2ITFA

Crystal structure isda neat domain from staphylococcus aureus with heme bound
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
ATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Haem recognition by a Staphylococcus aureus NEAT domain.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Metal binding protein
molecule keywords Iron-regulated surface determinant protein A
total genus 25
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2itfA00
2Q7AA 3RURA 3QUHA 3QZMA 5D1QE 2ITEA 3SZ6A 3S48A 3OVUB 3VTMA 3QZNA 4H8QA 2K78A 3RTLA 2O6PA 2E7DA 5D1XE 3VUAA 2O1AA 3QUGA 3QZPA 4NLAA 3QZOA 2Z6FA 4YMPA 3SIKA 3QZLA 3SZKC 4WJG3 4H8PA 5D1ZI 2ITFA 2H3KA 2MOQA 4MYPA 4FC3E
chains in the Genus database with same CATH superfamily
1DQQA 4WZ9A 5C70A 1KCBA 4QMEA 3S3JA 3SBPA 5ID1B 2EO1A 4N0CC 2KERA 1IKOP 1HIML 1PYWA 2BHZA 1LO4L 2Q9OA 2KL6A 1KJ3H 3CFEA 2HT2C 3VTTA 5GS1B 3CZLA 1N64H 4CW1B 1T1YB 1ZSHA 3OF6D 3PJSB 1N5YL 1AGCB 1OAKL 1RPQA 4NUQA 2WQUA 1N0XH 3VXOB 1YEKH 3VXTB 4A37A 1G5AA 3DURB 3ABMB 3VW3H 1FNEB 1CE6A 1PF3A 4XHQA 5CEXA 4MZ3A 2Z35B 5ID0A 1JYXA 1GW0A 1VA9A 2DJUA 3L6FA 3ROLB 4AVHA 2YRPA 5JIPA 2VLLB 3LXUX 2WVUA 4FXKC 3RNQA 4JFOA 2GW5A 5LGYA 2BH0A 5C6WH 2FO4A 2BMKA 2PCPA 4G70B 3L9RA 1LEGB 1J87A 3MC0A 3WTTA 1Q9LA 1FGNL 4CN4A 4GRMA 4DEWA 1QQDB 3TH2T 2EZ0C 5AW2B 4AT6A 1LNUB 4FQ2H 4Z76B 3WIHH 3VFTA 1FBIL 1IGIL 1Z32X 5I74C 2ZOLB 4A55A 3V52H 5C3LD 1A7OL 5EUKA 3ZPDA 4YBHA 4HBCL 2L04A 3L3JB 1PQZA 3DO7B 3ZTJG 2CLVA 1T7WA 2OYLA 2GIYA 1MFEL 3SE3C 4UTBA 3UZVA 1QVOA 4FQJH 3VGHA 4L2LA 1FL6A 1YN7B 3VGDA 2QMKA 4P57B 1W91A 5AOLA 1PIFA 3MR9B 1C1EL 3DX8A 2HPTA 2PR9A 4G6FD 2UX7A 3OWEA 4BSVA 4JVUA 3NJVA 5IBTL 4LLUB 3KJ6L 5DHVH 4J6RL 4LSSL 1BOGA 4BUGA 5EBGA 1T83A 2XBTA 5FV2A 2I9LB 5CEYB 1AGBA 5DD0L 3WTUA 4LCCC 1ZJBA 4CSZA 1J5HA 2D0HA 2FB4H 3D39A 4HUVB 1E4XL 5A2JH 2ZXQA 2EC8A 3IXTA 5T1LD 3QIUC 1AD9A 1ZHBB 5D2NB 2EINB 3RVUC 2FBJL 3H42H 2GIMA 2DYPB 4JHAH 4K3EL 2CJTA 1HDMA 1VACB 5IG7B 4GKSB 1B4LA 3VRJB 3F8UB 4OAWB 1MHPL 1KCRH 3Q9PA 2XQYK 1ODAA 4MZIA 1D6VH 1OCWH 5EC1A 2WY3B 2AK1L 3S5LG 6FABL 2FX9H 3QXVA 4PY7A 3GBMH 2OX5B 3ZKSD 2E9IA 4EDWL 5FYJE 4P4RB 5KYYA 4RWYL 1HCVA 3NCJL 3MO1B 3S0PA 4HXBL 3G6DL 5D7JD 2E5EA 4HXBH 5BQ7A 1DZ0A 3NCJH 1VEMA 3CFUA 5D2LF 2Q7YA 3V6BR 2MPVA 4XBGB 5EU3A 4MQXC 2PO6A 4EDWH 2X3CA 3QPQD 4YL9A 1FIEA 1BVOA 4XPGH 3ZVVA 1AGFA 1OCWL 4MNGB 3V8OA 3VRIB 5F3HB 1KCRL 3JQOB 2X6CA 3C5SB 3T1FA 3SIKA 3ARUA 4AKOA 3D18B 4HBQA 3CDGA 4WTZG 2IQAA 1R3HB 3U46B 1WPCA 2O30A 3J7HA 3QUXB 3P4NB 2EIEA 3SDXE 4KVPA 4TULL 3SPVA 3FQRA 4GG6B 4KKRA 1A3LH 1PBYA 1S7VA 3AT0A 4KKBC 1Z3GL 1N12A 1YPZB 2QADB 5GZNA 3V0AC 1I7RB 3UCQA 4JM0A 5IIEA 3NJFA 1JD9A 1JPGA 3GGWB 4BSJA 2XPGA 1NLBH 3QFJB 1OTSC 1HQ4A 1RIUH 1WBZA 3BEWB 3SKNB 5C0AE 2K1MA 4FADA 5IBTH 3QRGL 1JN6A 1C1EH 2L7EA 2P26A 1FC2D 1FZJB 3S98A 5C0BD 2OR7A 3ASWA 4BZ1A 4KHTH 3DJTA 3OAUL 3R0MA 3TYGH 4PGDA 1JI1A 1AI1H 2IGFL 2JKSA 2WVVA 4ISVB 4MKTA 1JWUB 3LRKA 3ZSSA 1QYGH 1D9KA 4G8EB 4M6OL 2H0JA 4JFDE 5I5IA 2BNUA 2FO4B 4ZO6A 4HJTA 3L3IB 1RU9L 2C26A 2D73A 1BFOB 3IXAA 3T4YA 2VLKA 2PWEA 5DMIH 2H32A 5IFJB 4V11A 1RLBA 1FBIH 2FZ3B 3E80A 2BSTB 4FQ2L 1LNUA 5LDUA 4U1SA 3BHBA 2YQGA 3ECBB 3ILPA 5J3HC 5KOMC 2NUPA 1CDGA 3JWOL 5I1KH 1KCSH 1IAOA 4JFVA 4N0YL 5I1AA 1OW0A 2X1WL 4G6MH 3SGDI 4JDEB 1AXTH 2NNXA 1FO0B 3EIFA 4URTB 5F44A 2W38A 2IAMA 1KB9J 2UZPA 4ENED 3Q8CA 3BQUB 3CFJA 5E1AB 4GBXA 5HGAB 2GBVA 4XE5B 4KNUA 3VW3L 1AR1D 1AMYA 2J88L 3MR9A 3WHE0 1HCFX 2OMWB 4I87A 1MPAL 2R29A 3N0PB 3CBRA 1DVXA 1IZJA 1CYWA 1E65A 1RJLA 3LNHA 4EZLA 1KENL 5BZDA 1YQVL 1TTBA 1KJ3L 1F11A 1AO7E 1LO4H 4ATTA 1AMXA 2P8MA 3MREB 4JY5L 4PCSA 4GMTL 5FO7A 1FFRA 3EYSH 5GS2H 2ITEA 3D39B 4MVBD 3EH4B 1DN2A 5AFAA 1O9ZA 4U1MA 1P6FA 2C9VA 2R2BA 1WV7T 2LFGA 3IAPA 3H53A 3CH1A 3Q5OA 2O5XH 1CGTA 2QSTA 2OXHA 2RCSL 4X6CE 3WFDL 3LPGA 1WIPA 3RZCA 1N9PA 1OALA 3PP4H 4J39A 3HZVB 3L2LA 5L0QC 1YPZF 4Z7NE 5C7ZA 3DRQB 1XR9A 2VISB 2DLFL 1SJHB 4IOFD 1F1GA 4NPYB 4FNPA 1JYVA 4ZUWB 4F57L 2XI9A 3AUVA 4GQZA 1XGTA 5I6NA 3RDTD 4AMKL 2OR9L 4K3HA 5B8CA 4R90H 5EPMA 5MEOB 4OZGE 5E03A 1FL3A 4N0CD 4Y2DC 4UT9L 2W94A 4GQ9L 4TVPH 5GGUB 5D7EA 3LH9A 1I1AC 2QQQA 2YPVL 3Q6FB 2QR0B 5JYLA 5I73B 4ZFZA 3LEVH 4K8RL 1FSKB 4M03A 5J7CC 1NCOA 2X12A 4YHOL 1UOLA 4G9DB 5GQBA 3TEXA 4ZYKB 2YPLE 5I6PA 1LO3L 1T22A 4JW3A 3KR3H 4WW1B 3K2UH 1WT5C 1SBBA 2FX7L 4UQ9A 1YNLL 1W72H 5IIEB 1HKFA 4MQXD 3SJVA 3ARGB 2Q7NA 1IBYA 4L8CA 1SOXA 4EZJA 3WYRA 4HCRH 5JORB 5DZNA 1JERA 3VYPA 4YSEA 5DFTA 3U2SA 3RURA 1T0NA 4X5XB 3TFKD 4M7ZB 5MP6L 2XTLA 3RTQB 2X3AA 5E6ZA 3D07A 4D9QE 3IBOA 3VXOA 3PFUA 4N5ED 1NGWB 3S8WA 1U3HC 2AQNA 4G59C 5FO2A 1NL0L 5KVFH 1F90L 2MOGA 2YRBA 3ZHFA 1MY7A 1WGOA 4FOMA 1QNZL 4WFFE 5CBEA 4ONHB 2EH8H 4DZ8B 3S8GB 4PJIA 1BFOA 3IXAB 3RE0A 1R3LB 2XV0A 4M6AA 1D2OA 4RX4D 1OWWA 2Z0BA 4UUJA 1WCBA 1PS3A 3GJFB 3U83A 3F7YA 3GMPA 5IQ9B 1DLFH 2BDNL 3TYFA 1MFNA 3ES6A 5F88B 5ICXB 3QDMD 2LT9A 4PRAA 3U7YH 1QOKA 3GXTA 4TPRL 4PFEA 1NCBH 2ZF9A 1X5JA 3IJSA 4TXVB 4MS8D 4GFXA 2ZCKL 4PBXA 4DVRL 4QLWA 4YOKA 3HE7A 4UQIM 1P4IH 2IEPA 1KLUB 4JO2H 4EDXA 4L37B 3TS8A 4BWWA 1UOKA 3APDA 3EADA 4IBLT 4YDMA 2ZCLH 3BZ4A 2GSGA 1CZ8L 5HTSA 2J6EL 3Q8BA 5BO0D 3FTVA 3E6FB 3OPZH 3KPRE 4LSQH 1Q9KB 3BWUC 3QJFB 1KIQA 4UYPA 5BZXA 3MLPA 2WINA 2NXYD 3N91A 5DHYB 2WLLA 1PPIA 2FNWA 2NY0B 4ODUA 4DO6A 3WAJA 3Q5TA 4XP4L 5AW6B 1I9IL 2GYSA 5I1JL 4IU2A 1ERNA 1QFWL 2BY3A 2F53D 2P24B 3HG1E 2X4UB 3LCYA 2AW2A 4LIQL 4M4RA 1IB5A 2ZKXA 2AABL 1OARL 1NQBA 4QYAA 5TPWH 1KPUB 4N9GA 5HHVL 2WKLA 2HFEB 2YXMA 3VU2A 1MFVA 1OOWA 3LIZL 1P4BH 1RSFA 4MYPA 3VFPB 4XX1G 2XV3A 4JG1H 1SM3H 2CUIA 3U6RB 2QKIB 1BZ9B 5M95B 3QNYB 5CLTA 1VACA 3C60D 3S7GA 1OAQH 1YRKA 2ICEB 3VI4B 2CAKA 1XGUA 3FT4B 1SYVB 1ZT1B 4QKTA 2K45A 4O51A 5L8LB 1DBBL 3ML8A 4F7CA 4KTEL 5B8CB 3C6LC 3O45B 3QULA 1XTMA 1AXSB 1XO8A 2HA1A 3RWGA 2EE0A 4RGNC 3TVMA 4IIQB 3HS9A 4HT1L 5HYFA 2YC1A 4AYID 2C7UA 2QQLL 4RBPK 4TNFA 5HI3C 4GAGH 3OZKA 3WO3B 3FTXA 1MCPL 3DI2B 5GGQL 2DWEA 2PWGA 4IHOB 3L45A 3ZDYF 5BUGA 2GITB 3OAZH 4XVTL 3VRLE 1QAWA 2C4FT 3C5SA 3RFRA 2WBJB 2CCLA 1L9NA 3CSGA 4WEBL 5CZVH 5FGCB 1ZHLB 2QGDA 4G6AD 3LHPL 4KRNA 3HC0A 1IT9H 3QXWA 4PPTA 2FBRA 5E8DL 4JM4H 3MROA 5LBVA 3QDHA 2CHNA 1AGEB 4HAGA 4NHCL 4UTAA 5IB1B 2IWEA 1T03H 4PS4H 5AVVB 5EOQH 1K2DB 1TQWA 3RUGA 3WHE1 5I1GL 5JHMA 5ADOL 2R15A 3U0TA 1ND0B 3QNXB 3VA6A 2YUVA 3SCMD 1G7HB 3GGWA 5ENWA 3A67H 1A9EB 4Z3IA 2F7OA 3MRMB 3DDGA 1I3GH 1IEBA 1HZLA 2FTAA 2GT9A 2ZYSA 2ZX6A 2BWIA 2H45A 2NR6D 4PJ5E 4GAYA 4PD4K 4ZUUA 4MRCA 1HDMB 2XG4B 2B8OT 2XXGA 2A83A 2RIKA 1A9BB 1MSPA 3CVHL 5DZ9A 2QQKH 4PGDB 3BAEL 2PR4H 2UXGA 2JJVA 3CDCA 3L5WA 1SN5A 2D7PA 1CE1H 4QHKJ 4XWOD 3AT8A 3GRWH 3LPOA 1ANUA 1CIUA 4G9FE 2YK1L 3ENEA 4GI8A 3NZHH 4UU9B 3LRHA 4XBGA 2DV6A 2YGOA 1RZ8A 4R3SA 2MOVA 1X4XA 2ESVB 1HEHC 3V5HB 1KB9K 3N43B 1GGIH 4RETB 2PABA 1QG3A 2X1PA 4M5TA 3REVB 5F7HA 2X41A 5E94A 5CAYB 1U95A 4WWKB 3VXMA 4TOYL 4ICXA 2QPEB 2QMJA 1VADA 4NN5C 1FLTX 1RJCA 4NQSB 4JY6B 2LABA 3OKMB 1J9RA 2XQYG 3HE7D 4J2QA 5AVYB 4M62L 2F08A 4JRYD 3MODH 1UXMA 3QCTL 4HIXH 5DF0A 4AW7A 4CNIA 1D5MA 5EO0B 5DEJA 1HYSC 3V7AE 2V5MA 4JO5A 4KI5E 4XVSL 4XMKL 5EG6C 4AG4L 1I8MA 3B8SA 5A2AA 4KKZA 4KKNA 5TFSH 4LKCA 4GUOA 4IBYA 3PRZA 5KYXA 3QRBA 5AZ2H 4L18A 3QDMA 5D7LA 3Q8EA 2D03L 1KY7A 2D7MA 4BQBA 2H1PL 1UM5H 2R51A 3AB0B 3CMOL 1PKOA 1SF3A 3MRIB 2EXSA 2R2CA 4KDTA 4OZIB 1GAFH 4DPAX 3UYPB 1ETZA 4KDVA 1DTUA 2QTEA 2N3JA 4GO8A 4PJAA 4L23A 5JXEA 5KYNA 2OJZL 3NA9L 3L1OH 5AB1A 4DK6A 1V7NL 4F8PA 5EU6B 1C16A 4O9HH 2XNAA 4U3CA 1XGUB 3FT4A 4F8TA 3GEWB 2EIJB 4GLRH 3V8CA 4LEEA 1CGUA 3ZHNA 4B97A 2E7CA 1QFHA 5HDOA 3AJ7A 4PCKA 3NCFB 1CLZL 1Z5LA 2Z93B 4RCAA 2F1AA 5I8KL 1HWWA 3BE1L 5DCCA 1S5IH 1UKQA 4KUCF 4Q6IA 5D6DA 4HX1A 5FIEA 4RMUA 3NDZE 4NRZA 4LGRB 2V9QA 5DVMA 1BMZA 2DBLH 2ZXWB 2ORBH 3BKCH 4MMZB 1BZ7B 4AQ1C 2UWEB 5AOZA 3IGKA 3CZGA 1D5RA 1AQHA 3WO4B 3EUUA 3OR6A 4XN7A 3D39D 4QHLB 4YDIH 2W65B 4AEEA 4MCZB 4I2XE 1QRNA 4WJG3 1GS7A 1GPOH 3HR6A 3K91A 5DK0A 4IBTA 2FJFA 4U2YA 1P7QA 3NVQA 4ZPVB 1U92A 1SOKA 4OLXL 4JCWA 5EBLA 4LB8A 4ZFOA 3O41B 4KPHL 1W0WB 2FYVA 3CZEA 5JQ6L 2QTVA 1LP9F 1U4FA 2PXYC 1DJSA 3US1A 1KV3A 4HZLB 3V6ZA 2VLRE 3ATAA 3LYRA 4O58L 2P5WD 1CI3M 3DTUB 3FTSA 4PRNA 1DQLH 3ECVA 5EOCJ 4AK2A 2WQWA 2FX8H 3GJFH 2BS8A 3RB5A 3UTQA 2RA1A 2DQ6A 1TZAA 2A83B 4PRBA 4WV1B 2IDTA 1LK3L 3Q5YA 4QEGA 2EIZA 3BAXA 4LSVL 2AHIA 2B2XL 2J25A 1XB8A 4I9WE 5F6IB 4EUPH 3PREA 3QIWC 1NWOA 1F41A 4U31A 1X4YA 2BIQA 1YECH 3FQYA 3LB6D 4PN6A 1MDTA 3GHBL 5CBEB 4GJTB 3TXAA 1QMUA 1C5DA 4ELMA 4CSSA 3LEYH 5KSBF 3WXWL 2XPZA 4XCFH 4M61A 3EJUA 3GHBH 1DZBA 3RX9A 2GTQA 1T1XB 2CO7A 2EVIA 3FFDB 4IGBD 4LSVH 1OB1B 3UGUA 5BZWB 3MVSA 4WO0A 5BVJB 1EAPB 2ALAA 4N1HB 1DDHA 1FNGB 3OKOB 3FJTA 1DVTA 4OD3L 3KPTA 4UIKH 3ZGIA 2NR6A 3DUSA 3W56A 2OI9B 3VFWA 3HG4A 1KN2L 2R1XA 3HS0A 4GUPA 4GQPH 2DN7A 3NRFA 2YEZB 1FVCA 2NW3B 5GRJH 1A1NB 3VI3A 1RZKL 1IAIL 2P3YA 3S88L 1DN0B 2CKBL 3SDDD 2MNWA 4XP1L 5DA4A 4WWNA 1AS7A 3B9AA 1UXSA 3MXVL 3QGVA 3V55A 2E8ZA 1XF5A 3B2VL 1QSEA 4J3OH 3RGBA 3OM3B 2P7TB 2B1HL 2IH1A 2G4GA 2IWKA 4M7LL 4Q6KA 1LO0L 5JZ7D 2W0LA 4ANXA 5LGHL 1DSFH 1OM9A 1QPPA 4FZ8H 4PS8A 1OVZA 1NBYA 1HCYA 4NERA 1CFQB 4X9YA 4N8CH 1PSKH 2ORBL 3BKCL 3VFPA 3N42B 2R1YB 4P2QA 4KUZH 1KB5H 5EOTB 4NEHB 1CFTB 4YFEA 2MFNA 2XTJB 3P30L 1RJYB 5T3XL 1DUYA 4OZ4A 2LTQC 2UZIH 4U7KA 1CLZH 5I8KH 4ZD3H 4B6ZA 2UYLA 4LBAA 3TN0C 3F83A 1U93A 2AXFA 1IE4A 3KH3A 1MI5B 3EOBB 2EVFA 1SFHA 4N2MA 2BVPB 1BZQK 3H9SE 5DD6A 4F7PB 4FE9A 3JV6B 1RIHL 4K15A 4XMXA 2JJSA 1KCUH 3EFDH 3L1OL 5CP7A 4XN4A 2WTOA 4EKJA 3W37A 5E7BA 3LH2H 1PZUB 4HWBL 4WUUE 4BV1A 4B9ZA 2H4EA 3HRZA 3MZGB 3SCMA 1YMHA 3BZ4B 1RUKL 2ZCHL 4M8UA 4Y5XB 1QZ1A 2ED6A 5FKAB 3UAJA 4NKOA 4DP9X 5HHOB 3IMUA 1PLBA 4QR7A 3ZHKA 5HYIA 1XGQA 2WBJC 2A9NL 2W07B 5JIMA 1NMCB 3IWVA 1BLNB 4ZFOB 3ZKND 4DWHA 3CFBB 1RCYA 4X7FC 1SDYA 4HISA 2F74A 1SVZA 5M94B 3QDJB 1UM6H 2OW6A 5E9NA 4XN5A 5AZEH 4XMKH 4JDTL 3UTSD 2V4LA 2BY2A 2C9RA 2NW2B 4HKXB 4NZTL 5K1VA 1CDYA 1HT6A 1YN6B 2DZEA 1TXKA 4I13B 1Y18A 3ZMEA 3MODL 3X17A 3FFOA 4NZRL 4BFKA 1ADWA 1MCKA 4M62H 1RIVL 4B60A 1LJMA 4FNUA 3N55A 3HZYB 1MCDA 1LE5B 4BZYA 3MBXH 4ODXA 2EXWD 5DMJB 3FQXA 3B5TA 4RIRA 1ZTXE 4B7LA 4X8GA 2WB7A 1R19A 3FO2A 1MCHA 4HPYH 2COVD 1IGYB 5IMLB 3SPJA 1TZGL 3VD1A 4OZHA 4PHXA 1XEDA 4NDMB 4I2XB 4NUGH 1EBAA 3ABKB 3DVGB 1HXMB 1ECZA 1QP1A 4AENA 1EEZA 2UV3A 4KVNH 1JXGA 5KZCD 4J3UA 4WK4B 3F7RA 5EN2B 5EIQA 3RFZB 4YFLF 5AWNH 1NOLA 3FQ1A 3T0EC 4HWEL 3RGHA 5JIQA 5DJ8A 3RDTC 1IBGL 4UM8A 1SEQL 1UB5A 4J3OD 4MB1A 1KXTA 4GXUM 4FJZA 5AYUL 5AAWA 2VDPB 1KWGA 1NOAA 1UWYA 2HWZH 2Q6WA 5TDOB 1A4JA 3HMXA 8FABA 4YJZL 3CVDA 3P40A 5HJGA 4ABQA 1XTLA 1B4JH 1AD0B 4J3OG 4LPUA 4AQ8A 4A2LA 5E94B 2RQ8A 1FFOA 1A8ZA 3RHWF 1AZRA 2Q2LA 1T2XA 1MCNA 4H1LA 4RAUA 4NFBA 1JGUL 1DJGA 4BH7A 4NQSA 4KK5D 3MRDA 4UDUB 2PCFA 1X5HA 4BD4A 3KLQA 4OGXH 5LO7A 1ZS8B 3N3EA 2EILB 3LRLA 2JJTA 1U8JA 2JB6A 3EH2A 3E8VA 3GO1H 3CXFA 4QKXB 4UDTA 1PNCA 3HIZA 4TQIA 1A6UL 1XF5B 3ZQWA 1NDGB 1MAMH 3GS7A 4HS3A 1RURL 2QHRH 2YIHA 2VTFA 1JP5A 2AJZB 4M93B 1WIUA 4PJBE 4RDBA 1MXGA 1T89C 5J89A 1IFRA 1T1YA 1JYNA 3MN8A 3OGCB 4FXGA 5C6TL 4JG0L 3WJLC 3IJHB 3IF1B 4O2EA 4DTGL 4HPHA 2EYRA 2JJWA 3GINA 4LO9A 3VXQB 1QFUH 1MRFH 4NQDE 1ZSDB 4N0UE 4RA0C 3V9FA 5GGQH 3EZ8A 5KW9L 1BGXL 2GSIB 4LHUA 2CR3A 3UYPA 3B9KD 1NM4A 3T71A 1V3MA 5A7EA 1LYQA 1UOVA 2XXCB 1MI5E 2ZWKA 4J3VA 1Z3RA 1DVSA 1S9YB 1G6RL 4P2OB 5EORL 1OTSD 5EZLA 5FA4B 1SBSH 2P49B 3KS0H 1UCBL 1H6FA 2PCPB 1ZMYA 4KTEH 1ID2A 5FXCH 5B1KA 4Z7QF 5CU9A 5F9JB 3PXJA 2E7BA 4PJ8D 1H3UA 1OCRB 2P5ED 4JPWH 3KJ4B 5IOKA 3DDFA 1UWGH 1ZT7B 2F53A 4YHYB 5IP4A 5IJKC 4H25B 5CIPB 3ZZ1A 5T1LB 1PGRB 4ZUSA 2JCCB 4JG1L 1S5HA 4AUUA 1B90A 1RZKC 4JGJA 4K3DL 4CC4A 1EGJL 2QT6A 4KJYA 2WLIB 4JFEB 3UZQB 3DX1A 2R7EA 5JOPE 2WYTA 1OARH 1E4WL 4PI2A 4Q58C 2ENSA 2FJGB 4TSBH 4LIQH 1XH0A 4AC2A 2DTSA 5JHDE 5HHQB 1ZLVK 3DX8B 5BS0A 3D2TA 3WGUB 2O6FA 1H5BC 1AZUA 1T66C 4R8WL 1JGVL 1WICA 2B9BA 1I8MB 3ABGA 1RHHB 3TGXA 1YN6A 2HXAA 1U8CA 4GEIA 1WZLA 3WEAA 3W3BA 1HEJC 2QADC 1L6PA 4FFVC 1PL3A 4RFOH 4L4TD 4N9OB 5IR1B 4XCCH 2EEAA 2TSBA 1WEJH 5FKPB 3U9PL 4P9HC 4MAYB 3D3VB 4PJEF 1FO0H 2I07A 5C08E 3IS1X 2ZCLL 3ZU8A 1TU2A 2H8PA 2NXZD 2WXLA 3MU3A 4AGQA 2X4RB 3APFA 5DTFB 3ZOAA 2I69A 3OKKA 4CU6A 5IMKB 3WCYA 1FZMB 32C2A 1QKZL 4Y19A 4YDJA 2NLJA 3HHRB 2DWYA 4X4XA 1GH7A 1JNLH 1KIRA 1WH0A 3L5JA 4NRYB 5F9WB 4RESB 2N01B 2AV1B 2Q1EA 2EAEA 3EXLA 1XCQB 1JZ4A 1DLFL 4YXHL 4PJ9B 4QWWC 4PRHD 4OCWL 2IOOA 3V0VA 5GZOC 2ODIA 2LLNA 2QKSA 4QOKD 5EZOH 1KBVA 2MTPA 2I5YH 4GO9A 1UZ6E 1E3ZA 2AITA 4TMPA 4NKQB 3RWEA 5IJDC 5K33A 3ZSTA 4N1EA 3IDXH 1J48A 1O6SB 4LP5A 1BVLA 4MMXB 5EO9A 1UA6L 5H94A 2XZAL 3LKPB 2D4DA 3TLRA 3MRLB 3WIIL 1RUQH 1U8HB 2Z1PA 2V33A 2BNQD 3V0EA 1FJ1B 3SY0B 3C6SA 5J11B 4LPTA 3QQDB 1OK8A 3ESOA 1UG9A 3QC6X 4XBMA 5LAPA 3VFRA 1G87A 3QJRB 1SXAA 2J8UF 5B39G 5KJRH 3LQMA 4F2FA 3LPFA 3FCSB 1JTPA 5EOCL 1LO3H 5JHLA 3K81A 1AE6H 2ARWA 1T20B 3JTTB 3D39E 1TMCB 1UM4H 4WWKD 3WNPA 2R0KH 2WNWA 3BO8A 2AZAA 1Y7VA 2YAQA 1WRFA 2NR6C 1CL7L 1PFOA 4L1LA 4QXGH 3D1MC 1M9WA 2YPVH 3H55A 5EUOA 1SHSA 1Z9PA 2ZIDA 3CZFA 3QQ3B 5C9JA 1K5NB 4WNJA 4AK1A 4MQ7A 4A63A 4PTTB 4X6DE 3MV9A 2VZTA 1FVDB 2VCOA 3ISRA 4HUWA 3SE8H 3QUXD 3BH4A 5C0AA 4D0CA 3TTYA 2ENYA 4HWNA 2J55A 3F85A 3UO1H 4U1SB 2NYYC 4WJKB 5GRWA 4HIEA 5T3ZD 3EJPA 4P23C 4WU7A 1JPSH 5K9JH 4NQVB 1WS8A 5AYTA 3VTMA 4D8OA 3RDJA 2JI2A 4O00A 4PY8J 1ZLSL 2UZYA 2HT3C 2I60L 3RVWD 4JFFB 2VOTA 3LXAA 4X5RA 5IKCB 4LP8A 2C7FA 1DANT 4P8QA 3X1EA 3UXFA 1WA0X 1P4UA 3WFCL 3TP4A 3U4BL 3RY4A 1U3ZA 1XIWC 2P1YA 3F64A 3L3GA 4FFYA 2OZ4A 3DX7A 5BOJA 2EIKB 3FTWA 4PS7A 1YN7A 4PG2A 4JY5H 2DIJA 4LHJB 1HYSD 4NO5B 1CGXA 1F11B 1QLFA 4G8IB 1YMMB 4NYLA 5KSBE 1F58L 4ZJ9A 4XHJC 2IH1B 3MFGB 1HZHL 3GMRA 3ARGC 4W9LC 4E9VA 2C9SA 4PWKA 1MPAH 3VFVB 4WTWA 2J88H 4HDIB 3P3SA 1M7DA 1KELH 1BVKB 1ZA6A 1R1CA 3EJCA 3QJZA 3KYOA 5DTFA 2J4WL 4M7ZC 3ZR6A 3CE1A 4CC1A 1AXTL 1WISA 1AD9B 2FT7A 5D2NA 5JW5A 2O72A 3P2BA 3NRQA 4G6ML 2R1YA 5ICZB 2VLJA 5TDPB 3RZCB 1KIRB 4NO0D 3Q01A 4LARH 4OZHB 4Y4KC 2A1WL 1V3KA 2VQUA 3I6KA 4OZ4B 3T5WA 3RKPA 5CGBA 1KY6A 4PJ9A 1FFPA 1HHHA 2Y2WA 5EU5B 5DHEA 1EEZB 1EHXA 3G6JA 4WI3A 2BVPA 4YXKH 4X4YA 1GJIA 1RU9H 5MEOA 2HKHL 3U1SH 2NUTB 4XZUB 3RZWA 4P4RA 1TQSA 5KYYB 3RDTB 5DJ8B 1U8PA 1MCCA 3EGXA 4M5ZH 5IB3B 3EYFB 4GRWF 4CN6A 1DVUA 3QDJD 2X4SB 3QEHB 3G6AA 3NSXA 4FC3E 3WTYA 1AI1L 2IGFH 4QJ3B 1E4KC 3B7SA 3DGGA 3TV3L 2AC0A 1AR1B 1YNTF 2CO6A 2G3NA 4UTAL 5SWSD 3GSNL 1I3RB 1ZTXL 3E8UH 3LKSB 2VLRD 5BNXD 4LEXL 1EERB 1Z9LA 4W9JC 3KYNB 4PJDE 4W9KC 3SKJL 4KOCA 1OM3L 1ZA3A 1DQDL 5DS8A 3TZVC 1NLBL 3ZYIA 1GIGH 3V4UH 1YEDB 4S0SD 2VABB 4JKWA 3QUMH 4PB0L 3SJVB 4AJYV 3MJWA 2A77H 2YFNA 4AEIL 4JKNA 1ML0A 4KJPD 5DEGB 1A2YA 2YAFA 4DK5A 1XEUA 3JTTA 3N1QC 4WGVB 3VXUA 2XICA 2AJSL 3ULUF 2XPGB 4UQ2B 2VN3A 3K6IA 3PWUA 4ICWA 1F8TL 5HY9A 3RTQA 3ETBJ 1H3PH 2EECA 4ZDHA 2FDBP 1ZLDA 2Y7NA 1B0RB 2JK5B 2UUDH 5FDWB 1NIFA 4ZODA 1A5FL 4JFZL 3FU7B 3LIUA 2ZKWA 4UM9A 3ZTNL 1U41A 2CALA 3HA0A 5CINH 3NESA 4TQEH 5C0GA 2YN5A 3OMNB 5ETUB 4P2RE 3MZTA 1KGWA 2V5RA 1E9PB 1M7UA 2JLPA 4KY2A 1J9SA 3EJYC 4JHBA 3ISYA 5F0LB 3RY6C 4ETQA 3B2PA 3O8XC 4JFDB 2DYSB 2G3ZA 3A6BH 3JUZA 3OTTA 4AYFA 1D6VL 3OZ9L 4FFVD 4O2CA 3F7LA 2FZ3A 2KT6A 5FF6A 4JREB 1ICTA 1MHPH 2NQ3A 4RGNB 5SX4I 4MDRA 4Z78A 4IW4C 4UAOC 5B38B 4A2GA 4LVHB 2X4QA 5CIPA 1HXKA 1V5JA 3WMSA 3D3VD 3L13A 3BAJA 4ZNCD 2Y9RT 4JHAL 3MRQB 1OKEA 1UEYA 3AADB 5H35A 2L3BA 3FYIB 1K4CB 5CILL 3MRDB 3DJSA 4UDUA 1WAAF 2CK0H 5FC9A 3WUWG 4DP4X 1YMME 2WXNA 4J3TA 3MCKA 4PB0H 3FU5A 2B1AL 4C4KT 4XGZA 2G60H 4G6AC 1T3FA 1GIGL 4ZMWA 2FIKA 1KGCD 4MJ6A 1QBLH 3ATDA 3HBQA 2HN7B 4U1HB 2MQCA 2PCYA 4XNMA 3PHQB 2AP2A 2X7LA 3C09C 3BSZL 1U3JA 3IF1A 2FNBA 3L1FA 3VWKD 3WGVB 4PV9B 3II2A 4LPVA 1MFEH 4U1JB 3VWKB 2W95A 2YLKA 1OIOA 3PHOB 2XVGA 1CICC 1TU2B 3H4FA 1R0AL 2XYCA 2AMGA 3WEMA 5K69A 1RK0B 2X6AA 2HJLB 1U8MB 4UOW0 1JVKA 4OD1H 2OKMA 4YDJB 4M5SA 4XRCA 4DO4A 1WD8A 3QZPA 3A24A 4L9LB 4P2OA 5EF3A 3WIHL 4NNXB 4F7KA 1SYVA 1ZT1A 1X7QA 3L3HA 4F2ME 3VD9A 1ZD6A 2P52A 5LB1A 4LARL 3TBVA 4EO5A 1NIEA 4ZFGH 2ID5A 4LLMB 3TO2B 5IJBC 3JWDL 4IBWA 2B1OA 3RLSA 4NQXA 2XLLA 5T1KD 3HC4H 3DO4A 2ESVE 4FNTA 3G9AB 4KKBD 2Y7SA 2MSPA 4LCUA 1WITA 3B83A 4NC2B 5I6MA 5LWYL 1KPRA 2Y6SC 4F2MA 3MJ9A 3U7WH 4CJ1A 3EYUL 4JRYA 1MHEA 4MMYA 2P46B 4GSXA 2Y22A 4DGVL 2XRAH 1N64L 1P1ZB 2Q8AH 1MJ7H 3DMMC 4WFHD 5TQ0L 4AIEA 5I30H 3HHSB 5D9SA 1FFTB 3II3A 4IMKC 4E41A 1JV5A 5CFAA 2HTLC 1IO4C 2VLKD 1JRHI 2H3NB 1P4LB 3WFCH 3FB6B 4MQSB 3TT1H 1FNSH 4AJ0A 1D2PA 1PZCA 5F1SA 4L3ED 4PG9B 4DGYL 5F9DC 1XGRA 4L8CB 4FJ6A 2ZNXA 4H1LG 3JYBA 3CHXA 4IQHA 1ZLSH 1FORL 2GT9B 1EHKB 2NQCA 3BD5A 3GMQB 4JLRA 2XWDA 1JPSL 5ERWB 4A68A 1P7BA 4HS8H 4WW2C 1TJMA 5D5MA 4P48A 3UO1L 2NY7L 4E68A 1MCOL 4EE2A 4E0RA 2EYSB 4Y8DC 1IM9A 1LEIB 2X28A 5JPNC 4DKFL 5FUOH 3P69A 2XJLA 2K7QA 3DXAA 3GSXB 4HF5H 4NKDA 1WE5A 3SKMB 1DVFA 4FQQA 4HJJH 4GG6F 1L9OA 5F1IB 3BT2H 1BFTA 1IFHL 3T65A 1KYOJ 1R3IH 2CDEA 3LKOB 5I26A 3QHTC 4L0YA 4PCYA 1KBBA 4PJ7B 3O4LE 1NUDA 5DJZA 3I9AA 3NCMA 4IIZA 3F00A 3EOYG 5H94B 3VXRB 1EJOH 1XSOA 2IPUG 1NBVH 4Z0XA 4HUUB 2WLZA 2BVOA 3PG2A 3KG5A 5KJRL 3HUJA 5DJXB 3UBFA 3QHFH 3L3KA 2PYFB 4Y4KD 4X6BA 2XVLA 4J3WA 1NGPH 4P5SA 4Y4FA 3E6FA 1U8LB 3VFSB 3CQPA 3T3PF 3LD8B 1E67A 1Y0LB 4Z7UE 3LDBB 3ARZA 1CR9L 2IFFL 4JPKL 1Q94B 1A8JH 2WCGA 5C08B 3R06B 3QUHA 2CUMA 4K9JA 3MA7A 3WIIH 5DSCA 3ZTDC 1MH5A 3RU8H 5D96C 3JYCA 1X5GA 4XNXL 2ZNWA 1Z9SA 3D50A 3SODB 4YNYA 1D7CA 3BH9A 3DETC 3MLXH 2ZKYA 4YDKH 1L7IH 3QJSB 4RNRB 4C83B 1JZJA 3CXHK 2ADFL 1FI8C 5CSZB 1EO5A 5CHNA 4JQVC 3LSOB 3WKML 3GSUB 1RMFL 4CVZB 5CM1A 1JDDA 3QUZB 2NZIA 4NPKA 2WHVA 2JKTM 2WXQA 3K6FA 4GRWE 4FRWA 2XETA 1VFAB 2EE2A 4JPVL 3KLAA 3ZYZA 4YXHH 4DZBA 1AC0A 4P0DA 5KYUA 4JFHD 2OAAA 5JW4R 5AOMA 4DCQA 4X9HA 2WLYA 1RLWA 1H19A 1ZEAL 3GXMA 4PH8A 3L4YA 3TPKA 3VXME 4QHUA 3GIVB 4ZMYA 5CCKH 5F1OB 4IKNA 3ZKXB 4B3EA 3ILDA 4X4YB 2WTRA 4WU7B 2WOBA 3BZFA 1S7SB 4ZX5A 2IWFA 1F4HA 1NIAA 5ADPH 4HMEA 2DQMA 5KN5B 2BVYA 2HFGL 3DHJA 4JRYB 3RL1A 1N0LB 1NCUA 3WUZA 3C5ZC 4QRAA 3CJJA 5D2LB 5HYQA 2VO5A 2C9UA 1HH6B 2HYMA 5FO9A 4D9RD 2WBJA 1JGVH 1WFIA 4FTVB 1WWBX 4PRHB 1JV5B 4OH2A 4KNTA 4PGEB 1CK0H 2EC9U 3K6NA 2YPLD 3U1QA 5JPMB 1L5GA 1G9ML 4GW5B 4MS6A 5LJYH 3C9NB 3QPKA 4NQDB 4JDZA 3SD2A 5DEGA 1D5IH 5I18L 4ODBD 3U0TB 2YUZA 5KSBA 1CLCA 4WKZA 1CDIA 4KDWA 4E9WA 4PVLA 1U36A 1DJYA 4FABL 3S3PA 2NPLX 1HXYB 3WNOA 2DQGH 1JPST 1GA2A 1M6UA 4S1QL 3U9WA 4QRRE 1BQ5A 1FSKC 4KXDA 4RRPM 3MV8B 1D5ZB 1SHMA 3KPMB 4JPWL 5CCJA 1A6TB 3BKML 4I0PA 1OGSA 4DOHE 1J9CT 5LN8A 3KWUA 2DQCH 1WVZA 5AD0A 2AQQA 4QHPA 2RACA 3MJ7A 4EN3B 5J06A 4YDVA 5EORH 4DESA 3Q1SH 5HHME 3QFDB 1YEHL 2R56H 1P53A 4B9FA 1M2VB 5F1IA 1S78C 5FM8A 3T2NL 4A2EA 3WI9A 4KY1H 4X7TB 3TN0B 1UOWA 4C59B 3UJJH 1YNKL 3IDYB 3DX6A 4JN1H 3BN3B 3H8NA 2CXGA 1SOQA 1J5IA 1FH5H 3KYKH 3MJ9H 4LOEA 1NCHA 3SJVD 4HUNB 2ZUYA 1EV2E 1RERA 3DGGB 2K3TA 1MCIA 1DQTA 2JFCA 5C6TH 3RTQC 3ESPA 3BIKB 4KRPD 1IIIA 4AQ8C 2WKGA 7FABL 5IFAL 1XSIA 3L3JA 4CC0A 1PCSA 3MCYA 1QRNE 4DGWC 3GMNA 5IV2B 5DFVD 1KCKA 2C1OA 2FQFA 3P0YL 4JFYA 1YSOA 3T0VA 2NY4C 5I0ZA 1F2XK 4OTXL 1NMCC 1U6AL 2Y36L 4BDVA 4PJCA 2J8HA 1D5MB 3FQUA 5I5MA 2NOYA 3QK0A 2I32A 4K73A 1OGAD 2HRPL 4MLIA 3FB7B 2ZG1A 3ZE2E 1OAZH 2V7HA 5D1ZC 1GZPB 2HX8A 2NT0A 1SUHA 1RUPH 43CAB 5GS1A 1R3JA 4ANUA 5E4OA 2R1WB 5IB2A 5DMKB 2PW2A 2G9HA 1T04B 4P2RD 3W5MA 3CFTA 4PV9A 2N4IA 1G6RA 5FDWA 5EBMA 2FJSA 4IKJA 1NFIB 3US0A 1SEQH 3FQNA 2NTFA 4FN0A 2YSSB 3CIAA 3Q48A 1ETZB 4FMFA 1E5CA 1PTZA 1E28A 2JJUA 3CPLB 4L5FL 1F4XL 2D3VA 3V9CA 1HS6A 4KVNL 3TA3D 4OI8A 1IILE 3P2TA 3S48A 4XWOC 4L9LC 5AVZB 5A2LH 4YDZA 1EIBA 3WD5L 1QPKA 1YZZA 5E9DA 3RTLA 3GXNA 4XXWC 3UTTE 2P5PA 4I85A 1KC5L 2BVEA 2WBKA 3NZUA 3L9RB 4M6MH 5BUPA 5CWSB 3RI5F 1OTTD 1ZGLA 4K7FA 4O2CB 4XN1A 3U4AA 4WU5B 3HG1B 1JXJA 4HPYL 4TNVF 3SDCD 4AM0B 4Z76A 5GS0L 5DUML 2CRIA 1VFOA 3QNZB 5DD5L 5B1CA 1AZNA 2A6DB 1LMKA 2OQJA 1BM3H 2IF7A 2FO8A 2KPWA 3MBXL 5D70L 2C3VA 5D8JL 3DPDA 1P7KA 4AQZA 1DJXA 3HRZB 3DV4B 5SX5K 2EDFA 4L5FE 2BX5A 4X98A 4I18C 3ARDA 4YR6B 1HH6A 5FO9B 3BRFA 4RSVA 1S3RA 4JDTH 4Z18A 3CK0H 1UM6L 4XGZB 5AZEL 3BWAA 4UCFA 1R3HA 2F9BT 3TBWA 3U46A 1P7HL 3GS4A 2J5LB 3N40P 1THAA 2XN9B 2CIIB 5KZCB 2DEWX 4LQFL 4HCIA 5IEHA 2UWEE 4OF3A 2Y72A 4JFXA 2NX5A 5IVOA 3HKZA 1KG0A 1ZV9A 3S5YA 1PLCA 3NZSA 4RMBA 1RZFH 4UAHA 4DEPB 2YAEA 4NZJA 1OP4A 4Q6IC 5D6DC 4HWBH 2JKXA 4XNYL 1LE5A 5F96L 4DN4L 3U9UA 2E59A 4G3YH 1FNFA 4P5MA 2ZUQB 2WO3B 3FO2B 1VKXB 3KPMA 3V6OC 3NJLA 1MFDL 1A6AB 2YPKA 1QLRA 5GJTL 4MD4A 2YUWA 4LP4A 4M1DL 3TCXA 4Y19E 4KK8D 2ATAA 2Q0ZX 1OT4A 1EWHA 4P5RA 3OKEA 3U4EB 5K9OA 1HHGB 1GY2A 2CU9A 2OX5A 2OMUA 3K46A 4IMKA 4P06A 4AVJA 2EE6A 4JPIA 4FFWD 4MBOA 2SEBB 5ELIA 2ATKB 3L16A 1A7PL 3T4AC 1IQDA 1PSKL 3R1GH 3KLHD 3PWVB 3NJNA 4EF3A 2DICA 3BUBA 5D7SL 4S0TD 3MLTB 4FEMA 1MCFA 3WNIA 2J57A 3P73A 3ILPB 5LGHH 1BEYL 3FBKA 1LO0H 2OJ1A 4QXTB 5JUEH 2MKLC 2KZKA 3WLWC 1ADQA 4ENZA 3BD3A 4MMYB 3OX8B 3ARYA 4X7DC 4XNUL 1S7RB 1N19A 1X9LA 2AJYL 2IQAB 1QTPA 2MPAL 3AY2A 4GW4A 2VDRL 2AK4B 5JHDD 3MRRB 1C12A 1JJUA 2Z92B 4CKVX 1XGYL 2E56A 3UERA 1N6QH 4LLQA 4OM1H 1M3IA 3CV5A 4XP5L 3IFNH 2DQTH 4UILL 1H5BB 2CRYA 2QVKA 4XMUA 1IU1A 5FYLL 1NDGA 1MHCA 1E3FA 1OGTB 1NC4A 3UDWA 1OAUH 3CN2A 3GEFA 5GGRB 4I48A 3BVVA 3OGCA 4F27A 5IB2B 2CHWA 5BO1H 4HKJB 5B7MA 4NKMB 1PYWB 3OXRA 5ERWA 1F6LL 4AKPA 2Q2EB 1JZ7A 2WKOA 3VGBA 1O7DC 8CGTA 1PY0A 4HUMB 1A66A 1SJEA 4XCFL 4L8SC 4OFVA 3DTXA 2DWTA 3T9WA 3IDIB 1Z1WA 3O2DL 5MEND 3KMDA 3CN0A 1N68A 1EA9C 5TE4H 1MFBL 4RRPG 5F9OH 4N2EA 4FQQB 2YWYA 3MNZB 4FQLH 3F12B 1WWCA 2J3SA 3T4YB 3K1DA 1MNUH 2F54A 1LK2A 1H6TA 1CG9B 3CLFH 3DUUB 1JD7A 4K0OA 1G7IA 3MXWH 3M86A 3V7MA 2CKBB 4RFNC 1PZBA 3AXLB 1EXUA 4P23A 3FB5A 3CDZB 3EHBB 2V2TA 1S5HB 2DI7A 2DQUH 4ZI8A 2WZ0A 3P0VL 4P99A 4YO0A 4JJ5B 3DVNB 5CP7B 5D7IF 2FBOJ 3NEOA 4FI6A 4MMXC 2X89A 4HUUA 5FO8A 2A2QT 5D72H 5DR5L 5EBWB 1PKQB 2XBZA 2KBGA 2FSDA 5FUZH 2YD5A 1D9KC 2QSQA 1MN4A 3OJMB 4GEJA 2FWOA 3ARDD 1IAKA 4GSDH 5D7KE 2PCXA 4PP1C 1VLXA 4WO4C 5J1AA 2VZ1A 4OFDA 4WW1A 1IIKA 3V2AR 4JFDD 1B4TA 3T0DA 1GSKA 3ILQC 2WD0A 4B5EA 3HMXL 4YDIL 4W1TA 1JV2B 3D48R 5DK2B 1JZDC 3SDCA 3GSWA 2CQVA 1Q0YH 4FYRA 4M7JL 4PLKC 2CPUA 2ED7A 4FKHA 2APXA 4HKBA 3FN0H 1AQDB 1GXEA 4WKZB 4CC4C 3GPSA 3NIFF 5L2KB 1WJ3A 4RNRA 4IOSD 5E8NB 4C83A 3S8FB 2J6WA 4M8QA 5GS2D 4XE0A 3QI9B 1RJZA 4J4PD 3SKOA 1CXKA 2UZXB 3BE1H 4XMWA 3M17A 2AJUL 4FYTA 4X7CC 1RUMH 4H1LH 4N5EC 3X3FH 4ZQTA 1VRSA 5DUPH 5IGXH 5IG7A 1FVEB 4PJFA 1OL0A 1XCTB 4NSKB 5IW1B 1I7TA 2X0WA 5DQJB 4WUUA 2J73A 5E6IB 3G5VB 1X9UA 1F5WA 2ZKMX 2MWCA 4Z9KB 5G4NA 1DQJA 5IW6A 5KBNC 1NFAA 5CJQL 1NMBL 2PTUA 5F88A 4RWHA 2P4AB 5ICXA 4JQXC 1G4RA 3UTSE 2CJUL 3SBWC 1TZHA 1YPZE 3LN5B 3CNKA 5TDOA 4D3CH 5D7HA 3RB7A 4MDJA 2KDYA 3GZPA 4KZ0A 2AQSA 3UFIA 3UTZB 4Z7WF 1KV7A 2ZAGA 3GUFA 1WC7A 4H8QA 3WS6C 3VYOA 2C8NA 4ALAH 1ED3A 1GZHA 3TNMB 4RQQA 4AM0Q 1WUNT 2W9EH 1XIWB 3INUH 3B8YA 2VDNH 3RY5A 4CSTA 3ARWA 2ZAIA 1ZS8A 4ZW7A 3GJEA 1WSST 4AYMC 3DVFA 2CH8A 3LRSA 2E9WA 3L8QA 3I85A 4UINL 3RP1A 3VXPB 3HLAA 1DFBH 2HX7A 1WBXA 2NXZB 1S9KC 1G43A 4TF4A 3ARBB 1JZ6A 1TTGA 3PGDB 3AY4C 4HXAL 3B9EA 5C0BA 43CAA 4WEUD 4M4RB 1G94A 3VVVA 3Q9QA 4H4NA 5JDSA 4H44C 2E4FA 4JZJB 2EDDA 2CMRL 3NZHL 5DJYB 3PWJA 1OTUD 1KFGA 2IJ0C 3CZFB 4ZAKD 5C9JB 4Q9RL 4N8VA 1AANA 3QUYD 2R8SH 1EZLA 3GRWL 3PLYA 2UY6A 2C9QA 1ZHNB 3QO0A 5IROC 1F4YL 1R3LA 4OF0A 1ZVNA 3ALXA 2F61A 4JRXE 5MEPA 1MREL 4I1PA 1D6EA 1NBZA 4UT6L 4Y2OB 4Q52A 5E9DB 4EBQL 3BQVA 1EJFA 1LTXA 2BS9A 5BRZD 3TYFB 3BIBX 4L4VB 2FE0A 5IQMA 4HIEB 3QG6B 4XTRD 1MCQA 1WAPA 4MJJA 3N04A 4ZTPL 3V6FA 4CAGA 4ZW6A 4QO1B 1WZAA 1ZK9A 2RD0A 3RL2A 2ICWI 2AQ2A 2E7MA 1KBWA 2CG9X 2J21A 3FUNA 3GBDA 3IJSB 4XI5D 1ZLVH 3ZE0B 4FG0A 3NJIA 3A67L 2K9UA 1MRCH 3UMNA 1DBJL 5KSAD 4F1SA 1TO5A 1QBBA 1ZVSB 3STZB 3UIZA 5IQNA 3W9EB 4ZXBB 2DJ4A 2OCJA 2VN6A 2BOLA 2OMTA 4ZTPH 2PO6D 3QW9A 1FO0A 3GMMA 4FAAB 5I1GH 3Q0HA 4Q2ZA 4YIQB 4JFYB 2Q8BH 3HPJA 1T03L 4NAJA 1PIGA 2ZPKH 6PAZA 1MREH 3T3ME 4YZWA 3D52A 2CGYA 4UOW1 3MRKB 1IEHA 5MHSD 1ASQA 1BSIA 4L29A 4LCIH 3RBGA 4KXBA 4ODVL 4PJAE 3SJVE 4WEBH 2WGNB 5C09A 3GDCA 2R2HA 4OT1L 3MPCA 1CLYH 5CJOH 2Z7YA 2P24A 3NEXA 3UO8B 4BCZA 3WS3B 4NJAH 4LBEB 1JWMB 4H88L 3WUWB 1R24B 1MIEH 3QJXA 1BQRA 1L0XA 4Y19D 2Z91A 3QWRD 1ASPA 1OE1A 1E2ZA 1PG7L 1RJZB 2NRDA 1VZGA 1CF8L 3JV4A 3EUDA 1XF1A 1DLHB 1NFDF 4XMTA 5FAAA 4OGZA 5B38G 2GK2A 1E27A 4LE8A 1FZMA 3SSGA 5EWIH 2V2XA 3OQRA 4P2OC 5A7BA 2DLIA 5EUOF 4M48L 3WENA 4OFYA 1BD2E 5CUSH 3DRQA 5HDBF 2MCMA 3EJYD 4XO9A 4K7FB 5L88H 5D4IA 1AXSA 5I1HH 1E8XA 2DYRB 4ZX6A 1IQDB 4AE1A 4KROD 3LIZH 4JQIH 2KLSA 4UU9A 1XF4B 1WD9A 3LOWA 2V9UA 1TSHA 3MRHA 5IWLA 4BZ1H 2WBXA 1ZRUA 5CP3A 2FATL 4K9EL 3MDJA 4KO5A 1J5DA 4ACTA 2JVUA 1I3RA 4ZFOL 3D4CA 4G7VL 4OFQA 4G7YL 3DLQR 1CXLA 4P2CG 4ZPTB 2QDWA 2EICA 1F97A 3Q3GA 4FHBD 4Q6YA 1EXGA 4KQ4H 4LF3A 1NPNA 1YEDA 4AV0A 4A6YB 3UBXA 3U7AA 3VDAA 5J12B 2ICWJ 2E47A 3IYLW 3MUHL 1UFUA 3BGMB 2Z7WA 2JQAA 4BYHA 2V5SA 4XNQA 3BP5A 4ZO9A 4PMFA 1IRAY 3MUY1 3ZE1E 5F71A 2J6EH 2AVGA 3TVMC 4LSRH 3MBED 2G2RA 4MAYC 1NBCA 3B1UA 4WIQA 2DEYX 4R7VA 3DOIA 4FFZA 5A16A 2BSCA 5D7LB 3MLUL 3NP4A 1HNGA 4ZDHB 4DP0X 1NCBL 3QVAA 3AU1B 3VWKC 2Y07L 1UJTA 5HHOE 3LZLA 3TFBA 2G2PA 3RUGE 1IUZA 1WBYA 4WY7H 1CYGA 2BOCA 4OZIA 1T2QH 2HSIA 4LOFA 1IC0A 3QPXH 4OZGA 1YLBB 1FV1B 4LLYA 4L8SB 2XZZA 2GJRA 3ZMRA 1U8NB 2V8MA 3DARA 3SB3A 2G5BA 1LWHA 4QWWD 4B0MB 1DVFC 1U58B 3M7FB 3BFOA 5LAXB 4TLUA 5FR3A 3LMJH 5FUZL 1SJMA 2EIDA 2UWEF 3BZEB 4J7RA 3DECA 2GC4C 2NXYC 2AXGA 4RZKA 2EADA 2E75C 5A2CA 3EHBC 1HH9B 4Q7DA 4KRPB 1UA3A 3ESMA 5F7YC 5L6YL 3NFSH 2F54E 2FEJA 2YD8A 5IKCA 4AYDC 1X5XA 5FO8B 2E7LC 5TD4A 4IKKA 1X44A 3IU4L 1IC4H 2ROXA 3W57A 2H26B 4J3BA 4Y9FA 2WTPA 1OSPH 4PJHB 4FQLL 4PWEA 2X70B 1RZGB 4LIQE 5DJZB 4R7NA 2VDQL 2Z7UA 1JK8A 5EU6A 1RVFH 4ELDA 1Q9OB 5MI0B 5J1AB 4PBDA 4QRPE 4FNLH 4JHWH 1ZGLM 1DBML 1W0WA 1YEEH 4I48B 1LVEA 4LOUD 4BGLA 3ARFC 3SDAC 1HOEA 4Y89A 1E90A 4UIMA 1PDKA 1KTRL 2Z7ZA 3Q2CA 3DIFB 4I3RL 3LXCA 4P2RB 1SDAB 3OXRB 4DQOH 3MAWA 4Z7IA 3WLBA 5DZLA 3SDYH 3MRCB 3E6HB 4CMHC 2ICWA 5BO1L 4JFUA 1PG7X 1ZA6B 5B7FA 1Y6KR 5E8NA 1Z6JT 3J2PA 1CN4A 4IEFB 4NNYB 3S2AA 1SJEB 2UVFA 4JHVA 4R90L 5ESVB 1E27B 3FU9A 1KACB 1VCAA 4WHYH 3ZDZF 4N6QA 2DQTL 1GZQB 3GSVB 1YC7A 2BIHA 3L3HB 4XMLL 3JVGA 2DLFH 2VR7A 1NUGA 4L1SA 4NQCE 1N4XL 1LK2B 4P9MH 5GSRA 1GHFH 1NA8A 5JMRA 4P46C 1U8IB 5KVFE 2HG5B 3G6JB 2RCSH 1NC4D 4F7CB 2X9XA 1NAMA 1TYJA 3QUMA 4P2QE 3S96B 5TTRA 3N42F 4NRZB 4LCUB 3SDDA 4HD5A 5J9PA 6TAAA 3OMAB 4HHWA 3BJLA 3EGXB 1CICA 1UH4A 3N9GH 3W9DB 5D7SH 5BZWA 4F2MB 3OR6B 1E8YA 4R97C 3P9WB 4WAFA 1HWHB 3IAQA 4LSTH 3J27A 2VQTA 4F80A 2IAMD 4NN7B 1GSMA 3P0GB 5I17A 2VMEA 1KENH 2A3TA 1A4KB 3QB7C 3TNMA 3EBGA 3P11H 2YEZA 4I77H 2VC2H 3BP6A 1M57B 3O41A 2WP3O 2VL5A 3IB4A 3HZMB 5B39B 1YPZA 4AGNA 1KJ2A 2F54D 3MROB 1QASA 1IZKA 3L2MA 2ZF8A 2KHAA 2PMZA 3DTDA 2X4TB 1KFAL 4G42B 4NENB 4OLZH 3QRFM 5ID1A 4YWGH 1RPUA 2VSKB 4N0YH 1J0IA 3IMRA 3FULA 2AGJL 1M2OA 1AFVH 1BIIA 5TQ2H 1I31A 1AJ7H 2GEQA 1EANA 3EG9A 4NKIL 1GCYA 4QRTB 2AXWA 5J13B 4J1UB 5ITBL 1R33A 2UY7B 1FV1A 3AXIA 3KPRA 5DLML 2XKNB 3M45A 3PWJB 1FVEA 4PJFB 3BSHA 1CE6B 5D5ME 2VRAA 4N3UA 3DXAB 5BRPA 2YA1A 3I3EA 2APVA 3C8KB 2N59A 3P9MB 5B3JE 4F7MA 3HBZA 1EGJA 3VJ6B 2ZP0T 3VGGA 1A25A 1NDMB 2AEPL 2IDCA 2JKNA 5CD3A 1CLOL 3TO4B 2JKJA 3PP3K 3JWOC 4KHTL 2N7BA 4OIFA 3TYGL 1LEGA 1FLRL 4UQAA 4ZTEA 5EO1B 3WXVH 3RIFF 1RXLA 1IAOB 1TENA 2KH2B 4R2GC 5E51A 4R3SB 5D70H 2Y1YA 5D8JH 3RL2B 2E9JA 4POYA 1B6DA 4PJBF 1BM3L 3PDGA 5DGRA 1RIUL 4PRPD 4TSCL 3C08H 4UT7H 4JRFA 5BRQA 2RR3A 4ENEC 1T80A 1ORQB 5DFVC 3WU1A 4FFZL 4WI5A 5ALCH 3SCMB 4DKEH 3O6FA 3WBDA 4JANA 4M6ML 1OF2B 2GPZA 2X6BA 3EAKA 4ZUVB 4XBPA 1BF2A 2G4EA 1FL5A 1I53A 3RVXD 1TUPA 1DN0A 1DQIA 4BWUA 1JNJA 3WNKA 4TULH 1BJ1H 4Y1AD 3TEUA 4PW3A 5J4MA 5DSCB 1QSEB 4FQIH 4PJXF 1T1ZB 2YD4A 3HVNA 1KGIA 2VE6A 3GMLA 4V1DE 4APQD 1MCWW 5B3NA 4V2CB 4TVSa 4WWID 1TTUA 2H1LM 4CW1A 2ICWB 4KVCL 2R2BB 3R18A 1JTTA 2CUHA 1OPOA 1IEAA 4JZJA 4IHBA 4PJHE 3QZWB 4DF9A 5ICYB 1OAZL 4X0NA 2DIEA 4GXVH 1XH3B 2DQJH 3IDMA 4PJCE 3I9GH 4IKIA 4L0ZA 5JXED 1SLVA 3ZRFC 2UY6B 3L6FB 5IJCC 3GBML 1RJYA 4POUB 5HPOA 5KYUB 3K4DA 4KX9A 5D1ZD 2EUZA 3SE9H 2OMYA 5EZJB 2JIXA 3SKUD 4HG4K 3D06A 1C7SA 4RH4A 1U8IA 4X99B 4D0DB 2OTPA 2WZPA 1TQVA 4F9LA 4NQDD 4K3EH 4HQQH 5E70A 4JREC 7FABH 1MLBA 2IALB 3VFTB 3LEXA 4G1EB 3E38A 1L6ZA 3GBNH 4LNRA 3HNTH 1DYZA 4U6HA 5C6PB 3O0RH 2FD6H 4ODTL 1YEJL 5B1JC 2WUBH 1KTKE 2GHZA 2YMXH 4B9PA 2A74A 1AD0A 1JXDA 4YIQA 3UJJL 4KY1L 3UBGA 3UTPE 4E42A 3DOHA 3F6LA 3T2NH 4HUCA 5FHBL 5CS7A 2AXJA 3DNKA 4LLVA 1U8KA 2AI0H 3VXMD 2IANE 4PGEA 5J12C 3F6JA 4IRZL 5CLXA 3SYPA 4MNHA 2P48B 3EW3B 4FQJL 4LVEA 4JS7A 3OQ3B 1MUJA 3C9NA 2X4TA 2XYBA 3QHZL 4NENA 1KB3A 4M02A 3S36H 1P4LA 1WFNA 2IQ9L 3MV11 3WUWA 5DU7A 2AAAA 5KAQG 4YGVB 1JPGB 2DQGL 4ZX3A 3HZYA 2E0PA 4NO3A 3B9DA 4Y9EA 1T6VN 3B7UX 3FUJA 4OQTA 2EVHA 3FC8A 1QTSA 3KPRB 3JUYA 3LS4H 2LAAA 2FQEA 5DWUH 1QR1A 5CLZA 4X6CA 3KXFD 3MX0A 5FA3B 2CR6A 1DO5A 4UZUA 3P3TA 4AYSA 2M8XA 3PL6C 5G2NA 3FFCB 1A64A 3H9SD 2YN3A 1QI3A 5C71A 3BJ91 3OAZK 3FONB 4EIUA 1VDGA 1MQKL 5LAXA 2GUOA 4C4KO 3TCTA 1P5UA 4YPGB 3ARFD 2LU7A 1E3XA 4PRIE 1QWHA 4NT6B 4PEEA 1FZOA 4UQ3A 1SLWA 3BVTA 3ECBA 4FLSA 2F53B 1BZ8A 2H3XC 1KGUA 1HWGB 1ES0B 3QAQA 2VM9A 5I8OL 1B3JA 4E9SA 4FQPA 1BAWA 4G6FB 4OBRA 5TF1H 3TZVA 2ITCB 5CEZH 3APNA 5E99H 5GRVK 3KZ8A 5IVXF 1FIGH 3HNVL 3WKQA 1T2JA 1J18A 3GT6A 1H3XA 2DAVA 5DHYA 4XNZC 3VFSA 3BVXA 1M56B 1F02I 3BCDA 5KVDH 4RISH 4GUQA 4I3SL 4XVUD 3VXRD 5C08A 3ULAB 3H3PL 2HCZX 2FWUA 3SKNA 4FXGB 4LVHC 1YEWA 1FCGA 2J1WA 4P2RA 3DJZA 2R69L 3QP3A 4M6NL 4KXCA 4UV4H 5E1GA 1GCFA 5TE7H 5EU7C 3RU8L 1EO7A 3SQOH 1MCEA 5IQ7L 5F1KC 3NJGA 3RVTD 4R0LA 3FTUA 3N1PC 4IEFA 4NNYA 4TS6A 3RGVB 3F05A 4OI9A 3ZO0A 5D6CA 1ITCA 1E5UI 1UATA 4BFJA 4PRIB 1MF2L 1NSNH 5DDHA 5DS2A 5L0QB 4HCGA 4N2HA 2P9RA 2VLKB 3SZKC 2ZYHA 2B0SH 5KSUA 3VE0B 1AS6A 4FL4C 3MSPA 4G1EA 5IB4B 5CN3A 1NBVL 1YEFH 1IE5A 4D0BA 2JB5L 4WSJA 5AVSB 3KWTA 2P45B 1DVQA 5HD8C 3HFMH 3VD7A 3LQAL 1TETL 1NC2B 3MLSH 4QJ5B 1DE4B 3D08A 1W72B 4PP2A 4F20A 1MQ8A 4IHOA 5FUCC 1G0XA 3BVWA 5GS0D 4MMXA 1CLVA 2ZX7A 5I73C 1A6ZA 4KK8C 5DT1H 4GKLA 4RAHA 1MF2H 1NSNL 4MA1B 4JQVA 4NWTL 4XCYB 12E8H 3D87B 2X87A 2DQEH 4Y5XA 1OXYA 1GYUA 1U8HA 4MAUH 3EFOA 5KJ7E 1Q1JH 2XN9A 1M53A 3EH3B 3SQOL 5ALBH 1NTDA 4FTVA 5E7FA 5TK2A 4UV4L 3C5JA 3BP6B 4Z3GA 4ADJA 3CFMA 3QQDA 1MW1A 4NM8L 4HMDA 4OLUH 5E2TH 1UACH 2BSEA 4ONGH 4MDIA 3CC1A 5GZNC 4P46A 5DUBB 4PLJC 3LZFL 3C12A 1L5GB 1EAQA 4XO5A 1DJZA 1HSBB 5D96B 3RVVC 3SOTA 5D5MF 3ARGA 2NY6C 3I2CH 4FNQA 4ODWB 3WLWD 3TC9A 1BZOA 1NPUA 1VGEH 4G6KH 1H8SA 3ARDC 4DGIH 4LFHD 4KK6C 1A6AA 1W6WA 4YHZH 1WFTA 2D8KA 4HV8A 4LAJH 3TT1L 3VD4A 3G9VA 4DAGL 2WW8A 4PUBH 3DHPA 4KKLD 3S3BB 4ONFL 1N8ZA 5F8RC 2DMKA 1OANA 2DIAA 2DTMH 1OAYH 4A7VA 4O4YH 4MQ7B 2XKSA 3GTVA 5TQ0H 5AB2A 3CUPA 4FGMA 4AXWA 5DHVB 2Q8AL 4NS0A 5HHMB 2XRAL 3P54A 5J6SA 1TQTA 5LGKA 4BKLA 4LAQL 1AO7B 3TO4C 3VI3F 2DF3A 2BM3A 4GP4B 1GTNA 2CJ3A 5AW0B 4H8HA 2D7TL 1UWFA 2JWYA 5BVPL 1SYSB 3SGDH 1SOSA 3ETBF 3D69B 2QR0A 1BECA 4QXTA 5I0VA 2BP8B 3QCUH 3RUGF 5L7XH 3T8XA 2NNCA 5I66B 3TEWA 1VEPA 2RFXA 1EDYA 1I8IA 4ZSOA 1ZLWH 1JIBA 3LKNA 4I5BA 3GUTB 2AJXL 3OKMA 3SCMC 4BK4A 3WS6A 5CCGE 1D5BB 4KQ3L 2O5ZL 1CO1A 2X40A 4X6CF 4ZYKA 2WBWB 4K8RD 3MJ8B 1JBJA 4Z7WA 1ZLWK 1UVQB 5HGDA 4FJYA 4MXVE 4OD1L 1TTAA 3Q44A 4Y5YA 2JELL 1IGTA 3IJEB 4UDTB 5INCB 5CZXC 4Z6AT 4F8QA 2IQ9H 3FW6A 3ARGD 3MACH 4XOEA 1JYWA 3ZIYA 5MENE 1NAMH 3V4LA 1M7DB 3QZNA 3BSZH 5EEYA 4HOWA 4XT1C 3VSTA 4NQQA 3ZZLA 4GG6E 2PP9A 4OVVA 4AJVA 1Y07A 4W4OA 3FT3A 4KGJA 5KSVA 3D09A 2G2NA 1FAIH 1I9JH 4JKPL 3LZOA 4HALA 4YMPA 4BE5A 4WI9A 5ICYA 5HYJE 4IRSD 1J8HB 5JW5B 3TIEA 3DX9A 4ANKA 1R3KA 4DUWA 1ASOA 2WIIA 1XHHA 2ZOUA 3HG5A 1MWAL 1SDDB 2YKKA 1E28B 2VDPL 3BKYL 2Y06H 3CPLA 1ZS2A 5F7EH 4PGBA 2NQDA 1H8NA 1H3WM 5EU7E 5C0AB 4D0CB 3MV7D 4ODTH 3VSQA 5EZJA 2JIXB 4UMSA 5FYKE 2CXKA 4JMXA 1A6WH 4JO3H 2VRKA 3V95A 1H9VA 5DHMC 3GBNL 3AU0A 6PCYA 2EDHA 5J6GA 3MMEA 1ZGLP 1V3JA 2J20A 4R7XA 3T0EA 4GSRA 5T5NF 1EMTH 5GS1C 2UZYB 3Q2WA 4NWUH 3OG6B 2Q86B 3RWFB 3RRQA 4ERSL 3VMNA 3QXDB 4U1GC 5AAWC 4JN2B 2PO6C 1XB3A 2XY1A 5B7EA 1S9XB 3ZDZE 5G5DA 3L17A 3D9AH 1JPFA 2GJ6E 1TO4A 2W91A 2EDBA 1WAEA 2OL3B 1IAKB 1O7DE 1S3KL 3I9PA 3PAYA 1U8KB 4F37K 1ZXQA 3DX2A 1AS8A 3CQQA 2HH0L 4EN2A 4B50A 4KNQA 2XN9E 1O9VA 1GOFA 4FXTA 4OR1A 1DJWA 4XB7A 5D1ZB 2QPFA 4LGSB 2IMMA 3CN4A 3TJHC 3WMPA 1R34A 4FQIL 5I74B 4IBZA 4YGVA 2P8LB 4OM0H 1G7HA 4YBQD 1JZFA 2VDOH 3FRPB 3WN5A 3IGLA 1GGCL 4K71C 4PRBB 4WV1A 2E3VA 4DVBB 5GRUH 5A2KH 4MA3B 1QA9A 4IRSA 2A77L 1J5OL 2C3XA 3ULUD 2GG1A 2J44A 2NLJB 5C0IB 2I25N 4TVUA 2N1TE 5ETUA 1F3DJ 5E6IA 4L4TE 3V4UL 4OJCA 3RWDA 3WTWA 1BQHA 4UT7L 4TSCH 4YE0A 2OMNA 4Y1AA 2N7AA 1EAOA 5E9DE 3UTTA 5F0JB 2XDHA 3HW7A 4FXLA 3AG4B 3SDCC 4QXVA 2OL3L 1ZTXH 2OZ4L 3ARBD 3H6JA 1U2HA 4FFYL 4LKXB 5EB9A 3Q1EA 3KPLB 5ISZD 4XOCA 2WXPA 3VH8G 3P4MA 4U6HB 5FF6B 1TZHB 4L8BB 3ULUL 4WNQB 3HRZC 3MNDA 5DEFB 5E2JA 5E6UB 3RWEB 5D2NC 3P73B 1GC1L 2VXTH 4PMEA 2OW7A 3RKDD 1DQML 2XTJE 2EDMA 2R29L 9CGTA 4GUPB 4H20L 2Y1AA 4WWKC 3U1SL 3OX8A 3LKPA 1ZKAA 1JHKL 2WJ5A 1DBAL 3IFPB 1S7UA 2R39A 5B22A 4WJ5B 4NOFA 5ILTL 2X09A 1KCVH 1Z2KA 5ITBH 3PAVA 4IBSA 4KKCC 4NKIH 5I1DA 1H0DB 4YHPB 1AJ7L 3HEIB 1UKSA 3TWCL 1IAMA 1BYOA 3H0TA 1J88A 1H5BA 3V5KB 5LXGH 3MRBA 4KMTH 4Q9QL 3KEDA 4X4MA 3W1ZA 4AMXA 2R4RL 4GAJH 5ANMB 4TVPE 1QHOA 3EDDA 5JDSB 3WIFB 3FPXA 3PIQA 1B0RA 5GGTH 3AB0C 1CFQA 3MYJB 4YHIA 1HZHH 4I77L 1FA4A 1HJCA 1GZHC 1KJ2L 1X7SA 2XV6B 4U1LB 1K8DB 3RGVC 3IJYA 1AQKL 5JPNA 3VFNB 4PWGA 4DUXA 2TAAA 3ESNA 4PTTA 4LEOA 3MNZA 1TKWB 4M43L 3U48A 4ORGA 2BO0A 1XMEB 5GZND 3U4BH 3QG6A 3K4AA 2G3XA 1FNAA 1J0JA 3MMEB 3PHAA 3MBWB 3V4VA 1CUOA 4FQXA 1XCWA 3UDWC 4FL4B 1G1OA 2NY1C 2Y2YA 4JX0A 3GHEH 5TGBB 2X4QB 4POZD 3UX9B 5EUKB 3GMOA 1YYMH 2V17L 1VPOL 4G11A 4M1CD 3FCUB 2XN2A 1S9XA 2VXUH 4XOBA 2BNQB 2GFBA 3O6KL 1M6OA 1ET7A 1LO5B 3AW5A 4OQTH 2E7DA 3PAUA 3ZL4L 3QR1A 3BYTA 1H9DA 1YJDH 3L7FA 3GBEA 1R17A 5I23A 5ACZB 2YQ3A 2IAAC 1Z9NA 4H26B 2FJFB 2IPKB 4KZEL 1OT2A 2HN7A 3X13B 2ZXDA 5KOVC 4XX5A 2NW2A 3ZTCC 3VWJC 3O6LH 4DQOL 3T0EE 4KH2A 1FPTH 5LBSL 4X4KA 2N0MA 1I85C 2RTTA 3MLVL 3CFDA 4BH8A 1XGRB 4WNSA 2VLJD 2NY3D 3WN5B 1O6VA 1UM4L 1VFBA 3WDJA 2VMDA 5CEZD 5L2KA 1QX1A 4AQAB 4XX1E 5H4YA 3MGAA 4A2DA 2DD8L 3CFIC 4L8DB 4PAZA 3TIDB 5IMMB 1B0IA 5BRZB 2EIZB 3PNWB 3T3PE 1IM9B 1PU0A 1S7QB 1KEMH 2IBZY 1LEIA 2GC7C 3CFKB 4B0MM 2WWKO 5L6YH 4WTQA 2EUWA 4JGNA 2X2HA 3LQZB 1W8EA 4FKEA 1I1FB 4TL5A 3B43A 2P44B 4UM8B 2ZXCA 4MJ4A 3AG3B 4D9RE 1AOZA 4BKLB 1TTRA 3O6MH 1ESOA 4NAMA 4AVKA 1E4HA 3KPSA 8FABB 5AKTA 1CFVH 1U3YA 2DM4A 3OB8A 5IB3A 4BUQA 4B7IA 2ZXGA 4HEMA 4ZPTA 5H2BA 1LQSR 1U0QA 1UWXK 4H1LB 5J57B 5ACMA 1YCSA 3VGEA 5HDQL 5GPRA 5JLZA 1V7MH 2W9LA 1J8HD 3L54A 5E4AA 4LL9A 4OCLC 1L4IA 4LLWB 3Q6GH 4W6YB 1HYRC 2NW3A 3J8F7 5GIRB 2Y07H 3OKLA 2QELA 2H1XA 1JGEB 2W81C 4NUJB 4Z7WB 3MLUH 1UVQA 1E6OH 1UKTA 4NHUB 3KW7A 4FP8H 2LHAA 4HWZB 2X05A 4MB4A 5JOFB 3ATFA 4Y16D 2XWBB 1N6VA 1FO0L 5JR1L 5SWQB 2P42B 2AQ1A 3PWUB 5LBSA 3LRMA 5C0ND 3ATBA 1WTGT 3L3DB 4XPFL 1HE7A 1U3HD 2HJFA 3D4ZA 4TRPH 2ZP8A 3L7EB 4LVOB 4TLTA 1Q72H 1I1YB 1NZRA 4FG6C 2A9DA 1SJVA 3FU7A 4GBXC 2A0LC 1QLEH 5E2VL 3DIVA 1BLIA 4G7YH 3UJTH 1O75A 1U8OA 4TLKA 1CF1A 2O93L 3FFCD 3QO0B 4PB9H 2HKAA 3CCHA 4Z77A 4K9EH 1NGYA 5FM4A 1F6FB 1IC5H 2PWDA 2VLLA 2VXVL 3RNQB 4TSBL 2WWNA 2AJ3B 3U2JA 4B9JA 3GHPA 1R5WA 3Q8AA 4OLYH 3FH8A 3P4LA 1D9KD 2JCCE 2MOQA 5AUMA 2AFNA 5IHUL 1AKJB 1IVTA 3BWSA 2BIIA 1KZYA 4YHKH 3AT9A 1EGJH 4ZS7L 3PXLA 3FQWB 3LV3A 1M1XA 1C8PA 2VITB 2UVEA 1SFDA 4FNSA 4NM4H 4ZUSB 4KI5D 3GNMH 1I8LC 3BUYA 4K5MA 4XO4A 4BK5C 5MEQB 1NANH 3QUYB 2HP4A 1WZKA 4CVWA 5CUSL 3VFGL 2BNQA 1FZKB 4HJ1A 3U82B 2GCYB 4LDLB 4YAQA 3BW9A 4M48H 5BOZG 2QSCL 3QEUA 1QUPA 1PQZB 3B1TA 5EWIL 1FHGA 3DROA 1GYVA 3H2PA 2BP5M 2OMWA 2HLEB 2JKLA 2X53A 4CN1A 3TA3A 5GISH 2OMXB 5JW4M 5GJSH 4C55A 5FYJU 4Y2LA 4JO4H 1ODUA 1J1XH 1BYPA 2BFVH 2HB0A 1RHHA 3FO0L 5I1LA 5AOIA 3HBPA 1MIEL 4B53A 3SE6A 5E1HB 3F3HA 4F7TB 4RFNB 3G6JF 3NACL 1ZVHA 5FOBA 2DWDB 1NGQH 3O3DB 3L5HA 3OB0H 4OT1H 4DTGH 3MRCA 1NAKL 2PLTA 4WFEE 1L9QA 4Y1SA 5IFHH 1S9WA 4ODVH 4OB5H 1YO4A 2X4RA 3UYOD 3QJQB 5IM7B 4JZJC 1HXYA 2DOCA 2APFA 2QHRL 3VMOA 3TURA 5CBAB 1MAML 4JDVB 1A6UH 4XAKD 3FHQA 2ERJB 1XF2A 1SDDA 4HD9A 3WNJA 1A6TA 2Q8BL 2RBLA 2FECL 1G9NL 2DWXA 3E2HC 4D8PA 4Q97A 3NOIA 1A6VL 4OGYL 4KKAC 1B88A 4OZFH 3DX0A 3X1NA 3A22A 3CDFA 4XP6H 3VI4F 1W80A 3EJQA 3DVGA 4XXWA 4YDVB 1ZLUK 1DBJH 4QTIL 1EZSA 4G9FB 3HE6D 2YJLA 4MXVF 4UMGA 4HP5A 4K23H 2YZ8A 3GM8A 4JFWA 3SDDB 1B4JL 5F1NA 1KCWA 5LNGA 5D1ZI 3EBIA 1JL8A 4N8VG 4XC1L 5GGUA 4AC4A 1P84J 4PR5B 5AVWB 5J1TC 1IGFH 4R2GB 4NFDA 4A2HA 4QDGA 3WTSA 3QXTA 1JF1A 2P5WA 3GZOA 1DJHA 1JPFB 2OSLA 2FECI 4PJIE 4OB5L 2GY7B 3RGVD 1A7RL 4CILA 3PU7A 5DRXA 5E5MB 1E2WA 1LDPH 2C1OB 3BISA 1CDUA 3OKLB 4WI4A 1WLHA 2LLGA 3GJFK 1CJYA 2FT8A 1HESA 3EYOA 3LRGA 3ARPA 4Q4EA 1NPJA 2GJZA 3O2WL 4JG5A 4TLSA 3GSRA 4N2GA 3UYRH 4NQDA 4HXAH 1NMAH 3K6DA 1LO2L 3GWJA 5DEZA 5DJCA 1JXFA 3FB6A 4NI3A 3U0PB 4PGCB 5EV7A 35C8H 4M93C 1DFBL 4N0FA 2G30A 4OCNC 5GISL 3FPYA 4UINH 2ADJB 3EGSB 3QEQA 2QQNL 5K9KA 2N56A 1T5WA 3B3BA 5DYFA 4DNLA 2BCKA 2Y6TE 3BN9D 4O2EB 3MV8A 4YL4A 3O11B 1YJDC 4WI0B 4N1CA 3CFCH 1AIFB 4OVUA 1KBKA 3CXHJ 5C0IA 2LU3A 3MJ7B 2W60A 4EN3A 5DQDL 3NCYS 3NH7L 2FUQA 3B2DC 4LPYA 3HBGA 4Y1AB 3BEVA 2A9NH 3AMLA 3V0GA 5IHUH 1BM7A 1J8SA 4LSPL 4Q0XH 5JHAA 4NC0B 3F2LA 5CJQH 5CXPA 4JQXA 2EXYD 5EO1A 3MFFB 2Y3AA 1HJBC 4G1MB 4NLAA 3LKOA 2A6DA 5EF2A 1F18A 1MVFA 1QATA 4GP8B 2F5BH 4H25A 5L4FA 5I5RA 4QUOA 2GVYA 4YSDA 1CPUA 3KGSA 3PV6A 4FYQA 3IKCA 1KB5A 3H85A 4HHAA 4JDEA 3CAFA 4H8WH 4N87A 1OTUC 2VR9A 4MX7A 1ACYH 3UAJC 5EEXA 2J72A 2VLRA 3UTSB 4M00A 3X3FL 2QVIA 3CFJB 5E1AA 3QDGA 2FJGA 1TJIH 4XN8A 4BDVB 1T0MA 3P3YA 1J11A 4FF9A 4KXAA 1OZUA 1BAFL 1I4FA 4H26A 3W0WA 5A1AA 1KB5L 4Y5VA 4AZ8A 1B6UA 3VFOB 5HXMA 3E1ZA 2VW4A 2B16A 3AY4A 3VG9C 2NY2B 4LNVA 5SWZA 3LJ3A 2O26U 1EQWA 3M7OA 5DMKA 4OJYA 3U6XS 4FZ8L 4YHLH 1IC7L 1Z9SB 2HKFH 2W1NA 5CIPH 5D1QE 3T0AA 3QORC 4MXWH 2B1HH 1Z9MA 5HDQH 3HTLX 4RAVB 3FQ2A 4NX0A 3GZQA 4GSDL 1JVOA 4U0QB 3MUJA 1R47A 4JO1H 5A3ID 3SN6N 4FKKA 3T0WA 2E4TA 1K3IA 3VQ1C 4PRHE 3D2UD 5I1IL 4RMSA 3PNWA 3O6ML 1IM3D 1ETA1 2AV1A 5GRJL 4S1RL 4KKPA 3BPLC 2GABA 4G9FA 4OD2A 3FFCE 3ZKMD 4HGMA 3JWNG 1M05A 2ATKA 3OAWA 3ULSA 1TDQA 4JRXA 5KWYC 2QGEA 1EO8L 3FOMB 1H8OA 2Y5QA 1QO3A 4NZFA 4DP5X 4XNAA 2D0FA 2ZUWA 3K8KA 3BKJL 1BBJA 5HI4D 2XPYA 1C8QA 1USZA 5F93C 1MZYA 2CBOA 4TTDC 4PVBA 1MEXH 3FOLA 3O2DH 5L8JB 1WFOA 3LEYL 1RZ7L 4HIIB 5JLZB 5HYQB 2A6KB 4HJUA 3B3IB 4NP4H 1U3HA 3FB8A 4B96A 4R4FH 4CL7A 2XUWA 4ES9A 3SGJA 4UOZA 3MKKA 1KG0B 3RVVD 3MUZ1 3ARFB 4LOVA 1ND0A 3SYAA 1K9TA 3EO0A 4AI7A 1E30A 4KZEH 4LFHG 3IJ8A 1XFPA 3MA9L 4H2AA 4KV5F 2Z64C 2NNAB 1F42A 4JE4B 1T89A 3V0IA 5HVHC 5KS9F 3CSYB 5D7IE 4MMZC 2XWBA 4G5ZL 4JRWA 2A74C 1L6XA 3B6SB 3KYMB 3IFNL 5EA0L 5EFIB 2XVKA 4OM1L 1MXDA 3O11A 3AAZB 4UM9B 2ATPB 4OZFA 3ARVA 1KXQE 4PYGA 2H3KA 3L3DA 3PUCA 3T04D 2KPNA 3BYYA 4NQEA 4WWPA 3RTQD 3V0FA 3I9IA 1E9PA 1EX0A 2AJYH 3GHEL 3MLWL 5I8CB 4KJQD 5IQLA 4JPIB 4AEFA 4JG9A 4KZCA 5JUEL 1YY8B 1HSAA 3V4PA 5I16A 3GS0A 1OB0A 3VJ6A 3VDCA 5IHBA 4YZFE 2X1XR 1OGAA 3NZ8B 2CCVA 2GY5A 3BUQA 5ECGA 4NT6A 3ELQA 3Q2NA 5I6OA 1IJNA 2YEQA 2AEQH 3LPWA 2X44D 4PD4J 5JTWA 3UMTA 3AC0A 3H9SA 2VN4A 2ENPA 2WZ6A 5JA8B 1CD0A 5KSAC 3W39A 1U95B 4ZMAT 3QUYA 1KEGL 4KDTC 1KJ2H 1S5IL 2P5EB 3DVNA 3MGTA 1SMAA 4E5XA 4NZ8A 3NN8A 1JOIA 2ITCA 3FSAA 4F7EA 2WVSA 3DMMA 4NN7C 4QF1A 4RMQA 4ZNEE 1BJ8A 4MA1C 1KYAA 1BQKA 4PYHA 3BSZA 5IW3A 2FSEA 4HSCX 4U4IA 1TJGL 3V0WL 2FIKB 3T4AA 1FL5B 4O9HL 4KMTL 2WJ7A 4GNKB 1KIQB 4A1RA 5FW6A 2H0PA 4GQRA 1NC4B 1P2CA 4G3YL 4ZQKB 4A04A 3TWCH 5E8OA 5F7NC 2NXYB 4QAMB 4ODUB 1PMYA 4PJ9D 1CGVA 1GAFL 4NYLB 3LXBA 4MCNA 3KDMB 3VWKA 1MOEA 1NC2D 3OVUB 3O8XD 4KRPC 4G8GE 1CDJA 2X4UA 1AQDA 1JHKH 1BVKA 1I1AB 1G7MA 5SWZD 1X5YA 4MYWB 2R29H 4GKOA 1CBJA 4L4TB 1P9MA 2Y7QB 3NIDF 3OMZA 2UZXA 3BQUC 1SN2A 3CK0L 4LL4A 4AG4H 5IHWA 3SPCA 1TFHA 4PRIA 3RZCC 1WA2X 5FYJD 1MFCH 3NUKA 2HFTA 2O5YH 4OIAA 5L4IA 1HILB 4MQTB 2COQA 4HIXL 2E27L 2R0LL 2F54B 2IV8A 2HG0A 2MIZA 3BVUA 3N41F 3QQ9D 4KJWD 4JZOA 3GF8A 5A2IH 4S1SH 4PGJA 4L4VD 4IRJC 3Q2VA 5EU5A 2LAGB 3EXJA 1ZJAA 5DZPA 3AXLA 5AOKA 5D4QA 3AQZA 4C56A 3AS0A 3L95B 2BNRD 4WU5A 4BFNA 4HOZA 4MVBC 3RWGB 2BXZA 2GAZB 4YO0B 2VDKB 1S4IA 4JFFA 5DC4B 5IOPB 5EU6E 3CU1A 4UBDD 3EOTH 2FLMA 3LNIA 2C3VB 3IETB 2CM5A 3QEUB 5ANME 3WD5H 4HCFA 4WCYH 3KLSA 1GGCH 4KO7A 4MCZA 1HL4A 1NFDE 3HHMA 5I6LA 5DMYA 2OXGB 3PCYA 1YY9D 5E5MA 3E7JA 2QBWA 4P46B 5DUBA 2XIBA 3O8XA 4AGOA 2GJZB 1N18A 2DWDA 4A38A 3CSYA 1CU4H 1XAKA 3IK2A 3GB7A 2HRPH 1KN4H 4PRPB 5DI8B 5EH1A 3JXAA 3VSUA 1T0OA 2NY3C 2PF6A 4N25A 5ICUA 4R97B 4X9IA 3HE6B 5C07B 3ZE1B 3S2CA 5I71C 1TZIA 4HPOL 2MNJB 4N0UB 4F9PC 2IADB 3KPSD 4HFWB 3VG0H 3WDHA 2O61A 1CXIA 4EUPG 1IM9D 1LDSA 2VLMD