2ITFA

Crystal structure isda neat domain from staphylococcus aureus with heme bound
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
b'ATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein A
molecule tags Metal binding protein
source organism Staphylococcus aureus
publication title Haem recognition by a Staphylococcus aureus NEAT domain.
pubmed doi rcsb
total genus 25
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2itfA00
3QUGA 4H8QA 3OVUB 2ITEA 3VTMA 5D1QE 3SIKA 4H8PA 4WJG3 3QZLA 3QZPA 2O6PA 2Q7AA 2Z6FA 4YMPA 4MYPA 5D1XE 3QZOA 5D1ZI 2E7DA 4NLAA 3RTLA 2K78A 2MOQA 4FC3E 3QUHA 3SZKC 3QZNA 3RURA 3S48A 2ITFA 2O1AA 3SZ6A 3QZMA 3VUAA 2H3KA
chains in the Genus database with same CATH superfamily
1UA6H 3DURB 2GBAA 5DJCB 3SPVB 2AC0A 2IDTA 2IXQB 2UWEB 4BFIA 4GUPA 2FIKA 1FNHA 1ZT1B 4LLQA 2RFXA 2KQNA 3SOBL 5C0GB 1TEYA 1EHLH 1YEKL 2AEWA 3O6KL 5T1DL 4MCMA 2EKSB 4TSAL 5DHYB 4KI5D 5G5DA 1SY6H 4KC3B 3VWKB 1D6EA 4A6YL 5C09E 2NY4C 4HXAL 3C60A 1XF3A 3UAJC 2OYKA 3VGHA 2VC2L 4ZOAA 3FQ2A 1MHCB 3MRDB 32C2B 4FI6A 3MRJB 4AQ1B 5DHMC 1TVHB 1LWHA 3CQPA 4LSTH 1AQKL 3ENEA 4LPTA 4P23A 3KLLA 4XP4H 2PW1A 4JREB 4MAYC 2YEZA 4NHUB 3FQRB 4ZMNA 2CK2A 1TYEB 3UZEC 5JW4R 4KTDL 4HUKB 2I69A 3FUDA 3BYTA 3T3PF 1E5YA 2X6BA 1TO5A 3Q01A 2JKTM 2VMFA 2E9WA 2WPGA 1SHXA 1ETA1 3HN5A 4MNQB 2LAAA 2WTRB 2CUHA 2XRAL 2NQ3A 2WZ5A 3BMVA 3CCHB 3IETA 4N2NA 3FQXB 3B3IB 4H7VA 1VB9A 4JG9A 1EO8H 3RURA 4ZXBD 4DP8X 4LLYA 1U3NA 3O4OC 4BKTC 4Z3GA 5F96H 4MYWB 2XNAA 3H1ZA 4NQEB 1JWMB 2JIXD 4B9KC 4L3AA 5HYFA 1KIPB 5LAXB 1WH0A 2VJXA 2VLJD 2QFPA 4MQ7A 4CBZA 3CU7A 2DTMH 3KPQA 2L8AA 4YHLL 5L88H 4ZOEA 4E9SA 1PVHA 4MA1B 4FERA 3U48A 4AH2B 5E70A 3A4EA 1MQKL 5ICZA 3TS8A 3K5SA 1VIWA 3HZMB 1BMGA 4ZQKA 2VGLM 2NUPB 4K3DH 2BOBB 3L1EA 4GQPH 3RVVD 2EECA 3QJFB 1KV7A 4Z78B 1DCEA 4LOEA 3QEUA 1KEML 4G42A 2AMUA 1C5CL 3ILPB 3MCKB 3FT2B 3IBEA 4Y4HB 1L7TH 5DD1H 5TDOA 1YMMD 3GO1H 4LOFA 4PGBA 3S7GA 4JCLA 1N59B 2V9RA 3RWFB 3OKKA 1HQRB 3S3BB 2BOCB 2H0FA 3MOQA 5GXBB 3MNVB 3WN5C 1EIBA 1F1GA 3MACL 3MXVL 1JNNH 4AMKH 1KN2L 2ZYHA 4IRSD 1PCSA 1A4JA 4Y5YC 1IFHH 2BP8A 1BBJA 1BYPA 1MFVA 5EC1B 1TZOA 3UDWC 1OSPL 1XB3A 5EN3A 3MBWA 4XHJD 2YPLD 4N20A 5BUPA 2DZEA 3V4VL 3U1PA 4ESKA 3L7EA 5KSAA 2WWNA 3DJZA 4OZFG 4UOQA 2DM2A 3LSOA 5SX4I 1K6QH 1JI1A 1BFVH 3EBGA 4H8PA 1FIGL 4QHUB 2CGZA 5C07A 1MVFA 3TFBA 3BYYA 3O3DB 1DUZA 1PDKB 2AQ3A 2HPTA 2OP4H 5I6LA 3BJ91 3WO4C 1NAMB 2PXYB 2R51A 2Y24A 4FNQA 2ADJA 2W60B 1CICB 4S10A 2NNFA 3ZE0B 1VKXB 4WI6A 1JV2B 1LEGB 5DS8B 3HC3H 5AVSB 2R0ZL 1AZCA 4U2YA 4PP2A 4JPKL 2TSBA 3RGVC 1E4WL 2YRPA 4ZFQA 2P5EB 3EJJX 5LCVA 3GMQA 4L8DA 1IC7H 4X6DB 2BVQA 5HHNB 4DJMA 5FF6A 4PYGA 4UYPA 1KTKE 4WJ5A 5D7JB 2BM3A 3CVHL 2ROYA 3N55A 3P77A 2NW3B 3VRLF 1G7QB 2AXGB 3D85D 3BKYL 4LSQH 4K8RL 3MUGB 5KSUA 1EFQA 4UQ3B 3BPLC 5FW7A 1ZSHA 4NDMB 5ABAA 3NH7H 2R23A 3V0IA 4M3KB 2FSEB 5FYLD 3VFNA 1I1CA 5E8OB 4JFZL 3G5WA 3SGJA 1UOWA 3L3KA 2X1XR 4F3FB 4AYID 4O4YH 1WITA 2G3XA 4S1DD 2WBJA 3GWJA 4L1BA 5CIPH 3MLWL 2GTZA 4XP5L 3DSFH 4LCIH 3GHPA 5IHLB 2APSA 1EZVX 2ZZUT 1RULH 4OLWH 3EFDH 1SOXA 5D7LA 2NW2A 3MRIB 4EXKA 4NNXA 3CFMA 3QR2A 5D4JA 3FB8A 1NCCH 1K2DB 1TQTA 5HBBA 1LO2L 3GLAA 2FJGA 1RHHB 1AHWB 5CJ8A 4LVNC 1ZA6B 5I1KL 5KG9B 2O6DA 5IFJA 3LD8B 3ESNA 4R26L 2EDKA 5JYLA 2C3XA 3WMQA 5C0BB 1TZIA 3NSCA 3FBKA 1TLMA 1S7RB 4WCYH 4YDZA 5E0FA 3B2UD 5I2IB 3EXLA 5HHOA 3ILQD 4WENB 1OB0A 5JIIA 2XHNA 1RZ7L 4Z7VB 5CBEA 4UT6L 3NIGF 1G9NH 1P1ZB 3CHPA 4WI8A 3D0VB 5F88A 2YR3A 1N4XL 1J48A 2HT4D 1HNFA 3HZVA 4QOKA 1WTLA 3VFGH 4MRCA 4Y2OA 3MV7E 3NZUA 3PHOB 4R83A 4XMTA 1II4E 3SOTA 2EEBA 3TX4A 3V6ZB 3MKGA 5B8CB 4UTBA 5LBSA 4B6ZA 3PY9A 2WGNB 5CZRA 1J9SA 2FSEA 4MB4A 3GGWB 4KJYA 5DVMA 5E2TL 4DW2L 5DJ0B 5FYJH 1CQYA 5G55A 1NEZA 2OTWA 2NT0A 4ZD3H 4AENB 3TH2T 5TF1H 1BVKB 1VAHA 3D48R 1UKQA 3ZY7A 2AQQA 1CE6B 2VE6B 3SCMC 4MSWB 3EOAA 3ILQC 3PHQA 2PWDA 1R3LB 3CSBA 4PEEA 5J6HA 4HV8A 4I18B 3ZKQD 1ILSA 2VDRB 2WINA 4YK4B 4JY6A 7PAZA 3UTQA 3LIUA 4YNYA 5JPMC 3K91A 4LHUD 1MCPH 4BEIA 1QFOA 5IHWA 1OARH 2XWEA 3SDAB 5HYJA 4NZUL 3TZVA 2X6MA 1M7DB 1XR9A 3TJHC 4AVKA 4WEUD 3ZO9A 1HCZA 4ZMOA 5EDSA 1SEBA 5KAQG 5DK0A 1Z7JA 3LV3B 4KO9A 5F7AA 2XWJA 2XFXB 4UIKL 3R0NA 1CLYL 3ZDXE 2PP7A 5GS3A 1QLFB 3TBTB 2AJVH 4IRZH 1R6VA 2JXMA 3T65A 2GJPA 4C56E 5F21B 5GGSA 2QZQA 2JNZA 1B0GB 4I9XA 4YO0A 5CMAA 2Z31A 3V6OA 4NOBA 2H47C 1UXSA 4G83A 1HHHA 1Q94B 1CDJA 4OBRA 5KZCD 1Y1UA 3KL0A 2QKSA 1QYGH 3CLWA 2VR8A 5G5DB 4XPHL 4L1LA 4L3EA 4Y4HC 5C8JA 2WKOA 3H0TB 1XF2B 4W6WB 1NWOA 3FO2B 1TDQA 5L88L 5D71L 3MJ8A 1KENH 3GEFA 2AJYH 1MCOH 3P2BA 3P4MB 2HKFH 3NJNA 4MJ6B 4APXA 4NCDA 4GKLA 4G7RB 1GJWA 4X8JA 1N0LB 2CZNA 2X4RA 3PP3H 4CADB 4P46B 5EU6B 3IFPB 5C0ND 2QVMA 4OLVL 2X05A 3RPIA 5JIKA 3SQOH 8PAZA 5HXMA 1CFQA 4XO8A 2C34A 3HE7B 4BRJA 4GG6E 4HIJB 3MA7A 3DUUB 4PW3A 5DJAB 4J7RA 5JIMA 1T66D 2KI6A 4PMEA 3MMEB 2ED9A 3QUKB 2QQNL 1TTFA 5C86A 1JVOA 3ZE2B 5I1IH 4X4XB 3P30L 3N40F 2QSVA 3AXHA 4UOZA 2CXGA 1O7SA 1EJ6A 2OMUB 4LL4A 4FRWA 4P9ML 4Y2DD 5F3BA 2K3TA 1MJ8H 4TQIA 4YEFA 4MA7L 5D72H 4PREB 1MWOA 2N01B 3MDJA 1KCVL 3ROLA 1OTUC 3P54A 3MNWB 4D8PA 4K23H 1U8LB 2RQ8A 3ELQA 2A6DB 3FUKA 1JPSL 2E6JA 4Y19E 1IX2A 3QQ4A 4CDHA 3RFRA 5J06A 1KWGA 3KL3A 4H1LA 1BQHG 4AEIL 1LD9A 4ACPA 2PCPA 5T1DH 2WIMA 4UTBL 5I16A 2AQPA 1C8QA 2C7UB 2J4WH 3IF1A 3KYMA 4PQXA 4GT7A 1L6XA 4ZMPA 1FZOA 4DWHA 2JB6A 5HDQL 3MREB 2BSTB 1WGOA 2HP4A 3VD7A 5E6RB 2ADIB 1BVZA 1CGXA 1N59A 3AQDA 3IK2A 1UVQB 5FUZH 4N25A 3K7UA 1BG1A 4WU5A 5HHMB 2X9YA 4JO4L 1A2YA 1K5NA 1E50A 3D3VD 1TCMA 1TU2B 4PJ7E 4ZD3L 1B6DA 3GXPA 4G6ML 4Q6IC 2EIJB 1L7TL 1ILUA 2YQBA 4HXAH 1PIFA 5DYOB 2IPTL 1UT9A 3T4AB 1KXHA 2JCCF 4KO6A 1U0QA 3GXNA 4C54A 1ASOA 4MNQE 4PJFE 1F56A 1QR1A 1ZIAA 3QRBA 2ARWA 3VI4E 4I88A 3LN4B 4K3JL 5FGCB 3S3SA 2WBXA 2W0FA 3KAAA 2XZQL 4LVEA 5DD5H 3HFMH 5BOPA 3BIAX 1RIVL 1MCRA 3NGBC 4WUUE 3T0WA 4FZEH 2P8MA 3H8NA 1RURH 3ROLB 3MROA 3P4LA 1IT9H 2JKJA 1TSRA 4LL9A 3DTDA 2GI7A 1GGCL 1AC0A 1XAKA 2EH8H 3IN2A 4JPVH 5AW7B 3GB7A 1OP9A 1UZ6E 3VXNB 4F7KA 1HEJC 2EYSB 3INUH 1MREH 5C0IA 4DKFL 1I8LA 2XG4A 4JDZA 2YRBA 1FORH 2BY0A 5BUGA 2DQTH 4IIQB 5F7UA 4U3CA 1MELA 5F9WB 2RA1A 1J10A 2WM0A 3AADB 3MJ7B 3BUYB 4QJ5B 1C12A 2PUQT 5C7XL 3P3SA 2H32A 4WSKA 3SYCA 3UAEA 1A6AB 3C5SA 2RBLA 3HPLB 5IT2L 4TQ8A 3JV6A 4JUSA 5CILH 3RBSA 3AM8C 4ADGA 4K9JA 1LEKA 3SDYL 1DUZB 4HWBL 4JCWA 2NTFB 5CJQH 4HJJH 3GI8L 2G0KA 1WAAF 2CKNA 2AAVA 4M7JH 3JTSA 1MN4A 1BZEA 4XGZB 4TSCH 3BZDA 3LQZA 2B2XH 3ZZLA 4F57H 3K2UL 5I75B 4X7DC 4HFUH 3HS0C 5C0AE 4WV1B 2P5WE 3IJSB 4HBCH 1J18A 1R19A 2PWFA 4X7TA 4PHZA 5FV1L 3VXMA 4XXWA 2AVGA 1J8KA 2DQEL 2WXNA 4KHXL 2WO3B 2A9AA 2V37A 1Y6NR 2YFNA 5KSUB 1A25A 2WMPA 2DBJA 5I5MA 1DANU 1JHTB 4HPYH 2JI2A 3O4LB 4JM2A 3QZWG 4HHAA 3TT1L 3PNRB 1TZGH 1N67A 3KL5A 1ZTMA 3GTTA 3DX2A 2OMXA 4XN5A 4N0CC 5GHWL 4OY9A 2O93L 2BJML 2A77H 2E8ZA 3P02A 1IGYB 3MLUL 3OJDA 1NOAA 1T7VA 2PR4H 3SDAD 2VKWA 4WIQA 2M26A 4DP0X 3I75B 2RH0A 5BV7B 4HISA 1JPFB 1W8EA 4GRMA 4MCZB 4ORZC 1IM3A 5DURB 3BN3B 3KPOB 3L1FA 4YWGL 1PAMA 2DQTL 5BQDA 3VRJA 4EIZC 5KN5A 3FQYA 4Z95H 3CSPA 4IJTA 1JGUH 1RUAH 4KI5C 4WQOA 5E8DL 4FLHA 1R75A 4E41B 5EDXA 3RAJL 5KW9L 4AENA 2Q8BH 2NYKA 4P2CG 5LGHH 5FPIA 1L4IA 3OJVC 4GAJH 3QPQC 4PGDA 4Q74A 5TE6H 2Y9RT 4AJWA 1R0AL 5JQ6L 4AOFA 1BYNA 4FNPA 1QP1A 1DVXA 3GEWB 5D7IA 2FUTA 3NP3A 2QVTA 3TO4A 4YBQD 3CG8A 2H6PA 5EG6C 2J72A 4HIPA 2G2RB 3PNWA 4NCC1 1MFCH 5ALCH 2Y06L 2YD6A 4OV5A 3LRLA 2ITCA 4NUMA 4Z76B 3KPNA 1KGIA 2VB5A 4YS4A 1YMMB 5DZPA 3IS0X 4EZJA 4X6EA 4XAKD 4POUB 4AZ8B 3VNYA 1U91A 4PI2A 4NSKB 4B95C 4JG0H 5LAPA 4L4TD 4S11A 32C2A 3N44F 4K23L 1TNMA 3QI9A 5DTFB 4D0BB 3HLKA 1TYRA 3RDTB 1LXMA 2OJZH 3ARGA 1QEWB 4U1NA 4U6HA 3H6AA 2CRMA 3CD4A 1QLRA 4PRID 5T1LB 2FBRA 3FT9A 1X7SA 3KNBA 4LCWE 4U1IB 2WSPA 3ARDD 4L3EB 5C8JB 4RMRA 4W70A 3L4VA 3DURA 2OMTB 2QV4A 2XQ0A 1E4KA 3U46A 2YN3A 2CIKB 3VXME 3AY4A 4E41A 3FO0H 1LILA 1U21A 4IBWA 2ESVD 3ZXAC 3WUWG 1B9KA 2XPGB 3BD3A 3LNFA 4HZ1A 2KZ1B 1ID5I 4FDWA 4DKTA 5C0CD 4NN7C 5IVZB 4JZNA 5E9NA 1D5XB 4OFPA 3REVA 1BOGB 1NJ9B 4YZFE 5MEOA 5I30H 1V27A 2HZHA 2FE0A 2WSDA 1QLFA 3K4AA 4IRSC 1X5MA 4MA3A 1W9XA 5H35A 3IU3B 3T8XA 4UM9B 3L08A 2AXWA 1SJEA 5BZXA 3RGBA 3D85B 1N7MH 4LOUD 5D2LB 5F1SA 2OTPA 3KPTA 4XMUA 2MCG1 3BX7C 5A6IA 2FSDA 4B7LA 1A6TB 4MAYB 5DUPH 1EO7A 4YOKA 3BO8A 3CZUB 4G80B 3DIVA 3RVUC 1LE9B 1TZ8A 4GG8B 3GSUB 5IK3B 4MNQA 1BXVA 2PYED 3H0TA 4LCWA 1VDGA 3BKCL 4ODSL 5E6ZA 2Z1KA 5TFSH 1IAOA 1KTDA 1X3DA 4HS3B 5TH2A 1UB5A 5DC2A 3BSZH 4B5ZA 3HNVL 4JN1H 1SMDA 3O4OB 4HDIA 1I4FA 3BT2H 1HWHB 4Y1TA 5ESVA 1RZJH 1A1NA 4NHUA 5CBAB 5I28A 4ODBD 4A67A 1PAZA 1AR2A 1GGUA 1L6PA 5KSBF 3TV3L 1DR9A 4LARH 1E43A 3BAXA 3QCVL 1U8IB 1KJMB 3WS6C 1MFAL 4PRHA 1INQB 5F7HA 4MQTB 4FHBD 3KWUA 3W9EA 4UB0H 3G5ZA 1WICA 1JTPA 4I77L 4AEIH 5KYYB 4PJ9A 2Y2YA 4LBEB 2VM3A 4R4FH 3D30A 1IC1A 1RUPH 3OKDA 1AS6A 1ZGLP 4OCWH 3VFVA 3PWLB 1O9VA 4NO2B 3UIYA 4JFTA 4JKWA 4WFED 1AFVH 4U0RC 5IM7A 1UOLA 4H44C 2COVD 4S1DC 1OWRM 1V55B 2JQMA 5JR1L 4FQCL 4KV5E 3E6FA 4JHZA 2WQAA 3B6SA 2DM3A 5D1QA 2QJDA 3P30H 5JORA 4Z7VE 5G4NA 5D1ZI 3Q2WA 5FECB 1XWVA 4F9LC 5L0QB 4OCXL 3ZTEA 4UT6A 4U6XA 5KUMA 4PYHA 5AKTA 3VQMA 1PFCA 3HPJA 2X89A 3UAJA 3WCYA 5EMYA 3IGKA 3FT4A 1PZ2A 1YY9C 4XMPH 5AAMC 1DBBH 3UCRA 4M8VA 3VA6A 1HVXA 3QNXA 4CILA 1IC0A 3DECA 1B0IA 1IBFA 2ZP9A 1MJ8L 5EC2B 4LLAA 4OUUA 5E5RB 4QY8B 4JJHA 1UM6H 5HYEA 3VFPA 2F7QA 3EF4A 1BQ5A 4G9FB 4BUQA 1T1ZA 3DV6A 3VH8B 5JIHA 3ZL2A 1DN0A 3HUJA 3LEYH 4PJ8A 3U0WL 1WWAX 1U8OA 1I9JH 3P73B 1MRDL 2FZ3A 4AX3A 3DO7A 4YUEH 3PWUA 3ZE1E 5ETUB 3EDFA 1FNSL 2X2IA 2QELA 3NABH 3Q1SL 5B39B 2UXTA 2FB4L 3DDFA 4HJUA 4L3EE 1WIPA 1AHWA 3JWNG 2AGJH 3RWDB 4XPGL 5CJ5A 1F02I 2L0DA 5AD0A 5L2KD 2VUYA 4PGCA 5GSRB 1SBSH 4KVCH 2DIJA 2J25A 3GMMB 4O02A 5F9OL 2CBQA 5CGMA 5IW1B 4NO5B 1FL5A 1F0LA 1MCOL 1G7PB 3GPEA 5JXED 2I9TA 4XNUH 5FK9A 4Y5XC 4OF0A 3BLPX 3B2XA 1ZLUH 2YAOA 1R3JB 3QG6A 3EYQC 4AQEA 2XA3A 1WZMA 2WBJB 3QIBB 3KLAA 4BZYA 2LHAA 2VERA 4ZAKA 5C0IB 3I9AA 2R1YA 1Q0XL 2Y07H 3QDHA 4YLBA 5E6ID 5IB4A 2IALB 1QOKA 4FTDA 2GK0A 1E30A 2HLFC 4PV8A 2HWZH 1IEBB 3LZLA 1HJCA 4XNBA 2X70B 1BREA 4X9YA 3VXSB 5KANG 3K4DA 4YH6A 5I0YA 2EC9U 4NWUH 4NWTL 3SDDA 3CX5K 3FT4B 4N2CA 3SJVE 1MFDH 2NY2B 4OLZL 3WIIL 4PBXA 2EVGA 4P46D 1ZHNA 1P2CB 3NAAH 3OJ2C 1K4DB 4KPHH 4XXWC 3M17A 3X14A 4ZFFB 2RALA 1U3ZA 4H0LC 1ZHKB 5K9OA 3GMRA 3PQYE 4NPKA 1BIIA 1DN0B 3L1GA 3WL9B 4EJ1C 1ZS8B 1U8PA 2B14A 1IIKA 2R1WB 3FQNA 3E6HB 3UPRA 5JOFA 4TNWK 3E2HC 4JDTH 3DOHA 4Y2DB 4LLDA 2Y3AA 2ZG1A 1FPTH 4YHZL 3HW7A 2Y7OA 2WLYA 1YEIH 1GYCA 2DQCL 3L95B 1IM9B 4RWYH 3RWCA 1DQTA 4HEMA 4A38A 1SNRA 2JKNA 4ZI8A 3WBDA 2HPOA 3TV3H 2NUTA 1CLOH 2EZ0D 1M7IB 5I1DB 3VFWB 4AMKL 1OB1B 3US0A 4JHBA 4H40A 5D1XD 4K5NA 1AFVL 2CBMA 4JFOA 3RGVB 4AMXA 5DLML 5C0NC 2BHFA 4F8PA 4JFFA 4XCEB 1VGKB 1RZGA 2XY1A 4NQDB 4Q6IA 5JIPA 4MVBC 4IRJD 1A6PA 5DEZA 4GUCA 1ORQA 4BCZA 3WIHL 4FJYA 5LBSL 2J20A 2GY5A 3KPNB 4DVBB 4HJ1A 4WNJA 1UZ8B 5DUPL 1ZD6A 3V5KA 1X9RA 4QT5B 1ZEAL 1I7TA 1GMIA 1WHOA 2J8UF 5IQLA 2YC1B 2Q8AL 4XT1C 5HYQA 3P11H 2Q20A 4NC1E 3O3BA 3ECBA 4A7SA 3QWRA 1EEQA 4YHLH 3TVMA 5I73B 1V8HA 4AQ1C 1J5OL 4ZUUB 5F7WC 4ONFH 3FTVA 2W92A 2Z8SA 4K7PH 1THCA 4G72B 4P23B 2X4RB 4G6FB 1IAKB 1N6QL 3JWDC 2I60L 1H3PH 4Y5YB 4N0YH 5FHBL 4O58L 3QUYD 3VD2A 2WLIA 5E9DB 1YY8B 3TNMA 1JNLL 4PG2C 5ACZB 3RKDD 1YEHH 2DI9A 1BJMA 1JIBA 2NCMA 1EGJA 4M62L 5CWSA 3BGMB 1I85C 5LWYH 2VW4A 5EFIB 3HMXH 4M61A 4LEOA 4O02L 2MPAL 1M56B 3HS9A 2VZTA 1ZT1A 3OHXC 1IE4A 2JCCA 1TEGA 1HEZA 4Q2ZA 2NUTB 1FE8L 3S37X 1DVUA 4GFXA 3EYUL 2YAQA 4IOIB 4J3VA 3HKFA 5DHVA 4OCYL 5GRXG 4N3TA 1KYOJ 3QZOA 2A5UA 4GXVH 2YEQA 3NCBB 2F5BL 1JZJA 5KBNC 3M7OA 4JFVA 4XN1A 2W80C 3CMOL 2LTQB 4NQED 4N0FB 3FQRA 1E4KC 1LD9B 3LZFH 4PGJA 3CU1A 5HDWA 3NGBB 1DLFH 5F7KC 3TO2B 4BFFA 5I66B 2BOBA 5CR1A 4S1SL 3M8OL 4BH7A 5D5MA 3T6XA 4CSSA 4ELMA 5HHXL 3VFOA 4ICWA 1QBMH 3EDKA 1UVQA 2R2CA 2WYTA 2AQSA 2X4OB 3BDYL 3RWHA 3C8DA 3ZKMD 3BH4A 2NY5L 2BOCA 4I0PA 4ES8A 1CZ8L 2ZF8A 3MUY1 4HJEA 1VZGA 4JRLA 1HCYA 1YC7A 4TV3A 4UILH 3OR7B 2F54E 1PKQB 4GBXC 4GW4A 5IB5B 1WC7B 2EIEA 4PB9H 4N6RA 1QZ1A 5DJAA 5K9JH 4UM9A 2GSIA 5EU5B 3LKQA 1RQ5A 3SY0B 2OCFD 5D7KD 5KUKA 4M56A 1SY6A 3OGCA 4M7LT 1HNYA 4G82A 3V5DA 5EWIH 3VAEA 1UURA 1ZHBB 4OI9A 4Z7UE 4AV4A 5I30L 3QHFL 3PF2A 2DWXA 4HKXB 3FKUS 1OP3H 4FQHA 3IDUA 1VEMA 4UTAL 1MHPH 1QA9B 1AO7B 2QR0B 4A68A 3KPSB 5AZUA 1F4XL 3O6FA 4GAJL 4W4OA 3C9NB 2WQUA 3KJ4C 5BXFB 5AOJA 5LDSA 5F1IB 1K8IB 4CJ1A 3FB6A 1SJVA 4F37F 3DSNB 4QTHA 2YPKB 1KBVA 1N2RB 2ZUVA 3HG3A 3AACA 1FRGH 4OKVA 1EAPB 4JG1H 1S5HB 1FZOB 4HSCX 4HH9B 3TYFB 2DIBA 4LSPL 1AH1A 3BP6B 1CDGA 4YPGA 1E9QA 2AANA 2D9QB 5I76A 4XVJL 3AT9A 5T5FL 5KSBB 2FATH 1XAUA 1AIFA 3BVDB 4N2IA 1QPPA 3T2NH 1AGEB 2E74C 4JQIH 1XCTB 5CEZH 1NBVL 5DRXA 3ETSA 2H1PL 1BBDH 3JVFC 3VJ6A 1S9XA 2WBJD 5C09B 3VM5A 2ZSVA 4A7TA 5E2VH 2F8XC 4F7MB 4XVSH 3SDAC 1TQBC 4HS8H 4AIOA 3L5WA 2VWEE 5IHUH 3SOBH 2BMKA 1QSFA 1CGSL 2XUWA 2OBGA 3KD4A 1K2DA 1IGIL 2R0LL 1X5ZA 1YAIA 4NO0A 3FB5A 4N2AA 5D7HA 1JNLH 3UMNA 4DGIL 4G8GA 2J8OA 1I3GH 4V2CB 1JPST 3Q05A 3DPBA 1LO5B 2A83B 3BWAA 3PWNA 3SDYH 1LE5A 2DQHH 3ARWA 2YD1A 2DQJL 3BZFB 3LH8A 1MPAH 3VI3B 1NICA 1A5FL 1OVZA 3P40A 4TSAH 4Y9CA 5FOJA 1U8HB 4PJDB 3D0VA 5F88B 3SKNB 5J12B 5JLZB 4CVWA 5M94B 4GXUN 2IALA 1DFXA 2EXWC 2GYSA 4DGWC 2CLVB 2BC4A 1ZEAH 4Y2OB 2IDSA 3ZHKA 3TURA 3RNKB 3CFKB 3VD1A 4GRLC 4R3SB 5CSZB 3BEWA 4U1SB 5C3IA 4NKDB 4PJHE 4Q9CA 4NZRL 2BHZA 3FT3A 5KBMA 4LVOB 4D0DB 2XV6B 3L4YA 4IOSA 2NXZD 4ZOCA 1HOCB 2VLRA 5AAWC 5I8CB 1NIDA 5BO1L 2FCBA 2OSLB 4GMSL 4YMPA 1BGXH 2NZIA 4O02B 2W88A 3VJ6B 1YEEL 1VGEL 3RWGA 1XTLA 2XY2A 1Y6MR 4FQQB 1KEGH 1MFEL 3TBVA 3FONB 3KYKH 4EPSA 4HWUA 1ULVA 4GMTH 5CJXC 2OYPA 2R0KH 2NQCA 3JT2A 1XF1A 2WNXA 3QNZB 4FFZH 1ACXA 3UPCA 2O72A 4WJG3 1J9RA 3LB6D 5D6DA 2ATPA 5FFGA 3KPOA 3L13A 3VRJB 3ES6B 1S7QA 4BFBD 2WW8A 3MNZA 3QEGH 1ONQB 4U3SB 4YQXL 3PWPD 3IMUA 5GRWA 1XGRA 3JWOL 3QUYB 2IMMA 1VERA 4OGAD 3JUYA 3N50A 4M6NH 4KZEL 4WEMB 2PETA 4PB0H 4CN4A 4ZNCD 4GS7B 3ZE2E 3MJ6A 1K4DA 5IT2H 1J86A 4Y89A 3FU7B 3CDZA 5KVFE 3G6DL 4S1QL 2HWZL 3QFJD 1GGBH 2HFGH 3QWOA 3MRBB 3DOIA 3OLEA 3CLEH 3L4WA 3PNWB 4BQBA 2QQNH 4NKOB 3U7YH 5DJ2A 1TF4A 3K8MA 1WK0A 4D0DA 2XIIA 1ZXQA 4FG4A 3SDAA 1U3HA 4QIRA 1VZIA 2XPGA 3B8YA 4ANWA 5KYWB 1SN2A 3GT6A 2VDPB 4BUHA 3DIFB 4Q0XL 1NGWB 1KFAL 3MRHA 3QYNA 3UJJH 2WQSA 1BZOA 1LO3L 1OAJA 1M2OA 1Q1JL 1NBVH 1SYVA 1DJIA 1H8OA 3OAYK 3O9WD 1KCVH 5AYQA 4Z6AT 1RPKA 4JFOB 2Y6SC 2IGTA 3N41B 1RZFH 4P8QA 3RL2A 3OR6A 2FX9L 3QDGB 4TQEL 2YN5A 2NX5E 5E1GA 2HRPL 3K6IA 3F04A 2QL1A 3B9KA 4OV6F 2BNRB 4TLKA 2BX5A 1RH8A 2VXQA 3ARQA 1VJSA 4FXGC 1F18A 4O02H 3DX9A 2H3NA 3BXNA 2VDLB 3LN5B 2R83A 3GJFA 4DQOL 5AAMA 4L5FL 3IJHB 3Q2NA 3HI5H 5DUJA 3W38A 5J1SC 3O3BB 5GJTH 1A7PL 1BQKA 2A73B 2DAVA 2A99A 5A2AA 4XO9A 5HYIA 1PJ9A 1BFOB 4P5TC 5E95B 3TEZA 5IVXB 2J8UB 4JRFA 4DN4L 2J73A 3O2DA 2UY6B 2WNKA 1L9TA 4UOJA 1SDDA 1GY1A 2EE2A 3QFGA 3D2UA 1P5UC 4YLQT 4A7VA 4NRYB 3L6FB 4JY4A 3PG2A 2OJEA 1KJVB 4MMYA 1U8NB 1KJMA 1WA1X 2TAAA 4R7NA 4WDIB 3S37L 3UP1A 4JRXB 3W0WE 3HMWH 2W81C 3UBFA 4F7TB 1GMEA 1QFWH 3IGAB 2BVYA 3LZFL 3WV0A 1A9EA 3CIAA 4GT0A 4QAMB 1QSZA 1I9IL 2F08A 4AIZB 3AXLB 1N68A 5TE7L 3QQNA 2AEQH 1DE4A 25C8H 3LCYA 5DQ9A 3VXRE 4HIIB 2YD7A 4WUKH 1CLYH 3TYGL 4HS3A 3TOPA 4JLRA 2J5WA 1OXYA 1GW6A 2IPKA 2G3ZA 4FNUA 1IC4L 3MBXL 5L8JB 3WFHB 1U8LA 1CDYA 1ZXKA 1JYNA 1W80A 5C0RH 5J11B 4RFEB 3QHFH 1XBRA 2FEEL 2X4QB 5EUKB 2VDPH 2DOCA 1YZZA 2MPAH 3VRIB 4N8VB 5LDUA 1WLHA 4KK9D 2V2TB 4P4KA 5E5UB 1B2YA 1IC5L 1RLWA 1MFAH 4JM2F 4WJ5B 4ZX6A 2O5ZL 1LQSR 4YC2B 1FJ1B 1AR1D 1V3JA 1ZHBA 2JB6B 4JW3A 1M4KA 1HXKA 4Z3HA 2J6EA 1FFNA 1JPSH 1FSKC 1G9NL 3GSRB 4ONOA 5D4IA 2IWGA 1KJ2B 2L7UA 4FL4C 4LL1A 4N90E 4YHKH 4ZBJA 3GINA 3OF6D 3TTSA 3PGCA 1FC2D 4AQ1A 4C83A 4XR8C 4JB9H 2YLHA 3VYNA 5JXEC 3NCCB 3NJKA 1RZKC 1ZJBA 3WE6A 5KJRL 3FFCE 3EJYD 3RLSA 3HB3B 4G6KH 5CLWA 5I1CH 2GJ6D 3LKPB 1CLCA 1PZDA 1GZQA 3D69A 4PRAB 5JZ7C 5C3TA 3ABZA 2V3FA 1B4JL 1TLKA 2MEJB 2PTTA 3RFZC 1IGTB 1A9BB 1YA5A 5ISZA 3B7RL 4WNSA 3ZSTA 3QDJA 1S8DA 4PJHB 4KK9C 4ZX4A 4CL7A 1KACB 5BJTB 1M2VA 4HWNA 4ZMXA 3GJFK 4M03A 4N5UA 2PR9A 5KVGE 3SKMA 3C5ZC 1CGWA 4G8IB 4RETB 2VAAB 4NT6B 3VMPA 2XTJE 2HMID 3OC5A 2IOOA 2ZSVB 5EORH 3WKPA 3HC4L 1RFDH 2O26U 3QUZD 1IBBA 3QJZA 4X80L 3GHEL 1BXAA 1CLZH 4YFLF 2EUVA 4PJBB 2WKLA 4IU3B 1JWUB 3IMWA 1OGSA 2ATKA 4UIMB 5BW7C 3QGVA 3W0WD 4AGQA 3OSKA 4OUUB 5MEQB 4GIOA 1H15A 4AT6B 4ILDA 5DJXB 2HLAB 1W72H 2GITB 4LPWA 1MXGA 1F4WL 5EIIB 3WMSA 4G42B 1MRFH 1JD9A 4KNQA 3P0YH 4DUXA 3CDGB 3EGDA 4TQEH 4TVPE 1DJZA 4ZO7A 1BFTA 2EZ0C 5J4MA 2DYPB 4ZS7L 3V4UL 4HSAC 4WGVB 1HL4A 1MAMH 1X5YA 2X6CA 5DUBA 2AV7B 1DSWA 1Q38A 3HJ0A 3LS5L 3DX6A 2P4AB 1XH3A 1FNAA 1EXGA 2IOMA 3TFKC 3F7VA 1D5MB 4AGPA 1O5DT 4HMEA 4F8QA 5J9PA 1QRNE 5JW4Q 2NCEA 1XGYL 1CE6A 4G5ZL 3GMMA 4LT7A 2J1WA 1KYOK 5AVVB 2ADGB 3A6BH 1KXVC 2KPWA 1JL8A 1JS4A 4F9PA 4RISL 4I3SH 4KUCD 4Z7VA 1HXMA 1JI2A 3ZTNL 4KUZH 5FO8B 3ASOB 3DVGB 2ZUXA 4OLYL 1FNGA 3B7SA 1HOCA 2H6OA 1KFGA 1DP0A 2F74B 4L0ZA 1AZUA 3HI1B 4W93A 4PRNB 1G7HB 15C8H 5E4EC 3SCMA 3NCJH 1FO0H 4FQQA 5BVPH 5HVFB 2X4UA 2BVOB 3JYCA 3O2WH 4PJEF 1HILB 3QEGL 2ITDA 1QKZH 1F45A 2JVUA 1JZ8A 43CAB 5I8KL 3S36L 2AQ1A 1JZIA 4WUUB 5E8DH 3V7AE 1KCRH 5EU7C 1P4UA 2BSDA 2PW2B 2DN7A 4PS8A 4UM8B 2R1YB 3KPRD 2IADA 1T83A 3F3HA 3ZHDA 4JNXA 3RFZA 1YLBB 2GT9A 4I18C 1UKTA 5I1HH 5J6HB 4ABQA 3X11B 1I8IA 1UYWH 5ITBL 5EZOL 3WKQA 2ICEC 3ARRA 3BRDA 2NNAA 4HCRH 1A5FH 5DFVD 5MEPB 3UZVB 1RZJL 3SPGA 4P5KA 3GPSA 5C0FA 3PL6A 2Y22A 1NIFA 1W72B 3QYMA 3RDTA 2NNXA 2ZCHL 1ZV5A 4JKMA 3HZYA 2YXMA 2HUEA 3WHE0 1LK2B 4YHPA 1UM4L 5DA4A 5HDBB 2IAMA 4QHLA 2YWZA 3I6LD 1YPZB 1VENA 5T5NF 1KPUB 4M1GH 4KY1H 2GCYB 4XX5A 1V05A 1QASA 3FTSA 4N4YB 3T2LA 2OV0A 3DXAB 4A6YA 2KL6A 3UBXI 1A8ZA 1NDMA 1T20A 2ZCLH 4KVNH 4FLSA 4KRPB 4YHOH 4G8FA 4BK5A 4M43L 3CH1A 5DURD 3V5KB 3H7LA 3EJPA 3HJEA 4TNVF 1GJIA 4MKMA 4W6XB 4PRNA 5DF0A 3CZLA 4L3ED 2ICCA 1IBGL 4Y19B 3QIWB 2UY7B 5GS1B 1J12A 4IEFA 2WXOA 4QWWD 1MFBH 1QR4A 5EZJA 5CEZL 1HKFA 3HC4H 3NA9L 4NBXB 4NP4H 1IJNA 4J3TA 4ELKA 4ZO8A 1I8LC 3OAUH 2I26N 2NDFA 4U1NB 4CUCA 5IQ9B 3ECVA 3NCMA 3L5XL 5EN2A 1FCCA 1X9QA 3VWJB 2W38A 4Y4KA 1Z9SB 1MHHB 5L2KA 4V1DA 3UMTA 2NNRA 3NTCH 3TASA 1W72L 2EIZB 3SPIA 5EBLA 1EJOL 1CDBA 2R0ZH 3UZEA 1UASA 2MTPA 3H2WA 3QWQB 4HEME 1IAOB 1KTDB 1IKOP 5E94A 5H94A 5C0RL 4LQFH 2FYVA 3FFDA 4K71B 3QZBA 4OCRL 3GMPB 1OGAA 5C1MB 4FNLH 4M6ML 3C6SA 5GZNC 1FIEA 4UQ2A 1HZHL 1F11A 3FO9B 2NRDA 4P59H 5I8EB 2FBOJ 3GIVB 3QNFA 4YZFF 3RZCB 5JO5B 5TE7H 1LK2A 4L4TB 4YHPB 1P4BL 3VU2A 4L4VD 3L2MA 3VDAA 1P53A 3BH8B 1NLBH 1ZTXL 3MBEA 3WNKA 3OPZH 4U6VH 4JL1A 4RNRB 4WFEE 4WI3A 5AQ0A 5HGGS 2V7HA 2P24A 3RDTD 3VD0A 1JGDB 2BP3A 4GBXA 1X9UA 3RUGF 2ZYSA 3D85A 2MTAA 1P7QB 2X89D 1KELL 4XVOA 2Z9TA 5T1LD 3LN4A 2Q86B 5A2JH 2VQ4A 3CH1B 4WK4B 5LQBH 4P49A 3MLRL 2E6PA 2ZX7A 3IEAA 4U0RB 4YEEA 1B0RB 2P8MB 4AUYA 1T6WA 2EO1A 3C60B 1O9ZA 3V7AG 1PZBA 1S7XA 3B2MA 2IPKB 5F3HB 1KIUB 2YRLA 4W4NA 4K7PY 1PTZA 5EZLA 5DD1L 3BDXA 4QR7A 2BFVH 3SKJH 2J8UA 2Q2LA 2OXHB 1NIBA 1T1WB 5IQMA 1L7IL 2HCZX 1OQXA 1G6RH 5E1HB 4R96B 4LIQL 1W6LA 5DYOA 2CBOA 5DRWA 2QHLA 1GRWA 4ZUTB 4WHYG 1W6WA 1P4LA 3UX9B 3BUYA 1N5YH 4Y8AA 3LKQB 2WTRA 3RPBA 5AKSA 1FVDA 3ULUL 4JKLA 2XN9A 4JRYE 4PJ9B 2OSXA 4WI9A 5AZEH 3SIKA 2MKLC 4R7DA 1AAJA 3LNGA 4XP1L 3QC5X 4IRSA 3TBWB 4M5SA 3MRCB 4N2FA 3OXSB 2EKSA 5DHYA 3G08A 1X4YA 4HVBA 4P59L 4UTCA 3WGVB 4A39A 3PJNA 3IM1A 2HX8A 3DGDA 2OMZB 3HN8A 2DQUH 4PH8A 1JUFB 4LCYB 5ILTH 2PTTB 3F84A 1A7PH 2ZF9A 5ES4B 2VXUL 1BQLH 1LM8V 1FH5L 5B1AB 2K1MA 5IHZB 1DBAH 3ABKB 4ZTPL 4PRPB 2H7WA 1E90A 4J4PA 3TCLB 2WQWA 4TOYL 2I85A 4S1QH 3AVEA 4YIQB 5ANME 3S5ZA 5IR1A 1E5CA 3GS7A 3X1BA 2MNUA 4YXLL 4X9BA 4CRPA 4LNRB 3V2AR 6CGTA 1CC3A 3V8CA 2LFEA 2EICA 4KH9A 4ELDA 3A4DA 2I60H 2H3XC 3GUFA 3NFPB 4X83A 4YSDA 3ET9F 3QS2A 3DMMC 1HQ4B 5CN3A 1XMEB 5CINL 2H2SC 4HX1B 5MENE 5CILL 3B7UX 4PJGA 4XRCA 2EIDA 5E8NA 1NEPA 4ONGH 4ZAKB 3N1GC 4KXZH 1KTCA 4QRQA 4O5LH 2COQA 2AMGA 2Q8AH 2NYZA 2AJUL 4XCCL 3GXUB 4DQOH 2HFEB 5EPMB 4PJCF 3BESR 3BPOC 3PP4L 2EYRB 3V0VB 1QFUH 3WNIA 2MQCA 3V0DA 4J3XA 3LQMA 3L3IB 2ESVA 1R17A 1KLGB 1CXEA 1P9MC 2DQDL 3TO4D 1MIMH 4MXWH 1B4RA 3U6XA 3P1VA 2ZP0T 2J43A 3RA7H 5I8KH 3RRQA 1JHLH 2JIXB 2CDFB 1RUKL 2FNBA 3BT0A 4DGVH 1RZJC 1HNGA 3QJFA 2IH1B 3QCUH 5JQ6H 4H88H 5IFAH 4H2CA 3TZVC 1CGVA 1GKEA 1M1SA 1J05A 1HYRC 2F2HA 3BN9C 3QDGD 5IB2A 1NFAA 1OOWA 2UWEE 3HFFA 1CO1A 2WWKT 3KPRB 3C5XA 3FTGB 1YJDC 4MWFB 5L9DL 1T22A 5LLIC 2IBZY 4JN2B 5DGQA 5EZOH 3S5LB 3NIGE 5DZNA 4D9RD 5KSVB 5AFAA 3DYOA 2NX5B 4X8XA 3TCXA 3TA3A 1F4AA 2UVEA 5GZOD 3MUGA 4ENED 3U36B 2B5IB 3FPYA 4L48A 5KSAB 3D06A 2WLJA 1JDDA 3X3GH 3O3AB 1CE1H 5CD3A 3H9HA 3ZKXB 3I9IA 3Q5TA 2DW5A 1IE5A 4PRIE 3VWKD 4CN1A 2OSLA 4K7FB 5EB9A 3T3MF 3NSDA 3KCPB 4U31A 3SE6A 5A2IH 1A4KA 1V7MH 1OP3K 3KYOB 1MRCL 1KB5H 1DLHA 3HBQA 1ORSA 4D0CB 1P84J 4I87A 1PBYA 1XSOA 2NW2B 3MRIA 1CFNA 3ML9A 3SO3C 4Y5XA 2FJFA 3BEWB 4U1SA 3BDBA 3C75A 5JOFB 3HS0A 1I7UA 1PKOA 3Q6GH 3QNZA 4J3OF 4BXVA 1GYWA 2WYHA 3OX8B 2VLLB 3W82A 5CN2A 2M2DA 5C08E 2V6HA 4QGTA 2PXYD 4I7ZC 5D1QE 4RGOL 4ZMTA 3BZ5A 4OIFA 3T09A 3RB5A 2VXQH 4ZMAT 1RZQA 1KYUA 5KVDH 4DP2X 4L18A 4MBRA 4FNTA 5BZWA 1S7RA 4R4BA 1SEQL 2X9ZA 2YSSA 4C4KT 1VRSA 2RTTA 1IGFL 3QUHA 1W0VA 3FUEA 4WV1C 3T8MA 5IW6B 4P23D 1P1ZA 1SMAA 2GQHA 2QGCA 2Q3AA 3TEXA 2D9CA 3QDJE 1JYVA 1W0YT 4PJEB 1BCIA 4U49A 4OLWL 2E9BA 3QP3A 1QFPA 4EIGB 5MHSD 1CGTA 4U3SA 3AREC 4P3WA 1V3MA 3KJ4B 4MGXA 4NGHH 4JO2H 1T7XA 3NEEA 4U1MB 3H9HB 2UZIH 3BD5A 5B3JE 5A16B 2FJGB 5FYJE 5CFHA 3VSTA 4BZ1H 1IT9L 3E1ZA 5KBDA 5T3XL 3B7YA 5FGSA 4RH4A 3ILDA 4P06A 1SDDB 2FWLB 4TUJB 1TPXB 1RIVH 2LU5A 2V2XB 3FU7A 4W9GC 3V4PA 1W15A 4R8WH 2CCWA 3DHJA 3L9EA 3LVTA 2WQ8A 4EE2A 1AD0A 1PLCA 2YIHA 4NQDD 5H35B 5IMOA 3GSWA 5HI5C 3A6OA 3QR1A 2HKHL 3B3IA 4XMLH 3X1EA 3IXAA 1ZLUK 5D1XE 2ZSWA 2N4IA 1HK6A 2H3NB 4IIZA 1XR9B 3G6AB 4DKFH 3HC2A 2GJRA 3L4XA 3UOAB 2K7QA 3H4HA 2HVBA 2P5WD 4X0KA 4PJAB 2OMBA 2E3VA 4FQIL 4M5TA 1TQCB 3QIWA 4MX7A 4ODXA 3O41A 4OZGE 4QXGH 3S35L 1Z0MA 3CSTA 4QTIL 5C9JA 4JEGB 4UTAH 2EE6A 2WXIA 2WIIB 5EOCJ 3LTVA 5IQ7H 1A1NB 2YUWA 4NZUH 5CBAA 2H6UA 5AB1A 2IO5A 2J8HA 4HUNB 1A65A 2KYIA 1QUPA 2AK4B 1EWHA 3I02A 3S2CA 1C08A 5IJKA 1U8IA 4LARL 4R2GB 1T7ZA 1IO4C 1DQMH 3NIFF 4Y5VA 3O2DL 5E7BA 4PJDF 2IV8A 4ZUVA 1CFVH 4PRBA 4JHWL 1IVLA 4U7MA 2YGPA 3RU8L 5DR5H 3KPSA 1KTBA 4L8BA 1ASPA 5HHPB 2JSFA 2XZAH 2YKKA 1ZDSA 5JUEH 3WE6B 1WBZA 4FLRA 4TKWA 2F15A 3RZCC 1QX1A 2YPKA 3MOBH 1BM7A 4FXKB 3ULSA 1G6RB 4MXQC 3BDYH 5I6KA 5BRZB 4KGJA 1M05A 5LWYL 2Z31C 1DJWA 2ZXGA 4O51B 5D1QB 1TJGH 4HJSA 3D1MC 2J88L 1N4XH 4QF1A 1D7FA 4L37A 4OIBA 2WCPA 3O6LL 4Q9BA 2OMUA 3ARBD 3NYKA 1QRNA 3G6JA 2C9PA 4G8IA 4MB1A 1Q9OA 1O5PA 3T77B 3VGGA 5J7CC 2CJUL 1AJ7L 3IDXH 3M7FB 3RUGB 5B7FA 3L9RA 3PQYA 4F2MB 3A47A 4EOWH 4Q97A 4LLUA 2Z1PA 4XC3L 4FJ6A 4QHKI 4R0LA 5FB8B 3QQ4B 1NEUA 3NFNB 2ERJC 5B1JC 2IDCA 5ICZB 1JGLL 3QIBA 4GO8A 4MJ4A 5CJBA 3S4SB 1Z5LA 1A6TA 4HBQA 4MAYA 3SYAA 3N44B 1FZMA 1S9WA 3AREB 1MCWW 4WK0B 2G9HA 2Z31D 2CKBL 4N2GA 4YVNA 2FO4B 3QNYB 3J8F7 5DJ8A 1I8AA 1UEYA 3IDYC 1KJ2A 1UH3A 2RIKA 1HU8A 3N42F 4HK3N 2V33A 3CNKA 3OQRA 4GXFA 4EI5B 3FOLB 1OOAA 1JPGB 3CDCA 3RWDA 4B9CA 4G3YH 1AXSA 5DJYA 4FQXB 5ECJE 1KFAH 1CIUA 3WY1A 3SO3B 4M1CD 4ZW6A 5IB3A 5J13B 4CDGC 3U1QA 2B39A 5DO2D 4FQJH 3JTTB 3R06B 2HLEB 2XQBL 5INCB 4NGHL 4D9LH 5BRZA 1IGMH 4R3SA 4JDTL 4DO4A 3CFCH 4F2EA 3P0VL 4JJOA 1AZZC 4TXVB 2VZOA 4HMCA 1YDPB 4AYGA 3WENA 1QYGL 2Q2EB 1S7UB 2V8MA 3FFOA 1GJUA 4MS8C 4NO0B 2W9DL 3L8QA 4PSPA 1Z9PA 4K3EH 4DH2A 3CFBA 3MJWA 4FAAB 1CL7L 4JQIA 2X28A 2YAFA 1NCTA 1WISA 3LIZL 3APCA 3AJ7A 3QJTB 4GQ9L 3OAZK 3VCLA 1C9SA 1SEQH 3JWOH 3BWUC 4MMZA 4NWTH 5FUOL 4JFPA 3WIIH 2ZOKA 4YGVB 5I9QC 4QHPA 3OSVA 3ZDZB 5HYSG 4H8UA 3ZE1F 3BFOA 4ZFOA 2K8QA 4XMKH 5T5FA 2ZJSH 1VCAA 3ZZ1A 1E2WA 3HRZA 4Z95L 5ISZE 4GP8B 1PLAA 3TA3B 2XXGA 2CRZA 2YS4A 5MEND 3EO0A 3KS0H 3QNYA 1RD6A 2EE3A 4JM2C 3W5NA 3ZU8A 2DLGA 1XF4A 1Y6KR 3E2HB 3WNLA 2A74A 3TIEB 1A6AA 3TH3T 3WU1A 5KZCB 2EDJA 4UNIA 3SGDH 2B1AH 4PBVC 1FLTX 3P4OB 3QQDA 4PJCB 1BGXL 4WWNA 2WXKA 4N8CL 5HGBB 3EOTH 3GS4A 3P9MA 3IDNA 1IQDA 3SGKC 4JGMA 2H45A 3PGDA 3KHQA 2EEAA 4MA8L 5DJ6A 3WLBB 3BAWA 4FG2A 5ACZA 3KPLB 3FU0A 4ORGB 4OD1H 3PL6D 4ZW5A 1UG9A 1VHPA 4X6CE 1K8DB 2XWDA 4YWGH 1HXMB 4PJAF 5DI8B 2WWOA 5AVXB 5I1EH 4JRYB 3ARSA 2W9LA 4UMSA 3FMGL 3D18B 4K73A 1UUNA 3WXWL 3FOMA 1IAIH 4KITB 2CDEB 4NRZB 5F6IB 3DIFA 2VDRL 2VR5A 3IFOB 3L3GB 4FHJA 3SKOA 4OT1H 2EABA 4M7JL 3F58L 1JZGA 4Y7MA 1XGQB 2C9XA 4HWEH 1DYZA 3BPCB 1MH5A 4WAFA 1NPJA 4E9TA 4JM2B 1J0ZA 4U1HA 3DUSA 3V4VB 5EIVA 4UT9L 5CBEB 1WAAE 1MAML 1CD0A 1GC1H 1EO8L 1IAKA 1BQSA 2AQNA 3CHRA 4I9WE 3TNNB 4EBQL 3LKSA 3ZR6A 1PMYA 2GK0B 4P2QB 2HH0L 2RCSH 4XXCA 4YC2C 4PRDA 1WCBB 4Z7UB 4HFWA 2WLMA 4RBPH 1RUQH 4XX1E 4AG4L 2B2XL 1HL9A 3E8UL 1E6OH 2AABL 3T3MB 3UTQB 4ELMB 3EH5B 1F58L 2A74B 2ZAIA 3UYPB 5EEXA 1WAPA 2YUXA 1I8MB 4Y4FD 4IGBC 1HKLL 1PW3A 3F12B 3IKKA 1MOEA 3FRPB 1SOSA 3MV7D 4YE4H 3MXVH 4LAQH 1UB6A 3ZDYB 4WNQA 4JBSA 4AY0A 2GBVA 1VACB 4JANB 2D3VA 4YL9A 2O61B 4PS4L 5DHXB 2CA4A 5I1AB 2QPFA 3C2AL 1KEMH 3IE4A 3QW9A 3Q7JA 5GGTL 3T2QA 2DMKA 3MMEA 3D3VB 2DKSA 4X5WA 2VAJA 3V5HB 2DF3A 4YO0B 4E42B 4U6YB 3STLA 2UZYA 4KMLB 1KXQE 1YNLH 3GZPA 4I2XB 3BEVA 1WAAA 4PCTA 3VSUA 5ERWA 4D8OA 1GYUA 1D7BA 1QSEB 3H42L 1H6FA 5JOEA 3QUXC 4CSTA 3RWEB 4RGND 2GB2A 2FLRT 4TL4A 5E1IA 3UG4A 5SWZA 2K8MA 3RTQC 2RGSA 1CI5A 5LXGL 4ZFOL 5C9JB 5SWZD 3QBTB 3CSFA 4OLEA 4IBLT 2F5AH 2MJWA 3IKCB 4XN9A 2CPUA 2NY5H 4LEEA 3OKNB 4Y16D 5IFHH 3RE0A 1TXKA 5ANMA 3ABLB 1QFWI 3BZ4B 3TCTA 4BSVA 2FEDC 2OI9C 2VLRE 4LSSH 3TO4B 2BSTA 5C7ZA 4PTUB 5KJ7E 5DT1L 1HDMA 1E9QB 4TLTA 3ML8A 4GBXB 4CMMB 1SRDA 5GS0H 2IXQA 4KJQC 4XPFH 1J5CA 3OAWA 3MJ8B 3LZQA 3R4DA 3TIDB 2AHIA 1X5KA 2AJSL 3CMOH 4X98B 5DK3A 5IB1B 2FEJA 5A2BA 4Z0BH 3QHTC 4KVPA 4BKLA 1ZE3H 4XTRD 3SQRA 3H6JA 2ZPKH 3D4YA 1TTUA 1DE4B 1UACH 3RILA 1DBJH 2G75A 1IAII 3RY4A 3KPMB 5GRUH 4YSCA 4X5WB 1I9IH 1ZAGA 2LLLA 3CQFA 3X13A 2J21A 2DPKA 2VQ1A 3BVUA 4BZ2L 4FABH 3VFTA 3FU9A 2EC9T 4XI5D 3NZHL 4X4XA 2DIEA 3HMXL 3NJGA 3ELAT 1IU1A 3TO4C 1Q9OB 2MNWA 3UBXA 4KBPA 1IRAY 1WFIA 1M9WA 2CLRB 1OM3L 4Z78A 4HXBH 5KJ4A 2WZAA 4BA8A 5E4IA 1S78D 4JFEA 5EO1A 4ODUA 1CIDA 1OT1A 4J6RL 2NT1A 2EH7H 3ZT7A 4R2GC 4GG6F 3N0AA 4K71C 1KNOA 2AJXH 2F5AL 1MEXL 5GRJL 3W81A 3LRSB 5TQ0L 3RY6C 1OP5H 4Z77A 1G87A 1MF2L 1OE2A 3AB0B 5DJXA 3V0JA 4BWWA 1JPTH 4HXBL 5EULV 3IF1B 1V54B 3ZT6A 4KKAC 2VUKA 3RL1A 4LZKA 1DVFD 4XI5C 4M1GL 2VLKE 2AXFB 4IKJA 3DNKA 3NSXA 4XAWH 1NC2A 1TTRA 3GMQB 4KUCF 4L8DB 5EOTB 5HHNA 5C0JA 4J39A 4JQXA 3FK3A 2W0FB 4R5TA 3G6DH 4TUUA 3EYSL 1GZPA 2ILLA 3IGLA 3TV8A 1LE9A 2XQYK 2A9NL 4N8CH 4LF3A 2DRUA 3NEXA 4RAUB 4AITA 3SE8H 2LV4A 2VDLH 1MY5A 1U92B 2WAQA 5LCVL 5EBWB 1BM3L 1T4WA 4WKXA 1HQRA 4GI6A 1G9ML 1ACYL 1DQJB 4PJIE 2CLZA 5DFAA 2AQTA 5ITBH 2VLJE 4OCMC 4YE4L 2D7NA 1PZUB 2F7RA 4NYLB 4UWQB 4A04A 3CX2A 1FPTL 3VE0A 2VERN 1FNGB 3T0AA 2BP8B 1HHJA 4J3UA 5JLZA 1IAIL 4JKNA 5FLVA 4UOW0 4KFZC 2CR0A 1HCFX 3IRPX 4FQ2L 1RK1A 1O7DC 2Q7AA 4HYTB 3CHQA 4L9LA 2VLKA 3HOGA 2BVOA 1OY3B 2P8LA 4GQ9H 4I4WB 1O6TA 3QQ9C 2W91A 4NRXA 3D87B 4N0UA 1D5MA 4HKBB 4OLZH 3HE6D 3UFIA 2DJMA 4GMSH 4BSJA 2B1AL 2CIIA 1IGJA 5GGRY 4JO3L 1FF5A 4YBQC 5INCA 4HH9A 5FR3A 1J7VR 3BSZA 4EN2A 5DZLA 4P07A 5EZIL 1MHEA 5FO8A 5CFAA 2H32B 2NY1D 4A2HA 1H19A 2AITA 5EH1A 1EUUA 4E9RA 4GW1A 2NYYD 2VTFA 3GNMH 3F2LA 1RMFL 1NIAA 1Q9KB 5AWNH 3QS3A 2V4LA 4MDIA 2LU4A 2NY7H 3UAJD 4MFHA 5EORL 3PGDB 4CGUB 1TZGL 1WEJH 4MDJA 1MFDL 1U2HA 2ODHA 4WFFE 5FYKE 2X40A 2YXWA 3M6DA 4Z5RB 2C3WA 1HIMH 3EKCA 1HKLH 1MWAA 3O6ML 4MAYD 3EAKA 1NFIB 3MV8B 1QNZL 3ZMRA 1UJ3B 3HCVA 3J07A 2F54D 3FQTB 4RBPK 5T3XE 3OHMB 3N1PC 2XVLA 3T0EE 5I1LA 2IWEA 3UC0H 1PY0A 5CJOL 2JH2A 4MCYA 1KCSL 5DVPA 3VYPA 4I1RA 2X1QA 2JF1A 1RAMA 1ZLDA 3DO7B 4U7SA 1DEEB 3CFCL 4JE0A 3QRFM 4JFWA 2NYYC 2J2ZB 5I8OL 3VXQA 3FTZA 5ILTL 1NAKH 1E6JL 4UQAA 3AT0A 3J27A 4UUJB 5MERB 2DQHL 3MLTA 4PJCA 4NBYB 1EGJL 1TO4A 2IH3A 5JTWA 1ASQA 2V2XA 1RUML 4LQ1A 1TTGA 4Q9RL 1J1PH 1WFJA 3MRGA 4GAYA 1MIEL 2EO7A 5D9SA 3SO5A 4B9IA 5EF2A 2YGQA 4HPOL 3ZDXF 4RGNB 3GSWB 2Y7QA 4UAHA 5IIEA 5GGSY 3GDCA 3WTWA 3FT3B 4KDWA 5JDSA 1NZRA 4JM0A 1BJ1H 4KGLA 1TVBA 5T1KA 1E4XI 1F13A 3TZVB 4Z7NE 2PCXA 5ENWA 3TEUA 1YMMA 4W1TA 2GABA 3T0EA 4UV4L 1QG3A 4IK7A 2FHCA 4UQCA 1A1MA 4BE5A 5BS0A 3T2OA 1XR8A 2GG1A 1DBJL 5IV2A 1T5XA 3NZ8A 1N6VA 3CPLA 3IJYB 5C97A 1BBDL 4M48H 1OANA 4FL4B 5KSAC 4BH8B 2W9EL 2ENQA 3F5WA 4LMQE 3PQYD 2YD5A 5G4MA 1MWAB 2FH6A 1A3LL 2Y1VA 2Z31B 4L4VE 4X8GA 2X87A 3S4SG 2Z0UA 4E9WA 2D4FA 4QXUL 3LKSB 1ZE3C 4IBUA 1DQKA 5FM5M 2LU7A 3F65A 1ZS8A 4XWOD 2EIZA 5AVUB 3FT2A 5HSFA 4ZMLA 1OGAB 3TBBA 1BZ9B 4JFXA 4ZW8A 2CKBA 1CQKA 1G9NC 1NPUA 1XXFC 2VT0A 5IVZA 3VB9A 1JFQL 5D96C 5A1AA 3B2UC 4Y19D 2GUOA 2IAAC 1DTUA 1KTRL 1Z0NA 3E80A 3LDBB 4K9EC 4RX4D 1G0YR 1AD0B 3FTXA 1RZGB 3CTTA 1XGPA 3L7EB 3CSYA 3V5HA 4E42A 3UYRH 4BFOA 3CXDH 4ZQKB 1F6FB 2GC7C 4JK0D 2PWHA 4AGOA 1DLFL 1N8ZA 4NQCB 3D8MA 1FBIL 2BS71 3K1KC 3QSKB 1KB9K 2KLRA 1C8PA 4LCWB 5C08D 1XR8B 5D7KE 3HNVH 1JSYA 4F7PA 4F2MA 1MAJA 3V6FB 3KH4A 4K4KA 3LEVL 4HEPG 4KX7A 4M48L 5D71H 4ABUA 1INEH 5I17A 4FX5A 1RJZA 1LDSA 4J28A 3I9PA 4LAQL 2PMZA 4X8JB 4OM0L 4M3HA 4XVTH 3RHWF 5B21A 1W2KT 3WIAA 5TDPA 4F80A 2NDGA 2UZPA 3X12B 3F6IA 1I1AC 2XYCA 5HDQH 2KZKA 4L3CA 2XOTA 1ETB1 2NY2D 4UQ3A 1QZNA 2I07B 5DMYA 4BWUA 3VW3H 4AKOA 1BAFH 4M6AA 1EBAA 3IWVA 3DBSA 1M2VB 3D39E 1IILE 4X7SL 3QEQA 1J87A 4ERSL 4GEJA 1DJHA 1ZS2A 2E9IA 2VSDA 4YX2H 1M1XA 4G6JH 2GTZB 5I1JL 5AB2A 2JV6A 5IVOA 2WVVB 3GMOB 4WHCA 1PCXA 1JUFA 1UH4A 3FL7A 2DTSA 6PCYA 5FB8A 3AMLA 3FYIB 3EYQD 1TUPA 4UIMA 1YN7A 4EUPA 1R9FA 3UAFA 2M83A 1ZA3A 5IJDC 3MV9B 4Y4HD 2M8XA 4AIZA 2NY2C 2YOCA 1TTAA 3VFVB 1IVTA 4Z9KB 2B1OA 4QJ4B 4FNSA 2JWYA 2EADA 3U0TA 4NO5A 1HSAB 1KEGL 4NDMA 2FUQA 1EFXA 2X7LA 3QJXA 4KDTC 2P44B 2XBTA 3H2QA 3QJRB 3DK2A 2UVFA 2PO6C 2QQQA 2D03L 1CE1L 1RU9H 3SE4A 3QEHA 3S88H 1RZIA 1E8XA 3Q8CA 1U30A 3EYVA 3HG1B 4PY8J 1UHVA 3TWCL 2C3GA 2D7OA 1T66C 2DQMA 3GNML 3VFGL 4L8SC 4PJ5E 1QSEE 5ACMA 1G5AA 3UTSD 1ZLSL 3SDXE 4N6RB 2GT9B 4GG6B 5A3IC 3LQZB 3P3RA 4LSUL 5DWUH 4DK6A 5TQ2L 1C12B 2F58H 4I1PA 1GYVA 3K81A 3MQIA 3QFDB 4Y2DC 4ZSOE 4GKSA 5EHFA 5KSBA 3UJTH 5E56A 1MCLA 3ULVL 5E2WL 3AROA 3T1WA 3ZMNA 1HHKB 1FGVH 3F7RA 3ARFD 5AZ2H 4ZNEA 2BDNH 4JL2A 4QRPE 3MV8D 2UWEF 1YYCA 4NN5B 1IQDB 4GSQA 4M93B 4XXDB 4LVNB 2PCFA 3FDWA 2F6AA 3NCJL 2UUDK 1XGTA 2WJ7A 4LU5H 3RAJH 3RJQB 1QTYT 4XMZA 3VRLE 3LHPH 2N3JA 3V4LA 5INDA 5T3XD 3CPUA 3TC9A 2CBTA 4OJFL 1NL0H 2B0SH 4YFLI 1OARL 3LPFA 3QXTA 4HBCL 4NJAL 4GRWE 1T21A 3OX8A 5DEJA 1KG0A 3EH1A 3C8KB 4X7TB 3BFWA 3Q3GA 4LDEB 3QZPA 3UTPD 4X6FA 2O6PA 4APQA 2P47B 3Q9QA 1JGIA 1FNEB 4R8WL 1Q0YH 1BF2A 3QULB 3DROA 3C09B 1UCBL 5BCAA 1ACYH 2VLKB 4WHTB 1ETZA 1J8HB 2UX7A 1LE5B 3LXCA 1KT2B 1VGKA 2VDKB 1KJ3L 2X0WA 2ZT9C 2XICA 5F9DC 1R3JA 4RMWA 4ELKB 2PTUA 2OZ4A 3NIFB 4KHXH 3SBWA 2VO8A 3ZHFA 4PRHE 1LNUB 5ESAB 2MFNA 5FYLE 1R5WA 2ZAHA 3A4FA 1UZGA 3GLDA 3OMIB 2WLLA 1EHXA 2BY3A 5CJOH 1F4WH 2WLKA 4LSVL 1ET7A 4MXVE 1QSFB 1UATA 2JQAA 4Y2DA 1NC4A 2ZXCA 3LAFA 2E4FA 4HHWA 3OKLB 3LQAL 4NFBA 2R7EA 4LKCB 3RTQD 4OU3A 2A6KA 4NUGH 3V52L 1S7SB 4UDTA 3T5WA 3UGEA 4EXPX 3WN5B 3MOAL 5FOBA 5CGYD 5K9QI 2EDHA 2QV2A 1MLCB 3BP5B 2EDFA 1PKQE 3CLFL 1X5JA 1SBSL 1XGTB 5F9OH 5C3LD 2CQVA 3SE4C 1H9DA 4PVNA 2BK8A 1QWNA 3UPRB 2AI0H 1NGPL 1HEHC 2XKSA 1NFIA 3MV8A 2IG2H 4WW2C 2ZE0A 4OD3H 5ENWB 1PY4A 4U1JB 4GAGH 4L8SB 2JLPA 1EEZA 1AZBA 2GJZB 3DC0A 4OZ4A 1JV5A 1WBXA 4HUUB 4RFNC 5GRUL 3II3A 1K4CA 2VDQH 1ETZB 3CWGA 3G9AB 3OKEA 4XMWA 4KZDL 1S9VA 3BGFC 5TTRA 5A16A 3GSNB 3RWJB 2HTKD 5F9JA 5KS9B 2EDDA 2L4OA 4BM7A 4KWUA 1IZKA 5AW1B 1PZ3A 4H4NA 1SMOA 1FYTA 3NK4A 4ODWB 3L4TA 4DVBA 1DVFB 2B20A 3JBG7 4OGYL 4HUMB 2AP2A 4K3DL 1U2CA 3OAYH 4WEEA 5IJVA 2HT3D 4R90L 3QUXB 3BH8A 2R15A 4TULL 4IHOA 4J8QA 3ULUH 3ZHLA 1EEYB 3L4UA 2VW7A 3N85L 5BOZG 1PG7X 3LPWA 4U6YA 2Z0BA 1LQBC 1M53A 4K94L 4DVRH 2IDQA 3GTNA 4I1NB 2Y36H 1BF5A 4QXVA 3TVMB 1PZ5B 2BSBA 4IBZA 3ZYIA 3PABA 5C09D 2X9XA 1NMBL 1S9YB 2CUIA 2OL3L 2R1XA 3K1DA 4NJ9L 3IMRA 4OW6A 1J1XH 4ODTH 4R2GD 3UGXA 4V11A 5B3JF 4OCYH 1REIA 3C60C 4PJAA 1VACA 1X5GA 1NMCB 4JANA 5IV2B 4NSKA 4QXGL 3K0YA 3QDJD 4GSRA 2H2PC 4NAMA 1JE6A 4DPBX 4D8PB 1S7WA 3K80A 1FAIH 4V1DD 4FC3E 3GIZL 2R8SH 4IJ3B 1BX2A 4XNDA 5B7EA 3BKCH 3WJMB 2YKLH 2BY2A 2XKNA 4H1LB 1OLLA 2IPUK 2UZYB 2ZONA 4H0GA 3FBQA 2ED8A 4IDJL 3TCLA 4YDKL 1WF5A 4A55A 2BCMA 3SSGA 2JKXA 4L3FA 4LIQH 4GG8A 2R27A 4QRUB 4NHCH 3B83A 1E40A 4FKEA 4WF7A 4ZMZA 4U6VL 4CMHC 3ZKND 3QPQD 4OSUH 1U95B 5DRNA 4JPIB 4NQDE 3GB7B 4YBLC 2V7NA 3MRMA 4IDLA 3RGHA 2SODB 1GR7A 2H2PD 5F96L 2E76C 1W91A 2Q10A 3VWJA 3CN0A 2ID5A 1Z5LB 2YUVA 3Q6FA 1P7HL 4WHYH 2CAKA 3WE1A 4DHLA 5IQNA 3T0VA 4LRNL 2B16A 2FWOB 2ZKXA 5E8EA 1EX0A 3QDME 5C6TL 2D7MA 4TVPL 4WO4D 3RX8A 3UL4A 3TIDA 4J12A 5I73C 3AXLA 4J3OD 1U41A 3ILEA 1YPZF 2EP6A 3IJHA 1DL7H 1BDYA 4WSJA 3ORJA 4LEXH 2K7PA 5SWSD 1NA8A 4PP1C 2YBRA 4KRLB 5K93A 4ADIA 1BVLA 4FP8H 2GY7B 2J1XA 3C9NA 1AD9A 4JG0L 1CVSC 1PYWA 3L3KB 1AGFB 4GUQA 4LAJH 4RWYL 1E4HA 3L3OA 4TNWF 2VDRH 4KROD 1KCUL 2NY1C 2WZPA 5KVFH 4GRLD 4IIQA 3VNZA 1D6VH 5BV7C 1KGJA 2MOQA 4NO3A 4MLIA 5HPMB 5DUMH 1UWEH 3RX7A 3WS3B 2C1OB 1TQVA 2R0KL 4XNQB 2WLZA 3O2WL 4ZFGL 4XO4A 4AXWB 4UT7L 2IAMD 1GPOH 2I7OA 3CQQA 3H3PH 4HA1A 4MMZB 4OFQA 1URZA 3CK0H 1D9KB 1U33A 5ID0B 2IEPA 4FQXA 1G7MB 4PP1D 4LF3B 3HZKB 1G1YA 4ELMF 4Z0BL 5FS5A 4N2BA 3FH7A 4X4ZA 4E36A 4R97B 1GHFH 3KYNA 1PEWA 4HLEA 2YJLA 2JKSA 2Y25A 3DGGA 5D7LD 2TRHA 2E8YA 1KIRA 5EUOA 4OZIE 1OAUH 2DMBA 4ENZA 1UYWL 1B2WL 5FYJU 3NDYE 3VE0B 2P80D 3U9WA 5I1EL 1JP5A 1XX9C 4MZ2A 1I9RL 1NL0L 2B0SL 5IBUB 3QIUA 4KXAA 4MZRA 3JV4A 3WNMA 2D8KA 4JFHE 4GLRH 1I82A 1XSJA 4MNQD 3I6GB 4PLJD 3H9SE 3V6ZA 2X4NA 1QFHA 2H9GA 4BFNA 5C9KA 5LXGH 1SYSB 1GC1C 3KPLA 2FBJL 4Z5RA 1XF5B 4M6MH 2AGJL 4M4RB 2R59A 4M7LH 4HCRL 1RVFL 2BMKB 3VD5A 1CLOL 1MCCA 5MEQA 4APQD 4WKZB 3WOVA 5IEHB 2BVQB 5AOIA 1KIQB 4DP6X 2CM6A 1TSHA 4R6UA 3MV01 2XVGA 4XCNA 1BIIB 3WL9A 3K5RA 2DM7A 2BNRE 2MPVA 5DC0A 5DMIH 5AAWA 2HH0H 2RCSL 1MFUA 4DSYA 3GK8L 1PJWA 3WSQL 3GTVA 1EBPA 2VMCA 2HJKA 1GC1L 1T83C 1F4HA 2DYPA 2V8LA 3SHSA 1KCBA 3CSGA 4Y1SA 1AY1H 3MU3A 3O0RH 3SKMB 3BZFA 2WOYA 5K9KB 1KJ3H 3U0PA 5BZDB 2EDEA 2L7JA 3QR0A 3KVQA 5GSRA 3BHBA 3O9WC 5D2NE 5AVWB 1E2VA 2ALAA 4FQXC 4QXWA 4E0RB 1N19A 5GGQL 3A23A 1U8PB 1C16B 3IS1X 1ZDQA 4APQC 4F91B 3VW3L 2DQIH 3ZX1A 3DK0A 2FX7H 4LOUC 4A2LA 1UJ3A 3HCVB 5AAPA 1NUFA 1U3HB 2E6QA 2XTJD 3N2JA 1DVZA 1CGSH 2VC2B 4NUJB 2E7CA 3SE3A 3G6AA 4L1TA 3HI1A 1KLFB 1UOVA 2WVTA 4WI0A 1MWAL 4UNUA 4JFZH 1WWCA 2NY5C 4PWIA 3ZR5A 1L0YA 4MWFA 3RL2B 1MHPL 1WZKA 1ZVHA 2Q76A 3CFJA 1EFXD 3ULUC 4MJ6A 2IANB 4APXB 4OCWL 3F7VB 1OCWL 1OQOA 2YHGA 3BSGA 5DJZA 1JDCA 1E5BA 1F2QA 4UINH 1EK3A 3CBRA 1PD6A 4PRPE 5T1MA 3LXAA 1YYMH 4JAMA 3FSZA 1NCHA 1Y1DA 5HGHA 4CMHB 3PV7A 3PHOA 4HIJA 4UMGA 3ES6A 1KN4L 4LDLB 3ZO0A 3AXIA 4NKOA 3LH2L 1UUSA 3W37A 4EDXA 1CBVL 1N10A 2EVIA 1SJMA 3L5HA 4LLDB 4U1LB 1A4CA 3GSNA 3RWJA 1XD1A 3BT2L 3S88L 2IQ9H 4P48A 3T0EB 1RXLA 3SKJL 1I4FB 3MRHB 2VR4A 4NZFA 4ZXBA 2EDLA 3MRPB 3ROOA 3CDZB 3OB8A 4Z23A 3KBFA 5FGRA 1OCOB 1TZIB 5IOPB 2BSSA 2ZWYA 3EZJB 3UTTA 5JHLH 1H6UA 4C4BA 1GOGA 4YHKL 3MRBA 5E6IC 4KY2A 3GXDA 1TKWB 2Z35B 4HZAA 1A66A 3W9EB 2HT4C 4JCMA 1CDUA 4I2XA 2XVBA 1ZLSH 4HZLB 4WWKC 2QQLH 3KEDA 3LOWA 2UXVA 2YGOA 4KOCA 4BKLB 1J8SA 1Y0LB 3FUFA 1KGXA 1GHFL 4F92B 3R8BB 4IU2B 1LMIA 4PY7B 2ZAGA 2VITB 2WY3B 4H13C 4WHDA 1CDIA 1DJSA 1U3JA 6TAAA 1A0QL 5SWQB 1LVEA 5D2NA 3NFNA 5DR5L 4ATTA 4NPYA 1CL7H 2Z91B 4FULA 4XH2B 2DKUA 5GGRB 1WBZB 3OTTA 4N5ED 5IGXL 5EV7A 1FAKT 1KZQA 2FH8A 4FJZA 4I89A 4PJEA 1FGNH 4L3CB 2ADFH 5KVFL 4S1SH 3ULUE 4PTUA 4HQQL 4LP8A 4OGZA 1CK0H 5KS9F 1OTSD 4F7TA 1I1AA 1GXEA 4OZHB 2BRRL 3S5YA 4BDVB 1PZSA 4H8WH 1JK9B 4JDVB 4WSGA 3TJHD 3UH8A 4P4KC 1U95A 5DRNB 4BELD 3DMMB 2FQGA 1ECZA 2UXGA 2H1XA 2HKAA 4P5TA 1OWWA 2HT2D 3MTXA 4ZO9A 3D9AH 3I3DA 4MJID 1M6UA 4IOIA 2C8NA 2K4AA 4JLRB 4DFIA 3IDXL 2JCCE 5AOKA 3U6XS 5JHLA 1MHCA 3MRDA 1E3FA 1KWKA 1E5UI 5I0VA 2ZKHL 2VDMH 1U8OB 3VXUE 5KWYC 4RFEA 1AG6A 3M07A 4G7VH 1RJZB 1QLEH 4N5EC 1UD3A 1ZLWH 4EUPB 3QORA 5A43C 2LW3A 3MODL 2JK5B 1WA2X 3U79A 2ENSA 2J6WA 4WTQA 4P4KB 1S7UA 2QHRL 4HUXB 1GH7A 1JXGA 3CDFA 4E5XB 5EF3A 1WVZA 2F9BT 5F8QC 3UBXB 4AW4A 4IBVA 3FH5A 2EUZA 3TJEH 2P42B 4QRUA 3GS0A 4OLVH 3SQOL 1LEIB 1CYWA 2B4CH 3VFOB 3W3BA 1AXTL 3HPJB 4BQ9A 5A2KH 5KVGH 3DBXB 1DJGA 2NY6D 5HGAA 2YEVB 1AGEA 1DN2A 4QHNA 1JGEA 2J6EL 2PTVA 4PUBL 3GIVA 1JZEA 2A9BA 2XNAB 3BH9A 3KGRA 4NQEA 3GBLA 4XNMB 4F7CA 1A4JB 2RR3A 3RKDC 3HRPA 3SODB 4QRSA 3VI4F 3MO1A 2IFFH 5CZVL 3GI9H 1F3DJ 1OAQH 1BF8A 5SV3A 3GSNL 1KXQA 4X6CB 4X4YB 1G7JA 5E8EB 4A63A 2WCSA 1MI5A 3HZMA 1ROCA 1SN0A 4GMTL 1U8QA 2F53D 3EG9A 4JQVC 4WVRA 4KDVA 1OTTC 3F7LA 1HIML 4L4TE 3TP4A 4X7FC 1TJHH 4IOSD 1E3XA 1OT2A 3B37A 4ANKA 4PGBB 3D4CA 25C8L 3MNWA 2X42A 2XA8H 2VDNL 3EO1B 3IJEA 1AO7A 5ANHA 3C08L 4ATWA 2HRGA 3X3GL 1AP2B 2XJLA 3WEOA 2TSAA 3QG6B 1Q8MA 2DQCH 2P5EA 3F7YB 1U3HC 1OGAE 4DGYH 1PIGA 3DSNA 4QTHB 2V5SA 4TUKL 5HJBA 4IGBB 4TULH 1FLRL 1U42A 1A6VL 6PAZA 3SN6N 3SPCA 4NIKB 3U2SB 3CN2A 1YNTF 2XTLA 5EF1A 3RUGA 3WNPA 1CLVA 3MUZ1 1FVDB 1P1VA 1QLEB 2X7LB 4L1DA 5CGYC 1F41A 1I8UA 4NFDA 4NQVB 3EJZD 4G8GD 5DUBB 2ZX6A 3TT3H 1HQ4A 5HDOA 2PP9A 1P2CA 2A7BA 2ED7A 4F9PC 1NAKL 2VABB 5FAAA 4IKLA 5HI3C 4N0UB 3GLZA 3VXUD 2EE0A 1CXIA 1E5AA 2KDGA 3QIUC 4Q4IA 2R9HD 5I5IA 4YQXH 4JFYB 3MAWA 3KHOA 5K9OB 3LKNB 4OI7A 3MRRB 1L3NA 1JJUA 4F7MA 1JRHI 1WCBA 3OZ9H 4KK6D 2AF2A 2OR8A 4NZRH 3IPEA 3X11A 5T1JA 5HYJD 2WQVA 2XCMC 4F58H 3P69A 4L05A 1IAIM 1FCGA 2J2ZA 4H25A 3D18A 3BPOB 3ULVF 1CTMA 3TM6A 5C0FB 3RI5K 1CTNA 3CC5A 3KLDA 5B1CA 2NOYA 2ATPB 2R4SH 1WG3A 3V6OE 4F33A 2H1PH 1CWVA 4G70B 1OF2A 2Z34A 3O45B 3BHBB 5TGBA 2MHAB 5D6CA 3BCDA 1XGRB 5E9DA 1G0XA 5E1AA 5BW7A 1JG9A 1NKGA 5D9SB 1A7OL 5C7XH 3Q44A 4IRZA 2R9HC 4RMVA 3H54A 4PW4A 3Q6GL 1PQZB 1G1OA 4QRQB 4K8RD 5FYKH 5IMLA 5I5JA 5JMOC 1HEZB 3L3OC 4QTFA 4RRPA 4GOSA 4LRNH 1KDIA 3GBEA 3EH3B 1AHWC 4FQLH 3SDDD 4JO3H 2YC1A 5T3ZL 5H37A 4K5PA 3IRZA 2Z6FA 3O4LA 4KJYB 4PWEA 2GIXA 3NSYA 5TQ0H 2P7TB 1MPAL 3EHBD 5F1KC 2H0PA 4ZAKD 4WY7L 1CVRA 2OW7A 4I48A 3QRGH 4NKMA 5L4JA 1NANI 1H9VA 5FM4A 4DKDC 1JXFA 1H3UA 4XMXA 3AWFA 1JHKL 1HXYB 2AV1A 3CHOA 4FFYA 4XPFL 1DFBL 4Y1AD 2QVKA 2Q7NA 1B4LA 3OKMA 1I7UB 4G6AC 2ZX5A 4ZFZB 3TIEA 1PZAA 2UWEA 4BFIB 2XIDA 2XWTA 2NNAB 2EKJA 4EQ2A 1O6SB 1LGVA 3BUDA 2OPCA 2XPYA 3G5YB 1L9QA 1AHKA 1V7ML 4KDTA 4KKNA 3ZKNC 1QBLH 4P99A 5E2VL 3U36A 5BS0B 1VGEH 2ZXDA 4BFGA 4LCCB 2G75B 4UT7H 4WUKL 2IC2A 1XGUB 3D25A 1NBYB 1TQUA 3SJVB 5IG7A 1OGAD 1YPZA 4EDWH 2AERT 4LKXB 4JQIL 3EYSH 3WELA 2G2RA 5D8JH 1UFUA 2AXHA 2HXAA 1R5VB 2ZG3A 3BKMH 3LNEA 4N0FA 1SXSA 5T5NG 4BWTA 4DEPB 3KXFB 4Y4KB 2V9UA 1FYTD 1JF1B 5AL8A 2VL4A 4UQEA 1KB5B 4X99A 2QLYA 1P69B 2Y0SA 4KJWC 1G1CA 4XN7A 1Q72H 3ISRA 3U2IA 5C0DB 1FFTB 3SGEH 4DN4H 1KYDA 4C56B 3VMNA 5E2JA 3V9CA 4I3GA 3FQ1A 5FKPB 4F5CA 2X41A 1CFTA 3FO1A 5LN8A 4HIIA 3GO1L 5IOPA 1MZYA 2ZWZA 3U4AA 3X12A 1X5FA 3D0LA 1VA9A 3SD2A 1Z9SA 3T65B 4KROC 1F2XK 4W9IC 4TNVK 2P24B 3LRKA 5AW9B 4AEHH 5B1JA 3B9KB 4WTXA 2HFTA 2VLMD 1JK9A 4JDVA 1CG9A 4Y5VC 1CB4A 1UXSB 3GUTA 1PZ5A 4GNKB 4I85A 4LGRB 1SLXA 4KTDH 4Z7VF 4JHAH 2Y4SA 1ADQH 2CGYA 4OGAC 4PPTA 5K39B 3QXAB 3CFDB 3T08A 3QWRD 3AZUA 5JHMA 4LCVA 1THAA 4P3CL 4ODVH 4YHNA 2CHZA 2BRQA 1HWGB 5SWQA 4LFHD 2H2SD 4DTGH 2MH4A 4Q6KA 4F15B 4N9OB 4W9KC 3DRQA 3ZN6A 1XIWA 5GSVA 3L3OB 4PR5A 3US9A 5EU7E 4X4KA 3WTVA 2GJ6B 2CO4A 2F53B 4XZ4A 3O6KH 4MNGA 3CN4A 2VSKB 4KH2A 2QVFB 4Z3JA 3FMGH 3RJOA 4MMXB 3UYOD 4H2AA 2QZ5A 2OYMA 3OMAB 4LB8A 3T8VA 4TQHA 2PYEA 5ETUA 5CEZE 1A9VA 3D51A 4XNQA 3OG6B 2P28B 4TSBL 1LO5A 2A83A 3L81A 3MGTA 4QRTA 2P8LB 3D6GA 4I4WA 3T6ZA 4LSTL 3P9WB 2FR4A 4RIRA 2WWMD 1ZOXA 1UWGH 1XSIA 4Z7UF 2OYLA 1IKFH 1SBBA 4PJGB 1MJJA 5F9AC 3Q8AA 3U9PL 5AD0B 3ZQWA 2XYBA 3B56A 1JXKA 1RCYA 2VC2H 4PS7A 2BIQA 4OZHF 2J55A 5C0BE 3MLPA 2W95A 3WFEL 1JK8B 1HCVA 2X4SB 1V3KA 3WIFA 4ICXA 4PBWD 1AD9B 1EMTL 1M05B 4AH2A 2B3IA 2ESVB 5E8PB 1AKJB 1QHPA 3CFEA 3KWWB 1AGCA 4MDRA 5H37G 1HT6A 3OHXA 5FWQA 1B3JA 1L9SA 3ETTA 4NJAH 5AUMB 3LZRA 1U2YA 4KKQA 5IR1B 3SBWC 1PG7H 3WIHH 3AS2A 2PR4L 3ATDA 4LCCC 4W9LC 1I3VA 4NNPH 4JGUA 1H3TA 2J57A 1AO7D 3CLFH 1HWWA 4K9EH 3B9EA 2EAEA 5I15H 2AJVL 2Y1YA 1JMZA 4KZDH 2B5IC 4PP2B 1J5OH 1PYWB 4DZBA 1O7VA 2F7OA 1Z3GL 5IHZA 3RY5A 2Z3FA 4V1DE 4GKNA 1QBLL 4FQ1H 1ESOA 3UJTL 4OKDA 2F53A 1G4RA 3MXWH 5D70L 4FMVA 1YEDA 1ANUA 4GIAA 3KLKA 5IWLC 2H5UA 4LDOB 4OI8A 1UQSA 2Z92A 3IMVA 1FNEA 4IMKC 5E08H 4G1EA 4W9CC 3M45A 3RNQB 4JPWL 1F3JB 2C1OA 3MV9D 5FXCH 4P5RA 2Z7UA 4EI5A 3SGKA 1S6NA 3EADA 3TWCH 3BGFB 3DVNA 3TGXA 1LTXA 4UT9H 3HBPA 3MGAA 1UM5L 1RJLA 3B5HA 3QRGL 4G5ZH 4GB9A 3OMZA 5IESL 1JRHL 3RWGB 3KE0A 4Z1PA 3LKNA 2R29H 4IMLB 2PCFB 5BO0D 4FTVD 4K2UH 4OT1L 4J5VA 1I3GL 3HUJB 4PJ8B 3LH2H 4BFEA 4GSUA 3S5LA 3V4PH 4QCIA 2GSMB 3HG1D 5B22A 3C87A 3DJSA 3FC8A 1XDTT <