B0RB 4BKLA 5I15L 4ACPA 3QQ9C 1ZMYA 5BO1H 1YMMA 5FB8B 4JFQA 4OQTL 4FTVE 4P4KC 4HCRL 3Q3GA 2H1PL 2J1KA 4U2ZA 1K8IB 3QUZC 4XTRC 2R56L 2AK1L 4QYOA 2CR3A 1UZ6E 1NAMA 5BQ7B 2Y36L 4EOWL 1DQJB 1GPOH 4MA1C 1XF2A 1ITBB 1I8LA 3D39E 3VW3H 3SO5A 2UV3A 3VD9A 3TWCH 3CC5B 2B4CL 4QRRA 5T1KB 4ZYKB 1YC8A 3PWVA 4JN2A 3TFKC 4BQ6A 2CJUL 2OJZH 1ZHLB 5DD6A 3UYRL 3MLXL 1U2HA 3SPVA 1RUML 1S7XA 4OV5B 3FB5A 2FYYA 1U8JA 4Z7QF 3FRUA 3EOYG 4NP4H 5JQHC 1OAKH 4TNWF 1GC1H 2JF1A 3BZFA 4FFVC 3U4BH 3WHXB 4E41E 1DVFB 1CR9H 4GSDL 4WV1A 1M7DB 3VWKA 2E9IA 3ES6B 2CDEA 4LP4A 5ICYB 5J4MA 3RL2A 5ICZB 1NCAH 3T77B 2B2XH 5FA3B 1IT9H 4RIRA 1EEYB 4R7DB 4L4TD 1WIUA 3M45A 3DXAB 5CGTA 4ZMAT 5DFWH 43CAB 3I9GH 1GGBL 5TQ2H 3BOVA 4HIJA 5K59F 1IQDB 3F12B 3T4AB 2IADA 2P8LB 4G8EA 4I4WA 4G6FD 3D0VA 2ARJA 3NFSL 3RNQA 2MNUA 4JKPL 3D6GA 4PJCA 4OZ4A 3CLFH 2VAAA 1QRNE 1JHKH 4U31A 4WW2F 2QR0A 4M6ML 4UINL 3LZFL 1MJJB 4LGSB 4PJ9B 1JYNA 4G8GB 4YDVA 4HWZA 4JM2B 3BIBX 3ARFA 3BHBB 4ODUA 3IDJB 2YKLL 4S1DC 4B53A 5KVEL 4MD5A 5BS0B 4UT6H 5FO9B 4JQVC 3FN0L 3RI5F 4AIOA 1I8MA 3J8F7 1A14L 5L8LB 5HY9A 5D1QA 2FECL 1QYGL 4FQ1L 5HDBE 1A6ZB 4ZNEE 4Z7WA 4CU8A 4KRPB 1KOAA 3U0PB 4M6NH 3BSZH 4KKLD 4YXKH 5JDSA 4CVXA 5EUOF 1FH5H 4NOFA 4F7TA 1F02I 1HHGA 4POZD 1WC7B 2D7QA 2EE3A 1WBZB 3RVTD 2JB6A 3MRJA 2BCKB 1I8IB 4NQEB 3QPQD 4L8BA 2XWJA 3BI9X 4OFYD 5DT1L 1QSEB 1JGDB 1ZA6A 3M1BA 3VFOA 3D0LB 4QY8A 5JDJA 2D3VA 3TBTA 1T0NB 4NDMB 3HI5L 3D69A 4I5BB 4PJEF 3TESA 1X4ZA 3DRQA 4IRZH 3STLA 1OWRM 4HXAL 4PGCB 5HI4C 3LKSB 4M93C 1RZFH 4RX4D 2JK5A 2CKBA 4TTDD 1T0PB 1EHLH 4PJGF 5I1JH 4B0MM 5DSCA 5T1LB 4EXKA 3BDYH 3CXHJ 4NQXA 1EAPA 3T2QA 2BVUA 4U0RC 1CBVH 3EO1A 2ZUQC 3PF2A 4OZHA 4LHUD 5D7LA 3VRJA 4I9WD 1A4JB 3F65A 1Z9LA 3ZKXB 2EO9A 2P5EB 3DETC 5KG9A 3GIZH 2MPAH 5KVGH 5K9KA 2WWKO 3QIUC 1GPOL 5SX4I 4WFEE 4ZXBD 2WP3T 3O6MH 4XC1L 4BZ1H 1FJ1A 3BYTA 4HUNB 2VMFA 5DR5H 4BFBD 1MCWW 4M7LT 3JV4B 4ZO9A 5DJAB 5MEOA 3FB7B 5GGSA 4YHIA 4PRPB 4GAFB 3OXSA 5MI0B 1FNFA 5A3ID 3CLEL 4Z7VE 1LK2B 5JOFA 1U3HC 1DN0B 4ZO7A 5IFAL 1ONQB 4D0CA 5KSBB 2AEPH 5DWUL 4DKEL 3OV6A 4Q9BA 3SHSA 4LVOB 4PJ8B 3LQAC 5DMIL 5I1KH 3UZVB 1Y6MR 4H1LA 5INCB 1G6VK 3FQNA 5DUBA 4C54A 4F8QA 4M8QB 4KQ3L 4JHBA 4LSPL 1X4XA 3QUZA 2FIKA 3IFOA 3QFDB 3GMQA 1RIHH 5TE7L 3FQWA 2X09A 1MCJA 2ZPKH 2P24A 3AAZB 3OAZK 1X5ZA 3SE9L 2RFXB 4Y16C 5H2BA 4C59B 3B9DA 3P4MB 5E6ID 1KG0A 3S4SA 5I1DB 3ARSA 4R7NA 5IWLC 1BOYA 4HT1L 1YDPB 4ZUTB 3O2WL 3EDFA 3BMWA 2FB4H 2EDWA 1J18A 4X6CE 1I75A 4ONHB 2DQHH 5HI3D 2Z8WC 4HAGA 2A6DB 1Z2KA 2Z31A 3ARTA 4AQ1B 2E7CA 4H0HB 4NRXB 4PJ9C 3BPCA 4N1HB 5H94B 3LHPL 1P6FA 4Z78A 3NCYS 1OM3L 3BPLB 1NCNA 3ZTJH 1IM9A 3PV7A 2NW2B 3SDXE 3SKJH 3UJTL 2BSTA 5EU5B 3EDDA 3ZYJA 1GGBH 1Q9KB 4ZUVB 2I27N 4K7FA 4D0DB 1H3PL 4R4NC 5C0AB 2DQIL 1IAMA 1U8MB 5SWZA 1XIWB 4CMHB 1WWBX 4N9GB 1OVZA 3ABZA 4P23C 3EYOA 1UT9A 4WEUD 5LGKA 2DQTL 5CD3B 4QF1A 1AGFB 1JNLL 1YUHB 1CS6A 1KIQB 1NCTA 1VA9A 4X9GA 5IGXL 5ISZD 4G3YL 5D1ZD 1RZJL 4ZFFA 4M5ZH 4A2MA 4LSVH 1FV1B 1IAKA 3IDUA 1K6QL 4U1GC 4QGTA 2HWZH 1QR1B 3VXMD 2A83A 3TO4C 1HXYA 3O11A 2YRLA 1A7RL 4PGZA 5GZOC 4ODSL 4JRYB 1CGVA 1A02N 2R2BA 3DGGA 3F7PC 4MXQD 1CIUA 4QTHA 5JXAH 3FFCB 2VDOH 5CKGA 4X9BA 2NY2C 3FO2B 3AC0A 1A9BB 3VFTA 1R6VA 4NGHH 4YH6A 2KQMA 3HKFA 3LHPH 3E6HB 4OF5A 5C0CB 2HMID 3T1FB 5DHXB 4GLRI 1XGQB 5BS0D 5JHLH 4U1KB 5FYLH 1VACB 3L7FA 2FO1A 3S36H 3MGTB 3MREB 4NHUB 1JGEB 4ZTPH 3E8UH 5TDNB 4N0CC 1FL5A 2DQGL 2IWGA 4YDKH 4KMTL 4P3DA 2V7NA 5C0RH 4XC1H 3EFDL 4RGNE 5DZNA 1UWEL 4LSTH 1JNNL 3MRQA 4MMZC 5CJQH 2VIRA 3SJVB 4JRWA 3TVMC 3TYFB 1LNUB 1U8KB 1I1AD 3LQAH 4YZFF 5F72S 4JRYA 2FSEB 5L88H 1OAZH 1OW0A 3LS5H 2WQ8A 4YBHA 2BVPA 4GFTB 1DFBL 2PTVA 3SKMA 4BQBA 1HXYB 3SDYL 5C0DB 3RWIA 1KJ2A 1WAAA 1MHPH 5F9OL 3V9FA 4PGDA 3C6LB 5GGTH 1SY6A 4H0GA 5DVLA 4MDJA 4UDUB 1KB9J 5T1LD 4LBEB 1AD9A 2V5MA 5B21A 1DUZA 2DI8A 4HHAB 3VMPA 2OZ4H 1QD0A 4LP5A 4NOBA 1DQQB 2CDGB 2VR9A 3MLSH 3OR6A 1F13A 3ZKQD 5HYJB 3PIQA 1KPVA 3C8DA 1D5IL 2HG5B 5LXGH 3IKCA 3LKOB 4PY8J 3NA9L 3I02B 1YPZF 4FFYL 4U6HA 5D2NB 4H25B 4OGAC 1R0AL 3RTQC 5KSUB 5J6HA 3C09C 2FECI 5IEKA 1MJUH 4NYLB 2VXTL 3QIBB 1H5BC 1J9CT 3IRZA 4NBXB 4HJGB 4MJ6B 5DWUH 2O5YH 2Z31B 4KRPC 1N59A 1HHHB 4PG9B 1T1WB 5IMOA 3QWRD 4LLWB 1TJGH 3T1WA 1D5MA 5DO2C 4O02L 3QIUA 5J3HD 3B8SA 5D1QD 4M6OH 5F88A 4Q6IC 4JJ5B 1BF8A 4LHQB 4HWNA 3PHOA 4MAYA 1NAKL 3FQTB 4XMKL 3MV7E 1DLHA 4OFYA 3BH9B 3EYUL 5J1SC 2V5YA 1KXTB 3W2DH 5A2IH 1H0DA 3RUGF 3ZZ1A 3PDOB 2DQJL 2CKBL 4MS8D 1F3JA 1OARL 2AK1H 4OJFH 2NX5A 4H8WH 1ZEAH 3HZMA 1S5IL 3JV0A 3QQ9D 5JZ7D 4OGXH 2VXSH 4KPHH 4F7MB 3SGEH 3EYFA 1AIFA 2DM2A 1A6WL 4YFEA 2R1XB 4XPGL 3PP3H 1W72L 4KZDH 3DMMD 2NR6C 2D9QB 4JFYA 5IQ9B 5E2JA 3BDYL 4N8VA 4TVPD 2D7TL 3C5SB 2JELH 2RCSH 4NKMB 3VXUD 5F6HI 3OKDB 2R0LH 1K8DA 4HS8L 4ZUWB 1D5ZA 5ACZA 2VDOL 2J88L 3LY6A 4GG6E 5ACLA 5TGBA 1IQWL 3DTXA 3VWJB 3WS3A 5E95B 5JNYB 1CDCA 4YHZH 3DJ9A 5HVHB 5LQBL 3MRNB 1UM4H 4NN5B 5CWSA 4FFVD 1DZBA 2Z0BA 4P2QD 3C60D 2EH8H 4LAQH 4PLJD 1QEWA 2NY3B 4Y7MA 1KB9K 4AT6B 1RZGA 2QSQA 5MI0C 5F97E 2B39A 5IB4B 4M5YH 4IOIB 2AABH 1N0XL 4NQXB 4JPKL 4LKCA 3QNYB 4OIAA 3N1QC 4B41A 5B8CC 2JK5B 2C3WA 3HE7B 4WU7A 5KVEH 4MX7B 2GJZB 5CJXA 2IH1B 1DCLA 1RZ8B 1PKOA 4PTUB 4HUUA 4P0DA 1HKFA 4NC2B 5DFVC 3TH4T 1C7TA 3ORJA 4G6KH 2PO6A 2B7DT 5DD5L 2I60H 2EIDA 3NIFF 1XR9A 2MMXA 5GS2H 3E6FA 3WN5A 2WBJB 1E4KC 3HG1D 4JY4B 2DLFL 4QHUA 1OOAA 2Y36H 2OZ4L 1CD9B 1MCSA 1S5HB 1OP3H 2C5DC 2WUBH 3C60A 3KNBB 1CVRA 2VUOA 1A6VL 4J7RA 1TIUA 1HEZB 1F97A 1NL0L 2J6EH 3HI6H 3P73A 4F80A 3ZYOA 1YQVH 5CKAA 1TPXB 3ZT5A 3JWDL 2APFA 1MFBH 3MLVL 1HCVA 3ARFB 5GS3A 3K8LA 3S9DB 4QNPE 4KAQL 3PABB 4XP4H 3EUUA 1LE5B 3H42L 1EEZA 5EIQA 3V7MA 3I6LE 4O4YH 4XHQA 2I9LB 5DD0L 3KPQB 4WCYL 3V5HB 4LMQI 4AH2B 2VABA 3W5NA 3HUJF 2VQ1B 5ENWB 2X1WL 2ZOLB 2FIRT 2E6JA 4HWEL 4HW6A 4DUXA 1AXSA 2GAZA 2ZOKB 5EOQH 5MERB 5E99L 2IH1A 4RISL 1F4YL 5B22A 3HMWH 1TVBB 4HDIA 1EX0A 3REVB 1KPRA 4M3KB 5D5MA 2Y72A 4M6AA 3IAQA 1EO8L 3CDGA 3WFHA 3TO4B 2IPKB 3ZTJG 5FV2A 3WHXA 5I1CL 4IOIA 1I85C 1MIEH 1X5FA 3O2VL 1ZEAL 4LLVB 5T5FL 2AV7B 3QPXL 3TBYA 1OP5H 4PJHA 2P8MB 3DV4A 4FQXC 1CDBA 1FO0A 1MJ7H 1QFWH 4NP4L 3K1KC 4UIKL 3M8OH 4RBPH 3W0WD 2VDQH 3ZTNH 2E8ZA 4MJ4A 4OKDA 2NCMA 5EBMA 4FP8L 5A3IC 1MJ8H 5CEXB 3ILQC 2H6PA 4DTGL 3ULUL 1SJEB 5B39A 4ENED 1X5JA 2NX5E 5FYLL 2YC1A 4S1SH 5TH2B 1T21A 4G9DB 4S0SD 3UTQB 2QEJA 1D5ZB 5ACZB 1Z6JT 1S7UA 1IGJA 2VITB 5F8RC 3BD4A 1ZT1B 4QNPF 3DX7A 3SE8H 1VEMA 4XCYA 2MQ3A 4HD9A 5T3XE 2L4OA 3PWLB 5E2WL 1GGUA 1ZTXH 4H88H 3HI1B 5L8KB 4JZOA 4DKAA 5KANI 3VGBA 2J8UB 3WO4B 3DIFB 2F54E 2FHFA 5F7NC 1S3KH 5C9KA 2ZKHH 4ZOBA 4G8IB 2KPNA 5D2LB 4CNIB 3EO9L 5MHSD 4LVNB 5CJ8A 4XWOC 1S9KC 3VJ6A 1N64L 2XWTA 4XVTL 2KH2B 4EJ1C 4XPAH 2FL5A 4P4KB 3DX9B 2YPLA 4HS8H 5EU3A 4B50A 4U6TA 1BD2B 3V4UL 5ACMA 2GSGA 5E2UH 5ADOH 1IM3A 5MHSE 4LPUA 3NPSC 4KKCD 4O58H 2EXYC 2ZCLL 1DFBH 2VKWA 2VXQH 3S98A 5I8KL 4KHTL 3U7YL 4F15C 2DLEA 2OP4L 3RGVB 3WBDA 5FA4B 5DS8B 3WNMA 1I1YB 3ULUC 4XNZB 1BWMA 2XQBL 3MRIA 5KJRL 3EHBC 1IILE 4KUCD 3MJ9A 5C0BD 4ZPTB 1JPTL 2QQQA 4WO4D 1RU9H 4KROC 1CK0L 2P49B 1TMCB 1EDQA 4NQVA 2B5IC 1HSBA 2EZ0D 1ZLSH 2R1YB 4W6YB 4WHDA 5FM5M 4OLUL 1I4FB 5DVOA 4PRNB 2KDGA 1VESA 2VSCA 3UTPD 3D9AH 4F7EB 5D9SB 4Q2ZA 2OYPA 1MWAB 4M3JA 2I07A 3GUTA 2UWEB 3TO4D 4WJ5A 5JW3H 4WIQA 5D7JC 1E4WL 1MLBB 4E41D 1A14H 4LLDA 5IQ7L 1SJHB 1P2CA 1U36A 1JP5A 3X13A 4XPAL 3VE0B 3WXWH 1MCIA 5AG9A 4N90D 4OI9A 1BM3H 2UZXB 4OZGB 5JHDB 4AEHH 2AK4D 4TTGA 1DBJL 1PBYA 3KXFA 5C1MB 4OCYH 4OLXL 2MCPH 1OTUD 3N06B 1OQOA 1TQCB 2IMMA 5FCUH 3SJVA 2YD2A 3EFFA 4U6XA 4I1NB 4GT7A 2O5XL 4XRCB 1AO7A 3MNZB 1R5VB 4YGVB 1WBXA 1OTTD 2FWOB 2VR5A 4FXGA 4JANA 1F3DJ 1MCPH 4OLWL 3WKNA 3FN9A 3UC0H 2IF7A 3GMLA 2NXZD 2AEQH 1YJDH 2GITB 2EDFA 4FP8H 3S37X 3LH2H 2APVA 4NN5C 4FQQB 1O7VA 1YPZE 5DT1H 4UAOB 4F7MA 3NZHL 1QFUH 3K0WA 3HB3C 1J05A 4R4BA 1HH9B 5FGRA 1RUPH 3FFCA 2X4OA 4YAQB 3A67L 2YD3A 3ZDZE 3G5VA 1XCTB 3MA9L 5EBWA 4Z7UE 3LEXA 3G04B 1PQZA 5IVXE 4HX1B 5E24E 1A3RH 3HC0A 4KUZH 4QRUB 3F8UB 2Q8AH 1MCWM 1BOGB 4F58H 3CCHA 1F6FB 1BM3L 4HXBH 1S7QA 3V6ZA 1R3JB 2DWDA 1CICB 3FL7A 5HDOA 3RQ3A 4IRJB 1II4E 3WDJA 5SWSD 5DTFB 3ZE1F 1K4DB 3BRDA 3VXPA 1HINH 3WIHL 3MRFB 3SKOB 1N6UA 4BQ8A 3IDGB 3BP6B 2H8PA 1U8IA 2PW1A 1OWWA 4D9RE 2HLAA 4LSSL 4G9FD 4Q9RL 5KOMC 3ULVD 3D3VB 5FECA 4MDIA 5IMMA 5KBNC 1HCFX 5ISZB 5GHWH 5D4QA 1H3XA 3WNLA 2F54A 2N7AA 3IDIB 1D6EB 5D7IB 5ESQB 1CIDA 1CFQA 3MNVB 4OBSA 3QEUB 2BJML 3BP4B 4WDIA 5EPMA 2HLAB 3W2DL 3AROA 3BIKA 3MRBA 4LVOC 4KK9D 3T0ED 5L2JB 4IDJH 5FEBA 2CUMA 3KPTA 2DI7A 1K4DA 3AY4A 5I76A 4ZPVB 1JN6A 3V6ZB 1GOFA 1MWAL 5T1DH 4DKFL 4X98A 4OCRL 4NWUH 2ZKHL 3KPSE 4E42B 3DX9A 5I18H 2KBGA 3HMXA 3MRKA 4V2CB 1P7KB 4YHNA 2FLRT 4URTB 4AEEA 4UT6L 1LO3L 1OSPH 2QQLH 5EBWB 1YY9C 1AKJB 4OFPA 1DDHA 1I85A 4R26L 3UBXG 1YA5A 1FVCA 1SYVA 4WUUD 4EOWH 3K2UH 1N6QH 4WI3A 4JM4H 1FZOB 1BBDH 3V0WH 4NFBA 5BV7L 1LD9B 1RJLB 2D7OA 1C8PA 3OJVC 1HZHH 3IFPB 3QHZL 5D1ZB 5B39G 3WJJC 5M7QA 5K9QG 4X4YA 4WW1A 5BW7A 1LO4H 3KPLB 3EJJX 2EH7H 5KANG 4JFZH 2BC4B 2J5LB 1DJSA 3BPNC 3MV8D 1N0LA 4G6AC 3WDIA 4JHAH 1BVKB 1CR9L 2R0ZH 3QSKB 4RGOL 3KPRA 1AQDA 4X5WA 3EFFB 4WFHE 2AQ1A 2Q86B 1CF8L 5JPNA 1A9EA 2Y23A 1SM3L 4RMSA 4DTGH 1JPGA 3RDTC 1P9MA 3AS2A 4O2CB 5F1KC 5AEAA 5D7LD 3DO7A 2EXWD 1NCCL 1NBVH 5JW5B 2W9EH 3L9RB 4L4TE 4KJYB 5C9JB 1UXSB 1A6AA 3VFSA 4NKIL 3LH2L 2DL9A 1LEGA 1VFUA 2VKXA 2DD8H 2O5YL 2QSTA 3IJHA 4HJ0D 3QEHA 3I6GA 5I17A 4G80A 4NN6B 4HBCL 2X2YA 5HPMB 3H0TA 2VLRA 2XN9D 3DRQB 3LKRB 1S9XB 1CD8A 3QQ4A 4FXKB 3L5WB 3Q6FB 4EDXA 4CJ1A 2BVYA 5AYUH 3WXVH 3KPMB 4D0DA 3UP1A 2LVEA 1EHAA 3WO3B 4XMKH 4EBQH 4G6JH 5MEPB 5KVFH 3GHBL 3MLVH 4L8BB 4GMSH 3BGFB 2A73A 1FH5L 3P9MB 4GQ9H 4Y16B 4R0LA 3TT3L 3GHEL 4CU7A 1Y6NR 5E2WH 4PRHA 5GZND 3P4LA 4D8PA 3DURA 3V0AC 3MX0A 3PWPD 2YOCA 2YEZA 5KAQG 3DMMA 3ZE1E 4K07A 3QNZB 3FN3A 3HZKA 4PJXA 1MCOH 1W0WB 1PX4A 3P30L 5IR1A 5GQBA 3JBG7 1RJZA 1ZHKB 4L1DA 5BV7C 1MPAH 4TQEH 3GMPB 4ZFZB 2HFEA 1TVDA 5EO9A 5HY9B 4M43H 3KNBA 4QXUH 3RFZC 1MFEH 1WT5C 3QNZA 3VXRB 2Q76A 5BS0A 2BK8A 2RAMA 4HV8B 2VLMD 1A6WH 4HGMA 4GAYA 5JIHA 4YHKL 1NSNH 35C8H 4OZIE 4TYUA 2F74A 4P46A 5JOPE 2EDOA 5IF0A 1NFDB 3T4AA 5SX5H 3F12A 2X4OB 5BZWA 4OD3L 3L3OB 4LEOA 3ZKND 1KLUA 2AJ3B 3SKJL 3UJTH 4NQEE 2NY6C 1KC5L 4HUUB 2VLME 2C1OB 1S9XA 5FHBL 3CX2A 1KN4H 5TDOB 1VGEL 2EIBA 5HPMA 3RDTA 1E4WH 3OJ2C 1OB1A 4HSQA 1PLGL 3EOBA 3IFNL 3O4LB 5TQ0L 3T0XA 3DX7B 5SWSB 3B9KC 5JORA 3SDDD 1CVSC 1O0VA 2HT4C 4PJEA 4RSVA 1B4RA 1U3YA 1MQ8A 4G42B 3FOMA 1TDQA 3ZKMD 5IB4A 2HLFD 5TH2A 3D9AL 5C9JA 5GS0D 4MQ7A 4YBLB 5ANME 5I1IL 4UT9L 3BZDA 4P9HC 4UOW0 3DRTA 1EBAA 1R3IH 4JKLA 1QTYT 12E8L 3OX8B 4S2SB 3PL6D 4WI9A 1AXTL 1X3DA 1F4XH 4M7JL 4X7SL 1JF5A 4O2EB 3B9AA 2NY4B 1PDKA 3QDAA 2H2PC 1X5GA 4G3YH 3RKPA 1BAFL 4PJFA 1V3LA 4HUWA 3D18A 3DV4B 1X5AA 3TBYB 5GGSY 3G5ZB 4ZG1A 2PO6C 3QEQB 5JIPA 4HK3J 1K8IA 4O02H 1ACZA 5JPMB 3MMEB 3OB0H 4TRPL 3BKJL 3PV6B 2ICWB 3UAJC 3VD7A 4XPFL 5IKCA 5IW6B 3BKCH 3L6FB 4L3CB 1INQA 4RDQF 3CDGB 4U1SB 2BNRB 4YIQB 2E27H 3OJDA 3LRSB 5I8OL 5HHVL 2HJKA 4OD3H 5BXFA 1F2QA 3RDTB 3TN0B 1LO0H 3T65A 5ERWB 2X1QA 4IMKA 3WYRA 5HHPA 4QY8B 1HDMA 4RAHA 1UJTA 2OCFD 3NCCB 1ZA6B 3TCLA 4MJIE 1KULA 1BQHA 4NO5A 3BQUA 5D1XB 3RVXD 1HQ4A 2MKWA 1RUKL 3C5ZB 2Z35B 4UBDD 5B8CB 4HPYL 2NY0D 4NCC2 4APQD 2G5BB 2E6PA 1UWEH 1MF2H 3ZYZA 5L2KD 2P5EE 3EDKA 3RAJH 3RVVD 5B38A 5C8JA 4PJ9D 5JUEL 3TH3T 3RIAF 2C4FT 3P73B 4X4ME 2FGWL 4Q97A 5F1IB 2OTPA 3MROB 1EFXA 3G5XA 5F9OH 4DGVL 2BJMH 1ZLWH 43C9B 1HHHA 4DAGL 4KROD 4WWID 3AXLB 2BVQA 1OSZB 1TETH 3LOWA 4YHPA 3O6KH 1SMAA 4P4KA 3RA7L 3MZGB 4R4ND 1AD0B 1INDL 3P11L 1NCWL 3X3GH 2R4RL 5IJVB 3VXUA 2VAAB 5A1AA 4BYHA 4GRWH 1D6EA 3M07A 1RK0A 1EVUA 2Z93A 3GJEB 3MQIA 2JCCB 1WCBB 5I1AA 2ATPA 3T0EA 2AAVA 3RL1B 2IJ0C 4QWWC 4NQTA 4O9HL 4AMKH 4RGNC 3TBSB 1WJ3A 5EIIB 4OCWL 1AGDA 2Y1VA 3D85B 4NUJA 3QCUH 2HRPL 3QUKB 3TN0A 3BKYL 3IS0X 5FHBH 5DJDA 1U8PB 3EJZD 1UZ6F 1UJ3A 4WV1C 4JQXC 3BXNB 3UBXB 5GZOD 4JRXB 5DEFA 1DVFA 1T7XA 2NW3B 3VI3E 1Q9WB 3P0YH 4FQPA 5IHUH 1YN6A 3IU3A 4S1QH 3HRZB 1N4XH 5BS0E 5F6IC 1SJVA 3KPPB 2BVPB 4JAMB 3DO7B 4ZTOH 1YEGH 4XH2B 4KMTH 3C09B 1C5BL 1WF5A 4K8RD 1AGCA 4F9LC 4WWKA 3U79A 5GSVB 4R4BB 3G6JF 1T2QH 5GGRB 4JAMA 5KSAB 4J3SA 3H6JA 4XMPH 2AEPL 1QA9B 3NTCL 1XF2B 1YEEH 2UY7A 3DTXB 4LPWA 1EERB 3O3AA 1PAMA 3U0TA 4P99A 1FL6A 1HHJA 1ZSDA 4LLVA 2AQ3A 1ZGLA 3FOMB 15C8H 3PHQA 2ZUXA 4PJGB 1NGQH 3DX8A 4PRID 5C3TA 2B1AL 4R6UA 5JORB 1QFPA 2M8XA 2GY5A 4P4RB 4N8CL 3LQZA 3O2WH 1IZKA 3O41A 5TDOA 4K71C 5T5NF 4QHNB 2C1OA 4XHJC 4HUMB 2G2RB 4I48B 4U0QB 5IFHH 5EU4B 5DQ9B 1AXSB 2GAZB 2X6MA 3EYFB 4AY0A 5L7XL 2NY3C 3ULVF 1FVCB 3O2VH 2JCCA 3FJTA 3KYKL 1AI1L 1TJIL 2COQA 4R3SA 3TNNB 5IB3B 3VDCA 4X80H 2DYPD 2IEPA 3DGGB 3OF6A 1GGYA 4JDTL 1KEGL 3MYJA 2YPKA 4RZCA 3KHOA 2NY7L 4ZS6D 4NNXB 3FAXA 4CAGA 5CINH 2X4QA 3WXWL 1IAKB 2QBWA 5ITBH 1SJHA 2LTQC 4HV8A 1NGWA 4WO4B 2ZUQB 1XF4A 2WZPD 2PYFA 4PJFE 4DGYH 3OZ9H 1I7RA 2GJJA 3VXRA 5CBAA 3TIDB 1B2WL 1EJOL 5J9PB 3QPXH 3O9WB 2IQ9L 1QBLL 3N85L 3U9UA 3DVNA 2ESVE 1F3RB 5KVDL 1GGIL 5LGJA 2UWEA 2W60B 1L7IL 1NBVL 4QRPB 4TSAH 3BZEB 3KWWA 3UMTA 4JFEB 1MLCB 3MJ7A 2YEZB 2X4RA 5IEHA 32C2B 3QUML 4GG6A 4PBVC 2BMKB 4WHTA 2ADJA 5KVFL 1Q0XH 4M4PA 4WNQB 2CIIB 3UROR 4EI5C 4DOHE 3O4OC 3P9MA 2Z35A 3I9GL 2FD6L 2A73B 2VL4A 1XAUA 3OAZH 5BMFH 3GBMH 2FGWH 3W0WE 1HIML 4MVBC 4P2RB 4YHKH 3GBNH 4HK0A 4PJ5E 3QEQE 2J6EA 3MV7D 4JY5L 1QLFA 3H0TB 4H0IA 1BIIA 3VFUA 4AK1A 4WHYH 1S7VA 2VDRL 4U1SA 4UT7H 4F37K 4Y4HC 1NFDF 5J0BA 1NJ9A 4MQSB 1V5JA 1NGWB 5IVXB 1JJUA 3OSKA 1T4KA 3RWIB 3L3DA 3IDYB 3SDAD 2XTLA 3BVNB 4YK4C 2R9HC 1K2DB 4X7EC 3VXSA 4NZUL 3KDMA 1SVZA 3MRPB 4N0FA 1N4XL 2QTEA 1IJ9A 3LN5A 2GSIA 2CKBH 2LV4A 1NLBH 3MLYL 4WFFD 4ZFOL 3PXJA 3VFNA 1Y0LB 4PJDB 4RAVB 3NGBC 4K9EL 4XBEH 4YE4L 3MRNA 1J05B 1HYRC 5DMJB 4OD1L 4KC3B 5E5UB 1NUDA 4N5UA 5MEQB 4ZOAA 2Z31D 4WUKH 2AEIT 1FLRL 3DX6B 1F4HA 2FX7H 2AXGB 5GRJL 4LARH 4HIXL 1M05A 5SWSA 5D96C 4OCWH 2Y07L 2VZUA 4IRZL 2E8YA 4X4YB 1J1PH 3QXWA 4RQQA 1LO5A 2E9JA 4UTAH 2BVTA 3LKPB 2A6JA 2OR7A 4IRSA 4X6FB 3QWOB 1CZ8L 5FYJU 3ZMRA 3FO2A 3VFTB 5EBMB 1EGJH 1CDJA 1NANH 5IHUL 1BAFH 4DFIA 2JJTC 2XXCB 5IF0B 4JB9H 4HCRH 3SDXF 2H41A 5B3JF 4OCRH 3D3VD 2HT2C 3KPSB 4NJ9H 4UDTA 1XGTB 1QSZA 1QR1A 1V7MH 1I8KA 2A6IA 5TF0A 1QKZH 1T04B 1ZKAA 3TN0C 2P43B 4X98B 2X4TA 3GDBA 2X7LA 3ZE2F 1OD9A 1AGFA 5J11B 4ZFZA 3B6SA 1U8PA 3GSQB 3VMNA 2CXGA 2EO1A 2IG2L 5L2JA 1ZE3C 4YLQT 4J3XA 1GGTA 3ARBB 3TV3L 4ODHH 4NFCA 5GZNC 3ULSA 1N7MH 3PGCB 4GBXC 4JKMA 2XXMB 5ILTH 2VQ1A 3DGCR 3B4NA 1HYSC 1BP3B 4OCMC 3THMH 1XCQA 2HJLA 4EDWL 2DICA 2JB6B 4UMGA 5CUSL 1K3ZA 5IB5A 3I6KB 1CICD 3D39B 4RMUA 3KPMA 4CN1A 1I1YA 1F6LL 5I8CA 3P11H 3MFFB 1LEIA 3PP3K 3QJHA 3EO0A 3GRWA 3OR6B 2NYYD 4GKSB 1DEEA 4JO4L 1XF5A 4MAYD 4PLNC 1A3LH 3GSQA 2XTJC 1A2YB 3HPLA 2P4AB 1KC5H 4PJ8C 4OKVB 1AI1H 1Y18A 1LE9A 1MF2L 2VLKD 1PG7W 5J57B 3WJLC 5EOTB 4G9FA 5EUOA 4YDIL 4JQXA 3W5MA 1MRCL 3FQWB 3LRGA 1BQSA 4RAUB 3MFGB 3PGDA 4RGNB 4NQDD 4R3SB 3DXAE 2P8PB 2R2HB 3O81A 1CXKA 4LLQB 1JTOA 3QIWD 3QWOA 1CU4L 1KYOK 4NUGL 5DK0B 1UKQA 2VLKE 4P23A 4UUJA 4BH7A 1G6RB 2V7NB 4LU5L 4KJQC 4FQXD 1D3CA 1P5VA 3NPSB 1FBIH 4PRPE 1VADA 3GI8L 2X89A 4L29B 4PJGA 3PL6C 4OLUH 3SKNA 1AKJD 1N2RB 3BKJH 4K9EH 4XBEL 4YE4H 1SBSH 5LGHL 3ILQD 5EC1A 2FX8L 3A6BL 2IFFH 1ADQL 4R4FH 2EC9U 4Y4HA 1IGCL 4ZUUB 1JPSL 4PRBB 4LQFH 4ZUSB 4CVUA 1RK1A 4ZYKA 1ES0A 4QTHB 4K55A 5T1KA 5T3XD 5CWSB 4XP5L 1K5NB 4CMHC 4GO6B 3MBEB 1CFSB 2ID5A 1MHEB 4QYOB 2BHUA 3K1DA 1OGTB 3CFCL 3L5XH 1YEFL 1MLBA 3RUGA 1BBDL 1NJ9B 2H2SC 3V4PH 4NJAH 1OCWL 4XPTL 3FZUC 2FNBA 4NO3B 1W72A 4W68A 1VFBB 2I07B 1FLRH 2GKIA 1F42A 4XWOD 3FQXB 1ETZA 2PR4L 5JA8B 5EC2A 2CLVA 4PJAE 3VFWA 2IGFL 3M1BB 3QEUA 4K7PL 3EDEA 4OLYL 1NSNL 35C8L 2H26B 3JV6B 4L8SB 5HHQA 4I2XE 3PDOA 1A3QA 1CD0A 1LDPH 1RK0B 4ZODA 1G9MH 2MSPA 5CJQL 3LIZL 2B4CC 3GB7B 3TA3C 2BOCA 3BEWB 2ZUTA 3OKKB 3MTRA 4WNQA 2F74B 4P46B 4Z0XB 5HHOE 1T66D 2UWEF 1KCVL 4MAYB 3WHE0 1JK8B 3O9WC 5F7LB 3O3DB 1OSPL 2QQLL 4CKVX 2JIXD 1C1EH 4W81A 1FZJB 3DSFL 1FYTE 3OKLA 2FO4A 3VFPA 1CXLA 5TE4H 2Z92B 3DVNB 1G9MC 4Q58C 2H32H 4RWHA 2UVEA 5D71H 3P4MA 1HOCB 4OZGF 3O8XC 1G7PA 5F7UA 3IDXL 2XZCH 3UJJH 2QKIB 4QWWD 1ACYL 3LN9A 1T5WB 4F7PB 4KHXH 1FDLL 1JHTA 3MYJB 3OGCB 4Z76A 1T3FA 3BN9D 4ZQKB 1D5IH 4M61B 1D9KC 1FFQA 5D2LA 1CE1L 2M2DA 3LD8C 1RZJC 4WFHD 4JHAL 3WFZA 2H3NB 5AAWA 1F58H 4HIJB 5DRWA 3WNKA 4OM0H 4M00A 3VGAB 4Y19D 4L1HA 5EC2B 3VFRA 1CG9B 1QSVA 5HYJA 1QLRB 1DEEB 4M7LH 2XWBB 4K3DL 1WFNA 2BXZA 2HVJB 1J8KA 3LMJH 5ERWA 5IV2A 4U3CA 4MXWL 1W72B 3AY4C 5KSBA 4IRSC 1YECL 4ZDHB 3TNMB 5EB9A 1FGVL 1AXTH 1OTUC 4GAJH 4XAWH 1OGTA 4AEFA 3TFKD 4JFDA 4G9DA 4X5LA 3SGEI 4POYA 4HIHB 4ODVH 5I6XB 1D7FA 3GJFK 3QO1A 4NM8H 3CH1A 4IIQC 5JW5A 4JCLA 1DBBL 3BD5A 2BX5A 5DD6B 2B20A 1FJ1B 1ROWA 4K3EL 3DHMA 1YJDL 5EUOE 2C3GA 2IAMB 3LSOB 5HHVH 3BKMH 4M5ZL 5F7KC 5D7IE 2EE6A 4KKBD 4WI7A 1EGJA 1YJDC 2Z4QB 1T83C 3O6KL 4HKZB 5JNYA 2YD5A 4JO3L 4PB0H 4Y4KC 3DVGA 4L3ED 2XKNB 3C6LD 2AV7A 2FBOJ 1N2RA 3ARFC 1UZ8B 4LEXL 1MFNA 4YBQD 2IPKA 1S7WA 4M1DL 4P5MB 2OR8A 4LLMB 3HB3D 1KEMH 1W0YT 3R06B 1WBYB 3OKOA 5HYJD 2EEAA 1FC1A 5F1NA 4EN3A 1T0NA 5E7BA 5C0IA 2NY5L 4XVTH 4BH8B 4FQHB 4MXVE 1QSFD 4JCMA 1SYVB 3NPZB 4S1DD 2NNAB 3HNVL 2R1WA 3PGDB 4NPYB 2KKQA 3SO3B 3CSYA 4X99B 2E7MA 1HXMA 5IGXH 1T5WA 4OD2B 2OZ4A 3U7WH 1P7KA 3DX6A 1GHFL 5JTWA 2QKIA 3QG7L 1K6QH 4J3OC 1QBML 3VCLB 3OAYK 4PRDB 4Z7OF 2Q76B 3BAEH 4D0BA 4FQXB 1D5MB 2W9DL 2DQDL 5I76B 4HK3N 2PYED 1AJ7H 1E6OH 5D1QB 3C5ZC 4XT1C 4K8RL 5J13C 3HZKB 4HMCA 3CFBA 3GSNA 4FFWD 1XF5B 5DK3A 1W0VA 5D1XD 4LOUD 4KZEL 3QPQC 5FV1L 1S5HA 1NFIB 4I77L 2F5BH 3RPKA 4YHLH 1XGRA 5C7XL 2W0KA 2XWTB 2F8VA 3QXUA 5I75B 2EYSA 3FCTA 4O51B 4C56B 2OP4H 3RUGE 1MCKA 1D5BB 4AEHL 2P8LA 2PYEE 2NW2A 5DI8A 1JZ3A 3H9SE 1BLNB 3ESUF 1ZAGA 1IGTB 4PJCF 5FECB 2XKSA 3N0PB 5EO0A 5DQJA 4DEPC 3PWNA 4Q9RH 1AGBA 1L4IA 4JO1L 4PB9L 3PL6A 4KRMB 2N4IA 4M4RA 4HHAA 3O6LL 3OG6B 3CFEB 1PYWA 3IYLW 4QXGH 3RZCD 3V2AR 4JDTH 1T1XB 4GQ9L 3UDWC 4BFIB 3KR3H 3LD8B 3WV0A 1J0KA 1KG0B 4OCNC 2DQCH 4KTDH 1HWHB 1T21B 2EC8A 3QEQA 1DQLH 3HLAB 4HCRA 5FUZL 1SYSB 5DJ2B 4CW1A 5FFLA 5B39B 1T1YA 2WBJC 3NZHH 3FO0H 1H3TA 1A1OB 1JPGB 1TTUA 4UINH 3VXMA 5FGBC 1FNGA 4PJAB 2AEQL 3CSPA 2QADB 1FGVH 1INEH 5C7XH 3LKPA 1GC1L 1S3KL 2MOVA 1HZHL 3E3QE 3FONB 4JPVH 3QDMA 4KI5F 4TPRL 3D2UB 3ZE2E 4PBWD 5H35B 5FHAL 4Y5XC 1NCCH 1S78D 1WWAX 3UYRH 3TGXA 5BRZE 3MGTA 3WFDH 3WIIL 2BVEA 2EE9A 4JZNA 4ZFOB 4F9PA 4QHMB 1X5YA 2IAMC 4LIQH 3IVKA 1HIMH 4U05A 1XT5A 5GGSB 2YN3A 2YN5A 1KPUA 1IGCH 1OT2A 3CD4A 2YPVL 4K23H 4S11A 3C8KB 4LGPB 4BH8A 3HE6C 4FQLL 2NY4C 3HZMB 4Y4FD 2P8PA 2R2HA 1JGLL 1J0JA 4P5TA 4PD4K 4KDWA 4XC3L 5IFJB 1CFTB 2ZUUA 4IMKC 2FEEL 1DDHB 4OCSH 5B3NA 4OZGA 2AW2A 5D7JB 1J1XL 4LLMA 5KVDH 3ZTNL 4HUXA 4P57A 3PABA 1J5OL 3X13B 2ESVA 2V9QA 5H35A 3FB6A 2ZCHL 5EZOH 4X4MA 3FMGH 3TT1L 4K7PX 1OCWH 3TA3A 5GJTL 1A6TB 5CP7B 1G6RH 4LCCC 1FNGB 2QHRH 2JJVA 4PJAA 5EA0H 2JELL 4Q7DA 2EYRB 2FGZA 2L7JA 4J4PC 4OSUH 3BIKB 4C56D 2B0SH 3P40A 4MQXC 4UI2A 5IVZA 3LQMA 4LVHC 5GS0L 1A4KB 1P4BL 2KUTA 3ROOB 1Q9KA 1BMGA 5TJWK 4BUHA 4JM2D 1FQ9C 4Z7VB 3ARGC 2BCKA 4CDHA 1RIUH 3QFJD 1Y6KR 1AJ7L 1B6UA 3X14A 2AGJH 2PO6B 1G7MB 4GW5A 3ULSB 2BMKA 4U6YB 4PJ8D 1QPXA 1NFKA 3SE8L 3VXTA 2XG5A 4HKBA 5AWNL 3TPKA 1V7NL 3I50H 3V6FB 3WUWA 3BEVB 4TOYL 4OLEA 5DJXB 3PNWB 1G9NL 2EDYA 5HJ3A 2D7NA 3BZ4B 3MUGB 3LPWA 3IU4H 1RSFA 2IAND 3T0BA 1BD2A 3T0EB 1I7ZA 4XWGL 1I1CA 5AD0A 4K2UH 3VGEA 1I8MB 2XN9B 1BQLH 3OB0K 3KLAB 2PYFB 4NQED 3HI5H 5CGMA 1SVCP 1BOGA 5I73C 1UXSA 1JFQL 2EYSB 3FCTB 4O51A 4UDTB 1KCRL 4O2FB 3CZFB 4AT6A 1DQML 4YHOH 3U4AA 3VRLE 4OT1L 2MQ0A 2WWKT 2ARJB 1U8KA 2ATKA 5FYJE 4KJQD 5T3XL 5BCAA 2XRAL 4JZJB 1EEUA 4IRJC 2V2TA 3TZVD 2BRRL 5FUCC 4QXTA 4PS4L 3MYZA 3OAYH 5E2TL 2A6JB 3O2DL 4IRSB 2AJZB 4R7DA 2DLHA 2GITA 1MFAH 3O3DA 5BVJB 2BNQB 4TVPH 4WWKC 2VUYA 5IBLC 2VXVH 1IBGL 3OAUL 4ZNEA 2C3VB 1PY9A 5KSBF 5C07D 4GSDH 3NGBB 3S3PA 1T1ZA 1MFCH 2R23B 1GGCL 3KPOA 2H2PD 1I9RH 3BO8A 2R1XA 1X7QB 4UT9H 5C09B 2ILLA 2OXGA 2CLVB 5D7SH 3VFWB 4WY7H 2XZAL 1YEJL 1OL0A 4XNQA 3INUL 4ZSOA 4YNYA 5GRVK 5GS1A 1DQLL 4F9LA 3K7UA 1KJMB 4UTBL 4XH2A 4K2UL 5HHXL 3GHBH 4HQQH 3BPLC 2BNQE 3OJDB 2FEDC 1WAAE 5HHMD 2EYTA 1RZIB 2VLRD 5IKCB 1R3KB 2QJDA 1QVOA 5F9AC 2V9TA 2EEBA 3IXAA 4UU9A 5IVXF 1MY5A 1MHEA 4PY8I 4ZOCA 3F6LA 1RZIA 1XIWC 1S9WA 1G7LA 2XKUA 3CFKA 1PYWB 1HNGA 3ZL4L 5IMOB 5DJ0A 1R24B 4XNMA 4M48H 2SEBB 1MCHA 2VLRE 2CRZA 4D3CH 4JO2H 5C0CD 3H9HB 3VFOB 5ENWA 2B0SL 5SWZD 3QA3B 4UB0L 5C07A 4GRLD 4GMTH 2XACC 5T33H 1IM9B 1IE5A 1BJ1J 3MNWB 2HFTA 3HCVB 4C56A 3HE6A 2ZCKH 4EUPH 5CHNA 2RBLA 1AO7E 1XGRB 2FX8H 3MBXH 2X1OA 5J3HC 2BVQB 4W4OA 3D2UD 4NQDB 2XFXB 3U0PA 5DJ6B 3GSWA 4EIZC 1JNLH 1KN4L 1T5XB 5DUPL 4MDJB 5ADPL 2AJ3A 3HZVA 5F7HA 1KLUB 2Y6SC 3O6FD 2G5RA 2UZYB 4TVPE 3F58H 5DR5L 3T3PF 5JW4N 1CN4A 5GSRA 4PJBB 3GMMA 3SE4C 4EI5B 4PB9H 3DUHA 2O61B 2RFXA 1OGAD 3U6RA 3VXRD 5GGVY 3MJ9L 1Q9OB 3JV5A 1OAYL 1BF2A 1WTGT 1WAAF 3RNQB 1C5CH 4RGMB 1AFVL 1HQ4B 3BQUB 3QWRA 1MFDL 3OWEA 5FKAB 5FYJH 3GNML 4P3CL 5BVPL 4IRSD 4P59H 2HFEB 1HH9A 3TBWB 2E6QA 1MCNA 2MWCA 1L9MA 1NBQA 3QWQB 1KUMA 4M1CD 4XVUC 1W0WA 1OAQH 3NAAL 3CFDB 2VDKH 3OKLB 4ODTH 1I7UA 4HUKB 1I3GH 3D3VE 1IGFH 3HNTH 1AC0A 3LEYL 4LNRA 3U30B 1FG2A 4MCYA 2WUCL 5I71B 2Y5TA 3BIAX 4ETQA 1X4YA 3S96B 3X14B 2D03H 4JO3H 2F53B 2DQUL 5TDPB 5HI3C 4K8RC 5ETUA 3WL9B 1TCMA 2GY7B 1T6VN 2YD9A 3WKMH 3QA3A 4JE4B 1IEBA 5D2LE 3SE9H 5H37H 5D72H 1U58A 1QA9A 2Z4QA 4M62L 1A9BA 5CEXA 4WWKB 1FIEA 1LDSA 2DQGH 5JMRA 2VLRB 1I9JH 4XPTH 1KYOJ 1H8OA 3CX5K 2D7PA 3U7AA 1IARB 3W0WA 3VRLF 5KSBE 1HI6A 2VLJE 3O3EB 2LE9A 1XZ0B 3EO1B 4WFGE 2R4SL 2AJUL 4PJEB 2XOTA 4NM4H 4MHHI 1GIGH 4HUXB 3MXVL 3GK8H 3VG0H 5BVPH 3PDDA 4ODWB 4M9PA 5E94A 5FOJA 5HDBF 5ITBL 4FZ8H 4YFLI 3BKCL 1UWXH 3AU1B 4J3VA 1FNSH 3UYOD 5MERA 3QZWA 3MBEC 3VFRB 4ZS6C 3KPRB 4PRNA 5D93C 2QQNH 5AZEH 1EUUA 3C6SA 2Q6WA 4KZEH 1ED3A 1G7QB 1I8IA 2ESVD 4MXQC 3MRJB 3VRIA 3A6BH 4RFNB 2M26A 4LHJB 2W38A 4LPVA 3S96A 4F7PA 3VH8A 4NQCE 3MRIB 1I3VA 4LNRB 5F88B 4ONFL 2AQ2A 2EH7L 2AJZA 5CMAB 5HXMA 4XGZB 4K9EC 2YKLH 1EFXB 3CPLA 3BPNB 4NKIH 3I84A 2V5TA 4EI5D 2Y06H 5EFIB 3V6OC 3FAWA 3NOIA 1FGNH 1RY7B 3DMMB 4NQCD 1RZKL 4JPWH 1U92B 4J3TA 2O5XH 3DURB 3FHAA 2F8XC 1SM3H 5E8EB 2OI9C 3SOBL 1UA6H 3T0AA 5IEKB 3F7YA 4R0LB 3OBAA 3IFOB 1R5WA 3JTTB 3MLRL 3V79C 4Z6AT 1MCLA 4NBZB 5T3ZE 2R69H 2CUHA 2F19L 4HKXA 1B90A 3W81A 4EBQL 3K4DA 4YX2H 1EAJA 4YDKL 1XFPA 3GSWB 4X0KB 2FHBA 3LB6C 5FYKD 1JNHB 4WW2A 4DN3H 3S7GA 2E7HA 2GJZA 1P1ZA 2DWEA 1MHPL 3FQRB 5ESAB 4PV8A 2WANA 1UB6B 1LVEA 1RIVL 1EA9C 5JXEC 1IGTA 1EZVX 4PTTA 1RZFL 4ZNCD 1MCOL 3P30H 1DVFC 1CLCA 3BZFB 1JYXA 2ORBL 5CZVL 5DD5H 3Q1SH 3CVHH 4MDIB 3D18B 4PJFB 1ZVYA 2DI9A 3AM8C 2FSEA 4FQCL 3BPOC 1UXWB 4JFEA 5D72L 3VH8G 3ZE0E 4WI2A 4YDIH 3RTQD 1HK6A 1ZVSA 2XA8L 5F70A 5JPNB 2DN7A 4JFXB 2VDLH 1FO0B 3MRQB 3O9WA 2DQUH 1CL7H 3WD5H 2GYSA 1TZHA 4P9HL 5LCVL 1NMBH 2UZIH 1T04A 3BN3B 5INDA 3FB6B 5T1MA 1FL5B 4AG4L 5CLWA 2F5AH 3DHJA 3KAAA 2VDKL 4FTVD 3O4LA 4RZCB 4X99A 4P5KB 4NO0D 3VRIB 5GGTL 4ISVA 2WNGA 4MAUH 5IQ9A 1IMHC 4ZFGL 2LFGA 5IFAH 3VXQB 2MPAL 3C6SB 3MRRA 2XZAH 4UNUA 4FQHA 4KKNA 3MR9B 5K93A 5DQ9A 5C0IB 4Y16D 1QOKA 2DMKA 1F3JB 3NFSH 2JB5H 5C0EA 3IAGC 5ID1A 1QFUL 3RA7H 3EYQD 1H15A 3R06A 2VDPL 3HMXH 3TEUA 1JL8A 3MACL 3O11B 4WTWA 5JZ7C 4X9IA 4WI4A 3AB0C 2FJGA 4HS6A 4UQ3A 2BFVL 2OR9H 2ZUVA 4DK6A 2JCCE 1NAMH 5D93B 2DQEH 1Q72H 5F6IB 4LLUB 4CBPA 4TRPH 1HEZA 4J12A 5TFSL 3WLWD 4QOKA 4LASL 4WW2C 5TE6L 4NJ9L 2PTUA 1J0ZA 1I3UA 3HAEB 5EZIH 4YDVB 3QUZD 3S37H 1F90H 2R0WL 2CIKB 4O2FA 1M7IB 4JPWL 3VE0A 4LGRB 2ZUYA 2NY5H 2DKUA 1L0XA 4NFDA 5AD0B 4PTTB 4G43A 4X6DE 5J13B 3QUXC 1UJ3B 4IDLA 1FSKC 4NC0B 4Y4KA 2EEDA 3HFMH 3MJ9H 4MCYB 5CEZL 4I8DA 1IGIH 3FO9B 3L3HB 4I0PB 5IJKC 1GAFH 3AM8A 1PX3A 5E6IB 1AGBB 2OS7A 4U6YA 4LLYB 3RL2B 3QDGE 2CMRL 1NGPL 1KFAH 4G80B 4JHZA 2AXJA 3NN8A 1B6DA 3TJHC 1UYWH 4PGDB 3MA7A 4LKXB 3BFOA 4M7KL 3ARBD 2EDHA 1RHHA 3ARED 1X44A 1TFHA 5LXGL 3QEGH 1KF9B 5KVGL 2A1WL 4IMLA 2VDNH 1ZTXL 2GHWB 1RMFL 3ULVE 2YA0A 1XGYH 1EMTH 3IFLH 1N3NA 3TYFA 4BZ2H 4UOW1 4HC1L 1GH7A 4OSUL 1AQDB 2A0LC 5CP7A 1UM5L 2NXZC 1NAMB 1IGFL 3HNTL 5CMAA 3T08A 4KK5C 1A47A 3NFPB 4U1LB 2NZ9D 1JHLH 5EOCL 4HQQL 5C0BB 2OK0H 3WUZA 3BESR 2BY0A 3NMEA 2PTTA 1A7OL 2YPKB 3BEWA 2DQFA 4Y1AD 3DROB 1MCPL 3GMNB 4OM0L 3UPCA 3TBVB 5IB3A 4Z7UF 5HI5C 3GFUA 4HMEA 3ZDZF 2A9NH 2F19H 4LAJH 1WLHA 3FT4A 1RUAH 4WFED 5KS9E 4Y5VC 3GIZL 1YEDA 4LSVL 4OM1H 5K9JL 3L3KA 3QDJD 4CGTA 4QHLA 2JE8A 1RFDH 4DVRL 2DOCA 3Q0HA 2LABA 1UYWL 2H2SD 1PKQA 5CEYB 1RUPL 4L5FL 4P4RA 1MFEL 1S9WB 3RP1A 5JW4R 2VITA 4K3HA 1ITCA 1FPTL 3L6FA 5FXCH 5EOCJ 3T0DA 4XX1E 1XZ0A 3GBLA 4LLDB 1FN4B 5F44A 2GTZA 4I13B 4KJWC 3V4PL 4GW1A 4HUWB 2WBWB 5T3XH 4PUBL 4YWGH 1YEHH 3PG2A 5D6DA 5MEND 1MWAA 5I30H 3OKNA 1NMAH 1WGOA 4ZTOL 2P48B 3I2CL 4UNVA 3ROLB 1EJ6A 4P2CG 1SYSA 4XVJH 5DJ2A 3BO8B 1IEBB 5HVFB 4JG1H 4Y4FA 4JFDB 3CDCA 12E8H 4HFWA 4KHTH 3U7YH 3I02A 1B4JL 4JQIH 1OB1B 4JN1L 3FQRA 5ESAA 2XQBH 4Q6YA 5KJRH 4NRXA 5H94A 3B9VA 2APBA 2HVJA 3TYGL 1I7UB 2C1PA 5C09E 2A6DA 4OIIH 5CEZH 3U7WL 1M7XA 3MACH 4QXTB 4HH8A 5E8PB 2EDKA 1A6ZA 2ZOLA 4LCYB 2YRPA 2CLZA 5BOPA 4LLQA 3V8OA 5F96L 4PLOB 3BHBA 3P4NA 3QH3B 1WWCA 5GGRY 1M7IA 3CZFA 4GKOA 1DBAL 2QR0B 4XB7A 4FFZH 2VLJA 5TQ2L 4NT6B 5F7FA 4WRLA 5GGQH 3QQ3B 1OSZA 1MREH 1CE1H 2BNRE 2WWMD 1FRGL 1KB5H 3LCYA 1J0YA 2IANB 1JI1A 2KL6A 1FZKA 1IC4L 1FYHB 4WUUA 2X5PA 4JPIA 3QIBD 3DXAA 4PJ8A 3G5YA 3W39B 2DDQH 4BZYA 1FYTB 1GGIH 3AGVA 1N6VA 1UKSA 3MO1A 3VH8B 4RA3A 1ZWIA 3V4UH 3W9DB 3V5DB 2EDBA 1VACA 4ORGA 4PRPA 1I7TB 4KKCC 2H26A 3JV6A 3S8WA 4UILH 1FNHA 4U2YA 5MEOB 4LSUL 3QDJB 3PGCA 1WV7T 2XN9E 4MA1B 1A7RH 2FATL 3RPIB 4N0YH 2SEBA 4JLRB 1DANT 4FABL 5JOPD 5LAXA 3P4OA 2AJSL 5DJ0B 4HJ0C 4ODWA 5E94B 4LSSH 4B7IA 4G8GD 2EKJA 1S9YA 3U4EA 5HTSA 1MAMH 5I66B 2X70B 1DQJA 5CLTA 2ZSWB 5IW6A 1KLGA 4G7VH 2BNUB 1UG9A 1WZ1H 2FB4L 4R90L 3DVGB 5DD3H 5SV3A 2ZG1A 4JJHA 4P57B 4Y5VB 2BRRH 4KPHL 4DZBB 1YUHA 3L9RA 1J1OL 5EU6B 4J8RB 4F9PC 2XA8H 4WJ5B 2D31B 5JQ6L 4O2CA 3QG7H 5FUOH 1HILB 2Q8AL 2F58H 4QHLB 4I5BA 4Q6IB 3T4YA 1HKLH 1CL7L 4IEFB 3WD5L 2AXFB 3NCEB 1L7TL 4KDTA 4F57H 3ZO0A 1DL7H 4TUJB 3A6OA 4HC1H 3I2CH 4K7FB 4TUOA 5JHDE 4MZ2A 3ZDXF 2VQTA 2VC2L 1BQLL 1T2XA 1FFNB 4DZ8B 4ORGB 5T5NG 4S1RH 1DTUA 3VW3L 5FYJD 3WFBH 5AG8A 4LSRH 1BFTA 3ULVL 1FORL 4JRYE 4I18C 4IS6B 4BH7B 4KY1H 3V7AG 1E4KA 2WBKA 43C9A 3JXAA 4YX2L 2NTSP 1DE4B 3I3DA 5DRWB 3JTSB 5F3BB 4LCUA 4OCSL 4HKXB 5KW9H 1LQSR 2VDPH 2VJXA 3HMXL 4XMLL 1R5WB 3JTTA 1C08A 1OAUH 2ZZUT 2C4FU 2XPGB 2OMNA 4ODUB 5H2BB 3ZKNC 1Q0XL 3B9EA 4XI5D 1OAQL 2P24B 3AAZA 3L3DB 2ZJSH 1VGKB 5GRVL 3EYVA 2W0PA 1IT9L 4OLVH 4OKVA 4X5XA 3ARWA 2X4PA 4YC2B 4I0PC 4XXDB 4N8CH 5EO9B 3GSOA 4N1EA 1KIPB 4NSKB 1T5XA 1PGRB 2AJXL 4LCYA 5IW3A 4ESKA 4PJEE 2GW5A 1F90L 5EG6C 2ZG3A 3N9GH 1BFVH 2DTSA 3MOBL 5K9OA 3OMZA 4JGMA 5HVWA 4IS6A 4M6MH 3U82B 5CZKA 3RWDA 3OTTA 2HJKB 3ALWA 5L2KE 5I74B 3I50L 4L4TB 3EOTL 1KXQE 4OGYL 4YDLC 5I73B 2UUDH 3QCTL 2WUBL 3GBNL 5CEZE 3BKML 1SY6H 2Q6WB 4V1DD 3JVGC 2HYMA 3L3JB 4U6HB 3MCG1 4YZFE 1BIHA 3H9HA 5J06A 4Z8FH 2PUQT 3MJ6A 4HZLA 5CUSH 3ARBA 4RMRA 2EH8L 4LAQL 2QQNL 3MV7A 3UAJD 5GGUA 2Q7NA 3BH8B 4XP1H 1P84K 3GK8L 5DTFA 4PIRF 1SJXA 1ZXQA 4CL7A 1PG7X 1I7RB 4EN3D 2P1YA 4S0TD 1NKOA 2FX9H 5C71A 3KYOA 2X4QB 4JY5H 2YA2A 4HEPG 3VXUE 2R29H 4S10A 1K5NA 5HGGS 1NFDE 5C70A 2AKRA 3H3PH 2CKBB 2RB8A 4M1DH 2MHAB 3BQUC 4JLRA 5DQDH 1A9EB 3FB8B 1OAXH 1TPXC 1R0AH 1U3HA 2L7UA 4ORZC 5D70H 1X7QA 1RFDL 4DVRH 3IKKA 2VABB 1MIEL 2OXHA 5T5FH 2NX5B 1RIVH 3UJIH 1K9TA 4JFFE 4KK6D 4R4FL 5HGHB 1KCUH 4GRMA 4GG6F 2XZCL 5DRZA 3LQZB 1E6OL 2ICCA 3DYPA 4DK3A 2MTPA 3CVHL 1I9RL 5T1MB 4JJ5A 3QDMB 3R8QA 3FONA 3CVHB 3G5YB 1YNKL 3RVUD 4PGEA 3NCFB 2BRQA 3ULUD 1CXEA 4CVWA 3DI2B 5GSVA 4YEFA 1TJHL 2VR4A 2HA1A 2DRUA 4JEGB 4CU6A 1ZVSB 4ODTL 5IBUB 1T89A 1P7HL 2GSIB 4W6WB 5FYLE 2HTKC 1UXWA 5L6YL 1QRKA 3NIGF 4FABH 3GKWH 3KPPA 1N7ML 4ZAKD 2O26U 3QRGH 3JUZA 4WHYG 1JYWA 4RGND 5JXEA 5DRXA 1HKLL 2IANE 3PWUA 1B0GA 1WWWX 1XR9B 3QHTC 4X8XA 3WEXB 1A2YA 3C08H 4Y8DC 1EFXD 4ZDHA 1DQMH 1U91A 3TJHD 2HG5A 3CFIC 5E08H 4XMLH 3ZHKA 3EYOB 5IHBA 4P4KD 2CDGA 5L0QC 5FM4A 1BGXH 5CJOL 2ZCLH 1U8MA 3D48R 4LBEA 3SBWC 3D39A 5EU6D 1G7MA 4GW5B 4WFGD 3LKQA 1C12A 3GJEA 3EKCA 1P69B 4UV7H 2CK0L 2F54B 4KU1A 2J2ZA 2YSSB 5DMYA 3BMVA 3HUJA 5C0DA 5FGSA 5B38G 5IMMB 5GGQL 4KJYA 2C3XA 2B4CH 1KELH 3V6OE 1FIGH 5C2UB 1JYVA 3DUSA 5IVZB 3SDYH 5T3ZL 3BPCB 3ROLA 2O5ZL 5FA4A 1U3ZA 5E8OA 3F62A 1BX2B 1AXIB 1NFIA 1P5UA 2WM0A 1MIMH 5LGJB 1WEJH 4GRWE 1L9NA 3PWJA 1OGAA 4L4VE 1VB9A 1S7QB 5D2NE 2PXYB 3QUMB 4XP9L 4P3DB 1KACB 3CCHB 2F8OA 3MGOB 1UM6H 5KN5B 4P9ML 1JGEA 3BPOB 1BFSA 1NAML 3KPLA 5CCKH 3NBNA 2AERT 2XRAH 3OKKA 3GMQB 1PKQB 5CEYA 3OR7A 2DD8L 3C5ZA 3AMLA 3PE9A 2UY6A 2NNAA 3NIFE 2RIKA 2XZQL 3RJDA 1UWXK 5D7SL 3MR9A 1PY4A 1U3HB 4X6FA 1ETZB 4G5ZL 5GIRB 3GZKA 5IQ7H 4WU5B 5F1NB 1Z5LA 1T1ZB 2V6HA 1UEYA 1MAKA 4ISVB 5M94B 3OR7B 4JRXD 1CXFA 4G6ML 5BXFB 4OV6F 2F5BL 4HGKC 1UGNA 1INQB 1FV1A 4FXGB 1TTGA 4KKLC 3UC0L 5JUEH 5DJAA 3SE3A 4XRCA 3WN5C 1Z9MA 4LCIL 5JIKA 1HH6B 2XICA 4LEXH 1FBIL 1A64A 3VGDA 2NTFA 1N3NB 1QHPA 1RD6A 3OXRB 1BREA 5C0ND 4PRBA 5LVEA 3MRGA 3E0GA 1H8NA 4UB0H 3FFCE 5D8JL 5ESQA 1T4KB 3C2AL 4KK9C 4LKXA