2ITFA

Crystal structure isda neat domain from staphylococcus aureus with heme bound
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
ATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein A
publication title Haem recognition by a Staphylococcus aureus NEAT domain.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Metal binding protein
total genus 25
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2itfA00
4MYPA 3RURA 2E7DA 2Z6FA 3QUGA 2H3KA 4H8QA 5D1XE 4YMPA 3SZ6A 3QZMA 4H8PA 4WJG3 2MOQA 2ITEA 4NLAA 3VTMA 3SZKC 5D1QE 2O1AA 3QZLA 3SIKA 3QUHA 3RTLA 2O6PA 3S48A 5D1ZI 3OVUB 2Q7AA 3QZOA 3VUAA 4FC3E 3QZNA 3QZPA 2ITFA 2K78A
chains in the Genus database with same CATH superfamily
4POUB 2D3NA 2V2WB 4CSSA 3RTQC 3HZKB 3R19A 1MPAL 3AQZA 4UT6H 4NKOB 4OM0L 4PG2C 3RLSA 4AXWB 3TCXA 5D2NA 1J8HB 5HYQA 3VMNA 3ZDZF 4NO5B 4QHUB 1YMMB 3T77B 3QR0A 3OTTA 3K71B 3V0WH 3QJSB 3H54A 5JW4N 1UD6A 1AGEB 2B59B 1FC1A 5HBBA 4M00A 4HEME 2UV3A 3GLEA 3NIDF 4DO4A 4NO2A 5H94B 1WAEA 3D12B 5LN4A 1Q90A 3IDYC 1I7RB 1QZNA 2N4IA 4FYQA 4G9FB 1CLOH 3FFCB 3CHOA 3A47A 4MA1B 1XGRA 3AC0A 3L9RB 2KDYA 4RQQA 5CINL 5HHVH 5DYOA 5BS0A 3DO7B 2VN4A 2YOCA 3FTWA 4OD3H 5HDQL 5IMKB 2VDMB 4P2RD 2K9UA 1M6OB 3SCMB 1A3RH 4DGUA 2MH4A 4D0DB 1VGKA 4XPFH 4JY5H 4U4IA 4OLZH 1PZ3A 1H5BC 4GMSL 5HYJB 4CVZB 1U3NA 5AVQB 4HKJB 3VWKC 1S9XA 1DZ0A 1BOGA 1MFMA 3KLQA 2FRGP 5EO0B 4KHXL 4F3FB 4W70A 3MUHL 1XR9B 3HHMA 3CTTA 4UT9L 3RUGB 1E0OB 1FSKC 2YD1A 5BV7L 4QOKE 1XIWC 3MJ7B 3VQLA 3P3YA 2XQYK 5I74C 2L7EA 5T1DL 3ZQWA 1CFTB 1WZMA 2CLVB 4UV4H 2R2EA 4FI6A 5F9WC 4KNUA 2V2TB 1T21A 3SDXA 4G1MA 2X41A 4FXTA 5CU5A 4AYBA 1OV8A 2BVPA 3HI5L 4Y1AE 5JXEC 3QS3A 3TBCA 4UOZA 2ZAGA 3DDGA 5LBGA 3VSUA 3ZE2E 2ZX8A 3HAEH 3HI6H 4D0BB 3PWPD 5KAQF 3JQOB 4HK0A 1H8SA 3IJEB 4GAJL 1BBJA 5A2JH 1W0WA 1P6AB 3OKDA 1XR8B 3U0WL 1DQIA 4ATWA 2OCCB 2KI6A 2XQYA 4NWUL 4NAJA 3UYRH 2XY2A 2YQGA 5E9DE 5L2JB 5FKAB 4N20A 2EDQA 1MSPA 4CADA 1LDPH 4JZOA 1MI5E 4YZFE 3IGUA 4PEEA 2ROXA 3EG9B 3LEXB 3ZQXA 4MKMA 1I7TA 3QRGL 1B6DA 1E42A 2KDGA 4DP4X 4OFQA 2ZX6A 4ZZKA 4NN5B 4LT7A 2EZ0D 4J12A 5J11C 1X5ZA 1USQA 4P2QE 3RY6A 2AEQL 1AO7A 4V2BA 4GSQA 5D7JA 4FMFA 1C8QA 5D2NB 3UTPE 5JXAL 5HYQB 4ZO9A 4XP5L 3TJHD 1J87A 4OLUH 1YEWA 4X80L 3QHZL 2NNAA 4NHCH 5HHNA 2AJYH 5JHLL 3SQBA 3C9NA 4XO8A 5HDLA 5F1KC 3MBWA 1B4JH 3AZUA 5AVRB 5CJQH 3WO4C 4RGND 4HQQL 4DAGH 5D7IA 4NO2B 4G6MH 1URIA 2ZSWA 3MA7A 2GJJA 3HVNA 3BAEH 3VVVA 1I8LC 1UATA 2Y06H 2Z7ZA 3PP3K 4B53A 5C6PB 1MRCH 2B4CL 4HFUH 2DW5A 1YYLL 2X4UA 3WFDH 1XGRB 3TTYA 3ZUNC 1I1CA 1BQRA 2YD6A 4RQQB 5E51A 1BGXL 1U21A 3MZTA 3PUUA 1UA7A 5DYOB 2MTPA 3FQWA 4JRXA 5GHWH 1NCWH 3EOTL 4Y1SA 4PPTA 4AWJC 4X4ZA 5BS0B 5FEBA 4DOHE 2NY6D 2F8XC 1L0PA 4KQ4L 2MCPL 3OHXA 3P0GB 4ACTA 1VGKB 2D0HA 4AUUA 1NCDH 3LXAA 3T0BA 3LPPA 4BFGA 3BWAA 4R7LA 2AS5M 4X6BA 1NMAL 2O5ZH 3TH4T 3HE6C 4ALAC 1S9XB 1BOGB 5IB2A 3HMXL 3MRBA 1ZVSA 4LKCA 4GKNA 5E2WL 3O2DH 1OY3B 1HEHC 3F7KA 4M9OA 4YSOA 3PPEA 5JHMA 2Y1YA 1S78C 5T3XD 4XI5D 2GCYA 4LSTH 5EIIG 3O3UN 3NDYE 1W72H 4P9ML 1DVQA 2R2EB 5DLML 3RIKA 2VH5L 1E4WL 1T21B 4NJAH 3CFDA 1BZQK 4G1MB 4PCKA 3S4SG 3UEZA 3TJEH 1MJUL 2BVPB 3DYPA 1XD0A 2VXSL 1OE3A 3ZXAC 3TT3L 3PS6A 3ALXA 5DJ8A 5I23A 3NFSH 5CJ5A 1INEH 3UTSE 4L4JA 1A7BA 4FTVD 4HK0B 5ECGA 4WUUD 5CLWA 2X2HA 1BBJB 2HLFD 3NSJA 1W0WB 3OKDB 2XICA 3TZVD 4ZNEE 2LGNA 3IN2A 3DK2A 3ML8A 2BVEA 1HSBA 4M48H 1IVTA 2JI2A 1S9VA 5AW4B 3CSFA 4CADB 1L3NA 4JZOB 3KGRA 5GGTH 2ZF8A 4H5SA 4YWGH 4P5KA 2NY2C 4MXWH 5KN5A 1I7TB 4DN4L 1ZJAA 2XDHA 3VDBA 5A6IA 1ZJBA 1BVZA 1YDPA 1AYRA 5AQ0A 1XB6A 4Y4FA 3X1EA 4XBEH 1MFUA 4J1UB 2KPWA 3FAXA 3GBEA 4QXUH 4YBQD 3CDZA 1AO7B 5D7JB 4NI6A 1UASA 1CF8H 3Q1SH 4HEMA 5FYLL 3THML 4DP6X 3B34A 3NQIA 2NR6C 3CH1A 4HUXA 1QR1A 2WANA 3Q8EA 1IEAA 2NNFA 2IH8A 3CFCH 1A4BA 3V5HA 1YY9D 2FBJL 3AREA 2NNAB 3S35X 1NGYA 1A7RL 3CHXA 5DD1L 5HHNB 3SQBB 3C9NB 1QPKA 1YAIA 3MBWB 4WWKC 1ESOA 1O7DE 3SYOA 2RIKA 3MLUL 3K2MC 5D7IB 2WUCL 4KXBA 3TH2T 5I8CA 2AK1H 3DLQR 2ZSWB 4HBQA 3MA7B 5ETUA 4MAZA 1HL9A 4K8RL 5A3ID 5C0AD 1KN2H 1I9IL 3D25A 2CM6A 2FWSA 4LLYA 4OIBA 1GGIH 2X4UB 4YN3A 3W2DH 4KH9A 3ZUCA 1WT5A 4L05A 4M6AA 2LU4A 4U1HA 3N44B 4F9LC 2PUQT 1IEBA 3FQWB 3GSNA 4JRXB 2CO3A 1UZ6F 1FZOA 5IR1A 1MVFA 3N55A 4K07A 5D7LE 3OHXB 5FXCH 1CTOA 4M8UA 2F08A 3CFTA 3BWAB 1IQWL 4X6BB 2N3JA 2OYLA 3GO1L 4DETA 3UGUA 5IB2B 3KYAA 1ZVSB 3B2VH 4LKCB 4X5QA 4GKNB 1A9EA 1GS6X 3CHRA 4O4YH 1GMIA 5JHAA 3NFPA 1FZJA 1N18A 4FABL 1XDTT 3ML9A 1GCFA 3MSPA 2GCYB 3RPIA 5DZAA 1UH2A 4Q9QH 4J5VA 2W88A 1JZDC 2WXRA 3CZEA 4PJ7F 4X9YA 4K3HA 4K7PL 3JUZA 4N3UA 4DNLA 3BE1H 3CFDB 5E6ID 4Z8FH 2D7TH 4DN3L 4JPVH 5IHLB 3DVFA 4IKJA 3S0PA 2UZXA 3MRNA 3HCVA 2JKTM 3NK4A 3N50A 5IHUH 3VD7A 5AFAA 5KVDL 4N90E 5DJ8B 5SV4A 3WV0A 5E9DA 1C08A 5T1KA 3NACL 3LNHA 4AZ8A 4IHBA 1HKLH 1IC0A 1OHZA 4LESA 5HD8C 1U33A 2IQ9H 2BMKA 4MS6A 1MI5A 3NEXA 4BCXA 5CLYA 2NMSA 1PS3A 3SDYH 5HYSG 1J1PL 1CR9L 5C86A 1HSBB 3QEQD 2V5MA 2MMXA 4NAMA 3WJJC 2ZXAA 1S9VB 5C09D 4XXWC 1AZZC 1SYVA 3KJ4B 4H5SB 4P5KB 2VDNB 5KN5B 1TPXB 1HWGB 1ILSA 1UM6L 2XVLA 1PL3A 1YDPB 3PJSB 4Y4FB 5KSVA 3F7PC 2E86A 5E2UH 5E99L 4KZ0A 2DQGH 2QPDB 3CDZB 3I74A 4FN0A 1AZNA 1DEEA 3KAAA 1V54B 2BNQD 3CH1B 4HUXB 1QR1B 1OWWA 2Z8VC 3R7RA 4FDWA 1IEAB 2P5WE 4E41D 2D4DA 3GHBL 3V5HB 5LKNA 3AREB 5CUSL 3ARPA 1NGYB 2G3XA 1DJZA 2BSED 4UT7H 3DUHA 1ZT1A 3VRLF 4HUMB 3T6QC 5I8CB 2K8MA 4YH6A 5ETUB 1EVTC 1PYWA 2OP4L 1R46A 1S9WA 1NINA 2Z6FA 3F8UB 3D25B 3QZWA 3I9GL 5EUOF 4HLZG 1C1EH 1PLCA 3PQYD 4LLYB 1A8JH 3VAEA 4UOJA 4PLJC 4MA1C 3R1GL 4U1HB 7PAZA 4QUOA 2IDSA 4S1RL 3DBSA 2D3LA 4KROB 5H2BA 1YEKL 3W81A 1IEBB 2K4AA 3GSNB 5FLUA 3VGEA 4M1DH 1D5IL 1GMEA 2QVIA 1WCBA 1FZOB 4W6YB 5IR1B 3U30B 4LIQL 3SCMC 1IGJA 1V8HA 4NRZA 1WHOA 4PJDE 2HTLD 4E5XA 3W37A 3GRWL 1PAMA 2WYZA 5D2LF 5B39A 2V8LA 3OGCA 2J56A 4FEIA 4P2OD 4FQLH 4GAAA 4QTFA 4XP1L 4DTGL 3TPUA 1A9EB 4U1GB 4FJYA 3CN2A 3FO2A 4O02H 1JWMA 2PYEE 3NFPB 1FZJB 1UD3A 3AT8A 3NCBB 3RPIB 2QVKA 3HG1A 3NA9L 2ZWLT 2VM9A 4OCLC 3FCBA 4L1BA 3U25A 1FZMA 4NBZB 1GTFA 3NCEB 1T2QL 3QBTB 3MRNB 3HCVB 4ZNEA 4LEBA 3VE0A 3ZBMA 3FZUD 5E9DB 1C08B 5T1KB 4AZ8B 2DIEA 4RX4A 4JGJA 1QI3A 4EAEA 2BMKB 3IPFA 1MI5B 3UZEA 4TNWK 1DYZA 2ICWI 5EEYA 4M62H 1VPOH 4JJ5A 4K5OA 4ZMLA 2XV2A 4U1MA 3MBEA 4NQCD 3BT2L 3D69A 5T3ZL 2APFA 3PYCA 5DHVA 5CMAA 3WIHH 1OAYH 4F2ME 3FQUA 2PN5A 3LH9A 1ZA6A 5LWYL 2UVFA 1AR1B 1SYVB 4PJFA 4G11A 1X9UA 4K2UL 3RIAK 2Y7QA 3RQ3A 3ZHLA 4JKWA 1CI3M 4WFED 4POZD 4NQED 5F9AC 3GBNL 5KSVB 5BQDA 2XI9A 2X05A 4F58L 2AANA 3WXVL 4GSXA 3DO3A 4RISH 1IJNA 2FGZA 4L5FE 1DEEB 1GPOL 3B2UD 5D2NC 1I85C 1IAMA 4KJPC 4LZKA 5F96L 4KTYA 4AJWA 5KVEL 2AITA 3MRRA 2VDKB 3V52H 5E5UB 1TYEB 5DFVD 3SPJA 1ZT1B 2Y7OA 3GK8H 1HFUA 5TDNA 4I9WD 3QEGH 2V9UA 3ILQD 3L3KA 2EUXA 2LLLA 1PYWB 1RIHL 1WAAA 1S9WB 2O26U 2PW1A 4LCWE 2K70A 5AW8B 3QZWB 4PV1C 1FVDA 1WFMA 2F8OA 4HUNB 3W9DA 3L3OA 4JGUA 5TTRA 4CDGC 1PZSA 4HS8L 2MCG1 4PRHE 4XR8C 4YFDB 5H2BB 1FAKT 4AVKA 2VLJD 3TWYA 5KZCB 3UPRA 3L5WA 4GFTB 2VDOL 3ZY7A 1WCBB 4BZ1A 3BZEA 1BXXA 3H2PA 2R4SH 1IGJB 5GGSY 1OALA 1UT2A 4PJAA 5F1NA 4NRZB 4ZTEA 3MLRH 4E5XB 2AZAA 5I1EH 3QUMH 1ZIAA 5LCVL 1QX1A 1ZTXE 1BD2D 1HT6A 3CAFA 3IJ7A 4O2CA 4U6TA 4YS4A 3SD2A 4KKLD 3KPNB 5B39B 5JW4R 3FU0A 1YEFH 3OGCB 4AVIA 1CU4L 3I6SA 3BVXA 1FNFA 3TPUB 4G6AD 2X9ZA 5DF0A 3FO2B 1MEXL 2PWGA 1JWMB 3LKNA 3UIZA 3RZCA 5C0CD 1LO3H 2Q87A 1WS8A 4M1GL 2V9RA 3K0WA 5DC0A 3ECWA 3FYEB 3HG1B 3WEXB 2ATPA 3HC0A 4RSVA 1O7SA 3OB0H 4JZNA 4H4NA 5BZWA 3NIGB 4MQXD 1FZMB 1KPVA 4I0PA 3TM6A 1YEGL 2A9AA 2VGLM 5KVFE 1MFDL 5FO7B 3VE0B 1XCQA 4LL9A 4HKZB 4DPRA 3LB6C 3IFLH 3E7JA 5E1GA 1KXTA 1VGEL 4KI5D 1ORQA 5DO2C 5FAAA 1TKWA 1YHPA 3HEIB 4XC3L 2G3MA 2XTJE 4RZKA 1MWAH 4JZJA 4U1MB 3MBEB 2IDUA 2XJLA 3D69B 3TURA 5DHVB 3FCTA 5CMAB 2BNRA 2ADJA 1YQVH 5DC4B 1QHPA 3Q05A 3FQUB 3V4PL 1ZA6B 2BW4A 4PJXF 1M7XA 4UWQB 1QSEE 4PJFB 4F8OA 5GGVH 2D7QA 2VERA 2Y7QB 2MQCA 4NWTH 4LSUH 2VLRA 1QSFA 3RAJH 5FUCC 2Y7NA 4Z95H 2FH6A 4O02A 3KLKA 2P5WA 5IF0A 5GRJH 2D9QB 4GAYA 5GS0L 3RY6C 3P2TA 2YQBA 2ENPA 4WWPA 2WZ0A 3N43F 5D7JC 4NQDE 2K1MA 2F58H 2DQFB 4B97A 4EO5A 3MRRB 2X88A 4ELDA 1OB1A 3X1NA 5CM1A 4C47A 1SUJA 3C2AL 4WWID 4YSDA 3QRLA 5IIEA 2R8SL 1T0NA 5TDNB 4LBAA 4Q9RH 3H8NA 4UZGA 3L3KB 1JMZA 1PD6A 4PJ8C 3RI5F 2PW1B 2IWGA 4MBOA 5DS2A 3TU6A 2CHWA 3FQ4A 1FVDB 1OPOA 3W9DB 2EUVA 1UM5H 1KB9J 3QB7C 2WWMD 5IJBC 3L3OB 2RCSH 2Y5EA 1CPUA 2AQTA 4PJDA 5FECA 5B7FA 4S2SB 4PJ5E 5AZ2H 2FSDA 3UPRB 3L5WB 3UOAB 3CXDL 3D87B 4QF1A 1URZA 3BZEB 2B0SL 4TPRL 2QQNH 1I9RH 2FLMA 3N85H 4IEFA 5F1NB 3OHXC 4PJAB 5HGDA 1HL4A 2PYEA 3LSOA 3FTVA 1OK8A 3II1A 4Z9KB 4O2CB 1CDIA 4AL8H 3WFBL 4NS0A 4PV8A 1MRFH 5DEJA 2J4WH 4PS4H 3IKCA 2A9ML 1ZHBA 3RZCB 3LKNB 4AK2A 2YEVB 1UFUA 2CPUA 5F7EL 3V7AE 3W11C 3WFZA 4FG2A 1TTBA 2XXCB 5JOEA 5FIEA 2GBUA 2ATPB 3HC0B 4AIXA 4FNSA 4IDJL 4JZNB 3HB3D 4CSTA 2YZ1A 5TFSL 1MCCA 3QIUA 3QK0A 2P8MA 4GAGL 2WNWA 1KPVB 1JPEA 4ICWA 1XEUA 3O4LE 5F93C 3WSQH 3D39D 3BRGC 1NDGA 1XCQB 3FHEA 1KIQA 1K8DA 5IBTH 4YK4B 3SE8H 4GUCA 4OSUH 2HN7A 1R4XA 3APFA 4Z7UE 3L7FA 3UTQA 4MRBA 1KXTB 3ZKMD 1EJOL 4LOVA 1ORQB 3QXAA 5IBUB 2WKOA 1TKWB 4JZJB 3TGXA 5HHPA 2VW7A 4OCWL 1CDGA 2HJFA 4TYUA 3FCTB 2BNRB 2ADJB 4OQ1A 2H8PA 5IT2H 3N41F 3QUMA 4M6OH 3KJ4C 4S1SL 2WJ7A 4ADIA 2VLRB 1TPXC 4FFVD 1QSFB 3JTSA 5AB1A 4DGYL 3LD8B 4O02B 1HWHB 2P5WB 5IF0B 1R33A 2YN5A 4YNYA 4KTGA 4ANUA 5JW3H 1MELA 3GKWL 4Y4FC 4WFHE 4RZCA 1IC1A 4GAYB 1TT6A 3FMGL 2VDRB 3BD5A 2VSCA 1CFBA 4K3DH 3UBGA 5F72S 2X4PA 4HETA 5TQ2H 1H3PL 1JDAA 2AQ2A 4FJZA 5IJKA 1VZHA 3RIFF 1OB1B 4ZX3A 3ULVD 3QWRD 4LLMA 5F0LB 1PCSA 3AREC 5ITBH 1J12A 4BSWA 2NSMA 4WJG3 4ABQA 1WS7A 2VC2B 3CZUB 5IIEB 2XN9E 5JOPE 3TV3L 1T0NB 4CMMA 4G80A 5E8DH 1UB6A 1QBML 3RVTC 1UXMA 3VYOA 1LQBC 4ZPVA 1MPAH 5MEOA 1WIUA 3HE7B 3GBLA 1WT5C 4TLUA 3MKGA 4PJDB 4OM0H 4GRLD 4PP1D 3P4OA 5FECB 2W59A 2BVYA 4KROC 2A0LC 1KLUA 2Y9RT 5EC2A 1T1YA 4QF1B 3GDBA 4KXZH 1RZIA 2DIJA 3FPYA 3MPCA 3KL3A 1FA4A 4LLUA 3GHPA 1FF5A 2PYEB 3LSOB 3MLZL 3QORD 5AOJA 5HGDB 1EEUA 3BQUD 3T0VA 5JHBA 4AITA 3WFCL 4KV5F 3WTYA 3NP4A 2B20A 3Q2CA 4PV8B 4X9HA 4S1QL 4AI7A 3IKCB 1A4KA 3Q6FA 4JPIA 3WAKA 1ZHBB 4U1GC 3QQ9D 1M7UA 3A6BL 3X1FA 3BEVA 5ERWA 4DF9A 1QFWI 4IS6A 3PF2A 5CINH 4MD0A 3L3HA 5FYLD 5ISZD 5FV1L 1MAJA 1KB9K 2YGNA 5HDQH 4K94C 1DUZA 1T83A 2JB5L 3JWNG 3QIUB 2P8MB 1UFGA 4H8WL 4J28A 4KDVA 4ONFH 2GIMA 2NY5L 5IROA 3QIWD 1YEIL 3PLYA 2BZ7A 4ZFGL 4JNXA 1NDGB 4GMSH 1UD5A 1TXKA 2WP3T 1K8DB 2HYMA 2ICWJ 4LB8A 1RZKH 4Z76A 1HINL 2HN7B 3DTUB 4RBPK 3L7FB 4KHXH 3UTQB 1R24A 2OJZL 3QXAB 4FI7A 2GQHA 5HHPB 3NJMA 4Y2LA 5BV7H 3OLIA 4P23C 3SZ6A 2H8PB 4NEHB 2PXYD 3QUMB 5T1DH 2IG2L 4R6UA 4N68A 5A7EA 4J2QA 2OULB 1AR1C 3GJFK 4K5MA 3PNRB 4NQDA 1NPJA 1NM9A 3HI5H 1K5WA 3JTSB 3C6EA 4H26A 3LXUX 2XTSA 3QYMA 6FABH 4MJIE 4YNYB 5IW1A 2BSRA 3F00A 4TL5A 5K59E 4RZCB 3BD4A 4HCIA 4GINA 3OB8A 4N2AA 1VA9A 4YO0A 4GAJH 1ZANL 4OFYA 1UWXH 5JA8B 3F5WA 3KGUA 2X4PB 3U0WH 4Y16A 3EYVA 2OSXA 3UG3A 4NWUH 3I3DA 5D5MF 4XP4L 4YE4L 1HX0A 4LLMB 4GIOA 1LEKA 3BJ91 3PWUA 4KK9C 4BSWB 3JWOL 5A7BA 2A77L 4B5EA 3GJFA 4PJCE 5JR1L 5AW2B 3SOBL 4B9IA 4C4KT 1M53A 4FKKA 4LARL 4CMMB 4G80B 3EYFB 1UB6B 3EDJA 1CN4A 4ZMPA 3PPSA 3V95A 5LGJA 1O9ZA 4ZPVB 5MEOB 1QYGL 1HKFA 3WKQA 3P4OB 3ERXA 4WLCA 4XP5H 2I27N 4BV1A 4KK5D 5E94A 3JV0A 1KLUB 3IN0A 5EC2B 1T1YB 4G71B 4X80H 4PJEE 3QHZH 4P8QA 5HYIA 1RZIB 3PDDA 5JHLH 4LLUB 4KI5F 1SOQA 2V3DA 1FO0A 1MLBA 4HQQH 4HIJA 4HLJA 1NUFA 4AQ1A 2H4EA 4RA3A 5FYKE 3QARA 4N8VA 2B4CH 4JPIB 1A4KB 2EUZA 2HRPL 2FIRT 1YYLH 1NH6A 3E38A 4OZGE 3BEVB 3MI6A 3LQAL 5DZJA 2DOCA 5AOMA 5ERWB 5IUCA 3QFGA 4IS6B 3EH5B 3O4LA 4MD0B 3L3HB 4FFWC 3IJ8A 1P5UA 2HT4C 3EOTH 4U2ZA 3EO0A 2V7NA 4Z7UA 3W0WA 1DUZB 1KCRL 4YGVA 1RP8A 2MCPH 4KQ4H 1TEFA 2ZP9A 1A66A 3GBML 1KYDA 2XTJB 4XNBA 3DHMA 3T6ZA 1BZ8A 1CDYA 1GJIA 4W6WB 4CVXA 3GSVA 4P3WA 2V5YA 1NMAH 3GMMA 4Z76B 3MJWA 3FUKA 3HMXH 3AM8C 5FM4A 1R24B 1Z7JA 1UT1A 5E2WH 1XSJA 4NZUL 4L18A 3UZEC 5F9JA 2X9WA 4JN1H 3AVEA 4OD1L 2L7UA 3MBEC 1AC0A 1B0WA 4UMSA 3OZKA 4ZOAA 3EJZD 4P9MH 5E6UB 5DK0A 2BIOA 4B9JA 4IBSA 5DLMH 2VH5H 1N6VA 1AZRA 5CN1A 5J5EA 1FI8C 2HT3D 2HKHL 3KEHA 4NQDB 4LSRL 4ZOCA 2VXSH 2YRLA 4H26B 1YZZA 2HVJA 3MCYA 5MP6L 1G87A 5IW1B 2BSRB 1GXEA 3RBSA 3FW6A 4PJGE 1KWGA 1M56B 4LSDA 5KOVC 4YO0B 5F1SA 4JL2A 4MB3A 1Z5HA 2XN9A 4HC1L 3F5WB 1OGAA 4LSPL 1AMXA 4Y16B 4FA8A 1KJ2A 3EYVB 1IM9A 4TQEL 1BVOA 1E40A 3UDWA 2O5NA 4KPHL 4BZ2A 1LEKB 1NSNL 5I0ZA 4P5TD 3B8SA 3LRSA 3PWUB 4A2LA 3K3QA 4HHGA 5HHQA 1MJJA 3QRFM 3GJFB 5C07E 1I8KA 1A6PA 5JHDE 4DN4H 1I1AC 5A2BA 3TFBA 1VEMA 4QY8A 5EO9A 1FYTE 5LGJB 2OYMA 4HISA 2CBPA 2AEPL 3L3OC 3UPAA 4TF4A 5FYLH 3THMH 2DYSB 2XWBA 5H4YA 1P69B 3R0NA 4TUOA 5GZOD 5E94B 4CGUB 5D70L 1OKEA 2IMNA 1MN4A 4H40A 2BSCA 2DKUA 2FBJH 5LG1A 5L4MA 1A7RH 5DD1H 3VUAA 3GI9L 3QZNA 4KOCA 3BCDA 1CE6B 2IVFC 2W91A 5AWNL 2HT2D 4M43H 2FGWL 2Q3ZA 1FO0B 1MLBB 3MLUH 2WUCH 4HIJB 5J13B 3ARUA 4AQ1B 2Y3AA 1NQBA 3JZ7A 5ECJE 4K8RH 4N8VB 1BXAA 4F2EA 1I9IH 4TVSa 3WY4A 1KZYA 2VZ3A 3NJIA 4J3TA 2Y69B 3F64A 4C83A 3O4LB 2XY1A 5MI0B 2WXQA 4UQ3A 1P5UB 3C09B 4FD0A 1N19A 3EO0B 2OMXA 1CB4A 3BLPX 4R7VA 4AMXA 4YDVA 4IOFC 4WWOA 2V7NB 1MY7A 2A6JB 1IC7L 4MVBC 4Z7UB 3STLA 4YGVB 3VI3A 3W0WB 4XPGL 4JK0D 5FPIA 3E8UL 2F1EA 1ES0B 4G8GD 3MRFA 1ZLWK 1Q72H 2EDNA 4KDTC 3R18A 2BIHA 3BKCL 1G9MC 3IBOA 2IAMA 1IQWH 4CVXB 1EJ8A 1AIZA 1S5HA 3GSVB 1C5BL 5EOQL 3GMMB 4TL4A 4TLTA 5BZZA 3GO1H 4YK4C 3B83A 3ULVF 1J5IA 1QI4A 4QLWA 2CHZA 2GC7C 5F9JB 3NA4A 4FABH 4JZJC 2NZ1A 5GS1A 1KJ3L 1K4DA 3CFUA 3NZSA 3P40A 4QRPE 3FNKA 5DK0B 2AQ1A 3D1MC 4PWHA 3RX5A 4OT1L 4K7PH 1RPQA 4M8RA 4XN5A 1MWOA 1MCNA 4DN3H 5F2FA 5T1LD 3D50A 5HDBB 2HVJB 2AF2A 3LD8C 5KVDH 4MRCA 3DX2A 4KRMB 4DVRL 4M7JL 3TASA 3NACH 5HDOA 1RK7A 1NJ9A 2NNRA 2A6IA 3TP4A 5FCUH 1NLBL 1NBYA 2XN9B 1OGAB 1KJ2B 4XCFL 5C0ND 4HJ0C 1J1PH 1H6FA 4L4TE 1XB8A 1CR9H 2JIXA 1R17A 2XV6B 1GGTA 2RJMA 3TBYA 3LRSB 4KZEH 5HHQB 1MJJB 4C56E 3L4WA 1I8KB 2CA3A 2XYBA 3P3SA 3EHBD 2FT8A 3UC0L 3TEZA 5C3TA 1UM6H 3SDCD 1T7YA 3TH3T 1A6VH 5CIPA 3VG9B 4E9TA 2HRLA 4P59L 2XOTA 4QY8B 5EO9B 3FSZA 4F15B 3V0FA 2V3FA 3SGDH 2EKJA 3HE7C 4AQ8C 2K8QA 2DI9A 2XWBB 1HHGA 2BM3A 5EZJA 1GJWA 3I3BA 2XRAL 4TUOB 5E7BA 4HIEA 1SFHA 3GMQA 3GYRA 4WCYL 5CUSH 5E1IA 4Y9BA 4H8QA 2ALAA 5DZOA 5L8KB 2NNXA 3UROR 3C8DA 5E2TL 4BHUA 2GFBA 4PMFA 2X1XR 3LQZA 3GIVA 3ZQ9A 5HHOD 2LAAA 3UGEA 1F02I 3RVVC 4A55A 4GEJA 3HS8A 4BFKA 3K4AA 4Z3EA 5IHBA 2OP4H 3DVGA 4ABUA 3R1GH 4OGZA 1BXVA 4S1RH 4C83B 4JRLA 1UGNA 1YEKH 4UQ3B 1A3LL 3U2SA 2OMXB 1D5IH 4YDVB 3QXTA 3STLB 3VI3B 4LIQH 4KOBA 4I5BA 4IBYA 3NJXA 5K9OA 4QI3A 1A14L 5DA4A 3MRFB 2WBJD 3TC9A 4UF7C 1OCRB 4W1TA 2AQ3A 2LABA 2IAMB 2IAND 3GRWH 1JMXA 1S5HB 4NLAA 1E9QA 3KJ6L 2XKUA 1ZPUA 2EXYC 4MMYA 4TLKA 4L1LA 2W9EL 1XO8A 1YNKL 3D34A 4XP1H 2X4TA 3EJYC 1BQHA 1N3NA 2AEIT 1E4XL 2JQZA 5JLZA 3LN4A 5A40E 1EZVX 5GS1B 4LHJB 1K4DB 2WGNB 5F0JB 2R2BA 5D1XA 3FYIB 1ECYA 2DL9A 2RTTA 3U1QA 3BC9A 1OVZA 5E4AA 5AOIA 3EJTA 4EJ1C 2I26N 1WIOA 3RWGA 4IKKA 5D71H 3SN6N 1MHPL 1T2QH 3SZKC 5DZVA 3DYMA 5TQ0L 3KXFA 4Y2NA 1YCSA 3NJFA 1L9RA 3I6LD 1NJ9B 1UJ3A 2VERN 5F8RC 1MG3C 2A6IB 3Q2WA 12E8H 1ET7A 1NBYB 3EH4B 4DWHA 4JX0A 1T3FA 3BN3B 3LPFA 3FUDA 3BT2H 2XVGA 3BOVA 4JHWL 5T3ZH 4CUCA 2JJTC 3VMOA 4R0LC 1YEEL 4D94A 5IJKC 2JIXB 3BYYA 1HYSC 3PAZA 1ZLEA 1N68A 2QLVB 3CK0L 4NOFA 3TBYB 5A2FA 3ZJAA 5JUEL 5LWYH 1KFAL 3M1OA 1S7UA 3TL5A 3UAAA 2CALA 2PTTA 4K2UH 4PRIE 4NUGH 4HBCL 4DKEL 3QRBA 3R4RA 5DT1H 1ZSDA 5C2UB 5CIPB 1EAPA 1SLUA 4RAVA 5AKVA 3GBNH 5T5FH 4PJEB 1F18A 2BP5M 4F58H 3L2LA 3QZOA 3WXVH 3C08L 3RVXD 3RDTA 5I1CL 2XQBL 3VA2C 1GPOH 3ZE1F 1HHGB 2WV3A 5EZJB 4APXB 5F96H 3MRLA 4P46C 3VGDA 4BSJA 1E2WA 4OB5L 4HIEB 5KVEH 3GMQB 4AQZA 3CBRA 3I50L 1JWUA 4ZAKB 1VESA 5IB1A 2G4GA 2W0PA 1MCOH 4I2XA 5TE7L 2GFBB 3SE4A 3LQZB 3GIVB 4L1HA 3QDGA 2WLJA 1V7ML 1WBXB 3VFVA 5H37H 2DJ4A 5DGRA 1NANH 1XF2A 3T6VA 4L1TA 4GG6F 2AEOA 3V6OA 5A2IH 4PY7A 1NCNA 1USZA 3GNML 3D4ZA 3F3HA 3DVGB 4M61A 1AG6A 3HR6A 2A73B 5BVJA 5DD5L 3FO0L 4AMKL 1UXWA 4HS8H 2XG4A 1QNIA 1U3ZA 5DFAA 3OAUH 1Q1PA 2R0KL 4KNTA 3U2SB 5BO1H 2DQEL 2BWIA 2NDGA 2VDOH 1OT2A 3QPXL 3PHQA 1U42A 3QS2A 4I5BB 1T83C 4ODWA 3CHQA 2FYVA 2UXFA 3R8QA 5K9OB 5IROC 4S10A 1G0YR 3L4ZA 2GJ6A 1L9MA 2QSCL 2XTJC 5LCVH 1RFDH 4PCSA 1EXGA 2X12A 5E2VL 1E9QB 1BAFH 5D7KD 2HAZA 4MMYB 3S97C 1CU4H 2D7MA 3V6FA 3DX9A 4W4NA 3HKFA 2X4TB 1UB5A 1BQHB 1N3NB 4D9LL 1MEXH 1ROWA 5JLZB 3LN4B 1MFAL 3PGDA 3NRQA 4FOMA 3L9YA 4M1GH 1A02N 2QQKL 2R2BB 5D1XB 2Y7MA 4W9EC 2RBLA 3PABA 2BPBA 1A0QL 4PREA 3PDGA 4LCIL 4L9LA 1QP1A 4I0CC 1B4TA 2J1WA 5DC2A 1UZ6E 3VB8A 2FX8L 5J8OA 2ZKYA 4EIBA 3DYOA 2F5AL 1RZPA 4YDMA 3RVWD 4I3SL 3RWGB 4Y0GA 4F20A 1DVSA 1YEGH 1AACA 2LV4A 4X7TA 5IHZA 4PS7A 1MFDH 4L4TA 3KXFB 4P3CH 4JGNA 1BPVA 5B4MD 5ES4B 5SWSE 4BQ6A 1YAZA 2J43A 1Q0EA 1UJ3B 1VGEH 2WOBA 2BXZA 1E5YA 1UM4L 1UG9A 4XC3H 3GLDA 1T3FB 1X44A 5DEGA 3KE0A 4Y16C 1FPTL 5TPWL 2ZOOA 2BP3A 2RMNA 3UL4A 4UB0L 3V4PH 1EMTL 1H8OA 1A2YA 2FDBP 1S7UB 2KPNA 35C8L 5IM7A 2PTTB 4HYTB 4PJ7E 1ZXQA 1AXIB 1OGTA 1T1XA 2R51A 1EXHA 1ZSDB 3LIZL 5J3HD 4KAQL 3CVBA 2OS7A 3KVQA 1EAPB 4BJLA 2EDXA 4RAVB 1WFIA 4BZYA 3S5YA 4QGYA 2YD3A 1F3RB 4H13C 4KHTL 4NP4L 1WHPA 2WXJA 2HG5A 5GS0H 4GP5B 2XWEA 3RDTB 1HZKA 1EGJL 1X9LA 4JM2D 3MRLB 4P9HL 1DBAH 2DLTA 5E70A 3WOVA 3DIFA 1JWUB 1OSPL 2VQUA 4P48A 4A7UA 5C9JA 2DTML 5E56A 4I2XB 3VX1A 2QSVA 1F4WL 2XVKA 4HSAC 3C2AH 3QDGB 5B21A 3HPJA 2F7OA 5B1BB 4JQIA 3VFVB 2R8SH 1NTDA 1R3HA 2QV4A 1XF2B 5J13C 1AZVA 2F5BL 3IKKA 3ZDZB 4PY7B 4M61B 3X1BA 3NUKA 2WUBL 1SVZA 5BVJB 3KBEA 3HZVA 4WU5A 1XGQA 3QG7L 1RMFL 4P2RE 1UXWB 2XG4B 1ZWIA 4DEUA 2XIBA 4LRIA 2UUDH 3EUUA 3NIDB 5MI0C 1P5UC 3C09C 3P54A 3CXDH 5C7XL 5F3HA 3PHQB 3PGFL 3ZR5A 1E28A 2B0SH 4PS3A 4M6ML 3K7UA 2EDRA 4TPRH 4WO4D 5KVGL 4D8OA 4ODWB 2R29A 3NZHL 4CVUA 3KYNA 2GJ6B 2Q7AA 2DKMA 5T5FA 2GABA 3VRLE 2CO2A 4FXKA 4NP9A 2C26A 2VN5A 4UM9A 2APTA 5C7ZA 3WFBH 2NY1B 3GXIA 5EIVA 1MKFA 3V6FB 3DX9B 2CNZA 2OTWA 2YUZA 2EEXA 1UB5B 3IJSA 3KHQA 5EUOE 1C5CL 2A9MH 2BNUA 3K6IA 3MBXL 3CZKA 5CGBA 3PGDB 1PG7L 2VN3A 2Z7YA 5J7CC 5F7EH 4MXQD 5AVWB 1F1DA 4N25A 5G55A 3P0YH 3PABB 4PREB 1JNNL 1WA1X 3F7VA 4L9LB 4IDJH 1DQVA 3CN1A 5H37A 1S2EA 4ZW6A 1DQMH 4AYID 3UAFA 1EAJA 1PIFA 3AAZA 4X83A 4ODHL 5TFSH 4GAGH 1X5AA 1YPZE 2IBZX 3PWPE 1B6UA 4IRJA 1OLLA 3OPUA 3H9HA 3T2OA 4X7TB 1KPRB 5IHZB 1SM3H 3R06A 4L4TB 5IFJA 2YAEA 3LZFL 3ENEA 5D2LE 5F1OB 1RL1A 2DLFH 3QQ4A 1CDHA 1MLCA 2MTAA 2ODIA 1U2HA 3L4TA 1EJOH 1SXSA 3IK2A 4WI7A 5AAWC 4K3GA 5DEGB 1H15A 3TIDA 1G9HA 4FG0A 3VM5A 4OCWH 2ZP0T 4DCQA 5AW6B 1Z6JT 4ZG1A 5LCVA 5CWSA 1A2YB 4GW4A 5IM7B 3K71A 3CUPA 2H41A 5KYXA 1T1XB 1OGTB 4G8FA 5HDWA 1T1ZA 3IMTA 4DGYH 3N04A 3GQFA 4GY4A 3GKWH 4GRWH 3BAIA 2L7QA 1DSFL 2HG5B 4F15C 4PB0L 3FMGH 4OGXL 3AG2B 1Y6MR 2ZAHA 5FDYA 1RPUA 4RGNE 3ZTEA 3DIFB 2C9QA 5CP3H 3LCYA 4U3XA 4CRPA 1B4LA 5EN3A 1I3VA 3AUVA 4YHYB 5C9JB 5KG9A 1TOXA 4OJEH 3O45A 3B2PA 4HD5A 1MCWM 3HPJB 2VTFA 4NLHA 4KXCA 1E7VA 1VIWA 4KKQA 3TV3H 2XETA 1R3HB 4FCAA 4WZ9A 1OAQL 5E9NA 4WWNA 1KTCA 1QBMH 4Q0XL 2W38A 3ARWA 3ZYZA 1DVFD 3ETBF 4WU5B 4FX5A 2JFCA 1ZWIB 2OPCA 1DFBL 3UGXA 1QFUL 1NZRA 4R5VA 3OAZH 2X6AA 1E28B 1RQ5A 4PRPD 1N5YH 1PBYA 2C3GA 1A9BA 4W93A 3TO4A 1CGSL 3KYNB 1FRGL 3MLZH 1GYWA 1MW2A 2QVTA 4FQPA 5CBEA 4QJ3B 4FXKB 3WFCH 1M4KA 2ENSA 2IAMC 4PY8I 3RWCA 4UM9B 5T3XE 2WWOA 4OIFA 3PL6D 4EI5D 2OTWB 4S1QH 1WICA 3TWCL 4KFZC 4X42A 2BNUB 3A6BH 3CIQA 3D2UD 4F8LA 1F56A 2IQAB 5AW9B 1GC1L 1UTDA 2JV6A 1FIGL 2MNJB 1QFHA 4YEFA 3F7VB 4G9DA 5AD0A 4DHLA 3AAZB 3LZQA 5FGBC 1I3RA 4QT5A 2JB5H 3E1F1 3FH5A 4B0MM 1E6JL 4A04A 2NY5H 4R7DA 4IRJB 4FTVE 1WA0X 3H9HB 4WUUE 1YEIH 4ZFGH 3TEWA 1SY6A 1JDDA 5IFJB 3RWFA 1LO4H 1URLA 1WTGT 3DTDA 3MFGB 5L7XH 2ZCZA 1HINH 3QQ4B 1MLCB 1VHPA 4N0RA 2OJZH 1NDTA 3QDMD 4OKDA 1IGIL 5KBKA 2FHCA 5INCA 1H15B 3TIDB 5F3BA 4UBDC 2R2HA 1JPSH 1MVYA 4WY7L 5DJ6B 4DCQB 1H9DA 2VMEA 2HFEA 4L3ED 5F7LB 2Z31D 4ENED 1QQDA 1HU8A 1HILA 1MHCA 3OR6A 5MEQA 4DT2A 3BQVA 2IG2H 4IRSA 1FQ9C 1U8OA 4ONOA 1QD0A 3QJHA 3QT2A 1HHIA 4GW4B 5CWSB 3T9WA 4YSUA 1XH1A 3CUPB 4KXZI 5KYXB 1IJ9A 5LNGA 4G8FB 4R84A 2F7RA 1T1ZB 1UZGA 1EA9C 4UAOB 1MF2L 4F27A 4M7LT 5I19L 2NZ9D 2X1WL 1OM3H 1E6OL 3M07A 2J6EL 4HALA 3ZTNL 1ZANH 4A63A 2E7MA 3BGMA 4KKAD 1KGXA 2EICA 2H1XA 2F8IA 4ODUB 4CSPA 1JZ3A 4XP4H 4YE4H 4ZAKC 5KG9B 1DLFL 4MKTA 3S37X 4R4NC 3DIVA 1X7QA 3ZGHA 1CBJA 3JWOH 5C6TL 2A77H 3O45B 5C0AE 4PIRF 4PJXE 4Z7VA 5JR1H 4LARH 5HDRA 1DZBA 3U82B 4BQ9A 2WZPD 4CU7A 2G30A 2YMOA 3U79A 1F45A 4MB1A 1NICA 1QYGH 3ZT6A 3D0VA 1OT1A 4XMPL 5HJ3A 1QWNA 1E30A 3QJFA 3D3VA 5D1QD 4Q4IA 4Z78A 3S36X 3MFFA 4LASL 4N2GA 1A9BB 3CWGA 5EUOA 2G60L 3S9DB 1W2KT 3TO4B 5I82A 5CBEB 3IDXL 2YSTA 1IIIA 4MS8C 4LSQL 3RWCB 2LLGA 2BRQA 5KS9F 1S3KL 4LCUA 2YHGA 2HRPH 3V0GA 1BEXA 2YBRA 3TCLA 3ZDXB 3GSOA 2KS0A 5KSUA 3ZLQC 4FA6A 3OPZL 4ZSOE 4FYSA 5D1XC 4PB9L 5BZXA 1I53A 1KDJA 5D2LA 4B60A 4G9DB 5AD0B 2IJ0C 1KCRH 4N4YB 1I3RB 4QT5B 1KYOJ 2AXHA 5EF1A 1BXUA 3ULUD 1L7IL 4R7DB 1A7QL 1Z5LA 3BDYL 5EU3A 1SUHA 3OQ3B 1L9SA 1NGQL 5FYJU 4NZFA 4JM2F 5D7EA 1MQKL 5K5YA 2KL6A 3RWFB 3N9GL 1XWVA 2VDLB 3LY6A 3QEQE 4N26A 3MN8A 1UJ3C 5K69A 4NZUH 5C09E 4PJ7B 5E0QA 5ADPH 5INCB 5F3BB 5I2IA 4OD1H 1XH0A 4PVBA 3H42L 2VMDA 4P2AA 1OTUC 5GRWA 1HILB 3OR6B 5A2KH 5IZ7A 5MEQB 3CD4A 4IRSB 1U8OB 3QJHB 3MGOA 1HHIB 3DX1A 5JDJA 1U0QA 5IOPB 1I1RA 2HKHH 3HPLA 3UTTA 1CQYA 2LR4A 4APQD 1ZV5A 4LQ1A 2BNQE 5MP6H 2VRAA 3VTAA 1QSZA 3CFNA 4QHMA 2G2NA 4KKCC 4E41E 1UVQA 1WAPA 3ABGA 4ODSL 4L9DA 3RDTC 1QPXA 3BGMB 3HS0A 1WFNA 4LSPH 3KYOA 4X8GA 5MEND 4I85A 4OJAA 4TQEH 3FJTA 1KXQE 1VAHA 4GOSA 2ARJA 4KPHH 1NSNH 1KGIA 1RUAL 1X7QB 4YHMH 3SE4C 3BUQA 3HOGA 4P2RB 4Z7VB 2G5BA 3PQYE 3TFKC 2HFTA 1QATA 2ZUVA 1M71A 3FTSA 4LOEA 3OC5A 3H0TA 2P5PA 3V6OC 1DO6A 3S5ZA 1Q1JL 3JV6A 4A6YL 2DQ6A 5C0GA 3VFPA 4E5XG 2AEPH 2Q6WA 5CR1A 4RFEA 2B1AL 1RZFL 2YA0A 3D0VB 4N87A 2NSXA 5HJ3B 1IKNA 4PJIF 2CDFA 3QUYD 1GGUA 3QJFB 3D3VB 5D70H 5CSBA 4X6DF 4JO5A 3POCA 4Z78B 1LK3L 1R19A 3MFFB 4EUPH 4OV6F 5EBWA 1PMYA 1IL1A 2F74A 5EUOB 5AUMA 3GI9H 4Z7QB 5AWNH 3U1PA 5CJOH 2BC4A 3EH1A 3DO4A 3KHOA 1KCLA 3B4NA 1U36A 3EF7A 2VXUH 3BZDA 3APDA 4LCUB 4X7SL 1MAML 3K1KC 2VMFA 3LKPA 3MV8D 2YBRB 3E1ZA 1GYCA 2A74C 3TCLB 3GSOB 2J1ZA 4TOYL 4NZ8A 4XGZA 3X12A 5KSUB 1W8OA 4FTVA 4JCMA 1LM8V 1QEXA 3ARBD 3SSGA 1JRHL 3QWOA 4CA4A 3RL2B 3TBWA 5D2LB 5CNHA 3TZVA 1UCBL 3G5WA 4P3DA 1IC7H 1NCBL 2NTSP 4ALAL 3S88L 3KG5A 5CJXC 3E0GA 4XPGH 3E8UH 1RJYA 1Z5LB 1J86A 5EU3B 4N28A 3BKCH 1OHQA 3FCGA 3MUJA 4UCFA 4A7VA 2E8ZA 4IBTA 2J8UF 1C5BH 4NQCE 5EOQH 1EQWA 4EBQL 4JHZA 4PW4A 4Y4HA 2QADD 1UACL 1FHNA 4CAGA 5LGHL 1U93B 4YSTA 5I2IB 1KJ3H 4ISVA 5JIPA 3NH7H 4Y88A 2NNCA 3AT9A 3HG5A 1QLEB 1KCVL 3CDGA 2WIMA 1B0RA 4WFEE 4NQEE 3ZO9A 4LOUD 1JD7A 3MGOB 4MJJA 4OT1H 2D3JA 1AS7A 3HPLB 2J2ZA 2W9LA 2BRRL 3C6LD 4MNQD 1P0SE 4RGNB 4BH8A 5TD4A 1KYOK 1MCPL 4QHMB 4M7JH 4DVRH 3OKKA 3WENA 1S7XA 1CVSC 1KIRA 5EV7A 5SWZD 1UVQB 4LDEB 4IMKA 2PO6D 3MV9D 1NLBH 4XVTL 1Q9WA 3HS0B 3TN0A 3KYOB 1MCDA 2P80D 1F90L 1CFQA 4HHAA 2VDPB 3QDJA 2ARJB 2XU9A 4I9WE 3JXAA 3CZJA 1ZGLA 4QCIA 1TQTA 3RI5K 4E9QA 4JFFD 4D3CL 3LRMA 1AVAA 3LH2H 4NCC1 2XPGA 3ZKSD 2G5BB 5FFGA 3UC0H 2DLHA 1M71B 1N7ML 2W07A 3H0TB 3K5SA 1F42A 4LDCA 4TXVB 1BFTA 4FNTA 5DWUL 1XMEB 3GRBA 2VLJE 4P59H 3KPOA 5C0GB 3VFPB 1F3DH 2Q6WB 3G5YA 3CSPA 1IQDA 4FQQA 1EEQA 1S8DA 4RFEB 3WI9A 2FL5A 4XBMA 3M6DA 2XXFA 1DE4A 5HHMB 3FHAA 1M1XB 2CDFB 3ELQA 4TLSA 1A7NL 5EIIA 2XRAH 2AK4A 3BAJA 4WCYH 3VFTA 5D5ME 1BD2E 3JZYA 5HI4D 2JQMA 2YXMA 5EBWB 3MRCA 3VH8G 4ZFOL 5E2TH 2F74B 4QRTA 5AUMB 4HXAH 3WGVB 1AC6A 2BC4B 3S4SA 3H9SD 4PWFA 4Z0BH 4ZSOA 4FXKC 4R2GD 5C0CE 4OW6A 4DESA 4CBZA 2C9UA 4J3OG 1M3JA 4QWWD 4BCZA 5DJDB 1SLXA 5DJAA 5DFWH 3LKPB 1BM7A 2EE9A 1OSZB 1YNLL 1CJYA 4XGZB 2OMZA 3X12B 3DX6A 4YSCA 4FTVB 5GS2H 5I1IL 1MW1A 4WUUB 3ATAA 1A5FL 3B7RL 1A3LH 2PPEA 3QWOB 2YUXA 3ARTA 2VWEE 5FKPA 3TBWB 3TZVB 1NC2A 3CLWA 4P3DB 5CGYD 1MCFA 2NUPA 2F7QA 1A14H 4L8SA 1RJYB 4GMTL 4IRJC 2UX6A 4KI5E 1SLWA 2MEJB 4Y5XA 3E8VA 4QTIL 2CXKA 2P43B 3KJ6H 2FX7L 2GIYA 3ARSA 3N3EA 1W16A 2W9EH 5A1AA 1YNKH 2EUWA 4Y4HB 4ZO6A 2H2SD 5CF3A 5JQIB 3T0EA 2JK5A 4GUOA 4ISVB 4XOEA 3SGDI 3WHXA 3RZWA 2XKSA 2VUKA 4L2LA 4HULB 3CDGB 1TQSA 1B0RB 2C9VA 1G0XA 4RGOL 5JPNA 5CFAA 1TZGL 1PKOA 1A4CA 1NEUA 1QBAA 5FO2A 4BGDA 1V3LA 1WWBX 2IGTA 2J2ZB 1NIEA 1NCOA 4TTDC 1JZ5A 4N8CL 1XHHA 4WV1C 5E8PA 2BSEA 1MHPH 2HWZL 5IFHL 4UAOC 4I3RL 5TQ0H 4WW2F 4BH8B 4RFOL 4QRFA 2O93L 1BM3L 5IW6A 2BFVL 2J73A 2VE6A 3RIFK 1RSYA 2A2QT 3OKKB 4J6IA 1S7XB 4V1DD 1KIRB 3ZE0E 3CLEL 4PVNA 3TT1L 1Q9WB 1RHHA 1Q0XL 3TN0B 4FNLL 2HX8A 5D7SL 5JORA 4JHWH 3TF7C 1CFQB 1EV2E 3Q13A 1YEEH 3QDJB 3B43A 4HHAB 4DGVH 4OZ4A 1ZGLB 2EEDA 4QCIB 2R9HD 3VFSA 5IMOA 5JUEH 1KFAH 4QXVA 2WHVA 1ADQL 4KKRA 2XPGB 4HBCH 3T3MF 3N43B 2W07B 2ZCLL 4GXFA 1OCCB 4Y9GA 4IKIA 3IDJA 4N9GA 4FHBD 1AOZA 2Y6SD 3ZKQD 3G5YB 3ZKXB 1IQDB 2ZTBA 3VXSD 1S8DB 2FL5B 2VMCA 4LL1A 4DUXA 5I1CH 3T4YA 3ULUF 1DE4B 3L2NA 4KRPC 3MRPA 4PG9A 3HFFA 5EIIB 4TMPA 2F7PA 1FE8H 4OB5H 5FHBL 2K3TA 3I50H 3VFTB 4BK4A 4JB9L 4LE8A 1E43A 3MRCB 4FKEA 4QRTB 4NN6B 4AW7A 4ZXBD 3TO4C 1V7MH 2P8PA 3S4SB 4Z7AA 2IAAC 4ZSOB 5I0DA 3BGAA 3NSDA 4FQXA 5E6IB 2H0JA 1SQ2N 1UEYA 2AXJA 4R26H 3WNIA 3DA0A 3GNMH 3DJZA 4NC2B 5DJAB 4WHTA 2VDML 3MV7D 1D7DA 5DD5H 3FO0H 3GKZA 3TA4D 4AMKH 3F6JA 3K6FA 1IRAY 2D7NA 2OMZB 3DX6B 5AVZB 4FLOA 2WNXA 3MDJA 4MJ5A 1A22B 2R0KH 4QXTA 5HYSA 5D55A 4K5NA 3MHZA 3JTTA 2VM3A 4GBXD 3QPXH 5FKPB 3FSWA 3D39E 3BAXA 1NC2B 3O3AA 2NUPB 1A4AA 3QEQB 2EJ1A 1T03L 5FM5M 4L8SB 5E00A 4X2UA 2PPCA 2QSCH 3VFMA 3JT0A 4QHPA 3WTUA 4Y5XB 5E2VH 4DO6A 2VAAA 1W0YT 2FEEL 1SJXA 4RNRA 2VOTA 3KL0A 1NOFA 2C7FA 4H1LH 4U05A 1G6RH 4JVPA 5FYKU 5LQBL 1QRND 1MFAH 2JK5B 5DVNA 2QQKH 2ZUYA 5I6PA 3WHXB 1A0QH 4N2KA 5CZXD 4FHJA 4AX3A 2CMRL 2BIIA 1W8EA 4LCIH 1TTGA 1H3TA 2VXQH 5E1QA 5JPNB 1OTTD 2J20A 5ANMA 4E41B 2F61A 2YIHA 3QJUB 2R39A 1J11A 4KK8D 5EFIB 2F5AH 2Q8BL 3KH3A 4I3SH 4PD4J 4EE2A 5E8PB 3EO9L 4NX0A 2VR7A 4LVNB 5HP5A 3OX8A 1BVKA 4B9GA 1NANI 5IW6B 3TJPA 2VE6B 1YO4A 3S96A 4XHQA 3N41B 2OFQA 3ULVE 3PGCA 3U1SL 5B38G 1UM4H 2MRYA 2Z4TA 1J5OL 3KPSA 1E2VA 1RHHB 2VZTA 2J8HA 1IBGL 3K5RA 5EZPA 1ITCA 5GGSA 2HVBA 4ZPTA 5E8EA 3D0LA 3WTTA 5BQ7A 5TPWH 4RVBA 3QISA 4OZ4B 2VLJA 2OR9L 3SYCA 4DP7X 3TEYA 4HPYL 4UB0H 3VFSB 5IMOB 1EMTH 3KPQA 1CWVA 1RVFL 2BY1A 2GKIA 2QHRL 4L1SA 4ZW7A 3LIZH 1AG0A 4KAQH 1NCCL 3K8KA 1ZV2A 3MOAL 1GGYA 4DUVA 4KHTH 3IDJB 3CDFA 1BD2A 4N9GB 4LBEA 3GTTA 4NP4H 4U1NA 3SDAA 5B3SB 1NFAA 3X11A 4M02A 1IBDA 5E24E 4RRPM 4XPHL 3T4YB 1DN2A 3MRPB 4P9HH 4PG9B 2E7LC 1KY6A 3IWUA 5C0CA 4XZUA 3DX3A 4AM0A 2FD6L 4N2EA 4AENA 1OSPH 4Q9BA 2DM3A 3QAZB 2EH7L 1F4WH 5FM8A 2ZOTA 4HG4J 1DJHA 1PZUB 4OTXL 5ELIA 2P8PB 4JM4L 2L7JA 4PU2A 5BO0D 2ZOKA 2DIBA 4FQXB 2OI9B 2F5BH 1A6UL 2AXGA 2E76C 5AENA 2JCCF 3OLEA 4J3WA 1W9XA 5FYLE 1Z9LA 2AJZA 3AY4A 5ISZE 2WUBH 2AQRA 4WHTB 3UABA 3QG7H 1RMFH 3NFNA 3P77A 4U7MA 4TUUA 4ZS7L 2YWZA 1DDHA 4MJ5B 4RAHA 4QXTB 5ADOH 5HPMA 5HYSB 1A7PL 3EH3B 3JTTB 4XCCL 2H2PD 4Y5YA 5C7XH 3FB5A 3O6FD 3PGFH 2WSKA 1Z66A 2JVUA 3CN4A 3O3AB 4M6MH 4L29A 5KVGH 4N2CA 3BZ5A 3CN0A 3KD4A 3NZHH 5E00B 1UHVA 2WO2B 3VFMB 4P5SA 2ZXWB 2MFNA 2F53D 4BFJA 1SF3A 4Z7WF 1FJ1A 1GOFA 1HEZA 3CFIC 2VAAB 4PFEA 3SIKA 4RNRB 5MEPA 1VEPA 1AP2A 1VFMA 2GC4C 3CSBA 1DVZA 2WXIA 2VJ8A 2EZ0C 1C5CH 1B88A 4HIIA 1T20A 2Y7SA 1CT8A 3MBXH 3CZNA 1XTMA 1PG7H 3VXNA 3NIFF 1A1MA 5F7HA 2IGFL 3D0AA 3IMWA 1JNNH 4KO7A 4P5MA 3TJHC 5IEKA 4PHZA 2C5DC 2YD9A 1C5DA 5ANMB 1DJXA 4NSKA 1T22A 3C5ZA 4R7XA 4I89A 2PWDA 2NXYB 1P4IL 3CQQA 3FS9A 1OAXL 3OX8B 1CGUA 1BVKB 4RGNC 1IV8A 3LZFH 1JK8A 3S96B 2W5PA 3N0PB 3PGCB 2WLMA 3MXWL 1IAOA 3KPSB 5EORL 2FQEA 2FJFA 3OMAB 3U36A 4YSSA 5GGSB 2I32A 5E8EB 3D0LB 3KH4A 5BQ7B 3EBHA 2VLJB 2X9YA 1ZS2A 2HUEA 4R5XA 5F44A 3KPQB 1DBJL 1K2DA 2JSFA 2L04A 3V0AC 3VWKD 2XA3A 5DWPA 1G6RA 4MDIB 2ITDA 4A1RA 2QHLA 3OVUB 4KVCL 3VB9A 1BD2B 4LBEB 4ZUWA 3D4GA 4U1NB 4Y2DD 5E2JA 3WGUB 1S46A 3QO1A 1DSFH 1HSAA 4PD4K 2CSPA 4PB0H 3V7AG 3X11B 1D5MA 4OGXH 2VXQA 1I82A 1KB5A 4PHXA 1IKNC 2QFRA 4S1DC 5C0CB 4YPJA 4XZUB 4AM0B 1N6UA 2G9HA 1P4BL 4OR1A 4AENB 5I5MA 3NRPA 1N4XH 1QO3A 4ZBJA 5JXED 1E5AA 4J6RL 4DP2X 3U4EA 4L8CA 2C9PA 4M4RA 5FUZL 2P44B 2J3SA 2VLKA 4GI6A 3RP1A 2ZOKB 5DD6A 2AXGB 5EU6A 3ZTJG 2ZIDA 1TETL 4MFHA 1Z9SA 2AJZB 5B1AB 4Q0XH 4JPKL 1K3ZA 3JWNE 2VT0A 4M7KL 1QW8A 3NFNB 3P77B 2XZAL 4Y4KD 3G6JF 3ZE1E 5HPMB 1AOHA 1DFBH 1QFUH 2HLFC 1ODUA 1I7UA 2OLDA 4Y5YB 3FB5B 3HFML 1ETB1 4U7KA 3TZVC 2DQTL 3CVDA 4L29B 1JCKA 1HH9A 1WBZA 1CGSH 2WLLA 1FRGH 1Q38A 2NYYD 4WSJA 2Y5TA 3FRPA 1MY5A 1FJ1B 3KPLA 1HEZB 4PW9A 4ZFQA 3T0DA 4PW3A 1MCQA 1AP2B 1KZQA 5MEPB 2X5PA 1MIML 2E9IA 3C2SA 3TWCH 4TQ8A 1HCZA 1BV8A 4Y4HC 4HIIB 4HAFA 1T20B 4UAHA 1CT8B 1JYWA 3VXNB 4YBQC 3VNZA 1A1MB 4LIQE 2XN0A 3BUIA 1GC1H 4N2HA 3UMTA 1FIGH 1M2VA 4P5MB 4OCXL 2XUWA 1P6FA 5IEKB 3V7MA 4XPAL 1FWXA 1VFBA 2BXYA 1C5DB 2GT9A 1VLXA 4KMLB 3DXAA 2AJVL 5J89A 1YY9C 4NSKB 1T22B 1BMWA 1BQSA 3C5ZB 1ZVHA 4AVJA 5DRZA 1BZDA 5GRXG 1RI8A 3LS4H 3WNJA 4I1NB 1WFTA 2JWYA 2YUWA 1I8AA 3NT0A 4K3JL 1JK8B 2OXHA 3TVMA 3UBXA 4JY5L 4FYTA 3ZN6A 5A3IC 2YPLD 3AGWA 4IMKC 1QW9A 1IGIH 4ZUTA 4ZNCD 3RNKA 2FJFB 3U36B 3FO9A 2YEZA 3TN0C 1LILA 2VDNL 3LKQA 4WY7H 4J3OF 1U2CA 5TH2A 3OG4B 3EZ8A 2CO7A 3DX0A 4JW3A 2K9FB 1INDH 4P4RA 4EXPX 2EE2A 3NPSB 3EYQD 2RH0A 1K2DB 2Q1EA 4NPJA 3HLAA 2B16A 5KSBF 3HE6D 4YXHH 1ZLUK 1G6RB 4IBQA 2ITDB 3UJTH 4PLKD 5I19H 4ZUWB 1P6WA 4LF3A 3QO1B 3WDJA 1E6OH 1HSAB 2I9LA 3QA3A 3S8GB 2J6EH 3ZKXC 2FLBT 1D5MB 2E9BA 5DS1A 3ZTNH 4ANVA 1KB5B 1M6UA 1AFVH 2MSPA 1B3JA 5CZRA 5IVOA 3IEAA 2C3HA 2F54A 2G9HB 4KDWA 3VSQA 1DLFH 1QO3B 1V7NL 1DVXA 4HKBA 3EGSA 5C6TH 4NN6C 3U4EB 2EDWA 1NIBA 3T4AA 5LVEA 4L8CB 4M4RB 2VLKB 4FFTA 3IU3A 4L8BA 1HAUA 4ZW3A 1TJMA 3CBKB 5DD6B 5E6IC 4NNPL 5EU6B 1N6QL 4ABWA 1Z9SB 5CHNA 1LDPL 3GSNL 3S3CB 2CXGA 1SHXA 5JNYA 2VRQA 1AD9A 3VXOA 1BVLA 4JDEA 1FC2D 3BW9B 3SBPA 4XMPH 3H2QA 3U9PL 1WRFA 2BJML 5BRZD 2ZJSL 3PUCA 1KGYE 4G8GE 3ZDYF 4BD4A 5JO5A 1I7UB 4ONHA 4FZ8L 1BEYH 4XMVA 4PWJA 2I24N 4LASH 1ZS8A 2G60H 2PXYA 3F84A 1HH9B 1WBZB 2WLLB 4L8SC 1LP9E 3IDXH 3ZZLA 5IB5A 1DANU 5JIKA 4HK3N 1L9PA 2Y5TB 3FRPB 4LSQH 1TMCB 4Y5XC 4MNGA 3KPLB 2N7AA 2AJYL 1S3KH 1BZOA 1M7IA 4ATTA 1AGDA 1KYUA 2SEBA 2VSMB 4HV8A 4OLVL 4PMEA 3BWZA 4K94L 3TIEA 2OCJA 5H35A 3V4LA 3OPZH 5F7BA 4N2OA 2Q3AA 1EUUA 3BUDA 2K0RA 4PB9H 1YEJL 1M2VB 1ZE3C 2NXZD 2PCFA 1ZXKA 3ULAB 5JPNC 1VFBB 5GRVK 2GT9B 3QFJA 3M88A 3DXAB 2ZZUT 4PTUA 3SPGA 1JE6A 1X5JA 1LEIA 1L7IH 5DRZB 3BDYH 1L9OA 3FSAA 2AJ3A 4LVNC 1NGQH 1F86A 4AE1A 1MQKH 3MVSA 3IGKA 5DGQA 3N9GH 2A7BA 4WHYH 2OXHB 4QAWA 3TVMB 1NCDL 3UBXB 2YPVL 3VRJA 4ZZFA 1GYUA 5IHHA 1JZ6A 2AHIA 4ZUTB 3EBIA 5HI5D 3RNKB 3BP6A 4LCCA 2B15A 3FO9B 2YEZB 1U8PA 2O5ZL 2WBKA 4PTTA 3LKQB 2Y1VA 1KG0A 3PXLA 3FKUS 1XCTA 3H42H 3WMSA 2CO7B 4UTBH 1T5WA 4P4RB 4JKLA 4U0QB 5EZIL 2NY4B 4YGAB 4O5LH 3HLAB 1VKXB 5SWQA 1G9EA 2ZWNA 1BG1A 2IH1A 4L3AA 3SKJL 2VSDA 4QRRD 4E9WA 2E4FA 1NFIA 2HTLC 1IZKA 3VGFA 1WYJA 4PIBA 4M3HA 2RQEA 4LF3B 4NJAL 1GCYA 1U91A 2VDKL 2I9LB 5LG6A 3QA3B 4KWUA 2F1BA 4ODSH 2UWEA 4G1EA 3BPOB 4KRLB 4JFDD 3VXUD 3CC5A 2R27A 5HHOE 4IGBA 1R3LA 3UIYA 3QDAA 4LLVB 4DKDC 3NCYS 2F54B 1SRDA 4KO5A 4MLSA 4AEHL 5I6MA 2ZNXA 1RUAH 2VUYA 3CIAA 1N5AA 4RMRA 1RERA 4BWTA 3QAZC 4HKBB 3EGSB 1PJ9A 3T4AB 1TU2B 4L4VA 3G5VA 1T5XA 2ADFL 2R2CA 1TQCB 3IU3B 4L8BB 2RFXA 3QWNA 1HJBC 4M48L 4FQXC 2OI9C 4NXSA 3P02A 2O72A 5CHNB 1Q1JH 3VTMA 4A6YH 3VXRA 5JNYB 1IT9L 4I77H 4MXWL 1AD9B 3FZUC 3VXOB 1BVLB 2K6ZA 4JDEB 3OKEA 2WNKA 4ODBD 2B1AH 1RZFH 1T1WA 2LE9A 2BHUA 1PGRB 5JO5B 4ONHB 2ZUUA 2E7HA 2G5UA 3CN3A 4YPGA 4GG6A 2IANE 3S5LG 1LK3H 1JXFA 1UOWA 1ZS8B 2PXYB 3DURA 1RK0B 4I0KA 1U8JA 2X4OA 5IV2A 5IB5B 2X40A 1KCSL 3WBDA 5D9SA 2DD8L 4IU3A 5TK4A 4MNGB 1QTSA 5JYMA 1M7IB 3B9VA 4X7SH 1WA2X 1J8HD 2WVVA 1AGDB 2SEBB 1MAMH 1SXBA 2JKLA 4HV8B 2DWTA 3TIEB 3I75A 1YMMD 1WG3A 5H35B 4TOYH 5B7EA 1FV1A 2MIZA 3DJTA 3F12A 4NRYA 5E23A 3RTQA 1JRHH 3AQXA 2PCFB 1UCBH 3QFJB 2D2CC 1Z2KA 4ALAH 3S88H 2E47A 3CVHH 1W8NA 2QGBA 3I6LE 4P5TA 4PTUB 2ORBL 1LEIB 4G9FD 4J3BA 3FFCD 3RVUD 5J4MA 2AJ3B 3AMKA 2NXYC 1S7TA 2EQDA 2GEEA 4Y9EA 5ID1A 3BSZA 4LFHD 1ROCA 2YAMA 3ILQC 1ASQA 2UXVA 2DM4A 1UACH 4YHIA 5LGHH 3BP6B 1J9RA 4LCCB 1MFEL 1U8PB 4PTTB 5TF1L 1L9NA 4MYPA 1KG0B 4MDRA 1XCTB 3EF4A 2BSSB 3B2VL 2JLPA 4A2DA 1T5WB 3LX9A 2AMGA 1JGIA 1IFHH 3RJQB 3H53A 4F7MA 5SWQB 4HWUA 3ZX1A 2IH1B 1M3IA 2BRRH 4GLRH 4I4WA 5DLLA 1HNGA 2FQFA 3HKZA 4RMTA 3T8MA 1NFIB 1A4JA 1FCCA 2FATL 3SE9L 3QCVL 1MCPH 2CO4A 2VW6A 3C6SA 3HIZA 2Q7NA 1U91B 4ELMF 4KKLC 4WI8A 8FABA 2WIIA 2D7TL 3CJJA 2UWEB 4G1EB 4KVNL 4XVTH 4U7SA 1F8TL 3QC6X 4G6AC 3DUUA 3CC5B 1SEQH 4IGBB 1R3LB 1CMOA 4WO0A 1F90H 1PFCA 2Y4SA 3UZVA 1ITBB 4ODXA 1QFOA 3L8QA 1FL6A 1IBYA 2J88L 1N5AB 4PGEA 2BDNL 3KLSA 4WQOA 3ISRA 4D3CH 4L4VB 1KGJA 3G5VB 3MCLL 2FT7A 3O9WD 1T5XB 1XIWA 1LE5A 4AV5A 3P9MA 5IW3A 3DHUA 2RFXB 1DJWA 1TZAA 3DROA 1N7MH 4G8GA 3ZE1B 3C5SA 4A2MA 5DWUH 1JTOA 3MREA 4V33A 4X4KA 4KKBD 4ADJA 3VXRB 4BZ1L 3N42F 4P05A 4ERSL 3OKEB 3QUKA 1P84K 4UTBA 5ID0A 4AKQA 5F7FA 1T1WB 4CU6A 2J6WA 4KI5C 1S7VA 4YHLL 4AUYA 4CN1A 1A7NH 3FB6A 1Z9PA 2OMBA 3SJVA 4YPGB 4GG6B 2DQGL 4HZLA 4JO4L 5D7KE 3IJHA 5IV2B 1XTLA 3DURB 1TVBA 1U8JB 2X4OB 5EEVA 2W8CA 1FBIL 2A9NL 4XNMA 5D9SB 1QACA 2Z8WC 4IU3B 5CJBA 3CV5A 1O0VA 1A6ZA 3FTZA 4JG1L 1U4FA 5T1LA 2NX5D 2WVVB 1YVLA 4XE0A 3ZDWA 2Z92A 1IIKA 3P4MA 3I75B 3U9UA 3MLYL 2PP7A 1I7ZA 1FV1B 1JZJA 5I1IH 4V2CB 3F12B 3F2LA 4NRYB 1A5FH 3GGWA 3RTQB 1KWKA 4NNXA 5EUKA 5E7FA 1C1EL 1G9ML 1XL4A 2W0LA 2VM4A 5M7QA 1CD0A 4P5TB 2NUTA 3TEXA 2GSGA 1XMWA 3C5ZC 4GMTH 2IH9A 2XVBA 5KBNC 3ATEA 3U4AA 4S11A 3KLHC 5AL0A 1S7TB 3BPLB 3REVA 5EBMA 1F6LL 5ID1B 3DPBA 5KS9E 5KAQG 3QNYA 4WK4B 5J6SA 1AXTL 2G3NA 2FO4A 4YHIB 4XPBL 2X09A 1EFXD 5PAZA 2WWMC 3LZOA 1DBKL 1KV7A 1XAKA 3IGLA 4W9KC 3E9UA 3OJVC 3APCA 4RGOH 4O02L 4HU2A 1JNLL 4XB7A 4PP2B 3NPSC 3JWDC 1TZGH 1C9SA 3Q1EA 2WQ8A 1NKRA 4N8CH 4I4WB 2VDRL 1LHZA 2HWZH 3QJRB 4I3RH 4WFGD 1A4JB 1FNHA 4C57C 3BLBA 4PCTA 4RFOH 5KTEL 3I85A 3C6SB 1BM3H 4HCGA 5EBLA 3N1MC 2BFVH 8FABB 1A47A 2WIIB 3CLEH 5E8OA 3QIBD 1ORSA 4LU5L 3TT1H 1G84A 2VC2L 2JJVA 3B37A 1Q0XH 3DUUB 4FNLH 3VI4A 1DANT 5D7SH 4JHAL 3CVHA 2K4WA 1CXIA 3UZVB 4ODXB 4JHVA 1JV2A 4XTRD 4DPAX 4EXKA 1FL6B 3ESVF 1DQQA 3A4EA 4PGEB 1FSKB 5ACZA 3O8XD 1ZLVK 3HB3C 1ADQH 3V0VB 4Z3TA 4NO0A 1KBWA 1XIWB 3LB6D 2VR9A 3L9EA 3P9MB 1U3HD 3QXDA 5I74B 3DROB 4G8GB 3C5SB 2UXTA 3MREB 3IE9A 5F9WB 4HIHA 3A4AA 3ZYJA 4IW4C 1PZCA 2CHNA 3AWGA 3QUKB 3ZKMC 5ID0B 3RG1C 4X7EC 5B8CC 1S7VB 2YAFA 1J5DA 3F7YB 1E4XI 3FB6B 3QHFL 2DRUA 3SJVB 5FHBH 4NB7A 1B4RA 4HZLB 2WXPA 4UOW1 3VNYA 4JB9H 2EXSA 4H8HA 3IJHB 1TVBB 1UEMA 3U2IA 2B14A 5KW9L 4LHUD 5FWQA 2AABH 4XNMB 2DQUL 5GS3A 3WY3A 1R6VA 4OCRL 3HLKA 4OM1L 3H3KA 5D1ZA 1A6ZB 5D7JD 4BFOA 4FFVC 3P69A 5HJBA 5T1LB 1HCFX 5J1SC 3CPUA 4TV3A 2FH8A 2Z92B 5GJSL 3P4MB 2VDMH 2XQ0A 3U9UB 2YC1A 5K39A 2BINA 1I7ZB 1YEHH 5AVTB 3VJ6A 3ABKB 3MRJA 3P4LA 3GGWB 4MMZA 4HUVA 3DV6A 4NNXB 3PRZA 4PJIE 5EUKB 5GISL 5J11B 1E8WA 2C9AA 4TUKL 2CDEA 2JMRA 4OKVA 3MACL 4J8RA 4FLSA 3HN3A 5AKTA 1BHGA 4QRSA 3R7QA 3SE3C 2NUTB 3AJ7A 5E6SB 3HAEG 3ULVC 1T03H 2GSGB 4BQ8A 3JV4A 2ZCKL 4DZ8A 2OW6A 2ZWYA 3REVB 1T7WA 5EBMB 1CC3A 3C12A 2H0PA 2TAAA 3DPBB 1JNJA 2BHZA 1SHWA 4WWKA 1OCWL 3QNYB 3QUML 5LQBH 4MD4A 4OVVA 2FO4B 3KDMA 3IF1A 4L5FL 3RB5A 2WCPA 4PP1C 1LWJA 1UD2A 3ETSA 2BCKA 1E5CA 2A83A 1WFOA 3B8YA 2X28A 1R3JA 3HHSB 5GSVA 2O61A 3JT2A 2RD0A 1WLHA 4OF7A 2EIBA 2Q8BH 4HZ1A 3EO9H 3QORC 5HHOB 4F2FA 5I6LA 1XGYL 1OIOA 3UAJA 5EBLB 2J8UE 3GRGA 1EAOA 2L0DA 4G7VL 3TBVA 5E8OB 2X6BA 4OFIA 3DHPA 1V3MA 5I30L 3IT8D 1ORSB 1J5OH 1V10A 3BPOC 3Q6GL 4JMNA 1IBGH 4QHKI 3QQ9C 3VI4B 5K59F 3CVHB 3ZRFC 5HGHA 4AIOA 3K74B 1JV2B 2Z93A 4HGMA 2W81C 4HPYH 5E1AA 3GD1C 4OLEA 5ACZB 4FC3E 4N5ED 1XFPA 3T4AC 4NO0B 4G5ZH 5FYJL 2WWKO 2M8XA 2KLSA 1TQCC 3QXDB 2A4EA 4GW5A 3ZVVA 4PBVC 3I9AA 2DQJL 1NCCH 1FHGA 5CR8A 4YR6A 3MOAH 2IWEA 4RMUA 4FG6D 4HIHB 2CRMA 2VKWA 3WEOA 4F7KA 3FUMA 5DEFA 2ESVD 2CGRL 4Y19A 5ALCH 4PRPE 1HZLA 1DQJA 3Q5YA 3ZR6A 1ED3A 2P7TB 4DVBA 4A7SA 1SN5A 1T0OA 4X5LA 4BBWA 5ABZA 2FD6H 1F97A 4NERA 3UYOD 1AE6L 3OMZA 1OE1A 2EH7H 2PXYC 2F58L 4OTXH 4YJZL 4JM4H 4Y4FD 1LE9A 1NC4A 5AVYB 2NQCA 5DD3L 3WJJA 1MHEA 2WAQA 3KR3L 5BMFL 5D1ZB 2WTOA 4Q97A 6TAAA 2Z1PA 4BH7A 2NW3A 1F4HA 2ENQA 2NOYA 2YC1B 5K39B 4WI4A 4JDZA 1IKFL 4GG8B 4PH8A 3QAQA 4ZS7H 4RFNB 3VJ6B 3MRJB 4A7QA 3Q44A 2X0VA 4MMZB 3EGXA 3DV6B 1A7PH 3VRIA 4ETQA 5F71A 4XCCH 4HUVB 3GDCA 3RUGF 1H6UA 2CDEB 2RCSL 3VGGA 5BJTA 4OKVB 4J8RB 3VXME 4QRSB 5AZ2L 1ACCA 5HPOA 4ZDHA 1HDMA 3H6AA 3JV4B 3MJ9A 4PLOB 4DZ8B 2GY5A 3QDME 1Y1DA 1THCA 1HK6A 5LNDA 4E0RA 1CDCA 1OP5K 4L3EE 2O6DA 4JM0A 4KROD 4B95C 1QABA 1PX3A 2A0LD 3D8MA 1FFOA 3CZSA 5PCYA 4MD4B 1HE7A 1MFBL 2EEFA 3KDMB 3ABMB 4OGAD 4LCCC 1NAKL 4LP4A 4AL8L 3IF1B 3BI9X 2IGFH 1MRFL 2BCKB 4JM2A 1IFGA 2JXMA 4KK5C 2NY0D 1R3JB 4NFDA 5GSVB 2O61B 3MX0A 2BWQA 4FG4A 4RMSA 4FMVA 5FHAL 3CX2A 1JVKA 1P4IH 5IMKA 5AB2A 4PN6A 2V7HA 2VAJA 2B5IB 1RIUL 4D0DA 1GW6A 3LN5A 1CXHA 3O3BA 4D9RD 3TBVB 1Q9LA 1E7UA 2H1LM 2B77A 3WSQL 3MXWH 4OBRA 5BUAA 1CZ8L 3WLBA 5A6LA 1C7TA 4FZEH 5IBTL 2OTPA 2RACA 2WXGA 1U58A 4IGBC 4PJGF 2J55A 3KS0H 4KY2A 5C2BL 3X3FL 1UA3A 2Z93B 1OZUA 3ZL1A 2V17L 4FCHA 5E1AB 4DPCX 4FA7B 4DO5A 1DBJH 3AABA 3B2XA 3CSGA 3JWNC 4TM9A 4W9HC 5DTFA 3UPCA 1I3UA 5T1KD 3MJGX 2AQSA 1DQLL 5AG8A 2ZKWA 4TS6A 3QQNA 4YR6B 4IJ3B 5IWLC 2GJPA 5DEFB 1E65A 5D1QE 4Y19B 4ONGL 1UWFA 1DQJB 1XF1A 2WXMA 1ED3B 1E4JA 4UYQA 4DVBB 3GTVA 1FO0L 1AR1D 2JELL 4JS7A 1A3QA 1G7PA 4TQPA 1P4BH 2PNDA 3UTPD 5ICYA 4AEIL 1IZJA 2P42B 4J6RH 3H3BC 3M17A 2WQSA 3UC2A 1U6AL 5FUZH 4NENA 1LE9B 2WCGA 1NC4B 3FUIA 3QQDA 2HT3C 4OCYL 3T3ME 5C0FA 1B90A 1MHEB 2ROYA 1WPCA 4PJIA 3QJZA 4G43A 1HIML 1OARL 2V33A 3LHPL 5I26A 4I48A 5FGCE 4X6DA 4BH7B 2NW3B 4JPKH 2WGXA 3LS5L 5LHDA 3NSXA 5CLTA 5FOJA 5ICUA 4D9QD 4JDZB 3VFGL 2OK0L 4AG4L 1I9EA 2HFFA 3H6JA 5E8DL 2XZAH 1E2ZA 4IBLT 4KK9D 3K4DA 3MTRA 4BSVA 3ULUE 3L3DA 2Y7LA 3EGXB 3VRIB 4ETQB 3CU7A 4ZX6A 1BQKA 3HFMH 3L16A 3AS2A 5H4ZA 1L4IA 3EAKA 3LRGA 2DQTH 5BJTB 1D2PA 3PP3H 1I85A 2YRBA 4FXGA 1SGKA 4P5TC 1HDMB 5G5DA 4ZDHB 4XZ4A 2GTWA 1PDKA 3BH8A 3BPLC 4E0RB 4FLRA 3SDXF 1NGXA 1MIMH 4BFRA 3DGGA 4HH9A 1FFOB 3L1FA 1JPFA 4X50A 2DKSA 2GIXA 4JFZL 3EKCA 3WS6C 3FQXA 3J27A 4L37A 4OCXH 4JM2B 1BQ5A 1JGDA 1NIAA 2JXMB 4XPAH 3U4KA 4WDIA 4AC4A 1FNEA 3BP5B 4UQIM 2BCMA 3MX0B 2AJVH 2AXFA 3OLGA 1O75A 3C8KB 2HT2C 4QYAA 1KGUA 1CGWA 1KJ2L 2V7HB 5MENE 4MMXA 2WD0A 2YD7A 4K3JH 4OGYL 4ONFL 3UH8A 1JZ7A 2OM5A 3LN5B 2LU3A 3O3BB 4FFWD 4B9ZA 1U3JA 4BZ2L 1Q9LB 2HT4D 1IGTA 3HG1D 2VJ0A 2J44A 3V6BR 3ARRA 3WLBB 4A7TA 2FUTA 4AT6A 2O30A 2VDNH 1RZKL 1U58B 4QRAA 5C0RL 1D5RA 1EHXA 4PWIA 4WEUD 2AC0A 1V5JA 4WU7A 4K23L 1GYAA 1E3FA 3BWSA 4XCEA 3KYMA 5DTFB 5HYEA 5FWRA 1CYWA 3G04A 5AZUA 4RX4D 4Q56A 1ZLSL 4TNEA 5CSGA 3VFRA 4JL1A 3RWJA 4G6KH 3ZRSA 1ETA1 1VFOA 4HIXL 1I4FA 3MBED 1JF5A 3HNVL 4QJ5B 2VZSA 3US9A 2D8KA 1N8OE 3PL6A 1JZIA 4EI5A 2CKNA 1J0JA 2E27L 6FABL 3VGAB 2ZX9A 4TKWA 3O6KL 1G7PB 2WKGA 2B1HL 1Y6KR 3SKOA 3B2MA 3MUZ1 5ICYB 1KTJA 5IHWA 1V7NH 4S0HA 1NBZA 2BZCA 4R7NA 3M17B 4OF6A 3MV8E 4WI0A 5J6GA 2YMXL 4NENB 4XVUD 3QQDB 2QEJA 5C0FB 2VIRA 4NNPH 4JY6A 4PJIB 4HOMA 4G43B 1N6QH 3GSNH 4I48B 2JKSA 4X6DB 3H7LA 3U48A 1HESA 5DJXA 3IGFA 5DZLA 3VXMA 2IV9A 2HFFB 4WI6A 3U9PH 2BJMH 4BSVB 2ZJSH 3L3DB 1XZWA 5CLXA 2R69A 4FZ8H 4J1UA 5KBDA 5C0NC 1PIGA 2DY2A 2BVUA 2OJEB 2C7UA 2OSWA 4MTMA 2YLHA 4FXGB 5G5DB 1T4WA 2GTWB 1PDKB 2AVFA 5IBLD 3BH8B 3WKML 1TIUA 4YXLL 5CAYB 1NGXB 2JCCE 3MRMA 1N0XL 4JFYA 4OLVH 1AQDA 3DGGB 4HH9B 4H88L 4K94H 2EVHA 3S3JA 1JPFB 5FM5O 2B7DT 3WEBA 4PJ8A 3PV7A 3FQXB 1YEJH 3L4CA 2X44D 1JVLA 1TYJA 4L37B 5AL8A 2YD5A 4MNQE 1NFDF 3DMMD 1JGDB 1UOLA 2J8UB 3ARFA 4WDIB 1FNEB 5C92A 3LRKA 4EN2A 4JG9A 3TO2A 3PDOA 4ZX5A 2Q2LA 2AXFB 2KQMA 3FT3A 5SWZE 4BFEA 2FE0A 1GOHA 3W3BA 3MV9E 3P1VA 4OI9A 3IM1A 5BRQA 2AI0L 4X0KB 3RZCD 4Z7WE 2B3RA 4MMXB 3WNLA 2YPVH 4QHKJ 3PG2A 4RMVA 2QGDA 1ULVA 5J56B 4M5SA 1IGTB 2Q76A 5IK3A 4JFFE 4MVBD 4JBSA 3JBG7 4AT6B 2APWA 1KCUL 1RXLA 3NIFE 3GZOA 3SBWA 4WU7B 1DUYA 4I0PD 4WW2A 4N24A 4W4OA 4XCEB 4ZOBA 4JN1L 5EZIH 3KYMB 2H9GA 1Q8MA 2EIDA 1ID2A 3G04B 4HS3A 3SKJH 1DEDA 1QHQA 4DKFL 1ZIBA 3VFRB 2F7IA 2FUQA 4QXGL 2WBJC 4N1HB 3RWJB 2DICA 2ZP8A 1B2WL 1UC6A 1JP5A 5FYKL 1I4FB 5I5RA 2VDKH 1XF4A 3QR1A 2BNRD 3PL6B 4LPVA 5SX5K 1HZHL 5AALA 4EI5B 1J0IA 4I1PA 3FQTA 2GBVA 1BBDL 2ZYHA 1E3ZA 3D2UB 3QEUA 3H9SE 4R4FL 3RGHA 2C34A 1NCGA 1TTCA 1SVBA 4AEHH 4WTWA 3SKOB 2VLRD 1QSFD 5IQLA 1NBZB 4R7NB 4BA8A 4WI0B 2ADFH 4HWEL 4I9XA 5J6GB 1ECZA 1KC5L 3H4FA 1OAKL 1EERB 2VIRB 1I8MA 4JY6B 4KO6A 5D1ZC 4KRNA 1OTSD 1VENA 1IT9H 5DJXB 3V0IA 3VXMB 4GUPA 2AAVA 1X7TA 2AJSH 3MLTA 3HHRB 4FJ6A 1KBVA 3CMGA 3F83A 4RFNC 4ZTOH 4ZMVA 5EF3A 2BW5A 2MPVA 4MMZC 3PJSA 1J88A 5HGBA 2C7UB 4Q6YA 3U6XS 3DVIA 5EEXA 1KCSH 2DD8H 2FNBA 4Z3JA 3KDPB 1EEYA 4NZDA 3SPCA 4E9RA 1JUFA 3MRMB 4JFYB 4M43L 5F97E 1XEDA 1AQDB 2Z34A 5CEXA 2DMCA 4CN6A 1L0YA 4YUEL 5E95B 4YFLI 4PJ8B 1GR7A 5EB9A 1UQSA 2ZF9A 3WELA 3G6J