2ITDA

Potassium channel kcsa-fab complex in barium chloride
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2itdA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2itdA02
5EU3A 4XH2B 2BRRH 2NZ9D 4LVOB 4D8PA 3GSWB 2GFBA 4P2OD 2P45B 4ONGH 3DX9B 5IGXH 1IGFH 5J9PA 4HIJA 3DIFA 4DN4H 3PWVB 3MRIA 4ODUA 1KJ3H 2J8UE 1IC7L 4X80L 5A40E 1FAIH 1V7NL 1BQHB 3QDGA 1WTLA 2DI9A 4N0UA 4L3AA 1NJ9A 5EA0H 1T5XB 1KBGL 3DUHA 4NN5C 4KJWD 5KS9B 5F9WC 3ZHDA 1AFVL 1OAZL 3L3GB 3QJHA 4XMKL 4K94C 4MD0A 3QIBA 4AENA 1J18A 1CXKA 2PN5A 5T5FH 3WE6B 5ID0B 1HI6A 3MLSH 4RMTA 1EHXA 4HC1L 5DA4A 4ZUUA 3BVNA 1OGTA 3A6OA 5D2LE 1RUPL 5A1AA 2PW2A 1AXSB 2M8XA 4RQQB 4XXDA 4U0RB 1AXIB 4JZJA 5EH1A 1YY8B 3I2CH 4RNRA 3MRKB 5GIRB 1T3FB 4LLYA 3E8UL 1VEPA 2VC2L 2FL5B 1AQKL 3B5HA 1TVBB 1CD9B 1MH5B 1KPUA 3L3KB 4NNPL 3RY4A 1H3UA 1YEHL 2BVOA 5HPMB 3DO3A 4U6YA 3QAZB 1DL7L 4P46C 5KZCB 1XGQA 1FV1A 1ZAGA 3KR3L 1U3HB 3EYSH 4JRWA 5EOCH 5EC1A 3GSRB 3PHSA 2FEDD 3LEXB 5JPNB 1IC4L 1R24A 4GKSB 3C5JA 4RWYL 4ZUSA 4OAWA 5BVJA 3MRRA 4OF0A 5I76A 4TOYL 1KJ2A 2VISB 1UCTA 1NLBL 4OZFA 4YHKL 3T0BA 1EXUA 1PDKA 2H6PA 4GRWB 4M6ML 4M62L 5DK3A 4G6AC 5C86A 3IRPX 4QXUL 1MJ7H 5EOTA 4NKDA 5C07D 5E0QA 5E08H 5FYJE 1RJYA 1MVUB 1R5VB 2DQUL 3QZWG 4PLKD 1IEBB 2R4RL 1F3JA 3BN9C 4HCRH 3U0TA 5EZJA 5H94B 2BDNL 2EIDA 4XVUC 5TE7L 1VCAA 2AEPL 2QV2A 1T0NB 5GRZA 1WFUA 2ADIA 2R1XA 2EO9A 4ELMB 5BW7C 4V1DE 4H8WH 3LRGA 3CVHA 3MV7B 4BYHA 1EHLL 1EFQA 1U8JB 1RUAL 3BKJH 1X7QA 3PGCA 3P0VH 4CMHC 2DWDA 1KJ2H 1MFAL 4OZFH 5HI5C 1N4XL 1UZ8B 1G7PA 2Y9RT 5E2VH 4F15C 4HT1H 3RZCC 5TDNB 1R3JB 4NJAL 1EAPB 1MCWM 2FJFA 3ZYZA 2WWMD 1BGXL 3O6KH 2Q8BH 5HYQA 4UZGA 4JRXA 3ZO0A 2EDJA 3S37L 2FX9H 4S2SB 2OXHA 1NCNA 5IF0B 4OCXH 1J05B 1AJ7L 3DROA 1Q8MA 3ZDXE 1WCQA 3MJ7B 1RUAH 3CDFA 1VFBB 3MGTA 1LO0H 5A2LH 5E94B 1MWAB 4JO1L 5KSAA 1S5IL 3NVQA 2DLFL 1HZHL 3BDYH 5A2IH 3D25B 5DRNA 5DYOB 3CVHB 1MRFH 3HB3C 3U6RB 3L9RA 4UIMA 2XNAB 3LKNB 3G04B 3ZSTA 4OQ1A 2WK2A 2F19L 3THMH 4HS8H 1DUYA 4OV5A 1GGBL 2A73B 1UM5H 4HCRL 3GZKA 4AIZB 2FYYA 3TLRA 3STLB 1KG0A 2R4RH 5D7SH 3N50A 2KUTA 4HQQH 2WAHA 1S7UB 1CFBA 4X6CF 3B43A 5GHWL 3JWOL 5KVFH 1V3JA 3O8XA 3TJHD 1QVOA 1A7PH 4Q6IC 5FCUH 3MV01 4LQ1A 4YR6B 5D71H 5DRZB 1E4XL 1F00I 1F3DH 5C9KA 1QBLL 1FRGH 5CIPB 1I3GH 1U8IB 4JO3H 4TQEH 3GBNH 1IAOA 4GG8B 3MRBA 4U49A 2Q3ZA 2PTTA 2HJLA 3DURB 4IHOB 4LP5A 3EYSL 3IGAA 1NH6A 4MQ7A 1M7IA 4OLVL 5ILTH 4DK3A 2JLLA 3GBNL 1FP5A 1PX4A 2XWJA 4BZ2H 1FVCA 3VH8G 3PGDA 4Q6IA 2Y5TA 4CU6A 1AQKH 5D7JD 3VFRA 3SKMB 1DE4B 4QT5B 4OJFL 3FOLB 4R7NB 3SQBA 1FGVH 3RWIB 4PD4K 2BY2A 4Q9QH 3FKUS 4FZ8L 1PAMA 2WBWB 4F57L 3C6SA 4FFWD 4ZFZB 3HMWH 1V8HA 1WWAX 2VXSH 4NZUL 4NYLA 3ZYOA 1KJMB 4X4XA 4FOMA 1QSFD 1NMBH 4YX2L 4WI2A 2AK4D 3MTRA 4M7LT 5ESVB 4HUVB 5IOPA 3CFEB 3PL6A 4HC1H 4MNQA 3BDBA 4QNPE 4QY8B 5T5FL 1LO0L 2F54D 5JIHA 1RHHB 4RA0C 5E5MA 3PXHA 4LEXL 5C0JA 3TN0D 3VWJB 1XR9A 3K8LA 2VB5A 2VZVA 2YRPA 3RBSA 4A6YL 4RNRB 1EAPA 1A0QH 1A9EB 2YRLA 3F7VB 1FVEA 3RGVA 2GJZA 3IJSA 3OKKB 1M71B 4N1EA 1IC7H 4ZO6A 4D0DA 1BQHA 4GXUN 2R0ZL 4ISVA 4ZAKA 4DKEH 3EDDA 3C5ZC 3T2QA 1QHPA 4UILL 5EU5B 4N5UA 3G6JE 5HVHB 4K7PY 4ZDHB 1TZHB 2NY0B 3MRMB 4RBPH 4ELKB 3KPQA 2QQLL 2VITA 3E6FA 5I30H 3VXPB 3FO2B 1IE5A 2J8OA 1ORSB 2B1AH 4QRSB 3RWHB 3HE7D 4R8WL 2ICEA 1E4KC 4YBQD 1OY3B 3TNNA 4QY8A 4WHTA 5JW4N 4KQ3H 2E5EA 1NL0L 3F7RA 3CC5A 5FF6B 2YPKB 3QIUA 2PR4H 4I3RH 4L4TB 4WI4A 1LO2L 2E3VA 2Y7QB 4KKLC 1NC2D 5C0GA 5AZ2H 3I6GA 4KJQC 4NQDE 5LAXB 4Y4KD 5CBEB 3X12B 5JW5A 3MODH 4P99A 1EAJA 3OSKA 1MFDH 4NWUH 1S8DB 2R4SL 3TV3H 3V0AC 5DRZA 3UTPE 3MUJA 1XF3A 5BJTB 2EDKA 3MLUH 3IXTB 5AYQA 4M4PA 4GH7B 5JDJA 1KIPB 4PRPD 1J8KA 5E9DB 1CLOL 1KACB 1BBDL 4PGDA 1UB5A 3U4BL 4NHCH 3ULVH 2PW1A 2WUCH 1Q9OA 4TVPE 4ZTOH 1D5MB 2YPLA 3CU1A 1FYTD 4LLQA 4GRLC 4NNPH 4I48A 4JG1H 2DL2A 1G9MH 4NHUB 5DSCA 1F6AA 4N0CC 5HGHB 4HKBA 4TSAH 3CSGA 2PETA 5CGYC 5GRUL 5DA0B 4IOFD 3WO4B 2EXYC 3MBXH 3I3DA 5CEZH 2IBGA 3GHBH 4I2XB 2LE9A 4IRJC 4JQVA 2CSPA 5JXEC 3K46A 1EERB 2N7AA 5ICZA 2EH7H 4YBLB 3I6KA 1NFDF 2DBLL 2PO6A 2W60B 1MHCB 3IS0X 4W4OC 4GLRH 1BIIA 4LCYB 1SYVA 1U8PB 2CLVB 3OHXA 2HRLA 5DS8B 3AM8A 4XC3H 2IAMD 2XPGB 4X9HA 4KRMB 4JDVB 4O00A 4HKXB 1YN6B 2CIIA 4RGOH 3HC3L 5DYOA 2VZSA 3L9RB 4XWGL 4UT9L 1UG9A 4KU1A 4JFFA 3RTQD 3LRHA 2CUMA 5EZOL 2ESVD 1YMMD 2ZCKL 3U0WL 4XP1H 5EBWA 3D39D 2PF6A 1S9WA 3GMRA 2FX8L 3IU3A 4XPBL 4FXGB 5EA0L 4ENEC 1AKJD 1W8OA 4XPGL 4YAQB 1MFNA 2C5DC 1NC2B 1ZA6A 1S7QA 1R0AH 1NBVL 1J86A 3V4UL 2NXZC 5I8OL 3L6FB 1BHGA 2HT3C 1K8DA 1W2KT 4LNRA 4PB0H 4BH7A 1EEUA 1MI5D 1MJJB 1ZA3B 3KYNB 3U9UA 1HHKA 3O6FB 4NKMA 2AJVH 4KHXH 2NCMA 3MRHB 3UTTD 3CD4A 1QFWH 1B2WL 3QHFH 5F7NC 3HI6L 2DQTL 3HLAB 4LSTH 3DV6B 3NTCH 4NT6A 2X4UA 3BIAX 2F54B 4L9LB 4YZFE 5I8OH 3ULUF 4MGXA 4W81A 3MXWL 5HHNA 3K81A 3V4UH 3BH9A 3TBSA 2OYPA 3D5OF 2C1PA 2P4AB 1L9NA 4FFYH 4YQXH 1SQ2N 2CDFB 2EO1A 2BX5A 4ALAL 4P9MH 4XNZB 3LCYA 5ICXB 4WTXA 3CZFB 4JPKH 5M94B 3PQYE 1HQ4A 3BPLB 4EOWH 5HHMB 4HW6A 3MV11 4NOFA 5DC0A 5B3JE 5F89B 3TIDA 4YHLH 2V5SA 2HAZA 5E8DL 2DLEA 5IB4B 1UEMA 2JK5B 3F58H 1QSED 1INDH 2YN5A 4OT1L 1YECH 2BERA 3Q5OA 1HHKB 3O6FA 4MB3A 4G8FA 4PS4H 2DM2A 4KHTH 3MA9H 1GHFL 2AQ3A 3UJTH 2W38A 1T1ZB 5KZCD 2K9UA 1RIVH 4X0KB 3RDTD 2XQBH 1YYML 1GOFA 3QR2A 2E9BA 1WFTA 4YXHL 5C0FB 4JDZA 1OTSC 3TBSB 5CEZL 2XN9A 1UH4A 3JV6B 4PJGF 5FA3B 4LLYB 5LQBH 4YDKH 5C0AB 3WNPA 4HK3J 4J12A 4R26H 1RZKL 2VDMH 5IW1B 2YS4A 3KLAB 4HK3N 3C2SA 4KHTL 1S3KL 3PWPA 5KSBB 2O5YL 4PP1D 3MJ6A 3VXRE 4PV8A 3EO9H 2P8LB 5AWNL 1AXTL 4KMLB 1AGDB 1IC5H 1DLHA 2XA8H 1HN1A 2OI9C 3CXDH 5JW3H 5MEQB 1A3LL 3RA7H 1MFBH 5FB8B 4PJFF 1P4IH 1I3VA 4PRHB 1D6EB 4XP5L 5IT2L 1TITA 3NFPA 4OV6F 3SE9H 1T5WA 5C0CE 1CZ8H 4HGWA 4HC1A 5H35B 1WWWX 3PGFH 3UDWA 5CBAB 2VXUH 4G9FD 5CP3A 4G6KL 3O8XB 1HCFX 1ES0B 4N0YL 3O3BB 4LSRL 5IBTH 3QDGE 3DMMA 5BZDB 4RA3A 3WHXB 2VWEC 4XC1L 4GW5B 5CP3H 3KPTA 2EH8H 1CE6A 4KTEH 3RTQC 4P0DA 3OR7B 1FAKT 1W0YT 5KSBE 3HPLB 1N5AA 3UDWC 3VXSD 1IM3A 2VQ1A 5ESAA 4YEFA 4Y16B 3RUGF 1IAIL 3R4DA 1KCVH 2L7UA 5JOFB 1JNNH 3K2MC 8CGTA 3DMMC 1UH2A 1R5WA 4E41D 2YR3A 2GAZB 3NFPB 4TN9A 1MWAH 4YBHA 2FB4L 2CR6A 1LO5A 2FX8H 3MJGX 1BF2A 1BQUA 2Q1EA 4WGVB 2J8HA 5FUZH 5K33A 5DI8B 1ED3B 4KROD 1ZHKB 1WC7B 2PYEB 4LPYA 3T4AB 4OLZL 2ATPB 2VOTA 1WVZA 4XP4H 2NW3A 2PO6D 4NZRH 5EBMB 5IB3B 3REVB 5HGGS 2I25N 3PXJA 4RFEB 4IRSA 3PWPE 5BJTA 1QZ1A 3CFBA 1NMCC 4NO3A 1GGTA 4MA3A 1LEKA 3GGWB 3N9GH 3L7FB 5FUOH 1J1XH 5DQ9B 4OLYH 3HZMA 3NA9L 1S9XB 1ZT4B 3EOBA 1OP9A 1Q0YH 3HNSH 3GSVB 4HDIA 4PJDF 1JPGB 2VAAB 5DEZA 4PRHD 3LN5A 3BISA 5I71B 3CLEH 1SEBA 4C58B 1YYLH 3QI9B 5GRUH 3JWDC 4UUJA 2X4OA 5SWQB 3BP4B 5L6YH 1QRND 4FP8H 4NKDB 5D7KD 4DGVL 3C2AH 3MBED 3DYMA 1JF6A 1CQKA 1RJLA 5D2NC 3X3GL 1NLDH 4Y4FB 2WUCL 4LCWD 4N8VB 3WIHH 4WUUE 4NBXB 1U41A 1F4HA 2B7DT 5HHMD 1DLFH 4EVNA 3HMXL 5LBSH 1T0NA 2QR0B 1Q72H 1IQWL 3LEVL 3CFBB 4KI5D 3PDOB 4WUKH 3VFNB 2DJUA 2Y5TB 1AH1A 2R9HD 1VGEL 2B0SL 1LILA 2NNAB 3L5WB 2VDNL 1AIFA 1IFHH 1L0YA 1CGUA 2DKSA 1BQLH 1P4BL 4F7CA 1LDPL 32C2B 2DD8H 3IJHA 1I1CA 3AU1A 5C0RL 4Z77B 2J5LB 2Z31B 1AY1H 1CIUA 1D5IL 1C16A 3AXLB 4YAQA 3ARXA 4TULL 4X8XA 1E27B 4PJ8D 5D7IA 1UXSA 2ZUXA 4F37K 5DRXB 4XP6L 4ZD3H 5IEKA 1ETZB 4QNPF 4R8WH 3B9KC 5MI0B 4TVPH 2EKJA 4M00A 5C7XL 4LNRB 5IK3A 3BZ4B 3QDJE 3QEHA 5E8NB 2HMID 4WI3A 43CAA 2I60H 2XKNB 4Y4KA 3UTZA 3DYPA 5JXAL 3FQWB 3IXAB 5J13B 5JORA 1KJ2B 1LK3L 2VISA 4OZFB 5CS7A 2FX9L 3U6RA 1M7DA 2FX7H 4OSUH 3LQMA 1CL7L 3BRGC 3O6KL 2VR4A 4XXCC 3G9AB 4XBPB 3DRQB 2IH1A 2BVPB 5C71A 3B9KA 4A6YH 4WU5A 5DJ2A 2IADA 4LKCB 1S7UA 5E9DE 5JIKA 4R90H 3BP5B 4JY4B 4QHNA 3SPVA 1QYGH 4P2OB 1FC2D 5JOPD 3P0VL 3OXSA 3RWJB 4OFDA 1J8HE 4PTUB 5FYKD 4HUMB 2JCCB 2AP2A 5GXBB 4DVBA 4O51A 1SYVB 2CLVA 1KCUH 4M6NH 1CT8A 7FABL 1JNHB 4TVPL 5CIPA 4W68A 1MCEA 2X4RB 4MQXD 1WWCA 1YMHB 4WWKA 1AO7B 3WV0A 5IK3B 3TJHC 2ICWB 1QBBA 4IMLA 4OQTH 3ROOB 2EE9A 2OXGA 3VGEA 2P42B 1VB9A 3RWEB 4POZD 5GSVA 1IARB 3HMWL 3L5HA 3PGCB 3MCG1 4HGWB 4OFPA 1X3DA 4K3GA 2I9LA 1B0GA 3G6DL 2HFEB 3LB6C 1CICD 4PJDE 1M7DB 3RY6A 5TPWL 4A6YA 4PGJA 2J6EH 4LSUH 3OJ2C 3Q6FB 1H3VA 3B3IA 1QKZH 3G5XA 4JANB 4K3JL 1U8HB 5BRZE 3KHQA 3SY0B 4CAGA 2VJXA 2NY6D 3RWIA 4ZUWA 2OJEA 4C54A 3VXRD 3RJQB 1QHOA 1DJSA 1G9NH 5J7CC 4HX1A 4WDIB 3ZDZE 4IRJA 4K07A 4OLVH 3FOMB 4TYUA 4IRZL 4YIQA 1RHFA 3H9SA 5T3ZL 2K7PA 4ERSH 4HWEL 4LPUA 1DQLL 4NJ9H 3IETB 4M61B 5DMGC 2BNQB 4FQJL 4ZUVB 1FRGL 2A6IB 3BPOC 3QEQA 1J88A 1HI6B 5DSCB 1E4XH 1A4JA 1Q9KB 1RZJH 1Q0XH 4NQDA 4YZFF 3ULUE 3ULVF 1LEIB 4GXUM 3U4EA 5FB8A 4BQ6A 4YDVB 4Z7QF 3KJ4B 4Y5XC 3DSFL 3FT4A 4NRZB 3N1MC 4MAYA 1OD9A 1T2QH 2CDEB 2D7MA 4X9GA 1UJ3B 1T21B 2ICES 4YHPA 4Y1AE 2PUQT 2NYYD 1KLUB 3G6JB 1PJ9A 3O4LE 4NO5A 5F9OH 2DIJA 3IFLL 1AGBB 5FUOL 1NGQL 2JCCE 3PHOB 5B3JF 3BZEA 1TXKA 2A83A 5LGHL 3FT2A 3L1OH 4OM0H 2B20A 3FONA 5IBLC 4HPOH 1A6TB 3TO4A 4J1UA 4P9HL 1CD1B 4Y4FD 1XCQB 3KYMA 5IB2B 3H9SB 1DZBA 5D7IF 1J9CT 1XGQB 3Q0HA 3CFCH 1J1OL 3D3VD 4L4TE 1AFVH 1WFNA 4ZOCA 5I74C 1A4KB 2KZWA 4DGIH 1RZ7L 3U4EB 4HG4K 4TSBL 4YDVA 5IM7A 3NH7L 5BO1L 2JELL 1FAIL 1EXUB 3TBTA 1S7QB 3ARSA 3BFOA 3BMWA 4GQPH 1P7HL 2BNRD 4NJAH 3TA3D 1MUJA 4Q9CA 4ORGB 4HMEA 3RVVD 4YHIB 1X5IA 5LXGH 4YHPB 5CAYB 3NZHL 3QQ9C 3QCTH 2YN3A 3SDXA 2DLHA 1UWGL 5D2LF 4JKPH 4I4WB 3NFNA 5K9OB 1NCBL 4BQCA 2NX5E 5CHNA 5DK0B 4BM7A 5IWLA 2B2XL 5I1IH 1CDGA 1CFNA 5TDPA 4XC1H 3INUL 1H5BB 3I6LD 3IDXH 2GUOB 3ARDC 2ZUVA 1C12B 1NGWA 4I18C 2Q6WB 4MJIE 3QCVH 3UO1H 5GS0D 4LSRH 5E1AA 4PJXB 2QQQA 1IILE 3FB8A 5C2UB 2I9LB 1IGMH 3LV3B 2DQGL 2AV7A 5DVOA 3VXRA 1MJ8L 3OKNA 4HXBH 1BJ1J 3FCTA 2BXYA 4U1NB 3F7YB 1CTNA 1SJHB 5DRXA 4F9LC 3EGSB 4K94L 4ODXB 3VG0L 5INCB 2VXVH 4K3DH 5H8DA 4N1CA 1IC4H 1W0WB 4I18A 4MXVF 1OB1B 5DT1H 3T0AA 1DL7H 5DJZA 5C2BH 5JW4R 5IIEA 3H3KA 4NP4H 3VE0B 2MCG1 3BJLA 3ULSA 1MWAA 5KSAB 4DTGH 5ESAB 4WV1A 2VLJE 2NX5B 1NPUA 3BZDA 4OI9A 4JFDA 1IGCH 5IKCA 4WFED 1GCFA 1FJ1A 2LU7A 2P43B 4YXHH 1DUYB 3QUXA 2A73A 4AIZA 2PYFB 2DIBA 3TYFB 1BFTA 4DW2L 3B9VA 1GPOL 4O02L 5DGQA 4OLUH 1K3ZA 3MUGA 1AGEB 4KKAC 4MXWL 5GRJL 5JHDE 2N1KA 2PCPB 1IEBA 1SJHA 1SY6L 3WLWC 3MXVH 3WFZA 3MV8D 3EHBC 4LEOA 1PG7X 3UZVB 4WV1C 2AQ1A 2AJSL 4WWKB 5DHVH 3EO1A 2L7JA 5KOMC 3VXUE 4GRLD 1OB1A 1M4KA 1OD7A 1YUHA 2R15A 3FTGA 3WNLA 3QUXC 5GGVH 1MHPL 2OTUB 4ONHB 5HI3D 3O6LH 4J4PC 4NQVA 5DMYA 2D7QA 1JWUB 1UACH 4DQOL 1A4KA 1XZ0B 2BFVH 4YWGH 1MCDA 2DKMA 2W92A 5DJ8B 4JHAL 4KI5C 4DKFL 1FGNL 5GGUA 4X6EA 3ABZA 3RVXC 3WLBB 1SEBB 2XG5A 3MXWH 5T3XL 1C08A 5FYKU 3LKPA 1I7RA 4GW4B 2R8SL 3TVMB 5I1JH 1WIOA 2K3TA 1RJLB 4JREB 4FQPA 2YEZA 3U83A 4NNXA 3OKOB 5E2JA 1V3LA 2BNRA 1B4JH 2MQ0A 4HS3A 3TA3A 5GS2H 3MNZB 3TPUA 3C08L 2LAAA 1VADB 4OZHA 5B38G 2XZQH 4LCUB 4JFZH 2COQA 1PKOA 4R4ND 2WBKA 4LPCA 1BREA 5EBGA 4L4VB 2GEEA 3X11B 1FBIH 1M6OB 4G8FB 1R0AL 4F3FA 4XRCB 3RWGB 2GY5A 4YGVA 1NCWH 4LASL 1I1AC 5IVXF 2NY4D 4X7SL 4NQSB 5F70A 2V9RA 3B9EA 5JUEL 1NGPH 1NUNB 5DEFA 4XP1L 3VXNA 1A14H 4M8VA 2EDDA 4HPYH 4EUPG 4M9PA 5H2BA 1B88A 2RB8A 5EZOH 3KJ6L 1RZKC 5F6IB 1KXQE 1SBSH 4LAQL 4CN1A 1RVFL 3QIUC 1BPVA 3RAJH 5IB2A 1Q9LA 4Y89A 4XC3L 2WQ8A 1N3NA 3MOBL 4NNXB 1QLEH 1CN4A 1CWVA 3OKYA 4DJMA 3T2NL 3FQWA 2AJYL 2AXFB 2H32A 3CAFA 2A6IA 5INDB 2F9BT 3H7BB 1F02I 4LLVA 3NCMA 3X11A 1P7KA 3O4LA 1ZEAL 3WFCH 5KOVC 5FM5M 1VFAA 2D0GA 3GSOB 5FF6A 1GL4B 3QI9A 4GAGH 4YBQC 1LMKA 1A64A 4P23A 2AEWA 1ZGLA 4M3JA 5CCKL 3QXDB 1Y6MR 4P4KA 5EU7C 1JE6A 2EDLA 2D9CA 1BD2A 4NO2B 1JJUA 1D7FA 1I7TB 2H2PC 4PGEB 1CU4H 5B38B 3PWUB 4WTZG 2XN9E 4ODBD 5DEGA 1DTUA 3CZJA 3Q1SL 4G6JH 1VERA 5DVMA 1AGCB 1Q9LB 1FO0B 5JMRA 4DZBA 1KIPA 3SKJL 2QL1A 3VI4E 1EGJL 3BEVA 3V7AE 3GSQA 4JM4L 5CLTA 1S7SB 5C09D 2G75B 1NCCL 4EKXA 5FFLA 4J3TA 5HHQB 1VHPA 3QULB 2GTZB 4NGHH 3S35H 4BSVB 5CFHA 4L3CB 2VKXA 5SX4I 3QJFB 2GAZA 5CEZD 5ADOH 3H0TB 2PYEE 5CJQH 4G9FA 4CU8A 3WD5H 3WHE1 4HIEA 1J7VR 4K7PL 3RL2A 5KS9A 2FO4B 3OTTA 4OCSH 4TNVF 1BZ9A 3WIHA 5EOCJ 4POUB 1JF1B 5KTEL 3B9KD 4PJAF 4EBQH 3MNZA 4U1IB 5BMFH 2H2SD 2DLGA 1XF1A 4H0GA 3WDJA 4X5LA 2GT9B 1DBJH 4BA8A 3WHE0 4CL7A 4E41E 2XPGA 1FL6A 4OM1H 1LEKB 3MNWB 3GHEH 5IQ7H 5D1XD 3TH2T 1NSNL 4Z7VA 2GHWB 1S7SA 4YXLL 4AYFA 2Y7QA 2DWDB 5IESH 5TDOB 3MA7B 3B9KB 5MI0C 4XMPL 5E99H 5C1MB 2VDOL 1K8IB 3D87B 2MQ3A 5I75C 3OQ3B 4XPTL 3WIIL 4TNWK 4EI5B 1QA9A 5MHSE 1AD9B 3DX8B 1S7XA 2A1WH 1TVHA 3E0GA 5GZNC 2CO7B 4JRXB 3PHOA 2VDLH 3P4MB 1BOYA 1NAKL 2AERT 5HHXH 4LOUC 4B53A 2WIIB 2I27N 1ZLWH 5K59F 4KKCC 4PLJD 3V4PH 5EU6A 5GGTA 5IB5B 2Q7YB 1U95B 4YHZH 4W4NA 1EPFA 3QT2A 4CVWA 5HTSA 4APQD 3D2UB 1N5AB 1U2CA 1QSEA 1KIRA 3EDJA 4NKQB 1B0RB 3UJIH 1JYVA 2H9GB 4KQ4L 4PJ5B 5FOJA 2H6PB 3TM6A 3NBNA 4NCDA 3GSNB 2X4UB 3HCVA 2Y4SA 3WFBL 1JPSH 1OPGH 3HFML 4PG2A 2YD2A 1IVLA 1KC5L 3AREC 5I16A 1IKNA 3AS2A 4RFNC 4JPVH 3ELAT 5T5NF 2FATH 4HSQA 1F3JB 3V0VA 3BKCH 1IBGH 5CJ5A 2M1KA 1PYWB 2ADGB 4U1SA 2JJSA 2WMPA 1KEMH 5I71C 1RAMA 1Z3GL 2QSVA 2WIIA 3TFKD 4X4ZA 1CGWA 4WO4A 1P53A 1KGCD 4WFFD 4JRXE 3SN6N 5GQBA 1O7VA 3X3FH 1UJTA 3OAZH 4F9PC 5ALBL 5FCUL 3RVWC 4NKIL 2ZCLL 2XTJE 3GJFH 3FRPG 4QKXB 2NQCA 5CD5D 1QBML 2M26A 2V5MA 2FJGA 5A2JH 2GQHA 4X98B 4CGTA 1GGBH 35C8L 2VH5H 2H45A 2O5ZL 5F1NB 2F19H 4XVTH 3RVUC 1U92B 5JO5A 1L7TL 1CYGA 1TETH 1AKJA 4FQHA 4Y4FC 3QG6A 4PB9L 5L2KE 3FT2B 1RQ5A 8FABA 4UIKH 2X4TB 2Z91A 3GUTA 4GW4A 5EFIB 5I18H 4KAQL 5F1SA 1P6FA 2R69L 1UH3A 4PJAE 4LU5L 3RHWF 1D6VL 5E94A 1RULH 5MP6H 4RSVA 4H0HB 1IQDB 4WI9A 1SVZA 2MHAB 4NZDA 2JB6A 2QSCL 3CK0H 4MXQD 2EEAA 4F37F 2HH0L 2FGWH 1WEJH 2IQAA 2JB5L 3CSBA 4V1DA 3VXSA 5J11B 1YEIL 3GMPB 3ESUF 5C0JB 4GS7C 1T1WA 4GO6B 3QUXB 4YGVB 4HT1L 3JTTB 1HILA 1FNGA 3SKOB 3PWLA 2NXYD 4EUPB 4JFQB 4HIHB 1FNHA 3J7HA 4NZTH 3LPFA 3FQUA 2AEQL 4LARL 2OZ4H 3U1SL 1I9IL 4Q6YA 2Q3AA 2X10A 3D85B 4Y4HD 4B0MM 3VI3F 3QQ3A 2HTKC 2UYLA 4XBGB 5E2WH 3P73A 3RGHA 4FMFA 5C6WH 2DQDL 2BNQE 3DVGA 4MB5A 2LTQB 3SGKA 4BSWA 1MH5A 5I1DA 2HKHH 1FYTA 3QBTB 1BEYH 3SKNB 3HTLX 3S4SG 4HJGA 2EYRB 1RMFH 1CXIA 5IB1A 1FIGL 4RAUA 2R2HA 2OI9B 1YMME 4PJAB 1CR9H 1OT1A 3BUYA 3ZTJH 4G6MH 1VFMA 4PRDB 25C8L 4EZMA 5EBLA 5KSAC 2VLRA 3TBYB 1WTGT 5C07B 5DQJA 1OTTD 4G9FB 4XCYB 2ZSWB 2R56H 3DUSA 3QHZL 3W9EA 1HILB 3UP1A 1TTGA 4E0RA 1IGTB 5FM5O 3LMJL 4GRWF 5I1EH 4HF5H 4PBVC 3RTQB 1N2RA 3HAEA 4KDVA 3A6BH 4MDIB 5F7EH 7CGTA 1C5BL 2EYSA 3QJHB 4JLRA 4HK0A 4ZS6D 5IFJA 4ACPA 3O8XC 4ETQA 4G3YL 5A2FA 1YEEL 2IMNA 3MBEB 5IBLD 3MOAL 3HKFA 4EN3B 1TNNA 1F8TH 1S9XA 4U05A 3DNKA 4TVSa 3B83A 4OD2A 1KPRA 4DKDC 4YDLC 1Z2KA 3Q6FA 1WBYB 1CD0A 2F5AL 4JZJB 4WIQA 3T3PE 3O0RH 2UZYB 1CF8L 4OZFG 1CVRA 1GOGA 3RUGB 1MHEA 3EOTH 4UAOC 1WFOA 2DQEL 1FFOA 1IGIH 4YPGB 2K1MA 5C09A 1BZ7B 3ESVF 1ZS8B 2IEPA 4F7TB 4GG6F 1KCKA 3BGMB 1DBAH 3BGFC 4S2SA 3C5ZA 3W0WD 5HPOA 5EO9B 2UZIH 1LP9F 4MHHG 4L29B 2ENYA 2F58H 3FO2A 3EYQC 2QSTA 2QHRL 5FO7B 1CFSB 1UWEL 1W72A 5DD3H 1F58H 3C5JB 4ZUSB 4PJ5A 3KPNB 4X7CC 4FMKA 4QXWA 3DI3B 2F5BL 4FFVD 1JWSB 1F4XL 3EOAA 2AXJA 2UVEA 1IGFL 3MLRH 4JFQA 4KDTC 4MWFB 3CMOL 3OR6A 1I1AA 3DIFB 2FD6L 4Y4KC 2P47B 1U8OA 3L3IB 4PJFB 2GSIB 4TSCH 3VGBA 4ETYA 2A9ML 4NO2A 1BD2E 2P44B 5CILL 3MLYH 5D7JA 2X1OA 4LIQE 1U42A 1I7UA 1O7SA 4NO0B 4X5XA 1RUKH 1MCPL 2V17H 2DQJL 4QOKE 3MLVH 2JF1A 4Z7NF 1JZ4A 3TPKA 5EO0A 5F9DC 4YFDB 2E7CA 4U1GB 3GRWL 3VWKD 4ZO7A 1OAXH 4OFIA 4KUZH 3S96B 3PQYB 5ISZD 1YMMA 3DGCR 5TE4H 1JGLL 1QFOA 5CD3A 3WN5B 1ZT4A 4FTVB 3U82B 1CGTA 5HGHA 3L3OA 3MO1B 1QPPA 2VUOA 5IM7B 5E03A 2ENSA 2YKLH 3ARGD 4FQ1H 2B4CH 1T0MA 4LGRB 5ALCL 3D3VE 3JWNC 1F2QA 4KI1A 4P49A 4QHUB 2CXGA 4LNVA 3K7UA 4YBLC 3WMSA 4L8DA 1G6RH 4XPAL 3O4LD 2BVPA 4LIQH 4P5TD 3OAZK 4JFHE 2JIXA 3MRQB 1U93A 3L3JA 3VFTA 5I16B 4Y5VC 4CJ0A 3K1KC 4HUWB 5IFAH 4H20L 3U7WL 4BZ1H 5DUBA 2X5PA 2NXZB 1YPZA 4X6CB 1KTDB 2ITCA 2PXYD 3S37X 1RZ8A 3QYCA 3AM8C 2X4PB 2BVUA 1FLRL 2GT9A 2HTLD 3TT1L 4GG6B 2W0PA 1A7NH 3GB7B 2D03H 5L9DH 1MF2H 4R7DB 2DQHH 4JFEA 1N64L 2X09A 3W9DB 2AS5M 4JM2B 5CINL 5GSVB 3OAYH 15C8L 3WNNA 1R3IH 4HIHA 5J06A 3LVEA 5GS3A 4U6HB 3VXQB 5IUSA 3TH4T 3CLFL 4JRXD 2IPKA 1G1YA 3VJ6B 3QP3A 4HFUH 3L5JA 4MD5A 1TQBB 4OFKA 1X6NA 4KZDH 4PUBH 1Z9SA 1U92A 1FH5L 3QIWD 2Y36L 3NIFE 4L4VD 2HLFC 2AV1A 4Y5XA 4JO2L 4I3SL 4IRJB 5DUML 4LDEB 1ZLVK 4P2RD 3WXWH 3REWB 5JXEA 1TQCB 3MV8B 4LMQE 4QTHB 3WO4C 1QEWB 3PJSA 4AG4H 5CKAA 4OUOA 4K7FB 3VFSA 3KPNA 3KHOA 3RWFB 2NY3B 2X9XA 1UYWL 4PLOB 1A3RL 3FB6A 4L3CA 2DYPB 5D96B 4PGBA 4V1DB 5J12B 5I1HL 2GJJA 1OQOA 4JN1L 4P2RB 1A47A 3CZFA 3P9MA 1AQDA 2Y6SD 3BGAA 4E42B 4IDJH 4MZ2A 1WICA 3FHQA 3WKMH 3BE1L 4KKNA 1N59B 4ODVL 2HVJA 4QHLB 3AAZB 3QDMD 1FE8L 1I7UB 3KPLA 2VDQH 1TVBA 4G43B 1T1XA 2KQMA 2NTSP 3CH1B 1KPUB 3L3KA 4XCNA 3TWCL 1PZ5A 4DVRH 2A6JB 3OX8A 4JJ5B 3GNMH 3E3QE 3P4OA 1OP5K 3BYYA 4C56E 1FYTB 3OBAA 5L88H 3AS0A 3VFPB 1I8KA 1RHHA 3GSRA 3MV8A 1NAMA 1EBPA 1QRNB 3ILPA 2IAND 3D9AL 4M43H 5ECJE 2BSTA 2CGRH 5TDOA 1TQCC 3V4VH 4R0LA 4Z0BL 3ZDZF 4MNHA 2OQJB 2WQRA 3HNTH 3K8KA 3BIKA 2AXGA 4PJCA 1NEZA 2BOCA 3QRGL 3P77B 1DSFH 2NY0C 1J5OH 5IVXA 1TJGL 3RIAF 1YNKH 3GI8L 4KRPD 5JW4M 3I9GL 4XB8A 4E0RB 4LHJB 3ARVA 1FL5A 2X4SB 4NQEA 5D9SA 5HI5D 1RZFL 5FDYA 3SDDC 5KVGH 4YIQB 4LSVL 2P8LA 4OIAA 5JR1L 3VDCA 4JY5L 2C7UB 4J6RH 2XTJC 4YHNA 3REVA 3IFPB 2AW2A 1K85A 1FNEB 4N0UE 4QF1A 1E6JL 1BLNA 4U3XA 1H3TA 3P0YH 1UM6H 4XTRD 3EJJX 1GIGH 4X6BB 2BSSA 5ID1A 1K4DB 4MHHI 1H5BA 1T83A 3HZMB 5C8JB 1NAML 1NGYB 2OMBA 3IDMA 3TO2A 4JQIL 5D70H 1YPZE 4YH6A 4XNQB 4PY8I 1DQQB 4LCWE 4WFFE 3ZT5A 3P11H 4HWUA 2ED7A 4P2YA 5D1QA 1ES0A 2ADJA 1GXEA 2D7PA 1A02N 1F4WL 4UUJB 5CGTA 5D2LA 1A1OA 5DMKB 5BXFA 3RUGA 3D3VA 3RVTD 2VLME 3C09C 3H9YA 5GGTH 1INQA 4XAWH 2VQTA 4F58H 3B2UD 1A7QL 1GC1C 3OR7A 4Y4FA 3MCLL 5FA4A 2FCBA 2HYMA 4XZUA 5DMJB 1K4CB 2X4NB 3MACH 4HJGB 5D1ZD 1DDHB 4D0BB 3U7YL 1AD0A 2AJUH 4U1HA 1JGVL 1A7RL 2BK8A 3MRRB 1H15B 1YEFH 3NPZB 1U0QA 1VSCA 2IQ9H 2D7OA 5LKNA 3K2UL 1JGUH 4MQTB 4OGXH 3WEXA 3RI5K 3ZYIA 4G7VL 3G5ZA 3JV4A 3N85H 1YQ2A 4KPHL 5IJKC 3BH9B 2ICWI 4AMKH 5FGBC 1R3HA 2HN7A 1RUML 3F12B 4LPWA 4GRWE 2WV3A 1EJOL 1WLHA 1S7WA 3VG9C 2X9WA 5I66B 1NCAH 3MRGA 1YEGL 3HR5A 3QEQD 4YXKH 2P8MA 1F13A 4V2CB 4XNYL 4U31A 3UTSA 1K2DA 5IMOA 3RZCB 1ETZA 1MOEA 1FO0A 3SGJC 1U91A 2E8ZA 4LRIA 4C83B 1LD9A 1A1NA 4JFEB 4S1QL 1WIUA 4LKXA 4PJ5E 4R4BB 2JK5A 3SGKC 2VDPH 3WUZA 1MY7A 3PF2A 4D9RD 1MFEH 4K55A 5D1QD 1FDLH 3S3SA 5D6DA 1VEOA 3M17B 4EI6B 2C3WA 4FQ2H 1E28A 5I9QC 1KENL 4N0CD 2NY7H 4OZHF 5F44A 2OQJA 4E9LA 2X40A 1KN2H 3LQAC 5HGDB 1AE6H 2YXFA 3QIUB 3QB7C 4G9DA 1TJHL 4U1NA 4DGYL 1A8JH 1Q94B 3O11A 4HWBH 1MHEB 1W8NA 1ZT1A 4DOHB 3S97C 5T1MB 2AV1B 4G8GD 3H9HB 4DAGH 4HH9B 1HDMA 1UQSA 1JWMB 1WWBX 2Z8VC 4KKLD 2Q86A 2YC1B 2ZOKA 2NLJB 3VFMB 4AM0A 1A9BA 5DR5H 3HPJA 1BLNB 1XGPB 3DRTB 1P4LA 4HIXL 1QQDB 1OCWL 4OTXH 3K4DA 2R0LL 3RWCA 1FZKB 4MQXC 3OAUH 3EYFA 4GKOA 4U1KB 2D9QB 2ZUQB 2YHGA 2F8VA 1YPZF 4OI7A 1I8IA 2EC9U 3DWTA 1QR4A 4P5MA 2B4CC 1DUZA 1Q1JH 2CK0H 3W39B 1S7XB 5E6ZA 5GJTL 3S36L 1U8OB 4N5ED 4EI5D 3BO8B 1R3KB 4H88H 4PBXA 3MC0A 2KH2B 3IS1X 4R2GD 4ZAKB 5T33H 4D3CL 1VA9A 3PNWA 5FOBA 1GC1H 4KTYA 5MEPB 1T1YB 1J10A 4XNZC 1M05A 2EE3A 1N7ML 1U58A 1NMAH 2YUWA 2J8UF 1OWRM 1FZOB 3UJJH 5MERA 5GGRY 1QR1B 4ZSOE 3KYOA 4FG6D 3WXVL 4JDVA 1T4KB 4XAKE 1I8MA 5KG9B 4L9LC 1A4JB 5A3IC 1FO0H 3L3OB 3RU8L 1TZIB 4EN3C 3WO3B 1A6ZB 2WNGA 3MRJB 2W0KA 2AJ3A 3D0LB 4HV8B 3RGVC 1F2XK 2IALA 3ISWA 5KJRH 4K8RH 5C0AD 5DD0L 3OG4B 4WW2F 5C09B 4CKVX 1HHHA 3S34L 3J8F7 1LHZA 3EIFA 5A16B 4P2RA 5T3ZE 2F8OA 2P8MB 2RCSL 4S10A 5JA9A 4A2MA 1EV2E 2YD3A 1CT8B 2IJ0C 5L0QC 3Q6GL 4JO4H 2ITCB 3NCCB 3HNVH 3ULUL 1A1NB 1MRDH 5FV2A 4XPFH 2QJDA 4ZOBA 3TESA 3LD8C 3B6SB 5AAWA 1SVCP 4JY6B 3DX7B 3BEVB 2VR5A 1RZJC 4WEBL 5ISZE 1S9VA 3OF6A 2MWCA 4YHMH 1QRNA 2DAVA 4PJAA 5CEYA 2DM3A 4OGYL 5LGKA 4NOBA 3SY0A 5B8CA 3GI9H 2DICA 3ARFB 2VUYA 2VWEE 2YPVL 3QNXB 5E7FA 4GAJL 2BOCB 2DB8A 4X7TB 4N0FB 5F7DA 5A16A 4P57A 3ARTA 2YA1A 5F7MC 3FO1B 3MLZL 1G7JB 5I1CL 3TCLA 4S1QH 4C57C 3K0WA 2X4SA 4NQEB 4ZFGL 3GSXB 2JIXD 4PJCF 1MJUL 3HPJB 3G9VA 3ZHLA 5B8CC 5BRZB 3O2VH 1ORQA 4UIMB 2AK1L 2D4FA 4X6BA 4YC2C 3NCJL 3GSWA 1S9WB 3HC0A 1FPTL 3QWRA 4HZLA 1AR1D 2WW8A 4JQVC 3BRDA 1A1MA 3VFGL 4PRID 2DQCL 1ED3A 1TZGH 1I9JH 2PO6C 1UM4L 3CDYA 2P5EA 2FJHA 5ERWB 2NY0D 1VENA 3KYKH 4X7TA 2R0WH 5B38A 1P5VA 3BAEL 3JTSA 2Z8SA 5FEBA 5DD5H 3S5LG 5DD1H 5DLML 5HHVL 1BVLB 3NAAL 1INQB 4U0QB 3JWOC 4NKMB 5D5MA 5FGSA 1U2HA 5MERB 3BZ4A 5TQ0H 1OAUL 1NDMB 1Y18B 3W5MA 2E6JA 3V2AR 1OTTC 5I1GH 3DETC 1ADQH 4NC1E 1XGRB 2G5BB 1JPGA 3U4AA 2HLAA 4PRPE 3MRJA 1XCTA 2VDKH 5I1AB 1OGAB 4RMQA 1YEKH 1G84A 4E41A 5T1LA 1WBXB 2OR9H 3TYFA 4PRAB 1IM9B 1YQVH 4K3EH 4NNYB 3V9FA 1TENA 4ZNEA 4WI5A 3DETD 5AZEL 1H0DB 1SJVA 3ZE1E 5DGRA 1HQ4B 3QO0B 1TTFA 3O3BA 3C5ZD 3NFNB 4KVNH 5FDWB 2NW2B 2W1NA 4M1CD 1KXVC 3DVIA 3PHQA 2H3NA 1QFHA 3QUMH 1BIHA 1KF9B 4H5SB 4YE4H 3WUWB 5CZKA 4L8CA 2FR4A 3CU7A 3MGAA 1CE1H 1OAKH 1RZFH 5I8KL 3BQUB 2APXA 3OWEA 2DM4A 4CW1B 4XP9H 5IG7B 3TO4C 2FIKA 5EZIH 1DSFL 3RIFK 3FCTB 1KULA 2FWOB 5FHBL 2GITB 3HC4L 1NQBA 4KKAD 1QVOB 2ADJB 5I19H 2D7TL 2C4FT 2MOVA 3QDGB 4CBPA 4O4YL 3TNMB 3RX7A 1N6QL 1FSKB 4X99B 2XWBB 4ZUWB 3ZE0E 3P4MA 3F7PC 5IVZB 4OZGE 4H0IA 4HGMA 1ERNA 1UCBH 1A5FL 4YNYA 2OR8A 5DFWH 2OCFD 4XMLH 1MREL 1H8SA 2NTFB 3HE7B 3SDDA 5GGRA 1DQDL 1QSEB 4RFEA 4KV5F 4QLRA 3NPSC 4CADB 4LVEA 1ND0B 3BJ91 1FVCB 4F2MB 2FSEA 4R7DA 1RIHH 5EPMA 3DO7B 5KVEL 2IAMB 3D0VA 3HC4H 1OGAE 1WIPA 2XWTB 3U9PL 3VGFA 1W72L 1JNLH 4XVSL 3NABH 4NM4L 3LQAH 1FLTX 1SM3L 3VW3L 3RZCD 5T1LD 5HYSB 5I8KH 3SCMC 2E6PA 3MYJA 3O6FD 3JVGC 2HT2D 1T03L 2W0FB 4OIIH 5SV4A 1IL1B 4LLWB 3U2SA 5IMMA 1A6TA 3TO4B 3ZYJA 5D7IE 5D6CA 2EYRA 5C8JA 4LSQL 2W59A 4F33A 1A6VL 2Y36H 1NGZB 1WAAA 1HINL 3VWJA 3DX9A 4YLQT 4Y5YC 3TIEA 1MI5B 3GMMA 1IEAB 5L2JB 1CDBA 2HLAB 6FABL 2HJFA 3QDJA 4NRYA 1A7OL 3DO7A 4YO0A 2FJGB 2VLMD 2R2BB 1RSFA 4PGCB 3LS5L 4GBXC 3S4SB 1JZ8A 5I1GL 4FQQA 4M7JL 1NUGA 3KLAA 5DJAB 4YC2B 4JB9H 2YD5A 5E6YA 5TQ2L 2ZUWA 3MR9B 4OFVA 3RTQA 4ENED 4PRHE 3RVVC 1CFTA 1ZKAA 4ZDHA 3T77B 2GYSA 1JWMA 5EULV 2NXZD 4OCWL 4P3DB 5IQ9A 3T04D 4ZOAA 1SEQH 3VFVB 4RFOL 5E6IA 4Q0XL 1N0XL 4MQSB 1CXFA 2VZ1A 4OLWL 2IBZX 4UBDD 3BP7B 4LLWA 3KYKL 1MCQA 3KWWA 5JA8B 1IAII 3WEXB 2VL5A 4LGPB 4QXTB 1EJ6A 1NAMB 2A9NL 1X7QB 1X5LA 2X7LA 1LE9A 4LLMA 4KRPB 4PJEF 3TIEB 4ZTPH 43C9B 3JXAA 4UB0L 3KPOB 1DQJB 1FFQA 5D2NB 1MLCB 1TPXC 1DUZB 1MEXL 1ZHBA 3TVMC 2EEDA 3O2VL 5C0DA 1BOGB 3EGSA 4BH8A 2XT1B 1WQVT 5M7QA 2VKWA 1HIMH 4U1JA 1J0KA 1MJUH 1BZ7A 4F80A 3IJYB 1A5FH 4NUGH 5E8OB 2OBGA 4IRSC 3BSZH 1EMTL 1F42A 1FL5B 5F6IC 5D5MB 4P57B 1ZSDA 5CEXA 3I3BA 2XTLA 5I1CH 5GS0L 1IMHC 1FNFA 3IAQA 4P3DA 2EDQA 2VAJA 1X5KA 3D69A 4O2CA 1JNHA 3CMGA 5IB1B 2H32B 4OZIF 1RFDH 3QIBB 4AENB 2X41A 4G6AD 4LLQB 1I8MB 1QLFB 2XNAA 3LKNA 2E7LA 3SDAA 2AJZA 1P84K 3GO1L 1I85A 2PXYC 4JCMA 3VWKB 5DMGD 4ZG1A 3MA7A 2Q7NA 3MLPA 1BAFH 1XGYH 5F96L 2A77L 1GAFL 1PKQB 1AXSA 3F6IA 5MENA 4E42A 3KPRD 2HFFB 1FL3A 3SGEI 1A9EA 3F7VA 3RGVB 1ZHKA 4JHWL 5GGVY 3T08A 4BFEA 5HI4D 2ZSVA 4JREC 3QNZA 4BFBD 1HKLH 2R1YA 3OPZH 3VMNA 5C0CD 3QUML 4M7ZB 2NY6C 5I1LB 1KELH 1TCMA 4JHBA 3T09A 4R4FH 5DD6A 2FHCA 3EO1B 5TFSL 1ZSDB 3SEPA 3K74B 2J88L 4LMQI 5CMAB 5C09E 4RMUA 1FNSH 1H15A 4DFHA 3GMNA 5JNYA 3LN5B 4O5LL 1CBVH 4LFHG 1DBBL 1S7VB 3PV6B 3UBXB 3UZEA 3BPCB 4TRPL 1LNUB 1UXWA 1NC2A 1ZA6B 3HZYB 4YFLI 4HGKC 3H2WA 2XN9B 5GZND 3MLWL 3SPVB 1F4AA 1QTYT 5L8KB 5F71A 5BS0A 3SE8L 5TQ0L 4MJ2A 1N26A 1MPAH 1A6UL 1LO3L 3T65B 1T1YA 2Z35A 3OG6B 4WW1B 4JM2F 4TPRH 3CVIL 3FO1A 3QO0A 4EQ2A 5T1DL 3C6LD 4Y1AB 4TUKL 5C6TH 4G3YH 3BOVA 5DMIH 2X4RA 4Z76B 4D3CH 5T33L 3S3JA 3L3DA 3U36B 1OAYL 1DBMH 2HMIC 5GRYA 3L95B 4P2QD 3A6BL 2CMRH 3QZWA 5HYEA 5EOQH 1HEZB 1YNLH 3EUUA 1PQZA 4XT1C 1U9KA 4NWTL 1CI5A 4NFDA 4KVCH 2BXZA 1XF4A 2Z9TA 1NEUA 1GGCH 3STZA 4AJ0A 4ZFFB 2XZAL 1MUJB 1BJMA 2D7NA 3GSUA 3BYTA 3QG6B 1PY9A 2CJUL 3W5NA 3BKML 2W9DH 5EU5A 2V7HA 1L7IH 3V7MA 4M6OH 3IDNA 1RUQH 3DARA 4IIQC 4XWOC 5M95B 3EFFB 1HQRA 4I4WA 4P4KD 1I3RB 2HKHL 5HDQH 5HY9A 4YPJA 3RIFF 4JY6A 4NM8H 1BQSA 1JGEB 4GAJH 4AT6B 4HXAL 4XHJD 5DJXB 4ZPVB 3RVXD 3S3PA 4HWBL 3O8XD 5INDA 1ZTXH 1C12A 1NGWB 3B2UC 4XVJH 3ARDB 3ZDYE 4RDQG 4ZODA 5DJ6B 1DVFC 5GGQH 1T1WB 3ARFA 1D3CA 5D1ZC 1KCLA 4RGMC 3BKYL 1X4XA 3P3YA 1UENA 3E6HA 4P23B 4Z5RB 1RPQA 4RZCA 1JFQL 3OB0H 2HT4C 1WEJL 6CGTA 4JG0H 3ULUH 4PV8B 1K2DB 4BQ8A 4FQXC 2Y07H 3ME0A 5E5UB 3Q6GH 3QEUA 3OKEB 1ITBB 5JHDA 4G8GB 4HKZA 4I3GA 3MNVB 3MLXL 5HD8D 5TF0A 3C60D 3O41B 1PSKH 2VDRL 5D1ZA 3WJJC 3GGWA 1Q9OB 3UTOA 4F9PA 1J8HA 2MCPH 2I9TA 1S7RA 2ED8A 5C08E 1JZ7A 3DTXB 3LIZL 4GOSA 3ZKQD 5DZOA 3GMOA 4LVNB 4RQQA 1WZ1L 1GGYA 3SJVA 2J4WL 3NIFF 4MAYC 4XX1E 4KPHH 2QTEA 4M03A 3S5LA 5T3ZD 3IJSB 1N6VA 3MJ9H 4N8VG 4LSSL 2GITA 1Q94A 2OTPA 4I2XA 3IAPA 5L2KD 4O2EA 4NN6B 4PJDB 2HKFH 4BFIA 1ACYH 2DWEB 3WIFB 3EJZC 5JHDD 1EVTC 4OF5A 5DJYB 4M93C 4NUJB 4OCLC 5T1DH 5ALBH 2ZCHH 2E8YA 2QKIB 2ZCHL 4JKMA 4PG2C 1A6UH 1MPAL 3IETA 2VLRE 2RAMA 1IQDA 5KW9H 4KV5E 4JPIA 2MHAA 1ACYL 2ZJSH 3PP4L 2AKRA 1IM3B 1R3LA 5JQ6H 4CADA 1ZVSB 4LSSH 1CGSH 1F4WH 1QBAA 1KGCE 3ARFD 5BOZG 1IBGL 5E1AB 1Q1JL 2CK0L 2DYPA 1Q9WB 3RVUD 4NQVB 5T1LB 3QUMB 4OD2B 4LLAA 5KSUA 5DRWA 2UWEF 3X12A 4CDGC 3A67H 1RU9L 1JPSL 3C09B 1L0QA 1T80A 4KJYB 2J88H 3MLXH 2C9AA 2QSQA 1YJDL 4OTXL 1ZGLP 1KSRA 3QQ3B 2CO6B 1OARH 2HVJB 4FQLH 4QHLA 2HJKA 3UJIL 1IEHA 4KRLB 4NQEE 3S8WA 1G7LA 5CJ8A 4ZS7H 4KXZI 1A3QA 5H37G 5EU6B 4UBDC 1JZ5A 1A22B 3OKOA 1LO4H 5FA4B 3KLSA 1A6AA 4OBRA 1PW3A 2EKSA 1WF5A 5EIVA 4I48B 3LPGA 5HHXL 5EIIB 3UXFA 5MEQA 2QQKH 3ARBC 4QRRD 2CLZA 5TDNA 5D8JL 5K9QI 5EBLB 4MVBD 4WW2B 5C0BA 1ZTXL 1A6WH 5C07A 1KN2L 4OD3H 3O6MH 1BJ1H 4JQXA 1GGIH 2C1PB 4HMDA 4M5YH 4F9LA 3V4VL 2X70B 4P46D 1ACZA 5C0BD 4M48H 3VH8A 3VD5A 1QLRB 1OP3K 2J8UA 1G7MA 3D9AH 3P9WB 1MFEL 1N2RB 3HAEB 4KXZH 3PG2A 1U8PA 4KY1L 3P30H 4OZGA 1BQHG 1T3FA 3UMTA 2O61A 4ZFOB 1JHKL 3LEYL 4LVHB 4MCZA 1H9VA 3QEUB 3DLQR 1CL7I 3OJMB 3TWCH 1CLZH 4KK9D 3N1FC 3IXTA 1ND0A 2H1PL 3CSPA 1INEH 4QRUA 3FRUB 4NCC2 1NCAL 3CDCA 4L4TD 5A43C 1EJOH 2EEBA 4PJ7F 3IKCB 5JHLH 2AJXH 5FK9A 4X6CE 4AMKL 1WBYA 5F7KC 2C3VA 2F54E 2YMXH 4PJXE 4HS6B 1NFDE 1DBML 5T1KA 4GXVH 1UYWH 3ZTNH 5DMKA 3IFOB 5C6TL 4WFHD 4BH8B 2R1WB 4JFFE 5ENWB 2VLJB 4GKNA 3UTSE 2AABH 2G60H 2PKDA 3FO0H 3A6CH 4P5TC 1BBJB 5EFIA 5DJZB 2O61B 1SYSA 3GK8L 3IGAB 2UY7A 3IYLW 4GLRI 3UX9B 2E27L 4PYGA 3OHXB 2ADIB 3WFEL 4GMSL 2R29H 4UMGA 1CICB 1YZZA 4TUOB 2Q76A 2NX5A 5E6IC 1M6OA 4NRXA 1NMCB 3F6LA 3OB0K 5FM8A 2F74A 2H2SC 2VYRE 2PW2B 4JM2A 5GJSL 1CBVL 4HKJB 3SBWA 3VFWA 1BWWA 1KEGH 1MCCA 4MA7H 1HEZA 1JPTH 3FT4B 2C3HA 4LVNC 4UQ3A 5D70L 3QEGL 2VAAA 5C08A 2UWEE 3QG7H 4P5TA 3TJEL 1NAMH 1DR9A 4UNVA 4N90E 2DRUA 4ODHH 5I8CB 4I1NB 5SX4H 4NQXB 2XFXB 3V52H 3TA3C 5D7JC 5AYUL 5JHDB 1EFXB 4PLNC 1E4KA 4UINH 3LRSB 1I9RL 4PJGB 1CIDA 3NACL 4QHMB 2VLKA 4JM2C 2VL5B 1UA6L 2KPNA 1FN4A 3DTXA 3CPLB 3EFFA 4JVWA 5CWSA 3O3DA 5KSBF 3NABL 1BAFL 3K80A 4G5ZL 4XPAH 2FECI 4LAQH 3MV9D 1U8MA 1E28B 4G8EB 3FRPA 2EDTA 1HOCB 3KPOA 2I24N 2Z92B 3G04A 5I1AA 2L0DA 1ROWA 4YHYB 1NFDB 2DTMH 5EWIL 1RIUL 4G80B 1KPVA 1LP9B 3SDYL 4JGUA 1MVUA 5JOPE 2BCKB 1EH9A 5E6ID 3H9SD 4PPTA 3U7AA 3LKRA 4IIQB 5HYIA 4MLSA 5D7IB 2OS7A 1VADA 4OZHB 1F11B 1X5JA 3QDME 1FG2B 3VXMA 2OL3H 2HFGL 4XPHH 5CUSL 2O93L 5F89A 3TIDB 3EW3B 3L3DB 3KDMA 3IF1A 2P7TA 5KN5A 4HD9A 3OKDA 2J6EA 5J6HB 3FN0L 1SY6A 2KDGA 2SEBB 5F6HJ 5I1JL 4UT6H 5CWSB 4MAUH 5EBWB 4MJ6B 1JRHH 1K3IA 4HWZA 4Y2OA 4Y7MA 2FWOA 4QRRE 4M1DH 4P23C 2F5BH 3T3PF 4PJXF 4OQTA 5D7LA 2ADFH 3G5VB 1U8LB 3IT8D 3X13B 4WHYG 3MRIB 2JCCF 4ODUB 2DLIA 1R5IB 4KK5C 1I9RH 3QHTC 5ITBH 1MVFA 3V0WH 4Q0XH 4LF3B 3GSUB 4P2QA 3DMMD 3Q48A 5EC2A 3KGRA 5DUMH 5D72L 4L5FH 3ZLQC 1NBZB 2UZIL 1MJJA 2ADGA 2XQYK 3IB4A 3MGTB 4X7DC 1BF8A 1OP5H 1JV5B 1S7TB 3QO1B 4R6UA 2XZCH 4K2UH 3RP1A 3G5YA 3LKQB 1YMHA 4OZHE 1OSPH 4LBEA 4J8RB 1JK8A 1F6AB 2BSED 3WFHA 1RURH 1TZIA 4OGZA 1NGYA 4MXWH 1UXWB 4K2UL 1ADQL 1Q9WA 4GMSH 4HUKB 1QLRA 1ZHNA 2LU3A 1X4YA 5IHLB 4M5ZL 4RGNB 2R2EA 1MIMH 5ICZB 1C7TA 5D72H 1IGCL 5D7KE 4WW1A 1NANI 3SDXB 3T3ME 2NY4B 4OZ4B 5DLMH 5HHVH 2N56A 1NANH 4JHZA 4HFWA 4HK0B 4JR9L 3R06A 4NO0A 5FIEA 3ZT7A 2Z91B 3H42H 2EXWD 3MV7D 3BDXA 2IBBA 1FZMA 1NDGB 4WHYH 1TMCB 4HKZB 1T6WA 3U7WH 1N6UA 2XKNA 4LAJH 4RGND 2BOBB 1JHTA 5EUOF 4PREA 5AG8A 3HE6A 2BNQA 4TNVK 5I1EL 4MAUL 1S7TA 5ESQA 5EC1B 2WWMC 3LEXA 2APWA 2R56L 3FN0H 2AGJL 2VQ1B 4Y16A 3M8OL 3EDEA 1RIHL 5IFHH 1OW0A 4LHQB 3H0TA 3VWKC 4S11A 2FNBA 2C26A 2H8PB 4RRPA 4D9QD 5IHZB 3MRCA 4U4BA 1WBXA 3WIFA 5C0EA 3VH8B 1OAXL 3P30L 4H1LG 3UC0H 4QHKI 4PV9B 2UYLB 1MCSA 3FFDA 4XBGA 2NW2A 1FNEA 3SDYH 4X83A 1KOAA 3D2UD 1OW0C 1P1ZB 2D7TH 2ICWA 4J1UB 3ROOA 1K5NA 3O6ML 3OZ9H 4Z95H 1NGXA 4HH8A 5FHBH 2EIEA 1I9IH 2ZG3A 5HJ3A 4UT6L 5F1OB 4PRHA 5FYKL 3ZT6A 1CGVA 1W0VB 5JZ7D 3EKCA 4FHBD 3GMLB 2RQ8A 4O58L 3AREA 2YA0A 3GMQB 2VLRB 3TBYA 1BVZA 5EO1B 1A1OB 2FGWL 1IGYB 5D93B 4QYOB 4X6DE 5E2UH 4F7MA 1F58L 2JJSC 4X5XB 3EO0A 3C60C 2OLDA 1J1OH 4G9FE 1TLKA 4FQLL 4GKZA 4JFPA 3IU4L 3LB6D 1HYRC 3HI1B 4PJ9D 1RIUH 1OLZA 3UTQA 5DS8A 5I18L 2DTML 1MRCL 1G7IA 1AO7E 1QEWA 4PJHF 2ESVE 3EOTL 3UYRH 3LS4L 2YPKA 4OCRL 4WTZA 5KS9F 5C0BB 2DM7A 4NBYB 4ZO8A 1XIWC 3SOBH 5JQ6L 1T7YA 3CFKA 2HRPH 3NACH 3MRPB 4ODSL 1LO5B 5DJYA 2FH6A 3KYAA 2X1XR 3LDBB 4NUJA 1UVQB 2IWGA 4WJ5B 4PJIE 4XNXH 5JZ7C 4QO1A 4P4KB 2GIYA 3GRWA 4Y5YA 1F11A 4R97B 4DCQB 2NY2D 3GIZL 3NAAH 4IM8A 5D7LE 5INCA 5DUBB 5DD5L 1ZLUK 1V3KA 5C0NC 3BAEH 3C8DA 3BXNA 2BJML 1U8QB 2WLZA 2H3NB 5GZOC 4R2GB 3NN8A 4MXQC 1DQLH 4IMLB 1AGCA 1XIWA 4WI7A 4I5BB 2SEBA 4Y16D 5IROC 4KZEL 5J89A 1G7IB 1FPTH 4OCNC 1G0XA 5D6DC 1V3MA 3QUMA 5KG9A 2OK0H 1RK0A 5EU6D 5KSUB 4OUUB 3B3IB 2C3VB 3BPCA 3MROB 2DOCA 3IDIA 3P0GB 3WFBH 2IPUG 3QQ4A 1QKZL 1IAKB 3ARBA 3ZKND 2XIDA 2BVTA 2YSSB 4XCYA 5TPWH 1E6OH 1VESA 1ZT7A 2EXYD 4S1RL 2X4OB 5SWQA 4JQXC 3A6CL 3FB7B 4KH2A 4GAFB 4ZFGH 2VSCA 4Z5RA 5BVPH 5IROA 5BRZD 4I0PD 4G8GE 4K23H 4Y5YB 3VA2C 1OVZA 1JFQH 2FHBA 3BPNB 4YDIL 1XAUA 2Q86B 3WS6A 4LQFH 4XCCH 4D0CA 3FQRA 4ONFH 3C6LC 3F65A 2I26N 7FABH 4BUGA 4OAWB 5BVJB 1CDUA 3I6LE 1FC1A 3RWFA 1FSKC 1K5NB 2EDNA 3CX5K 5JOFA 3EYFB 2AJXL 1AE6L 3DX7A 5HYJA 2BNQD 3FJTA 4F7EB 3KPSB 3O2DA 3ALXA 4Z7OF 4F8TA 3Q5TA 4FQ2L 3IVKA 4GUPB 3DVNA 1MCKA 4WEBH 3EJYC 1LDSA 3GMLA 3MROA 4MSWA 2D0FA 3GM0A 1CQYA 1X5FA 2HLFD 5D2NA 1CL7H 4U33A 1S9YB 2Z4QA 3ZL4H 4OSUL 5SWZE 1UADC 4ZS7L 1U6AL 5FA3A 5E2TL 1U6AH 3RQ3A 2DWEA 2IAMC 3DVGB 4AH2A 1PD6A 4D0DB 3D3VB 4AL8H 2CUIA 3QSKB 2RCSH 3IJYA 4CNIA 3TCLB 4PFEA 4U7MA 4E5XA 3ILPB 4PJBB 4GG6A 4K8RL 3VD7A 5EOQL 1D5XA 2F54A 1M7XA 2VH5L 3JUYA 4L9LA 2WM0A 3NGBB 1YN7A 3BIKB 4S1DD 2ZSWA 4OLXL 1CGYA 3FOLA 3VMPA 4NGHL 3S35L 5DTFA 3UTTA 4K23L 5B4MC 4P23D 4MAYB 1EX0A 2W0LA 2R2EB 1EZVX 2EYSB 4JLRB 1FYHB 4ZUTB 5C70A 5TF1H 1EGJA 4C56A 2C3XA 3TZVC 5IQ9B 1MIEH 1Z3GH 2YD4A 1CFNB 4KUCF 4JE4B 4G8GA 4Y8DC 4FN0A 1WAAE 4JZNB 1ULVA 3NCYS 5IVOA 4RISH 5GJTH 4FRWA 2OK0L 5HHOB 5EU3B 1NLDL 1KLGA 4OIBA 4D8PB 1WZ1H 3MCKB 2IF7A 4H25A 4QTHA 3D18B 3P11L 3FFCB 5F9AC 1VFOA 4RMRA 2HWZL 5ACLA 3GKWL 4FQXD 3HFMH 1ZGLM 5ESQB 5I15H 1CLYH 4LSDA 4WUUD 3VCLA 4Q2ZA 1JZ3A 2ZJSL 4LLDA 3E3QC 2BJMH 5IEHB 4JFFD 4QRQB 4GSDL 2V5RA 4PLJC 4R4FL 3WS3B 1NUFA 2VRAA 3T2NH 4JFPB 1LK2A 2X1QA 4K9EL 1HKLL 4HUWA 4PJEB 4UTBL 5EORH 3UTSD 1JYNA 5FDWA 4HEME 1ITCA 2EDOA 2ATPA 2NW3B 3BD3A 1REIA 3PWJB 1GSMA 2EIZB 1RVFH 2VDLL 3LS4H 4OCRH 4DUVA 1TJGH 3B4NA 1EUTA 4XP4L 4ZUUB 4L4JA 1T66D 3F7QA 1ORQB 2B39A 3FZUD 4WI8A 3LIZH 4XNMB 4HPYL 1ZOXA 4Z7QE 3MX0A 4FTVD 3QA3B 2H2PD 2JJVA 4FZEH 3CFKB 5KSAD 2Q20A 2HG5B 2E7HA 2VLKD 2IMMA 3VXQA 4LDLB 1OSZB 3BP5A 4JY4A 4QHNB 4I0PC 5I6XC 5GGSA 3VXRB 3OKNB 3GHEL 5E2TH 5E2UL 2KBGA 4KK8D 3EDKA 2XZAH 5I73C 1EEZB 2YRZA 3C08H 3BKYH 5EU7E 1QSZA 1KNOA 4GKZB 4J3XA 4KVCL 3GJFB 3ARQA 4RAVA 1DEEA 1UB5B 4PJEE 4P2CG 2APVA 3VXTA 4G8IA 2EH8L 4NQCB 1EIBA 4WW2A 3ROLA 3QIUD 3L5IA 3ZDXF 4ONFL 2E6QA 1JGUL 4NSKB 3RWDB 4LQFL 4XCCL 1VACB 2VXUL 2QQNL 4PRAA 2NMSA 3QUZB 4N9GA 2R39A 5CEZE 1C1EL 1NCCH 1L7IL 3W9EB 4QCIA 3MLTB 1QFUH 2M2DA 4D2NA 4JKKA 2Z0BA 1MCRA 1FH5H 3FFDB 5IEKB 2DQFA 2EDBA 4YDJA 5F3BB 1CU4L 2ICEB 5J6GB 1MQKL 4K3HA 4KK9C 2XICA 3L95A 1ZWIA 1A7OH 1AHWA 1DBBH 4OKVA 4ELME 2EDRA 3TT3L 5HHQA 3CUPA 2WBJD 4YDKL 3TN0A 1AI1H 2H9GA 4GAGL 3V6BR 4K71B 2ARWA 2ORBH 5DMIL 1N64H 4JR9H 3AMLA 4U6TA 5TFSH 3R1GL 4UI2A 5GGUB 3T3MF 5EO1A 3WLBA 1I9EA 1E6JH 1Y0LB 2IH3B 1HYSD 3HZKA 4P3CH 3V0WL 3SE8H 4N0FA 2NY5C 4EJ1C 5LGJB 2HRPL 4QCIB 4M5ZH 5F88B 5C2BL 3MOBH 1W0WA 2GTWB 4I18B 3MLWH 4PY8J 3VD4A 3QDMA 3O45A 5EO9A 1GGUA 3L3GA 4PJBA 2NY4C 4EIGB 1EO8H 2DQFB 4LGSB 5JPMB 1JGEA 1AGDA 4AT6A 2FDBP 4O5LH 2CDGA 4LRNH 3TGXA 2F74B 1EVUA 5F7YC 2DN7A 4FNLH 5IP4A 3ARYA 2IPUK 5D5ME 4PP1C 1BP3B 4RAHA 1CFVH 5GISL 4EXKA 1Z0MA 2OL3L 4AY0A 5ADPL 5I9QB 1DQJA 5SWZD 3RNQB 1C5DA 5GS0H 5C0EB 1IC1A 2WWKT 5C92A 1MHCA 1BIIB 1ADQA 3K4AA 4LSTL 1HH9A 4LSPL 5I17B 3AY4C 3DHMA 1ZT1B 2B2XH 2DQJH 2IFFH 4HX1B 1EFXD 1U8QA 3VGHA 4GQ9L 2IBZY 4PBWD 2V2WA 4Z7UA 1QNZH 4JKPL 1JRHL 4LPTA 2YUZA 4TSCL 1XGYL 5F96H 3FAWA 5JTWA 5GZOD 3IDJA 1DDHA 4D0BA 1M7IB 3NFSH 3RPKA 3NFSL 4QRSA 2OTUA 4ONHA 3IXAA 1H5BC 1T83C 5FO8B 1G6RB 3O3EB 5I73B 1QNZL 4M4RA 4AEFA 3CIQA 4LBEB 3ARPA 1F4XH 1S5HB 3LY6A 5I76B 2A6KA 2CRYA 4FXGA 4LVOC 4PJCB 4XPHL 5CUSH 3UPCA 1A3RH 1CDCA 4R3SB 5JLZA 3AROA 3CXHK 1SEQL 4N0UB 3V52L 1NJ9B 5GRWA 5J0BA 5EUKB 3MUZ1 1CXLA 4WFGE 5CIPH 1HSAA 1JBJA 3FQUB 4NYLB 1H0DA 4OZIB 3BO8A 2JCCA 4KK8C 5ACZA 5L2KA 2A83B 5FO7A 5IFHL 4D0CB 1NCUA 3TZVB 3L1OL 3MRLB 3T0DA 5J6GA 5I1DB 5LGHH 2WSKA 2NPLX 1I8LA 4LCCB 2DQEH 3QCUH 1QFWI 3SCMA 4GRWH 1KYOJ 4JKWA 1CF8H 1AGFA 3RWEA 1UWXH 3FRUA 5CMAA 4XAKD 1J12A 5ITFB 5I2IB 4K7PX 2ZNWA 1R3IL 3MCKA 1DQML 3W9DA 3WFEH 1MCOL 4WFEE 4NQCD 3RY5A 1T5WB 3H42L 3DSFH 1MCBA 4HKBB 3NGBC 1ZHBB 2EDYA 2NXYC 2VABA 9CGTA 3RX8A 4P3CL 4WJ5A 5E00B 4BSVA 4DZ8A 3MV7E 3TBTB 4LLDB 3F5WA 3O3AB 2FJFB 1YC7A 4MNGA 4OF6A 4ODHL 4FS0A 2WWKO 1FLRH 2ERJC 5F3HB 3BZFB 2QADC 3U0PA 1J0IA 3WHXA 5SX5K 2ORBL 3SHSA 3V8OA 5EUKA 1UJ3C 4OCMC 5EG6C 4GXVL 4ZTOL 1UM4H 2CKNA 1MCOH 3SGJA 1DQMH 4GBXA 4Y5XB 5HHPA 1KEGL 1SM3H 3KJ4C 1RZGB 3MJ7A 2X4QB 3D39B 3B5GA 3LAFA 1G6RL 4KMTH 1MQKH 3M45A 3WFHB 4P3WA 1IJ9A 2DQIL 3C8KB 3SO3B 3QXAA 1F4YL 2YXMA 4DWHA 4FABL 5C0FA 1XCTB 3DXAA 1T7ZA 3P9LA 1T7VA 4UDUA 4KROB 3T0EE 2G60L 3V0VB 3GMQA 5E8PB 2JE8A 4KY1H 4TUJA 5ITBL 3INUH 4JAMB 2HVKB 4YK4C 4J3WA 4UU9B 2YEZB 4ZFOA 3HUJE 4PJHB 4X7FC 4QRTB 1RZ8B 1PZ5B 4H5SA 3WUWA 4L8CB 4PGDB 4WEMB 4MA3B 5HHPB 2PW1B 3FHAA 1RZGA 3DX6A 3MSPA 3QPQC 5HYJB 1FZJA 4CVZB 5SWSD 4MJ5A 1PKQE 1NCDH 2ZUSA 4S1DC 1CK0H 3HN3A 4MX7A 1WT5C 3GSVA 3M07A 1IEAA 1CLZL 3C8KA 4KJPC 5DHVB 3NH7H 1CE1L 1OAKL 1IGJA 1S9YA 2Z4QB 3OKMB 5FYJH 3RKDC 5AUMA 1GVIA 4XMLL 1ZE3C 5IEHA 3VD3A 3JV0A 3FQNA 3P77A 5LGJA 4JO4L 3SDAC 2QHRH 4FQQB 5JXAH 3QFJB 2R1WA 4KK6D 5E8PA 5GISH 1D6VH 2W9EH 1P9MC 3KPRB 1N6QH 4NPYB 1HH6A 3A67L 4HLZG 1GGIL 2VLKE 4HUUA 4OM0L 2VERN 3VXOB 2VZTA 3MRLA 2OR9L 4OD3L 5GRVK 1IGIL 4DK6A 2AXFA 5D8JH 5GRXG 2D0HA 3C6LB 4Y1AD 4FTVE 4G5ZH 4B7IA 4MD4A 5EN2A 3CSYB 1G7HB 3QIWA 5HJ3B 1JI1A 3BPNC 4OBSA 4EN3A 3MV9E 1T7WA 3D0VB 1AY1L 3GMRB 2N7BA 3FN3A 4PIRF 4Y4HB 5C0RH 4MX7B 3NOIA 3QUYB 1J0YA 1VPOH 5HHOD 2H32H 2V6HA 1F45A 5FKPB 5AEAA 5D1QB 3X3FL 1IAKA 3ARBB 5HYSA 2GJZB 1WC7A 2A0LC 5C0CA 4ZSOB 5ELIA 5EOTB 3SQOH 1IM9A 3BW9B 4U7SA 5AD0A 4FQJH 4U1LA 3S98A 1TZGL 1CLYL 3CFDB 4GG6E 4MA7L 3CGTA 3MJ9L 4OFYD 3GSXA 1HH6B 4PJ7E 3BD5A 4UDTB 5IMLB 3V6OC 4XXCA 3FFCA 3HG1B 4FXKB 2VR9A 5D93C 4PRDA 3OJDA 4WHTB 3TP4A 3PP4H 1MIEL 3RPIA 3BEWA 4KGJA 4NQDB 3GK8H 4G6ML 3L5XH 2EIBA 1NFDA 1T22A 2PYFA 3LDBC 5GHWH 3ARFC 4N9GB 5DJCB 1WK0A 4PRNA 2Y07L 4CVXB 5E95B 1KCSL 4MWFA 2A74B 1R3HB 2HN7B 1E4WL 5EUOA 3WN5C 1MQ8A 5DD1L 1J87A 1R3JA 3NA9H 5F21B 1Y6KR 1X44A 3KPRE 1WCBA 2OJZL 3DMMB 1JF1A 2EDWA 4OLXH 1KN4H 4ETQB 2NY5H 4Y16C 3V4PL 1D5ZA 4CMMB 1HH9B 4FQXA 3HRZA 1P6AB 4JZOA 2YBRA 4MNGE 4S0TD 4M6NL 4RWHA 4L8SC 4Z7NE 3BX7C 4PJ9A 5HVFB 5I1KH 3UZQA 3P2TA 2A1WL 3MJ9A 4OF7A 1UC6A 3B9DA 1QFPA 1XFPA 4NQUA 2DLTA 2BSSB 1A6AB 2W07A 1ZWIB 1QYGL 1EUUA 5E5MB 1KENH 3WN5A 5DJDB 1D5MA 2YPLB 4F7CB 1CS6A 4GJTB 1B3JA 2H41A 4AL8L 4C56D 3GJEA 3ARED 2F53A 4XPFL 1VFAB 1RUQL 5IQ7L 5E5RB 4O2FA 4I0CC 3V6OE 3OKKA 1E27A 2APBA 2JJUA 3Q3GA 3KPSD 3VA6A 4PJ9C 2OJEB 5F7WC 2OL3B 4LF3A 1RULL 4WO4C 8FABB 1GGCL 2R69H 4QTIL 4YJZL 1DVFA 1XEDA 3VD9A 4FZEL 3ES6A 2XACC 4ZUTA 1HDMB 4RIRA 4C56B 4H8WL 4LCYA 2JJTA 3GI9L 4FQXB 3VDAA 3LSOB 2W0FA 3W0WA 5K9OA 1R3LB 1KIRB 2AEPH 1IL1A 5I1KL 4NDMA 3QDJD 2HT3D 2OTWA 4JFFB 2AJZB 2Z8WC 3AFLA 3HG1D 1OAYH 2CKBA 4LL9A 4MQ7B 1GZPB 1LO4L 4Y19B 4YDIH 5A2KH 2DD8L 3TBWA 1AHWC 1IKFH 4Y2DC 1P4BH 4YDLB 2ARJA 4M6OL 2AJUL 5BVPL 3L3IA 2VDNH 4XHJC 4M62H 4UU9A 5CJXC 2AXGB 3IDGA 3WSQL 1LO3H 5C0CB 1P4IL 1A7QH 4R7NA 1E6OL 4PGCA 1X6LA 3MBEC 1PLGL 1T04B 3DBXB 5JW3L 1NCTA 1KEML 5D1XC 2F15A 5IMOB 5J56B 4H88L 3RZCA 5I15L 3KS0J 4L4VE 3KR3H 4R4NC 3EO9L 3LH2H 4PJIA 1YNLL 4YNYB 3LH2L 4EVNB 3ULVC 3ZDYF 1YEHH 4NO0D 4NN7B 4KZEH 1F97A 3C2AL 1CFSA 3BQUD 3K4ZA 3IDUA 1BWMA 1NBQA 1B0GB 4PLKC 1HHGB 2XYCA 2WP3T 5DJXA 3GIVB 1R5WB 4U3CA 4UAOB 5DXWA 2XQBL 3GIZH 4PY7A 5DTFB 2DF3A 3VFUA 1Q0YL 3HNSL 2HTKD 2VLRD 2WLYA 4PRBA 3QFJA 2LV4A 5BZWB 1IKFL 1CDHA 4ODSH 4U6XA 4WWID 1J1XL 1UZ6F 2LVEA 3ARBD 3EBAA 4Z18A 3VRLF 2HKFL 2GTWA 5DHYA 4ZQKB 4WNQB 4OT1H 3SOBL 4PJFA 1TVHB 2HVKA 3RAJL 5I8EA 4IMKC 4XI5C 2XV6B 1DVFD 5E8EA 4TRPH 4PJ9B 5T3XD 3T8XB 4YHLL 4NO3B 2CXKA 4QRUB 3KAAA 1U3ZA 2P24A 4XMKH 1OAZH 3R0MA 3U79A 1L6XA 4Y4HA 2XY2A 1MI5A 3GMMB 1OCWH 4DUWA 5KSVB 5FV1L 4OZIE 3FN9A 1RK0B 4Y2DB 4OUUA 3KLHC 2D31B 2B5IC 1FBIL 2VABB 1KT2A 4IMKA 3LPWA 5J11C 1VFUA 3Q3GB 4NO5B 5SWSE 3HI6H 4WU5B 4PRBB 1QFWL 4HUXB 4H26A 2FO4A 3TH3T 3PNWB 2BCKA 1O5DT 4X5WA 4BH7B 1NCDL 1UKSA 4IDJL 5KVDL 5ETUB 1BD2D 1UKQA 2BNRB 3TA3B 3GO1H 5FO8A 5SX5H 4HBQA 2GCYA 3O3EA 4WO4B 1T4KA 2PNDA 4XNMA 1FFPA 4M7KH 2LTQC 1KN4L 2IAMA 1PZUB 2F53D 3T0ED 1FDLL 4HKJA 1OL0A 2R0KH 4ONOA 1JGVH 1E4WH 1HXMA 4ESKA 2W9DL 1KCSH 1XT5A 4HZLB 4NUGL 1J1PH 3W0WE 1FVEB 1MSPA 3GKZA 4S1RH 2RFXA 4YHYC 3HZYA 3BN3B 1CICC 3RA7L 4PG9A 4ZNCD 5JO5B 1YEGH 4FQHB 1Z9MA 1MCWW 5C3LD 3JSSA 1U8IA 5CHNB 5DK0A 5SWSB 1IAIM 4L8SB 4KMTL 1RJCA 4MMXC 2QLVB 3QISA 1HHJB 1S3KH 1JUFA 2OX5A 4CNIB 2L4OA 3CLFH 3DX6B 1FV1B 1I1FB 2A9NH 3OB8A 1NDMA 3QQNA 3WNOA 4B5EA 5JPMA 3E2HB 1G6VK 3HPLA 4FFWC 1J0HA 1P7QD 3TNNB 3QDJB 1FFPB 1RK1B 5DUPL 3AGVA 1Q9KA 4P2QE 3QQ9D 4P9HC 4OLWH 1A7RH 3SE3C 1MF2L 1DANU 3OKMA 4CVUA 3NIGF 5HYFA 1U3JA 4ODXA 4O2EB 2OL3A 4XNXL 3ZE2E 3RKDD 1VPOL 2HFFA 3FFCD 1MIML 2Y23A 2CIKB 4PD4J 1PYWA 5HYJE 1YECL 1R5VA 4NHCL 3RDTB 3PWPB 3D85A 3BRFA 5CJBA 1BBDH 3LS5H 4ZO9A 5E6IB 3GI8H 1YNKL 5E8EB 3QPQD 4LIQL 4PRIE 1Z9OA 3U9PH 2BVQB 3QCUL 5D2NE 3X17A 1MCFA 2Q87A 3HNTL 2MTPA 3TV3L 5EN2B 1GZQB 1HINH 4HCRA 4Z8FH 3OF6D 4CUCA 4PRPA 3EHBD 2W9EL 4F3FB 3VFOA 4F7EA 5HSFA 4MJID 5T1KD 4AIOA 1KB9K 1KELL 4QRPE 4KUZL 4IBLT 3GNML 3UYPA 3VRJA 3RGVD 2YD7A 4GRLA 5IBUG 2FL5A 4M1DL 1CK0L 5AD0B 2A9MH 2A77H 2V2XB 1UWGH 4P5KA 2ZG1A 3V5DA 4X9BA 3QRGH 4BKLB 5F1IB 3UTTE 1JV5A 3QO1A 1FZJB 4J3OC 3OZ9L 1PVHA 4Z95L 4CVZA 1VFBA 3RFZC 5KVEH 3HE7A 5T3XH 2AK4B 4QRPD 2IFFL 3SDAB 1AC6A 4W4OA 1BVKB 4HHAB 2CGRL 4LSPH 1T20A 4WUUB 3UC0L 3RJDA 4XX1G 4YE4L 1TQBC 4AG4L 1I8IB 2LU4A 3IKKA 4KRNA 4P5MB 3TBWB 2VTFA 1H8NA 4PP2A 1QRKA 3MRNA 4NQTA 5C08B 5J8OA 4PJ7B 5JIIA 1I4FB 3H9SE 4QRPB 3CNKA 4WW2C 4FNLL 1FFOB 1URLA 1F4YH 3HC3H 3HE7C 5AZEH 4GBXD 2D2OA 1MEXH 3D39E 3H6JA 4G6FD 2WZPD 5I19L 1IAMA 1MCIA 2GK2A 3IDNB 1SY6H 1EO8L 2DBLH 4ODWB 2C4XA 3L7FA 1QR1A 1FORL 2EDHA 4PJIB 4AK1A 15C8H 43CAB 3PL6D 5DHXB 3CPLA 5CINH 4X4YB 2AK4A 5IR1A 3ECBB 2BY3A 1TNMA 4NQCA 3DXAD 4RFOH 5FYLD 4Q6IB 1RY7B 2A38A 1XMWA 4G9DB 3FQXB 4DTGL 4L8BB 2OZ4A 1ZLVH 1KPVB 3RX5A 4PJHE 4GAYB 1VEMA 2VMFA 3SDCC 1C5BH 1JPTL 1NBYA 4W70A 4U6XB 1JVKA 4U1MA 1EHAA 3TN0C 5GJSH 2FJHB 3WKNA 4LDOB 4IIQA 1X5XA 3DHJA 4WU7A 2YZ8A 5IHBA 2E9WA 2VXVL 6FABH 4K94H 1QUNA 4RMSA 4Y19D 3NIDF 2BVOB 5HPMA 2G2RA 4U1GC 2ERJB 1FG9C 2A6DB 1A6VH 3MREA 3MGOB 4PRPB 4PJXA 3G6AB 1J8HB 3OKDB 3B8YA 3HUJF 4L5FL 4L3ED 4M93B 5KVFL 3UTPD 3MMEA 1XR9B 1J1PL 4BJLA 5E4EB 4I3RL 5DHVA 2RFXB 1T03H 4NN6C 2HFEA 4JDZB 3QFJE 1RMFL 4Q97A 3OV6A 5BV7H 2R23B 1N59A 3AAZA 3KG5A 1RUKL 1CCZA 2DQCH 4M7KL 4W6XB 3RVWD 1T04A 2DLFH 3DBXA 3CFJB 4CMHB 1J8HD 5CILH 5FYKE 1JTOA 1RJYB 2YPVH 5DEGB 1EFXA 5GRVL 5H37H 4JM2D 3C60A 3V5KB 2QKIA 4MVBC 1DP0A 2FD6H 2EXWC 1X9QA 2GSGA 3ULVE 2D4DA 3C9NB 5KVDH 3V7AG 4NZTL 3NCJH 3ZKXB 4YFLF 2YKLL 3WJJA 5DJ0A 1OGAD 5ETUA 4M61A 1INEL 4DFIA 4YHML 4ZPVA 2JJTC 2FR4B 4MAYD 3V6ZA 3KPPA 3BGFB 4KWUA 1IKNC 4Z78A 4LHUG 2FX7L 1TTUA 3HC0B 5EU4B 3CFCL 2MMXA 3WLWD 5HD8C 3V6FB 3ULVD 3ORJA 3VXUB 1WBZA 3ZKNC 5DEFB 2RJMA 1C5DB 1DVFB 1FVDB 3NCBB 5T3XE 4BSJA 2ITDB 4KAQH 3RWJA 4Q74A 3G6JA 3MRFA 4TTDC 2XWBA 3OKEA 3HS0B 3NCYP 4X6DA 2YA2A 4XTRC 5ENWA 2ATKB