2IU1A

Crystal structure of eif5 c-terminal domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
178
structure length
178
Chain Sequence
LERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EUKARYOTIC TRANSLATION INITIATION FACTOR 5
publication title The Crystal Structure of the Carboxy-Terminal Domain of Human Translation Initiation Factor Eif5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 70
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02020 W2 eIF4-gamma/eIF5/eIF2-epsilon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2iu1A00
4GMJA 2IOLA 3D3MA 2IONA 4JHKA 1UG3A 4LUNU 3EIJA 4JHJA 1PAQA 4B8CB 4C9BB 4GMLA 1H2UA 4B89A 5ANRA 2VSXE 2KZTB 2NSZA 4B8AA 2ZU6B 3FEXA 1UW4B 1H2TC 2RG8A 1N54A 2VSOE 2IOSA 2GGFA 1HU3A 3EIQC 4IULA 2IU1A 2HM8A 3RK6A 4CRWA 1H2VC 4CT4A 1N52A 3L6AA 1H6KA 3FEYA 2I2OA 3JUIA 4CEMA 2KZTA 2FULA
chains in the Genus database with same CATH superfamily
4GPMA 4YDOA 5KCMA 5JHAA 4G2VA 4WNFA 1NFIE 3DSVA 4E85A 4GTPA 3PEVB 1UW4B 4HOQA 1UOHA 1NZNA 4DK5A 4JL0A 3Q9NC 4HOSA 5FWQA 5EKQD 3V2XA 3CVPA 3ULQA 4CDRA 2KZTB 4OVUA 1BPOA 4RG6A 4JVSA 3IHVA 4UWHA 3GYZA 1OWLA 1OWNA 2QFCA 5G55A 2V8SE 1SZAA 3S7DA 3JUIA 3UMVA 3SFXA 3PZ3A 3APCA 3FUHA 1Y8MA 5EYLA 3PS6A 1OUVA 4LG6A 4K03A 1NA3A 1N52A 3PNLB 3RKVA 2I1JA 5LCWC 3TWVA 4GMJA 3FUFA 3FTSA 4JHKA 2GROB 4YVQC 2CHZA 1E8ZA 3CEQA 4M3OA 2QZAA 1TNYA 2XGOA 3UKRG 4G23A 4LERA 3MEKA 3FEYA 2L9BA 3AG4E 2KZTA 4GPKA 5FQ6A 4JHRA 5G04C 3SZ7A 2GW1A 4KVOA 2FO7A 2WPVA 3D9JA 5AJDA 3CHOA 4DJAA 4GCNA 4B8AA 4AV7A 2NC9A 3BG0B 2WB2A 4FHJA 4FC8A 2V5FA 1OCZE 4GU5A 2NYJA 5CMWA 3L82A 2A4ZA 1VDYA 2VTBB 3CVUA 1XGWA 1JCQA 1XNFA 2XEEA 4HXIA 3NQPA 1AP7A 3QWVA 4B89A 3Q4AB 4DI4A 3E34A 4KT6B 4Q69A 4A63B 1ELKA 3SD5A 2XENA 1IQRA 2PZIA 4BT9A 3WG7E 5D2MC 3Q15A 4Y6CA 5JJ7A 4DX7D 1E96B 4NRHB 2WXHA 2DWZA 2RD0A 4KVMA 2FO1E 3ONLA 4K5BA 3AJIA 4WWPA 3SBSA 3CKCA 3CK9A 4FHKA 1ZU2A 1N0RA 1MYOA 3PUKA 3E4BA 4G24A 3CQCB 4N5CA 1DNPA 1IHBA 5KNGA 2J49A 5ITZF 1QZ2A 3SBTB 1N54A 2VTBA 4GZ5A 5FQ4A 5T4YA 2ZISA 3IEGA 4Q96A 4MBGA 2V4HC 1KZPA 3EHMA 2MHKA 3U4TA 2J4BA 4F1SA 2E2EA 4I6GA 4JHJA 4FJZA 5A6CA 5D66A 2OEWA 3MKRA 3L9TA 3RSEG 4LRZA 3D9OA 2DBAA 4BFRA 3DPYA 1TYQG 4LNGA 5LCWJ 2HR2A 3SY2A 1O1RA 3DXKG 1NP7A 5FZRA 1PY1A 3MKQA 4LSZE 1SZ9A 3VLFA 3FDHA 2AJAA 4U0SA 3LJ3A 2Y69E 4GTTA 4EZLA 1K1AA 3RO3A 4HFGA 1ELWA 3VLDA 4DLOA 2CFZA 2XZTG 3ZU7B 4G26A 2C0MA 2V4LA 3ABLE 3Q9UC 4C0EA 5FJYA 3Q7AA 3FTYA 4I1OB 4GTSA 5G05J 5KJMA 4KBQA 3D9NA 2VYIA 3JXIA 2RKKA 3LS8A 3Q75A 2WXJA 2DYRE 2FBNA 5FZSA 4XKBA 4GTMA 2EQXA 1TNBA 1B89A 3D9IA 2PM7A 1D9SA 2IU1A 3FTWA 3DBSA 3TWWA 3PNTB 1JWFA 1EF1C 2ZGGA 4U63A 3ASHA 4NIKA 2Y4UA 3FP3A 4DLQA 3U66A 2VSXE 1KLXA 2ZU6B 4UWGA 2XRZA 1UJKA 4C0MA 3QAQA 4G25A 4OYSA 4XE0A 3ULYA 1N4SA 2LNIA 5AJLA 5ARGA 1LD8A 1OCRE 1H19A 1OWOA 4XKCA 2F8XK 5JJ6A 4ILHB 1TNUA 1LF8A 2H6FA 1EDUA 2GRQB 2OVBA 4WWOA 3FUIA 1H0AA 1HG2A 3APFA 4J7WA 3MCXA 4I2WA 4GZCA 1PC2A 2XS1A 1MX4A 1O1TA 5BXOA 2XHEA 3DSTA 4GTVA 2FI7A 2AW6A 2J4DA 3FEXA 3SI5A 4X8QA 4BX8A 3G2WA 4GZDA 4RQIA 4TXRA 1HU3A 4DX2A 5CERB 2IF4A 2H6IA 2WXMA 3FTUA 1S70B 2IOLA 3OTNA 4OAUC 2ILRA 2AXUA 2I6HA 2ONDA 3ZVVA 3KEAA 3OXFA 3ISMC 4GA0A 2ETBA 5BPPA 1H2VC 1INZA 4YDWA 3NZSA 3E37A 1HZ4A 3QC1A 3TL5A 4KZCA 1U3DA 5ENTD 4O1PA 5EX3A 4LUNU 4F7AA 5BW8C 4IN3B 3TWRA 4I6JA 3PE4A 3NF1A 5BV1A 3D9KA 3ZUVB 3EUVA 3DEPA 4HRMB 3KS2A 2OEVA 4IULA 4J8DA 5FINA 3MV3B 3ZKJA 3FU5A 5ENSD 3UPVA 5BUZA 2XPYA 4H7YA 4B94A 1HXIA 3UM3A 2JABA 3UTMA 1SW6A 3V2OA 4A1GA 3JCKC 4JZYA 4UWFA 4Z68A 1KZOA 5CRUA 3S7JA 1S64A 3RIBA 1UN8A 2V0PA 3DWLG 1ZB1A 2JLBA 3PEUB 2VQ2A 4I9CA 2M63A 3IV0A 1WG0A 3Q5MA 2FEZA 1OCOE 3HYMB 2KM4A 4CT0A 3CHQA 5AARA 4RVBA 3QNKA 3HHMA 1YMPA 3EU9A 1FVHA 2AXVA 3LDZA 4M7CA 4ILGA 3RRMB 3FH7A 3SFYA 4I2ZA 1QNFA 2YHCA 3FY4A 2R2LA 3HXFA 4BTBA 3C72A 4WNEA 1YYHA 5FTPA 3D9PA 4FU3A 3LVQE 3KAEA 4GZ6A 4J6IA 4CYMD 3ML8A 1JPLA 2P58C 4DRXE 2GRNB 4GTRA 3QWPA 3HVEB 5JA4D 2YQ8A 3L13A 4I43A 4G1TA 1TNZA 2DZOA 4HVBA 3UM1A 3ASFA 1OY3D 5HQ8A 2X6IA 3LY8A 1E90A 2RFAA 2XEVA 4BEPA 3ZYLA 3V79K 1NL4A 5AQAA 4A3VA 2AXZA 3QARA 1MX6A 3U9WA 2VSOE 2P2CP 3QOUA 1TNOA 3DPDA 1E8YA 4I9EA 3D9MA 3CK8A 3CVNA 4UQYA 4EZJA 4HRLA 2IO2C 4APOA 2A5UA 3ZNGA 4OVVA 2IY0C 3HVEA 3L6AA 1WAO1 2H6HA 1H6KA 2X38A 1V54E 4XZ4A 1LD7A 3CHRA 3VTXA 1TN8A 3R7QA 3KSQA 4GAAA 4HI9A 3QKYA 1BLXB 2EINE 3QK0A 4CT4A 1D8EA 1JCSA 4L9PA 5EIDA 4UI9C 3SF4A 2YHEA 3FULA 1HO8A 4HOTA 3RRUA 5G05C 1OWPA 1A5EA 1HFAA 3HRAA 3Q7FA 2ETCA 3T5VA 1HF8A 3LYAA 3FU6A 3E30A 2WXQA 4JB8P 3PZ1A 4MRUA 3FTVA 3ZIMA 1H2UA 5B3SE 2NSZA 1NA0A 3LY7A 3TAXA 3I4GA 2KATA 2KCLA 1EYHA 5KBAA 3JYSA 5ENRD 4EBAA 2P9IG 4B93B 2XRYA 4C48B 3B7BA 3L22A 4WAFA 4GMRA 4AVXA 5AAOA 1Z3XA 4J8EA 4BX9A 2R5SA 1BI8B 3I4RB 3MKQB 3Q78A 2GRRB 3FH5A 3T5XA 3OXLA 3CVXA 3K9IA 2P9LG 4UWLA 4JPSA 3WXXA 1MZCA 4YNDA 1MX2A 4TXPA 4V3IA 3TWTA 4O1OA 4ATGA 3I5PA 4U8VD 3UKUG 2GRLA 3FUKA 2IFUA 5AQBA 3V30A 2WQ7A 1S0PA 1E8WA 2R03A 2GRMA 1H6OA 2IONA 4LEUA 2P9UG 5CEDB 4G8LA 4U7EB 3TWXA 3B13A 4I1MA 2R05A 4XIFA 4R7LA 3ASGA 1RZ4A 3G2VA 3FH8A 3I3NA 3GZ1A 4J0UA 5FQ7A 3MZLB 4N3CA 3CK7A 4A3TA 3FU0A 4I17A 3ABME 3RAUA 4YDYA 4CRWA 3G2TA 2ZIRA 2J8SD 3HXBA 2EIJE 1FT1A 4HRNA 3CVYA 3AS5A 4QQIA 3EHQA 4UI9J 1TEZA 4BESA 1O1SA 2L0IA 5AYWD 1Y6IA 1N11A 3VTYA 2DIWA 1N9AA 5CBOA 3DEOA 4N2QA 1Z3YA 3IBEA 3TXMA 2CHWA 2WXNA 2DZNA 4BERA 2WMNA 2L6JA 2UY1B 2WXIA 4DI3A 1TJCA 2BTDA 1N4RA 4EQFA 4O60A 3FU3A 1FCHA 3KD7A 4KYOB 2C2LA 2QC9A 3S7BA 3T9KA 3UI2A 4IYPA 2XPZA 2FULA 4L1BA 4F1PA 2XS8A 3L54A 3VLEA 4GYWA 2XQ0A 5ENPD 3LKUA 3ZFWA 3W9GA 3C5RA 4N2SA 2CG2A 4PS8A 4JW1A 3HXCA 2YNQA 1EPUA 4J8FA 5CRVA 4JEHA 5A7DB 1P5QA 2XCBA 3CGHA 3ULEG 3MX3A 1FVFA 4U04A 4DX1A 4TV3A 1U2VG 1D8DA 4TUMA 2VGEA 3EIJA 1YA0A 2X6FA 3LJNA 3DRAA 2HO1A 2UY1A 1QYMA 4JD2G 5EYPF 2HYZA 1OCCE 2CHXA 2J07A 1NI1A 4ACLA 3RO2A 1HG5A 3FUJA 1X5BA 2L0TB 3PZDA 4YVOA 4G11A 5EX0A 1K1BA 3FUMA 2X6HA 4J8YA 1O5MA 1Q2ZA 3UINC 3BUAA 5IY5E 3D9LA 3X2QE 3OXGA 3G2UA 2VGYA 1DC2A 3E33A 3SGHA 5LX8A 1DVPA 4FA6A 4BWRA 2BKKB 2CFUA 3Q73A 2MRIA 4HOUA 5J08A 5DIZA 3PREA 3C98A 3DSXA 3IKOB 1JWGA 3B7RL 3CVQA 1A17A 2JEKA 5T8IA 3UXGA 5AENA 5CHEE 2OV8A 3AG1E 3S7FA 4WUYA 5KNHD 4UUCA 3CSFA 5FIOA 5AN8A 2R17C 4XI0A 3TXNA 1K8KG 5HKPA 4L2LA 4DX6D 4PS3A 4I6EA 4U0UA 3AU5A 4PUCA 2I9CA 1AWCB 3C3RA 4P29A 2AWIA 5T3RA 1BI7B 4G8KA 1OXJA 1JCRA 3MGBA 5LFAA 3LY9A 4GYOA 3CIAA 3TJPA 5BV0A 4IRUA 4LNBA 2VSNA 4A55A 1BU9A 4PDXA 3B7UX 5ARFA 3R9AB 4TXQA 4W9RA 2PNNA 4KMOA 4CGVA 2ETAA 5BXUA 1UG3A 2QYUA 3NOCD 3UT7A 4AIFA 3FTXA 1DCQA 2WXOA 5ENOD 3TWSA 5D0OD 3CHPA 3GZ2A 3ZPJA 4FJYA 4EBAG 5AQ9A 3CR3A 3URZA 1TR4A 4L23A 4MKTA 3R9MA 1OT8A 4GA2A 4CDNA 4GTQA 3PH0C 1LTXA 4ANVA 3ZYMA 3ASNE 5ENNA 2WQ6A 4EECA 4JA9A 4O6FA 3PZ4A 4E6HA 2FF4A 2Q7FA 4AP2A 2XPIA 3SHFA 1L5JA 4CGWA 3NOGD 4HB5A 3TGOA 1HE8A 4CZ2D 2KCKA 3AU4A 3CKBA 5EIBE 4Y6WA 2WMOA 2UWJG 3D9HA 3ZYQA 3ZXSA 4AEZC 1X81A 3BU8A 1DCEA 2DYSE 3EJNA 4PS7A 3NB2A 1WY6A 4GCOA 2Y4TA 2J09A 4AXHA 2P9KG 1KT1A 4QFVA 5C2YA 2B6CA 4XI9A 1K3ZD 4UI9K 3CLJA 3JUEA 4C9BB 5M72A 5AIJA 3MJWA 1UN9A 3GW4A 1SVXA 1N0QA 3EIQC 4FLHA 5AQ7A 4U0ZA 5DBKA 1JUQA 3SFZA 3CQGB 3CHSA 2Y1LE 2IJGX 4AY5A 4BSZB 4HNAD 4ANWA 4ZFHA 3ZW3A 4DX5D 4N5QA 2V5QC 2YINA 2I2OA 1Z5SC 1S63A 4RG9A 5BNWA 3T8KA 3ENEA 2J9QA 5ANLA 3AAAC 3JQ0A 3HXEA 5JMND 2RG8A 3OAWA 2PM6A 1IKND 2LAHA 3T8MA 1BD8A 3CV0A 3ONKA 3ZXPA 1V55E 5KJKA 5CCMA 4HS2A 1SQMA 1H6PA 3J5QB 3ZRHA 1QQEA 5D0QD 4AJWA 4APFA 4AOFA 1IQUA 3CVLA 1KPSB 2ZXWE 5E76A 3LPZA 2XEHA 2EIKE 4JEUA 4MLPA 4LNUD 2X6KA 3UQ3A 4GTOA 4PH4B 3PVLA 3AS4A 5J90A 1N95A 4ANUA 4GZ3A 1N94A 3FWVA 2GGFA 5CEAA 2A5EA 2QY7A 4UQZA 1SA5A 5G2NA 3DSUA 2F0YA 1ZBPA 3LVRE 2KC7A 1U3CA 4N39A 3DXMG 3AG2E 1GW6A 1YCSB 5EILA 1IXVA 4BETA 2GRPB 3ML9A 3PE3A 4DPRA 5E75A 5FZQA 3PRZA 2HE0A 3MV2B 4AY6A 4U8HA 4WWNA 4ATZD 1OWMA 2NXPA 3O4ZA 4L2YA 2I1KA 5B1AE 4NACA 5CMYA 5ANRA 3TG5A 3B7TA 4H7XA 4XX5A 3GZSA 3ZYKA 3PUJA 2WM9A 4YDEA 3TG4A 5HS0A 4N3BA 3NAWA 3HDXA 3B95A 4TRQA 5JJTA 3QJZA 3UUXA 4RLYA 2CG3A 1WDYA 5KJNA 3D3MA 1SA4A 3C3OA 4BY6A 2XGMA 4FLBA 3MYVA 4HBDA 2WQHA 1MJ0A 4MS6A 5FT9A 2KBXA 2L6BA 4WNDA 4GB9A 3EHNA 4UQXA 3BQOA 2OCCE 3P2BA 3FUNA 3R7RA 2WXFA 3JQ1A 1IHGA 5HRYA 3P1UA 2E0IA 4CCAA 1KT0A 4ACKA 5KJLA 5B1BE 3EDTB 4ABNA 1W3BA 3FTZA 3O48A 4K5CA 2BEDA 3S2AA 4OAVB 4F53A 1Z6TA 5G04J 2R02A 3FFLA 2H6GA 5LP0A 3L08A 3SNXA 1H2TC 1QBQA 1N4QA 3QWWA 3UIOC 2MYOA 3W9FA 5EDSA 1TJFA 3ZN3A 3QDNA 5H7PA 4HLEA 2C0LA 1FT2A 4UWKA 2XZDG 4AM9A 3ASDA 3LEWA 2BKGA 5JHBA 3HIZA 3ZGQA 2VGXB 4NQ0A 3TWQA 2EIME 4KZ0A 2EILE 2WXRA 2LXLA 4B8CB 5FQ8A 3IHYA 5EN5D 4N3AA 4BT8A 5CECB 4JC8A 4K0RA 3HG0D 4RSYA 3RU0A 4WNGA 3QB2A 1RW2A 4URKA 3ESKA 3ESLA 4ME2A 3IXEA 4EZKA 2PL2A 3B7SA 3L16A 2LSUA 2F8YA 4FULA 3N71A 3UT4A 3JXJA 3UX4A 4FP7A 5HI7A 3DSSA 2KXPC 2KCVA 2VSYA 2F37A 3CHMA 3E32A 3CVWA 4HORA 3KSLA 3APDA 2WXKA 3C3QA 4K5AB 4GYYA 2IEJA 3CSTA 2VGXA 2X3MA 2VJ8A 3BG1B 2QYJA 4D10C 3Q47B 3HXDA 1FPPA 4GA1A 3SO8A 4CEMA 3AS8A 4L7TA 4Q94A 1MQSA 3MA5A 3FUDA 3LXUX 2XGSA 2P9PG 4EPZA 3LCAA 1E7UA 2XCCA 4U8YD 3UIPC 1E7VA 2LO6A 3AG3E 2AVPA 2RFMA 3KEZA 4KXKB 5C1DA 2P9SG 4DUIA 4LCTA 4NURA 2PQNA 1UJJA 4U07A 4J8SA 4EHMA 3ASOE 2BUGA 2Y3AA 2R59A 3Q79A 1N4PA 1TN6A 3FUEA 5CBNA 3FHEA 4TUUA 3NBNB 2DVWA 3CVVA 4BSXA 3TWUA 4JA7A 2DCPA 4HQDA 4GMLA 4HLLA 3UM2A 4F6RD 2LAIA 2Y0BG 3F6QA 2P9NG 2PQRA 2X6JA 3U3WA 2BF0X 2OVFA 2IO3C 1TN7A 2HM8A 1WM5A 4U95D 4JXTA 3UM0A 3ZEFA 3SQVA 3ZHEB 3U64A 4F3VA 1MHQA 1PAQA 2LSVA 4HI8A 2J08A 3EU5A 1ELRA 3PDNA 5A23A 2MOWA 2WXPA 1IYGA 4A1SA 4XEIG 3G2SA 3PZ2A 4FADA 2WXGA 3ABKE 4ANXA 1HH8A 5KWDA 5CCLA 3V31A 3UT8A 3RJVA 5ENQD 2LXMA 4BTAA 3BEEA 4B0ZA 4I1AA 3RRNB 2LUHA 2IQCA 2IOSA 1HX8A 3J5PA 1HS6A 2ZGDA 2WVIA 3L17A 3EHRA 4ILIA 1G3NB 3DSWA 4CDMA 2B0OE 1E8XA 3Q49B 4ZHBA 3ZHEA 5BT1A 3RK6A 4U96D 3NZUA 2WXLA 5LOZA 2OOEA
chains in the Genus database with same CATH topology
2UY1B 2WXIA 2X6KA 2IOLA 3OTNA 3UQ3A 4PH4B 3PVLA 5KCMA 1TJCA 4DI3A 5JHAA 2ILRA 4G2VA 2BTDA 3AS4A 4WNFA 2AXUA 5J90A 4EQFA 3UPVA 2I6HA 4E85A 2ONDA 3ZVVA 4ANUA 3FU3A 4GZ3A 1FCHA 3OXFA 3FWVA 3PEVB 1UW4B 4HOQA 4GA0A 2GGFA 3KD7A 5BPPA 1NZNA 4KYOB 4DK5A 1H2VC 2C2LA 4JL0A 3S7BA 1INZA 4HOSA 2QY7A 3NZSA 4UQZA 4IYPA 5FWQA 5G2NA 1HZ4A 2XPZA 3QC1A 3TL5A 2FULA 4KZCA 5EKQD 4L1BA 1U3DA 1ZBPA 3L54A 3LVRE 5EX3A 3VLEA 4LUNU 2KC7A 4GYWA 5BW8C 2XQ0A 4F7AA 4IN3B 1U3CA 3CVPA 4I6JA 4N39A 3ULQA 3PE4A 4CDRA 1GW6A 3NF1A 2KZTB 4OVUA 3D9KA 5BV1A 1BPOA 3LKUA 3ZFWA 4RG6A 3ML9A 4JVSA 3IHVA 3PE3A 4N2SA 2CG2A 4PS8A 3KS2A 4DPRA 4IULA 3GYZA 4UWHA 4JW1A 5E75A 2YNQA 1OWLA 1EPUA 1OWNA 3PRZA 4J8DA 2QFCA 5FZQA 4J8FA 2V8SE 5G55A 3MV3B 1SZAA 4JEHA 3S7DA 3JUIA 5A7DB 1P5QA 2XCBA 3FU5A 3CGHA 3MV2B 4U8HA 2XPYA 4WWNA 4H7YA 3MX3A 1FVFA 1OWMA 1HXIA 2NXPA 3O4ZA 4L2YA 4U04A 4B94A 4TV3A 2I1KA 3APCA 3EIJA 3FUHA 1Y8MA 4NACA 5CMYA 4A1GA 5ANRA 1YA0A 3FTUA 2X6FA 3JCKC 4JZYA 4UWFA 3TG5A 3B7TA 4H7XA 4XX5A 3PS6A 3GZSA 3ZYKA 2HO1A 3S7JA 3PUJA 1OUVA 2WM9A 2UY1A 3RIBA 1UN8A 2V0PA 3TG4A 4N3BA 2HYZA 1NA3A 2CHXA 2JLBA 1N52A 3HDXA 3PEUB 3PNLB 3QJZA 4K03A 2J07A 4TRQA 3RKVA 3UUXA 5JJTA 2VQ2A 4I9CA 2CG3A 2I1JA 2M63A 5LCWC 4ACLA 3RO2A 4GMJA 3FUFA 5KJNA 3FTSA 3D3MA 4JHKA 3IV0A 1HG5A 4BY6A 2XGMA 4FLBA 3MYVA 3Q5MA 4YVQC 2FEZA 2CHZA 3HYMB 3FUJA 1E8ZA 3CEQA 4M3OA 2WQHA 2KM4A 4MS6A 4CT0A 1X5BA 3CHQA 5FT9A 2L0TB 3PZDA 4RVBA 3QNKA 3HHMA 4WNDA 4GB9A 3EHNA 4UQXA 2XGOA 4G23A 4LERA 4YVOA 3MEKA 3P2BA 3FEYA 2L9BA 4G11A 1FVHA 2AXVA 5EX0A 3FUNA 3LDZA 4ILGA 2KZTA 2X6HA 3FUMA 3R7RA 2WXFA 3RRMB 4GPKA 5FQ6A 4JHRA 5G04C 3JQ1A 2GW1A 1IHGA 3FH7A 3SZ7A 3P1UA 4KVOA 2E0IA 4I2ZA 2FO7A 1QNFA 2WPVA 2YHCA 4CCAA 1KT0A 3D9JA 3D9LA 3CHOA 5AJDA 3FY4A 3OXGA 4ACKA 3G2UA 5KJLA 4DJAA 4GCNA 4B8AA 4AV7A 2NC9A 4BTBA 3BG0B 2VGYA 2WB2A 4FHJA 3EDTB 4FC8A 4WNEA 2V5FA 4ABNA 3SGHA 5LX8A 4GU5A 5FTPA 3D9PA 4FU3A 3LVQE 5CMWA 1DVPA 3KAEA 4GZ6A 4FA6A 4BWRA 4J6IA 1W3BA 3ML8A 3FTZA 2A4ZA 2CFUA 3O48A 1VDYA 1JPLA 2P58C 3S2AA 2MRIA 4HOUA 4F53A 2VTBB 1Z6TA 5G04J 1XGWA 1XNFA 4HXIA 5J08A 3CVUA 5DIZA 3NQPA 3QWPA 3FFLA 3HVEB 3PREA 3C98A 2YQ8A 3QWVA 3IKOB 1JWGA 3L13A 3B7RL 3CVQA 4B89A 1A17A 3Q4AB 5LP0A 4AY6A 4DI4A 2JEKA 5T8IA 5AENA 5CHEE 3L08A 3SNXA 2OV8A 1H2TC 4I43A 4G1TA 4KT6B 4Q69A 3S7FA 4WUYA 4HVBA 3QWWA 3ASFA 1ELKA 3CSFA 5HQ8A 3SD5A 5EDSA 1TJFA 3ZN3A 2X6IA 1IQRA 2PZIA 2R17C 3QDNA 3LY8A 4BT9A 1E90A 4XI0A 2XEVA 4HLEA 3TXNA 3ZYLA 2C0LA 3Q15A 4Y6CA 5JJ7A 4L2LA 4A3VA 2AXZA 3QARA 3U9WA 4PS3A 1E96B 4NRHB 2WXHA 4I6EA 4UWKA 2RD0A 4U0UA 4KVMA 3AU5A 4AM9A 4PUCA 2I9CA 3ASDA 3LEWA 3ONLA 2VSOE 4P29A 3QOUA 5JHBA 2AWIA 3HIZA 3ZGQA 4WWPA 5T3RA 3DPDA 3SBSA 3CKCA 3MGBA 1E8YA 2VGXB 3D9MA 4I9EA 3CK9A 3CK8A 3CVNA 1ZU2A 4FHKA 4NQ0A 5LFAA 4UQYA 3LY9A 4EZJA 3PUKA 4GYOA 3CIAA 4KZ0A 3TJPA 5BV0A 2WXRA 3E4BA 4G24A 3CQCB 4B8CB 4APOA 4IRUA 3IHYA 4N5CA 1DNPA 4N3AA 5FQ8A 4BT8A 2A5UA 2VSNA 4A55A 2J49A 4PDXA 3B7UX 1QZ2A 4JC8A 1N54A 4OVVA 5ARFA 3R9AB 3SBTB 4K0RA 2VTBA 4GZ5A 4RSYA 4WNGA 5FQ4A 4W9RA 5T4YA 3RU0A 3IEGA 3HVEA 3QB2A 4KMOA 4Q96A 3L6AA 4URKA 1WAO1 1H6KA 4CGVA 2X38A 3EHMA 3ESKA 2MHKA 3ESLA 4XZ4A 3UMVA 4ME2A 3CHRA 2J4BA 3U4TA 4F1SA 4EZKA 2E2EA 1UG3A 2PL2A 4I6GA 3VTXA 3R7QA 3B7SA 4JHJA 4FJZA 5A6CA 4GAAA 3L16A 3UT7A 4AIFA 3QKYA 5BUZA 3MKRA 2LSUA 4LRZA 3FTXA 3D9OA 2DBAA 3QK0A 4FULA 3N71A 3UT4A 4CT4A 2WXOA 3UX4A 4BFRA 4FP7A 5D0OD 3CHPA 3GZ2A 5HI7A 3ZPJA 4FJYA 4EBAG 5LCWJ 3CR3A 2KCVA 2VSYA 4UI9C 3SF4A 2HR2A 3CHMA 3URZA 3CVWA 4L23A 4HORA 4MKTA 1NP7A 5FZRA 2YHEA 3APDA 2WXKA 1PY1A 3FULA 3MKQA 1HO8A 1SZ9A 3VLFA 4HOTA 3FDHA 3RRUA 4GA2A 4GYYA 4CDNA 3CSTA 2VGXA 5G05C 1OWPA 2X3MA 3PH0C 4U0SA 4ANVA 3LJ3A 1HFAA 2VJ8A 3BG1B 3ZYMA 4EZLA 3RO3A 5ENNA 2WQ6A 4D10C 3Q47B 3T5VA 4EECA 1HF8A 3LYAA 4JA9A 3FU6A 4GA1A 4HFGA 4O6FA 2WXQA 1ELWA 4CEMA 3VLDA 4DLOA 2CFZA 3AS8A 4L7TA 4MRUA 4Q94A 4E6HA 3FTVA 3ZIMA 1H2UA 1MQSA 4G26A 2C0MA 2FF4A 2Q7FA 2V4LA 2NSZA 4C0EA 1NA0A 5FJYA 4AP2A 2XPIA 3LY7A 3SHFA 3FTYA 3FUDA 3MA5A 4I1OB 3TAXA 3LXUX 3I4GA 2KATA 2XGSA 5G05J 5KJMA 1L5JA 4KBQA 4CGWA 2KCLA 3D9NA 2VYIA 4EPZA 3LCAA 1EYHA 3JYSA 1E7UA 2XCCA 3LS8A 3TGOA 1HE8A 2WXJA 2KCKA 3AU4A 4EBAA 3CKBA 2FBNA 1E7VA 2LO6A 4XKBA 5FZSA 4Y6WA 2EQXA 2UWJG 2AVPA 2WMOA 2XRYA 3ZYQA 3ZXSA 3KEZA 4AEZC 4KXKB 5C1DA 4LCTA 4NURA 2PQNA 1UJJA 4U07A 3L22A 4WAFA 1B89A 4AVXA 1Z3XA 4J8SA 3EJNA 3D9IA 2BUGA 4J8EA 4BX9A 2Y3AA 2PM7A 2R59A 2R5SA 4PS7A 4GCOA 1WY6A 2Y4TA 2J09A 2IU1A 3FTWA 3I4RB 3MKQB 4AXHA 3FH5A 1KT1A 3DBSA 3FUEA 3T5XA 3OXLA 3FHEA 4QFVA 3PNTB 3K9IA 1JWFA 1EF1C 3CVXA 5C2YA 4TUUA 4UWLA 4XI9A 4JPSA 3CVVA 4UI9K 3WXXA 4BSXA 4U63A 3ASHA 4JA7A 4YNDA 3CLJA 2Y4UA 4V3IA 3FP3A 2DCPA 4C9BB 4DLQA 4GMLA 5M72A 3U66A 2VSXE 1KLXA 5AIJA 2LAIA 4ATGA 3MJWA 1UN9A 2ZU6B 3I5PA 2PQRA 2X6JA 3GW4A 3U3WA 2BF0X 4UWGA 2GRLA 3FUKA 2IFUA 2OVFA 3EIQC 4FLHA 2XRZA 2HM8A 1UJKA 4U0ZA 1WM5A 5DBKA 4C0MA 1JUQA 3QAQA 4JXTA 4G25A 4OYSA 1S0PA 4XE0A 2WQ7A 1E8WA 3SFZA 3CQGB 2GRMA 2LNIA 3CHSA 5AJLA 3ZEFA 5ARGA 3U64A 2IONA 4LEUA 3ZHEB 4F3VA 1MHQA 1H19A 1PAQA 2IJGX 2LSVA 1OWOA 2J08A 4AY5A 4XKCA 3B13A 4I1MA 5JJ6A 1ELRA 3PDNA 5A23A 2MOWA 2WXPA 4ILHB 4XIFA 1IYGA 4ANWA 4A1SA 1LF8A 4R7LA 1EDUA 3ASGA 3ZW3A 3G2SA 2YINA 3G2VA 2I2OA 4FADA 3FH8A 2WXGA 3I3NA 3GZ1A 4J0UA 2OVBA 4WWOA 5FQ7A 4RG9A 4ANXA 1HH8A 3FUIA 5BNWA 3MZLB 5CCLA 4N3CA 1H0AA 3ENEA 1HG2A 3CK7A 2J9QA 4A3TA 5ANLA 3APFA 3UT8A 3RJVA 3JQ0A 3FU0A 3MCXA 4BTAA 3BEEA 4B0ZA 4I1AA 3RRNB 4I2WA 4I17A 4GZCA 1PC2A 2RG8A 2XHEA 2IQCA 3OAWA 2IOSA 2PM6A 1HX8A 1HS6A 4CRWA 2LAHA 3G2TA 3T8MA 3CV0A 3ONKA 3CVYA 3AS5A 2FI7A 5KJKA 5CCMA 2WVIA 3L17A 2AW6A 4UI9J 4HS2A 4ILIA 1TEZA 1SQMA 4CDMA 3ZRHA 2L0IA 5AYWD 1Y6IA 3VTYA 1QQEA 2J4DA 3FEXA 2DIWA 3SI5A 5D0QD 4BX8A 4AJWA 1E8XA 3Q49B 3G2WA 4GZDA 4APFA 1HU3A 1IQUA 3CVLA 3ZHEA 4AOFA 5BT1A 4N2QA 3RK6A 1Z3YA 3IBEA 3TXMA 5E76A 3NZUA 3LPZA 2WXLA 2IF4A 5LOZA 2CHWA 2WXNA 2WMNA 2WXMA 4JEUA 4MLPA 2L6JA 2OOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMJ A;  2IOL A;  3D3M A;  2ION A;  4JHK A;  1UG3 A;  4LUN U;  3EIJ A;  4JHJ A;  1PAQ A;  4B8C B;  4C9B B;  4GML A;  1H2U A;  4B89 A;  5ANR A;  2VSX E;  2KZT B;  2NSZ A;  4B8A A;  2ZU6 B;  3FEX A;  1UW4 B;  1H2T C;  2RG8 A;  1N54 A;  2VSO E;  2IOS A;  2GGF A;  1HU3 A;  3EIQ C;  4IUL A;  2IU1 A;  2HM8 A;  3RK6 A;  4CRW A;  1H2V C;  4CT4 A;  1N52 A;  3L6A A;  1H6K A;  3FEY A;  2I2O A;  3JUI A;  4CEM A;  2KZT A;  2FUL A; 
#chains in the Genus database with same CATH topology
 4GPM A;  4YDO A;  5KCM A;  5JHA A;  4G2V A;  4WNF A;  1NFI E;  3DSV A;  4E85 A;  4GTP A;  3PEV B;  1UW4 B;  4HOQ A;  1UOH A;  1NZN A;  4DK5 A;  4JL0 A;  3Q9N C;  4HOS A;  5FWQ A;  5EKQ D;  3V2X A;  3CVP A;  3ULQ A;  4CDR A;  2KZT B;  4OVU A;  1BPO A;  4RG6 A;  4JVS A;  3IHV A;  4UWH A;  3GYZ A;  1OWL A;  1OWN A;  2QFC A;  5G55 A;  2V8S E;  1SZA A;  3S7D A;  3JUI A;  3UMV A;  3SFX A;  3PZ3 A;  3APC A;  3FUH A;  1Y8M A;  5EYL A;  3PS6 A;  1OUV A;  4LG6 A;  4K03 A;  1NA3 A;  1N52 A;  3PNL B;  3RKV A;  2I1J A;  5LCW C;  3TWV A;  4GMJ A;  3FUF A;  3FTS A;  4JHK A;  2GRO B;  4YVQ C;  2CHZ A;  1E8Z A;  3CEQ A;  4M3O A;  2QZA A;  1TNY A;  2XGO A;  3UKR G;  4G23 A;  4LER A;  3MEK A;  3FEY A;  2L9B A;  3AG4 E;  2KZT A;  4GPK A;  5FQ6 A;  4JHR A;  5G04 C;  3SZ7 A;  2GW1 A;  4KVO A;  2FO7 A;  2WPV A;  3D9J A;  5AJD A;  3CHO A;  4DJA A;  4GCN A;  4B8A A;  4AV7 A;  2NC9 A;  3BG0 B;  2WB2 A;  4FHJ A;  4FC8 A;  2V5F A;  1OCZ E;  4GU5 A;  2NYJ A;  5CMW A;  3L82 A;  2A4Z A;  1VDY A;  2VTB B;  3CVU A;  1XGW A;  1JCQ A;  1XNF A;  2XEE A;  4HXI A;  3NQP A;  1AP7 A;  3QWV A;  4B89 A;  3Q4A B;  4DI4 A;  3E34 A;  4KT6 B;  4Q69 A;  4A63 B;  1ELK A;  3SD5 A;  2XEN A;  1IQR A;  2PZI A;  4BT9 A;  3WG7 E;  5D2M C;  3Q15 A;  4Y6C A;  5JJ7 A;  4DX7 D;  1E96 B;  4NRH B;  2WXH A;  2DWZ A;  2RD0 A;  4KVM A;  2FO1 E;  3ONL A;  4K5B A;  3AJI A;  4WWP A;  3SBS A;  3CKC A;  3CK9 A;  4FHK A;  1ZU2 A;  1N0R A;  1MYO A;  3PUK A;  3E4B A;  4G24 A;  3CQC B;  4N5C A;  1DNP A;  1IHB A;  5KNG A;  2J49 A;  5ITZ F;  1QZ2 A;  3SBT B;  1N54 A;  2VTB A;  4GZ5 A;  5FQ4 A;  5T4Y A;  2ZIS A;  3IEG A;  4Q96 A;  4MBG A;  2V4H C;  1KZP A;  3EHM A;  2MHK A;  3U4T A;  2J4B A;  4F1S A;  2E2E A;  4I6G A;  4JHJ A;  4FJZ A;  5A6C A;  5D66 A;  2OEW A;  3MKR A;  3L9T A;  3RSE G;  4LRZ A;  3D9O A;  2DBA A;  4BFR A;  3DPY A;  1TYQ G;  4LNG A;  5LCW J;  2HR2 A;  3SY2 A;  1O1R A;  3DXK G;  1NP7 A;  5FZR A;  1PY1 A;  3MKQ A;  4LSZ E;  1SZ9 A;  3VLF A;  3FDH A;  2AJA A;  4U0S A;  3LJ3 A;  2Y69 E;  4GTT A;  4EZL A;  1K1A A;  3RO3 A;  4HFG A;  1ELW A;  3VLD A;  4DLO A;  2CFZ A;  2XZT G;  3ZU7 B;  4G26 A;  2C0M A;  2V4L A;  3ABL E;  3Q9U C;  4C0E A;  5FJY A;  3Q7A A;  3FTY A;  4I1O B;  4GTS A;  5G05 J;  5KJM A;  4KBQ A;  3D9N A;  2VYI A;  3JXI A;  2RKK A;  3LS8 A;  3Q75 A;  2WXJ A;  2DYR E;  2FBN A;  5FZS A;  4XKB A;  4GTM A;  2EQX A;  1TNB A;  1B89 A;  3D9I A;  2PM7 A;  1D9S A;  2IU1 A;  3FTW A;  3DBS A;  3TWW A;  3PNT B;  1JWF A;  1EF1 C;  2ZGG A;  4U63 A;  3ASH A;  4NIK A;  2Y4U A;  3FP3 A;  4DLQ A;  3U66 A;  2VSX E;  1KLX A;  2ZU6 B;  4UWG A;  2XRZ A;  1UJK A;  4C0M A;  3QAQ A;  4G25 A;  4OYS A;  4XE0 A;  3ULY A;  1N4S A;  2LNI A;  5AJL A;  5ARG A;  1LD8 A;  1OCR E;  1H19 A;  1OWO A;  4XKC A;  2F8X K;  5JJ6 A;  4ILH B;  1TNU A;  1LF8 A;  2H6F A;  1EDU A;  2GRQ B;  2OVB A;  4WWO A;  3FUI A;  1H0A A;  1HG2 A;  3APF A;  4J7W A;  3MCX A;  4I2W A;  4GZC A;  1PC2 A;  2XS1 A;  1MX4 A;  1O1T A;  5BXO A;  2XHE A;  3DST A;  4GTV A;  2FI7 A;  2AW6 A;  2J4D A;  3FEX A;  3SI5 A;  4X8Q A;  4BX8 A;  3G2W A;  4GZD A;  4RQI A;  4TXR A;  1HU3 A;  4DX2 A;  5CER B;  2IF4 A;  2H6I A;  2WXM A;  3FTU A;  1S70 B;  2IOL A;  3OTN A;  4OAU C;  2ILR A;  2AXU A;  2I6H A;  2OND A;  3ZVV A;  3KEA A;  3OXF A;  3ISM C;  4GA0 A;  2ETB A;  5BPP A;  1H2V C;  1INZ A;  4YDW A;  3NZS A;  3E37 A;  1HZ4 A;  3QC1 A;  3TL5 A;  4KZC A;  1U3D A;  5ENT D;  4O1P A;  5EX3 A;  4LUN U;  4F7A A;  5BW8 C;  4IN3 B;  3TWR A;  4I6J A;  3PE4 A;  3NF1 A;  5BV1 A;  3D9K A;  3ZUV B;  3EUV A;  3DEP A;  4HRM B;  3KS2 A;  2OEV A;  4IUL A;  4J8D A;  5FIN A;  3MV3 B;  3ZKJ A;  3FU5 A;  5ENS D;  3UPV A;  5BUZ A;  2XPY A;  4H7Y A;  4B94 A;  1HXI A;  3UM3 A;  2JAB A;  3UTM A;  1SW6 A;  3V2O A;  4A1G A;  3JCK C;  4JZY A;  4UWF A;  4Z68 A;  1KZO A;  5CRU A;  3S7J A;  1S64 A;  3RIB A;  1UN8 A;  2V0P A;  3DWL G;  1ZB1 A;  2JLB A;  3PEU B;  2VQ2 A;  4I9C A;  2M63 A;  3IV0 A;  1WG0 A;  3Q5M A;  2FEZ A;  1OCO E;  3HYM B;  2KM4 A;  4CT0 A;  3CHQ A;  5AAR A;  4RVB A;  3QNK A;  3HHM A;  1YMP A;  3EU9 A;  1FVH A;  2AXV A;  3LDZ A;  4M7C A;  4ILG A;  3RRM B;  3FH7 A;  3SFY A;  4I2Z A;  1QNF A;  2YHC A;  3FY4 A;  2R2L A;  3HXF A;  4BTB A;  3C72 A;  4WNE A;  1YYH A;  5FTP A;  3D9P A;  4FU3 A;  3LVQ E;  3KAE A;  4GZ6 A;  4J6I A;  4CYM D;  3ML8 A;  1JPL A;  2P58 C;  4DRX E;  2GRN B;  4GTR A;  3QWP A;  3HVE B;  5JA4 D;  2YQ8 A;  3L13 A;  4I43 A;  4G1T A;  1TNZ A;  2DZO A;  4HVB A;  3UM1 A;  3ASF A;  1OY3 D;  5HQ8 A;  2X6I A;  3LY8 A;  1E90 A;  2RFA A;  2XEV A;  4BEP A;  3ZYL A;  3V79 K;  1NL4 A;  5AQA A;  4A3V A;  2AXZ A;  3QAR A;  1MX6 A;  3U9W A;  2VSO E;  2P2C P;  3QOU A;  1TNO A;  3DPD A;  1E8Y A;  4I9E A;  3D9M A;  3CK8 A;  3CVN A;  4UQY A;  4EZJ A;  4HRL A;  2IO2 C;  4APO A;  2A5U A;  3ZNG A;  4OVV A;  2IY0 C;  3HVE A;  3L6A A;  1WAO 1;  2H6H A;  1H6K A;  2X38 A;  1V54 E;  4XZ4 A;  1LD7 A;  3CHR A;  3VTX A;  1TN8 A;  3R7Q A;  3KSQ A;  4GAA A;  4HI9 A;  3QKY A;  1BLX B;  2EIN E;  3QK0 A;  4CT4 A;  1D8E A;  1JCS A;  4L9P A;  5EID A;  4UI9 C;  3SF4 A;  2YHE A;  3FUL A;  1HO8 A;  4HOT A;  3RRU A;  5G05 C;  1OWP A;  1A5E A;  1HFA A;  3HRA A;  3Q7F A;  2ETC A;  3T5V A;  1HF8 A;  3LYA A;  3FU6 A;  3E30 A;  2WXQ A;  4JB8 P;  3PZ1 A;  4MRU A;  3FTV A;  3ZIM A;  1H2U A;  5B3S E;  2NSZ A;  1NA0 A;  3LY7 A;  3TAX A;  3I4G A;  2KAT A;  2KCL A;  1EYH A;  5KBA A;  3JYS A;  5ENR D;  4EBA A;  2P9I G;  4B93 B;  2XRY A;  4C48 B;  3B7B A;  3L22 A;  4WAF A;  4GMR A;  4AVX A;  5AAO A;  1Z3X A;  4J8E A;  4BX9 A;  2R5S A;  1BI8 B;  3I4R B;  3MKQ B;  3Q78 A;  2GRR B;  3FH5 A;  3T5X A;  3OXL A;  3CVX A;  3K9I A;  2P9L G;  4UWL A;  4JPS A;  3WXX A;  1MZC A;  4YND A;  1MX2 A;  4TXP A;  4V3I A;  3TWT A;  4O1O A;  4ATG A;  3I5P A;  4U8V D;  3UKU G;  2GRL A;  3FUK A;  2IFU A;  5AQB A;  3V30 A;  2WQ7 A;  1S0P A;  1E8W A;  2R03 A;  2GRM A;  1H6O A;  2ION A;  4LEU A;  2P9U G;  5CED B;  4G8L A;  4U7E B;  3TWX A;  3B13 A;  4I1M A;  2R05 A;  4XIF A;  4R7L A;  3ASG A;  1RZ4 A;  3G2V A;  3FH8 A;  3I3N A;  3GZ1 A;  4J0U A;  5FQ7 A;  3MZL B;  4N3C A;  3CK7 A;  4A3T A;  3FU0 A;  4I17 A;  3ABM E;  3RAU A;  4YDY A;  4CRW A;  3G2T A;  2ZIR A;  2J8S D;  3HXB A;  2EIJ E;  1FT1 A;  4HRN A;  3CVY A;  3AS5 A;  4QQI A;  3EHQ A;  4UI9 J;  1TEZ A;  4BES A;  1O1S A;  2L0I A;  5AYW D;  1Y6I A;  1N11 A;  3VTY A;  2DIW A;  1N9A A;  5CBO A;  3DEO A;  4N2Q A;  1Z3Y A;  3IBE A;  3TXM A;  2CHW A;  2WXN A;  2DZN A;  4BER A;  2WMN A;  2L6J A;  2UY1 B;  2WXI A;  4DI3 A;  1TJC A;  2BTD A;  1N4R A;  4EQF A;  4O60 A;  3FU3 A;  1FCH A;  3KD7 A;  4KYO B;  2C2L A;  2QC9 A;  3S7B A;  3T9K A;  3UI2 A;  4IYP A;  2XPZ A;  2FUL A;  4L1B A;  4F1P A;  2XS8 A;  3L54 A;  3VLE A;  4GYW A;  2XQ0 A;  5ENP D;  3LKU A;  3ZFW A;  3W9G A;  3C5R A;  4N2S A;  2CG2 A;  4PS8 A;  4JW1 A;  3HXC A;  2YNQ A;  1EPU A;  4J8F A;  5CRV A;  4JEH A;  5A7D B;  1P5Q A;  2XCB A;  3CGH A;  3ULE G;  3MX3 A;  1FVF A;  4U04 A;  4DX1 A;  4TV3 A;  1U2V G;  1D8D A;  4TUM A;  2VGE A;  3EIJ A;  1YA0 A;  2X6F A;  3LJN A;  3DRA A;  2HO1 A;  2UY1 A;  1QYM A;  4JD2 G;  5EYP F;  2HYZ A;  1OCC E;  2CHX A;  2J07 A;  1NI1 A;  4ACL A;  3RO2 A;  1HG5 A;  3FUJ A;  1X5B A;  2L0T B;  3PZD A;  4YVO A;  4G11 A;  5EX0 A;  1K1B A;  3FUM A;  2X6H A;  4J8Y A;  1O5M A;  1Q2Z A;  3UIN C;  3BUA A;  5IY5 E;  3D9L A;  3X2Q E;  3OXG A;  3G2U A;  2VGY A;  1DC2 A;  3E33 A;  3SGH A;  5LX8 A;  1DVP A;  4FA6 A;  4BWR A;  2BKK B;  2CFU A;  3Q73 A;  2MRI A;  4HOU A;  5J08 A;  5DIZ A;  3PRE A;  3C98 A;  3DSX A;  3IKO B;  1JWG A;  3B7R L;  3CVQ A;  1A17 A;  2JEK A;  5T8I A;  3UXG A;  5AEN A;  5CHE E;  2OV8 A;  3AG1 E;  3S7F A;  4WUY A;  5KNH D;  4UUC A;  3CSF A;  5FIO A;  5AN8 A;  2R17 C;  4XI0 A;  3TXN A;  1K8K G;  5HKP A;  4L2L A;  4DX6 D;  4PS3 A;  4I6E A;  4U0U A;  3AU5 A;  4PUC A;  2I9C A;  1AWC B;  3C3R A;  4P29 A;  2AWI A;  5T3R A;  1BI7 B;  4G8K A;  1OXJ A;  1JCR A;  3MGB A;  5LFA A;  3LY9 A;  4GYO A;  3CIA A;  3TJP A;  5BV0 A;  4IRU A;  4LNB A;  2VSN A;  4A55 A;  1BU9 A;  4PDX A;  3B7U X;  5ARF A;  3R9A B;  4TXQ A;  4W9R A;  2PNN A;  4KMO A;  4CGV A;  2ETA A;  5BXU A;  1UG3 A;  2QYU A;  3NOC D;  3UT7 A;  4AIF A;  3FTX A;  1DCQ A;  2WXO A;  5ENO D;  3TWS A;  5D0O D;  3CHP A;  3GZ2 A;  3ZPJ A;  4FJY A;  4EBA G;  5AQ9 A;  3CR3 A;  3URZ A;  1TR4 A;  4L23 A;  4MKT A;  3R9M A;  1OT8 A;  4GA2 A;  4CDN A;  4GTQ A;  3PH0 C;  1LTX A;  4ANV A;  3ZYM A;  3ASN E;  5ENN A;  2WQ6 A;  4EEC A;  4JA9 A;  4O6F A;  3PZ4 A;  4E6H A;  2FF4 A;  2Q7F A;  4AP2 A;  2XPI A;  3SHF A;  1L5J A;  4CGW A;  3NOG D;  4HB5 A;  3TGO A;  1HE8 A;  4CZ2 D;  2KCK A;  3AU4 A;  3CKB A;  5EIB E;  4Y6W A;  2WMO A;  2UWJ G;  3D9H A;  3ZYQ A;  3ZXS A;  4AEZ C;  1X81 A;  3BU8 A;  1DCE A;  2DYS E;  3EJN A;  4PS7 A;  3NB2 A;  1WY6 A;  4GCO A;  2Y4T A;  2J09 A;  4AXH A;  2P9K G;  1KT1 A;  4QFV A;  5C2Y A;  2B6C A;  4XI9 A;  1K3Z D;  4UI9 K;  3CLJ A;  3JUE A;  4C9B B;  5M72 A;  5AIJ A;  3MJW A;  1UN9 A;  3GW4 A;  1SVX A;  1N0Q A;  3EIQ C;  4FLH A;  5AQ7 A;  4U0Z A;  5DBK A;  1JUQ A;  3SFZ A;  3CQG B;  3CHS A;  2Y1L E;  2IJG X;  4AY5 A;  4BSZ B;  4HNA D;  4ANW A;  4ZFH A;  3ZW3 A;  4DX5 D;  4N5Q A;  2V5Q C;  2YIN A;  2I2O A;  1Z5S C;  1S63 A;  4RG9 A;  5BNW A;  3T8K A;  3ENE A;  2J9Q A;  5ANL A;  3AAA C;  3JQ0 A;  3HXE A;  5JMN D;  2RG8 A;  3OAW A;  2PM6 A;  1IKN D;  2LAH A;  3T8M A;  1BD8 A;  3CV0 A;  3ONK A;  3ZXP A;  1V55 E;  5KJK A;  5CCM A;  4HS2 A;  1SQM A;  1H6P A;  3J5Q B;  3ZRH A;  1QQE A;  5D0Q D;  4AJW A;  4APF A;  4AOF A;  1IQU A;  3CVL A;  1KPS B;  2ZXW E;  5E76 A;  3LPZ A;  2XEH A;  2EIK E;  4JEU A;  4MLP A;  4LNU D;  2X6K A;  3UQ3 A;  4GTO A;  4PH4 B;  3PVL A;  3AS4 A;  5J90 A;  1N95 A;  4ANU A;  4GZ3 A;  1N94 A;  3FWV A;  2GGF A;  5CEA A;  2A5E A;  2QY7 A;  4UQZ A;  1SA5 A;  5G2N A;  3DSU A;  2F0Y A;  1ZBP A;  3LVR E;  2KC7 A;  1U3C A;  4N39 A;  3DXM G;  3AG2 E;  1GW6 A;  1YCS B;  5EIL A;  1IXV A;  4BET A;  2GRP B;  3ML9 A;  3PE3 A;  4DPR A;  5E75 A;  5FZQ A;  3PRZ A;  2HE0 A;  3MV2 B;  4AY6 A;  4U8H A;  4WWN A;  4ATZ D;  1OWM A;  2NXP A;  3O4Z A;  4L2Y A;  2I1K A;  5B1A E;  4NAC A;  5CMY A;  5ANR A;  3TG5 A;  3B7T A;  4H7X A;  4XX5 A;  3GZS A;  3ZYK A;  3PUJ A;  2WM9 A;  4YDE A;  3TG4 A;  5HS0 A;  4N3B A;  3NAW A;  3HDX A;  3B95 A;  4TRQ A;  5JJT A;  3QJZ A;  3UUX A;  4RLY A;  2CG3 A;  1WDY A;  5KJN A;  3D3M A;  1SA4 A;  3C3O A;  4BY6 A;  2XGM A;  4FLB A;  3MYV A;  4HBD A;  2WQH A;  1MJ0 A;  4MS6 A;  5FT9 A;  2KBX A;  2L6B A;  4WND A;  4GB9 A;  3EHN A;  4UQX A;  3BQO A;  2OCC E;  3P2B A;  3FUN A;  3R7R A;  2WXF A;  3JQ1 A;  1IHG A;  5HRY A;  3P1U A;  2E0I A;  4CCA A;  1KT0 A;  4ACK A;  5KJL A;  5B1B E;  3EDT B;  4ABN A;  1W3B A;  3FTZ A;  3O48 A;  4K5C A;  2BED A;  3S2A A;  4OAV B;  4F53 A;  1Z6T A;  5G04 J;  2R02 A;  3FFL A;  2H6G A;  5LP0 A;  3L08 A;  3SNX A;  1H2T C;  1QBQ A;  1N4Q A;  3QWW A;  3UIO C;  2MYO A;  3W9F A;  5EDS A;  1TJF A;  3ZN3 A;  3QDN A;  5H7P A;  4HLE A;  2C0L A;  1FT2 A;  4UWK A;  2XZD G;  4AM9 A;  3ASD A;  3LEW A;  2BKG A;  5JHB A;  3HIZ A;  3ZGQ A;  2VGX B;  4NQ0 A;  3TWQ A;  2EIM E;  4KZ0 A;  2EIL E;  2WXR A;  2LXL A;  4B8C B;  5FQ8 A;  3IHY A;  5EN5 D;  4N3A A;  4BT8 A;  5CEC B;  4JC8 A;  4K0R A;  3HG0 D;  4RSY A;  3RU0 A;  4WNG A;  3QB2 A;  1RW2 A;  4URK A;  3ESK A;  3ESL A;  4ME2 A;  3IXE A;  4EZK A;  2PL2 A;  3B7S A;  3L16 A;  2LSU A;  2F8Y A;  4FUL A;  3N71 A;  3UT4 A;  3JXJ A;  3UX4 A;  4FP7 A;  5HI7 A;  3DSS A;  2KXP C;  2KCV A;  2VSY A;  2F37 A;  3CHM A;  3E32 A;  3CVW A;  4HOR A;  3KSL A;  3APD A;  2WXK A;  3C3Q A;  4K5A B;  4GYY A;  2IEJ A;  3CST A;  2VGX A;  2X3M A;  2VJ8 A;  3BG1 B;  2QYJ A;  4D10 C;  3Q47 B;  3HXD A;  1FPP A;  4GA1 A;  3SO8 A;  4CEM A;  3AS8 A;  4L7T A;  4Q94 A;  1MQS A;  3MA5 A;  3FUD A;  3LXU X;  2XGS A;  2P9P G;  4EPZ A;  3LCA A;  1E7U A;  2XCC A;  4U8Y D;  3UIP C;  1E7V A;  2LO6 A;  3AG3 E;  2AVP A;  2RFM A;  3KEZ A;  4KXK B;  5C1D A;  2P9S G;  4DUI A;  4LCT A;  4NUR A;  2PQN A;  1UJJ A;  4U07 A;  4J8S A;  4EHM A;  3ASO E;  2BUG A;  2Y3A A;  2R59 A;  3Q79 A;  1N4P A;  1TN6 A;  3FUE A;  5CBN A;  3FHE A;  4TUU A;  3NBN B;  2DVW A;  3CVV A;  4BSX A;  3TWU A;  4JA7 A;  2DCP A;  4HQD A;  4GML A;  4HLL A;  3UM2 A;  4F6R D;  2LAI A;  2Y0B G;  3F6Q A;  2P9N G;  2PQR A;  2X6J A;  3U3W A;  2BF0 X;  2OVF A;  2IO3 C;  1TN7 A;  2HM8 A;  1WM5 A;  4U95 D;  4JXT A;  3UM0 A;  3ZEF A;  3SQV A;  3ZHE B;  3U64 A;  4F3V A;  1MHQ A;  1PAQ A;  2LSV A;  4HI8 A;  2J08 A;  3EU5 A;  1ELR A;  3PDN A;  5A23 A;  2MOW A;  2WXP A;  1IYG A;  4A1S A;  4XEI G;  3G2S A;  3PZ2 A;  4FAD A;  2WXG A;  3ABK E;  4ANX A;  1HH8 A;  5KWD A;  5CCL A;  3V31 A;  3UT8 A;  3RJV A;  5ENQ D;  2LXM A;  4BTA A;  3BEE A;  4B0Z A;  4I1A A;  3RRN B;  2LUH A;  2IQC A;  2IOS A;  1HX8 A;  3J5P A;  1HS6 A;  2ZGD A;  2WVI A;  3L17 A;  3EHR A;  4ILI A;  1G3N B;  3DSW A;  4CDM A;  2B0O E;  1E8X A;  3Q49 B;  4ZHB A;  3ZHE A;  5BT1 A;  3RK6 A;  4U96 D;  3NZU A;  2WXL A;  5LOZ A;  2OOE A; 
#chains in the Genus database with same CATH homology
 2UY1 B;  2WXI A;  2X6K A;  2IOL A;  3OTN A;  3UQ3 A;  4PH4 B;  3PVL A;  5KCM A;  1TJC A;  4DI3 A;  5JHA A;  2ILR A;  4G2V A;  2BTD A;  3AS4 A;  4WNF A;  2AXU A;  5J90 A;  4EQF A;  3UPV A;  2I6H A;  4E85 A;  2OND A;  3ZVV A;  4ANU A;  3FU3 A;  4GZ3 A;  1FCH A;  3OXF A;  3FWV A;  3PEV B;  1UW4 B;  4HOQ A;  4GA0 A;  2GGF A;  3KD7 A;  5BPP A;  1NZN A;  4KYO B;  4DK5 A;  1H2V C;  2C2L A;  4JL0 A;  3S7B A;  1INZ A;  4HOS A;  2QY7 A;  3NZS A;  4UQZ A;  4IYP A;  5FWQ A;  5G2N A;  1HZ4 A;  2XPZ A;  3QC1 A;  3TL5 A;  2FUL A;  4KZC A;  5EKQ D;  4L1B A;  1U3D A;  1ZBP A;  3L54 A;  3LVR E;  5EX3 A;  3VLE A;  4LUN U;  2KC7 A;  4GYW A;  5BW8 C;  2XQ0 A;  4F7A A;  4IN3 B;  1U3C A;  3CVP A;  4I6J A;  4N39 A;  3ULQ A;  3PE4 A;  4CDR A;  1GW6 A;  3NF1 A;  2KZT B;  4OVU A;  3D9K A;  5BV1 A;  1BPO A;  3LKU A;  3ZFW A;  4RG6 A;  3ML9 A;  4JVS A;  3IHV A;  3PE3 A;  4N2S A;  2CG2 A;  4PS8 A;  3KS2 A;  4DPR A;  4IUL A;  3GYZ A;  4UWH A;  4JW1 A;  5E75 A;  2YNQ A;  1OWL A;  1EPU A;  1OWN A;  3PRZ A;  4J8D A;  2QFC A;  5FZQ A;  4J8F A;  2V8S E;  5G55 A;  3MV3 B;  1SZA A;  4JEH A;  3S7D A;  3JUI A;  5A7D B;  1P5Q A;  2XCB A;  3FU5 A;  3CGH A;  3MV2 B;  4U8H A;  2XPY A;  4WWN A;  4H7Y A;  3MX3 A;  1FVF A;  1OWM A;  1HXI A;  2NXP A;  3O4Z A;  4L2Y A;  4U04 A;  4B94 A;  4TV3 A;  2I1K A;  3APC A;  3EIJ A;  3FUH A;  1Y8M A;  4NAC A;  5CMY A;  4A1G A;  5ANR A;  1YA0 A;  3FTU A;  2X6F A;  3JCK C;  4JZY A;  4UWF A;  3TG5 A;  3B7T A;  4H7X A;  4XX5 A;  3PS6 A;  3GZS A;  3ZYK A;  2HO1 A;  3S7J A;  3PUJ A;  1OUV A;  2WM9 A;  2UY1 A;  3RIB A;  1UN8 A;  2V0P A;  3TG4 A;  4N3B A;  2HYZ A;  1NA3 A;  2CHX A;  2JLB A;  1N52 A;  3HDX A;  3PEU B;  3PNL B;  3QJZ A;  4K03 A;  2J07 A;  4TRQ A;  3RKV A;  3UUX A;  5JJT A;  2VQ2 A;  4I9C A;  2CG3 A;  2I1J A;  2M63 A;  5LCW C;  4ACL A;  3RO2 A;  4GMJ A;  3FUF A;  5KJN A;  3FTS A;  3D3M A;  4JHK A;  3IV0 A;  1HG5 A;  4BY6 A;  2XGM A;  4FLB A;  3MYV A;  3Q5M A;  4YVQ C;  2FEZ A;  2CHZ A;  3HYM B;  3FUJ A;  1E8Z A;  3CEQ A;  4M3O A;  2WQH A;  2KM4 A;  4MS6 A;  4CT0 A;  1X5B A;  3CHQ A;  5FT9 A;  2L0T B;  3PZD A;  4RVB A;  3QNK A;  3HHM A;  4WND A;  4GB9 A;  3EHN A;  4UQX A;  2XGO A;  4G23 A;  4LER A;  4YVO A;  3MEK A;  3P2B A;  3FEY A;  2L9B A;  4G11 A;  1FVH A;  2AXV A;  5EX0 A;  3FUN A;  3LDZ A;  4ILG A;  2KZT A;  2X6H A;  3FUM A;  3R7R A;  2WXF A;  3RRM B;  4GPK A;  5FQ6 A;  4JHR A;  5G04 C;  3JQ1 A;  2GW1 A;  1IHG A;  3FH7 A;  3SZ7 A;  3P1U A;  4KVO A;  2E0I A;  4I2Z A;  2FO7 A;  1QNF A;  2WPV A;  2YHC A;  4CCA A;  1KT0 A;  3D9J A;  3D9L A;  3CHO A;  5AJD A;  3FY4 A;  3OXG A;  4ACK A;  3G2U A;  5KJL A;  4DJA A;  4GCN A;  4B8A A;  4AV7 A;  2NC9 A;  4BTB A;  3BG0 B;  2VGY A;  2WB2 A;  4FHJ A;  3EDT B;  4FC8 A;  4WNE A;  2V5F A;  4ABN A;  3SGH A;  5LX8 A;  4GU5 A;  5FTP A;  3D9P A;  4FU3 A;  3LVQ E;  5CMW A;  1DVP A;  3KAE A;  4GZ6 A;  4FA6 A;  4BWR A;  4J6I A;  1W3B A;  3ML8 A;  3FTZ A;  2A4Z A;  2CFU A;  3O48 A;  1VDY A;  1JPL A;  2P58 C;  3S2A A;  2MRI A;  4HOU A;  4F53 A;  2VTB B;  1Z6T A;  5G04 J;  1XGW A;  1XNF A;  4HXI A;  5J08 A;  3CVU A;  5DIZ A;  3NQP A;  3QWP A;  3FFL A;  3HVE B;  3PRE A;  3C98 A;  2YQ8 A;  3QWV A;  3IKO B;  1JWG A;  3L13 A;  3B7R L;  3CVQ A;  4B89 A;  1A17 A;  3Q4A B;  5LP0 A;  4AY6 A;  4DI4 A;  2JEK A;  5T8I A;  5AEN A;  5CHE E;  3L08 A;  3SNX A;  2OV8 A;  1H2T C;  4I43 A;  4G1T A;  4KT6 B;  4Q69 A;  3S7F A;  4WUY A;  4HVB A;  3QWW A;  3ASF A;  1ELK A;  3CSF A;  5HQ8 A;  3SD5 A;  5EDS A;  1TJF A;  3ZN3 A;  2X6I A;  1IQR A;  2PZI A;  2R17 C;  3QDN A;  3LY8 A;  4BT9 A;  1E90 A;  4XI0 A;  2XEV A;  4HLE A;  3TXN A;  3ZYL A;  2C0L A;  3Q15 A;  4Y6C A;  5JJ7 A;  4L2L A;  4A3V A;  2AXZ A;  3QAR A;  3U9W A;  4PS3 A;  1E96 B;  4NRH B;  2WXH A;  4I6E A;  4UWK A;  2RD0 A;  4U0U A;  4KVM A;  3AU5 A;  4AM9 A;  4PUC A;  2I9C A;  3ASD A;  3LEW A;  3ONL A;  2VSO E;  4P29 A;  3QOU A;  5JHB A;  2AWI A;  3HIZ A;  3ZGQ A;  4WWP A;  5T3R A;  3DPD A;  3SBS A;  3CKC A;  3MGB A;  1E8Y A;  2VGX B;  3D9M A;  4I9E A;  3CK9 A;  3CK8 A;  3CVN A;  1ZU2 A;  4FHK A;  4NQ0 A;  5LFA A;  4UQY A;  3LY9 A;  4EZJ A;  3PUK A;  4GYO A;  3CIA A;  4KZ0 A;  3TJP A;  5BV0 A;  2WXR A;  3E4B A;  4G24 A;  3CQC B;  4B8C B;  4APO A;  4IRU A;  3IHY A;  4N5C A;  1DNP A;  4N3A A;  5FQ8 A;  4BT8 A;  2A5U A;  2VSN A;  4A55 A;  2J49 A;  4PDX A;  3B7U X;  1QZ2 A;  4JC8 A;  1N54 A;  4OVV A;  5ARF A;  3R9A B;  3SBT B;  4K0R A;  2VTB A;  4GZ5 A;  4RSY A;  4WNG A;  5FQ4 A;  4W9R A;  5T4Y A;  3RU0 A;  3IEG A;  3HVE A;  3QB2 A;  4KMO A;  4Q96 A;  3L6A A;  4URK A;  1WAO 1;  1H6K A;  4CGV A;  2X38 A;  3EHM A;  3ESK A;  2MHK A;  3ESL A;  4XZ4 A;  3UMV A;  4ME2 A;  3CHR A;  2J4B A;  3U4T A;  4F1S A;  4EZK A;  2E2E A;  1UG3 A;  2PL2 A;  4I6G A;  3VTX A;  3R7Q A;  3B7S A;  4JHJ A;  4FJZ A;  5A6C A;  4GAA A;  3L16 A;  3UT7 A;  4AIF A;  3QKY A;  5BUZ A;  3MKR A;  2LSU A;  4LRZ A;  3FTX A;  3D9O A;  2DBA A;  3QK0 A;  4FUL A;  3N71 A;  3UT4 A;  4CT4 A;  2WXO A;  3UX4 A;  4BFR A;  4FP7 A;  5D0O D;  3CHP A;  3GZ2 A;  5HI7 A;  3ZPJ A;  4FJY A;  4EBA G;  5LCW J;  3CR3 A;  2KCV A;  2VSY A;  4UI9 C;  3SF4 A;  2HR2 A;  3CHM A;  3URZ A;  3CVW A;  4L23 A;  4HOR A;  4MKT A;  1NP7 A;  5FZR A;  2YHE A;  3APD A;  2WXK A;  1PY1 A;  3FUL A;  3MKQ A;  1HO8 A;  1SZ9 A;  3VLF A;  4HOT A;  3FDH A;  3RRU A;  4GA2 A;  4GYY A;  4CDN A;  3CST A;  2VGX A;  5G05 C;  1OWP A;  2X3M A;  3PH0 C;  4U0S A;  4ANV A;  3LJ3 A;  1HFA A;  2VJ8 A;  3BG1 B;  3ZYM A;  4EZL A;  3RO3 A;  5ENN A;  2WQ6 A;  4D10 C;  3Q47 B;  3T5V A;  4EEC A;  1HF8 A;  3LYA A;  4JA9 A;  3FU6 A;  4GA1 A;  4HFG A;  4O6F A;  2WXQ A;  1ELW A;  4CEM A;  3VLD A;  4DLO A;  2CFZ A;  3AS8 A;  4L7T A;  4MRU A;  4Q94 A;  4E6H A;  3FTV A;  3ZIM A;  1H2U A;  1MQS A;  4G26 A;  2C0M A;  2FF4 A;  2Q7F A;  2V4L A;  2NSZ A;  4C0E A;  1NA0 A;  5FJY A;  4AP2 A;  2XPI A;  3LY7 A;  3SHF A;  3FTY A;  3FUD A;  3MA5 A;  4I1O B;  3TAX A;  3LXU X;  3I4G A;  2KAT A;  2XGS A;  5G05 J;  5KJM A;  1L5J A;  4KBQ A;  4CGW A;  2KCL A;  3D9N A;  2VYI A;  4EPZ A;  3LCA A;  1EYH A;  3JYS A;  1E7U A;  2XCC A;  3LS8 A;  3TGO A;  1HE8 A;  2WXJ A;  2KCK A;  3AU4 A;  4EBA A;  3CKB A;  2FBN A;  1E7V A;  2LO6 A;  4XKB A;  5FZS A;  4Y6W A;  2EQX A;  2UWJ G;  2AVP A;  2WMO A;  2XRY A;  3ZYQ A;  3ZXS A;  3KEZ A;  4AEZ C;  4KXK B;  5C1D A;  4LCT A;  4NUR A;  2PQN A;  1UJJ A;  4U07 A;  3L22 A;  4WAF A;  1B89 A;  4AVX A;  1Z3X A;  4J8S A;  3EJN A;  3D9I A;  2BUG A;  4J8E A;  4BX9 A;  2Y3A A;  2PM7 A;  2R59 A;  2R5S A;  4PS7 A;  4GCO A;  1WY6 A;  2Y4T A;  2J09 A;  2IU1 A;  3FTW A;  3I4R B;  3MKQ B;  4AXH A;  3FH5 A;  1KT1 A;  3DBS A;  3FUE A;  3T5X A;  3OXL A;  3FHE A;  4QFV A;  3PNT B;  3K9I A;  1JWF A;  1EF1 C;  3CVX A;  5C2Y A;  4TUU A;  4UWL A;  4XI9 A;  4JPS A;  3CVV A;  4UI9 K;  3WXX A;  4BSX A;  4U63 A;  3ASH A;  4JA7 A;  4YND A;  3CLJ A;  2Y4U A;  4V3I A;  3FP3 A;  2DCP A;  4C9B B;  4DLQ A;  4GML A;  5M72 A;  3U66 A;  2VSX E;  1KLX A;  5AIJ A;  2LAI A;  4ATG A;  3MJW A;  1UN9 A;  2ZU6 B;  3I5P A;  2PQR A;  2X6J A;  3GW4 A;  3U3W A;  2BF0 X;  4UWG A;  2GRL A;  3FUK A;  2IFU A;  2OVF A;  3EIQ C;  4FLH A;  2XRZ A;  2HM8 A;  1UJK A;  4U0Z A;  1WM5 A;  5DBK A;  4C0M A;  1JUQ A;  3QAQ A;  4JXT A;  4G25 A;  4OYS A;  1S0P A;  4XE0 A;  2WQ7 A;  1E8W A;  3SFZ A;  3CQG B;  2GRM A;  2LNI A;  3CHS A;  5AJL A;  3ZEF A;  5ARG A;  3U64 A;  2ION A;  4LEU A;  3ZHE B;  4F3V A;  1MHQ A;  1H19 A;  1PAQ A;  2IJG X;  2LSV A;  1OWO A;  2J08 A;  4AY5 A;  4XKC A;  3B13 A;  4I1M A;  5JJ6 A;  1ELR A;  3PDN A;  5A23 A;  2MOW A;  2WXP A;  4ILH B;  4XIF A;  1IYG A;  4ANW A;  4A1S A;  1LF8 A;  4R7L A;  1EDU A;  3ASG A;  3ZW3 A;  3G2S A;  2YIN A;  3G2V A;  2I2O A;  4FAD A;  3FH8 A;  2WXG A;  3I3N A;  3GZ1 A;  4J0U A;  2OVB A;  4WWO A;  5FQ7 A;  4RG9 A;  4ANX A;  1HH8 A;  3FUI A;  5BNW A;  3MZL B;  5CCL A;  4N3C A;  1H0A A;  3ENE A;  1HG2 A;  3CK7 A;  2J9Q A;  4A3T A;  5ANL A;  3APF A;  3UT8 A;  3RJV A;  3JQ0 A;  3FU0 A;  3MCX A;  4BTA A;  3BEE A;  4B0Z A;  4I1A A;  3RRN B;  4I2W A;  4I17 A;  4GZC A;  1PC2 A;  2RG8 A;  2XHE A;  2IQC A;  3OAW A;  2IOS A;  2PM6 A;  1HX8 A;  1HS6 A;  4CRW A;  2LAH A;  3G2T A;  3T8M A;  3CV0 A;  3ONK A;  3CVY A;  3AS5 A;  2FI7 A;  5KJK A;  5CCM A;  2WVI A;  3L17 A;  2AW6 A;  4UI9 J;  4HS2 A;  4ILI A;  1TEZ A;  1SQM A;  4CDM A;  3ZRH A;  2L0I A;  5AYW D;  1Y6I A;  3VTY A;  1QQE A;  2J4D A;  3FEX A;  2DIW A;  3SI5 A;  5D0Q D;  4BX8 A;  4AJW A;  1E8X A;  3Q49 B;  3G2W A;  4GZD A;  4APF A;  1HU3 A;  1IQU A;  3CVL A;  3ZHE A;  4AOF A;  5BT1 A;  4N2Q A;  3RK6 A;  1Z3Y A;  3IBE A;  3TXM A;  5E76 A;  3NZU A;  3LPZ A;  2WXL A;  2IF4 A;  5LOZ A;  2CHW A;  2WXN A;  2WMN A;  2WXM A;  4JEU A;  4MLP A;  2L6J A;  2OOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...