2IU1A

Crystal structure of eif5 c-terminal domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
178
structure length
178
Chain Sequence
b'LERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EUKARYOTIC TRANSLATION INITIATION FACTOR 5
publication title The Crystal Structure of the Carboxy-Terminal Domain of Human Translation Initiation Factor Eif5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 70
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02020 W2 eIF4-gamma/eIF5/eIF2-epsilon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2iu1A00
2HM8A 1H2VC 2IOLA 2RG8A 1H2UA 3EIQC 3JUIA 1N52A 4JHKA 2IOSA 1H2TC 2KZTB 3EIJA 2VSOE 2KZTA 1PAQA 4C9BB 2IONA 1H6KA 2GGFA 2ZU6B 4IULA 4B89A 3D3MA 1N54A 2NSZA 2VSXE 3FEXA 5ANRA 3RK6A 4LUNU 4JHJA 2I2OA 2FULA 1UW4B 3FEYA 4B8AA 4B8CB 1UG3A 1HU3A 3L6AA 4CT4A 4GMLA 4CEMA 4GMJA 2IU1A 4CRWA
chains in the Genus database with same CATH superfamily
4GU5A 2C2LA 3IV0A 3O4ZA 1N94A 4V3IA 4XKBA 4HOQA 2VYIA 2V4HC 3Q9NC 2FEZA 2J09A 5T4YA 4UQZA 4BSXA 3TWTA 4NIKA 3DSVA 4B93B 3QWWA 5D0OD 3UXGA 4ACKA 4AOFA 2P9NG 4EZJA 5LCWC 5KJMA 1JCQA 3ABKE 2GRNB 2CFUA 4HLEA 2J08A 3RK6A 2XGOA 1GW6A 4GYYA 1K3ZD 4EQFA 1O1TA 1YYHA 3EDTB 2P9UG 5CEAA 4N2SA 3ZNGA 3IHVA 3F6QA 3IBEA 5EILA 3QWVA 2YNQA 4C48B 4UWHA 1U3CA 4JA9A 5KJKA 5BUZA 4CYMD 4C0EA 3UIOC 2F8YA 2DYSE 3TG4A 5CCLA 3KEAA 3ZUVB 5H7PA 3UUXA 4Q69A 2AVPA 3QOUA 3ASHA 4FA6A 5LFAA 2Y69E 3PREA 3CVUA 2A5UA 5ARFA 3B7BA 3ZHEA 2EIJE 2HE0A 2P9LG 4GTQA 3V31A 5J90A 2WXNA 2F0YA 3FTUA 3L6AA 5CMWA 4FC8A 4WWNA 1UJJA 3GZ2A 4LNBA 4B94A 4EECA 2IOSA 3LKUA 3HXFA 1E8XA 1OCRE 2VSXE 3PZ2A 2ETCA 3FTZA 3PUJA 3UIPC 2WVIA 3EU5A 4DX2A 3C3QA 3CIAA 2PM6A 4OVVA 4CRWA 1VDYA 5BT1A 4GCNA 4O6FA 4DUIA 3PVLA 4ILHB 2DBAA 4I1OB 5JJ7A 3ZYLA 3CVPA 1FVFA 2ZXWE 1RZ4A 5AJLA 1IHGA 2GRQB 2LSVA 3CKBA 3GZSA 3CHPA 2R17C 2XS1A 1OCCE 3UX4A 1DVPA 3ONKA 3B95A 4O1OA 2R59A 3G2TA 3JYSA 4BT8A 5AN8A 4AY5A 4LERA 4WUYA 3FH8A 3AG4E 3PZ4A 2QFCA 2I9CA 1HS6A 1N4QA 4Y6CA 2RG8A 5ENNA 5FZQA 5JHAA 2IO3C 3PRZA 3Q7AA 4JHJA 3L16A 4UWFA 2VTBB 3QARA 2EILE 2J07A 3CHQA 5AENA 5KJLA 2WXMA 2PNNA 2B6CA 1TEZA 5T8IA 1BPOA 2Y1LE 2X6HA 4APOA 2FI7A 4GZDA 5AJDA 2M63A 3ZIMA 1EPUA 3CGHA 5AQAA 3ZEFA 1HF8A 2WXIA 3S7DA 3LY7A 4DX6D 3RAUA 3Q9UC 1KPSB 4GCOA 3B7TA 3U4TA 5AIJA 1OWOA 3Q79A 1WG0A 3FEYA 2EQXA 1TNZA 1RW2A 3ZW3A 1UG3A 2PM7A 3SZ7A 4KT6B 3ZXSA 3HXDA 2ZGDA 2JEKA 4X8QA 2GRMA 3MKQB 4I43A 3MCXA 1OWPA 5D0QD 3DPYA 4OYSA 2EINE 3EHNA 2V8SE 3QWPA 1G3NB 3NAWA 4XZ4A 3KS2A 3ML8A 2WXJA 3SD5A 4U0SA 3U3WA 4GTPA 2BUGA 4J8YA 4UWKA 4U04A 2XEHA 2XPZA 3HVEB 1LF8A 2KCLA 3G2VA 4KVMA 1IHBA 4DX5D 3FU6A 4GMLA 2RKKA 1Z5SC 2DCPA 2Q7FA 2WQHA 2XRYA 1MZCA 5KNHD 3ZRHA 3I5PA 4AIFA 4FADA 3PE3A 3FEXA 3SFZA 1EF1C 1Y6IA 4EHMA 5KJNA 1NI1A 4RSYA 1IXVA 3EHMA 1S70B 1ELRA 5AQBA 5HKPA 4G25A 5BNWA 4JEHA 2XQ0A 4YVOA 5CHEE 1TNYA 1OXJA 4L23A 3D9OA 2CFZA 3TG5A 4WNEA 5CERB 4WAFA 3SGHA 3TWXA 3OXGA 3U9WA 3ZN3A 3V79K 1E8WA 4JEUA 2QC9A 4JHKA 1SVXA 4AY6A 2H6GA 4G1TA 2WQ7A 5BW8C 3S2AA 4U8YD 2AWIA 4I9CA 4JPSA 1IYGA 1LD8A 2X6KA 4CGWA 4J7WA 4CDRA 3P1UA 2YINA 2WQ6A 5FZSA 2FF4A 5IY5E 4GA1A 1TN8A 1LTXA 5HI7A 4GAAA 3ZHEB 2DZNA 2I2OA 3B7SA 2ETAA 4B8CB 5HQ8A 3URZA 4Q96A 3APDA 5FQ7A 3CVXA 3SO8A 2L6JA 4HOUA 3AS5A 5C2YA 2L9BA 4B89A 5LP0A 3R9AB 5BV0A 1E8ZA 2VTBA 4AVXA 1E7VA 2WXLA 3UM0A 1D8DA 3LCAA 4WNDA 3UMVA 2AJAA 1QQEA 2VSNA 1HE8A 4ANWA 5CEDB 4QFVA 4F3VA 1N4SA 5LX8A 4GPKA 4IN3B 4TUUA 2GROB 1OCZE 3ZFWA 3MV2B 1UN9A 4BX8A 1WY6A 2GRLA 1JPLA 1PAQA 3IKOB 4UI9J 2VQ2A 5FT9A 4FULA 4XX5A 3AU4A 2PQNA 1K1BA 3PUKA 3G2SA 3L82A 4J8SA 2WXKA 4I17A 2X6FA 3AS4A 4ILGA 1HFAA 3Q7FA 2QYUA 1OCOE 3BG0B 5ARGA 4HOSA 4DPRA 3RSEG 1NL4A 3E37A 3T8MA 1UW4B 1PY1A 4BESA 1OWLA 2EIKE 3ML9A 3BG1B 4KMOA 1Y8MA 3LVRE 3HXEA 3ULQA 3ASDA 4HVBA 3HVEA 1TN7A 3UT4A 3MKRA 4GYOA 3FFLA 3PNLB 5ANLA 2BEDA 4J8EA 3Q47B 3UQ3A 2H6IA 3HHMA 1H19A 4BEPA 2L6BA 5EX0A 3DEPA 4J8DA 4G26A 4J6IA 3SHFA 2XGMA 3FDHA 3NB2A 3LS8A 1K8KG 2VSYA 5BXUA 1JWFA 3EUVA 4APFA 5BXOA 3MGBA 4U0ZA 3CEQA 3B7RL 4U96D 2FO1E 3LJNA 2KZTA 3FTVA 5EX3A 2DVWA 3NQPA 4L1BA 3CSTA 4U0UA 4GTRA 3CVYA 5B1BE 5ENPD 2NXPA 3QJZA 2KC7A 3EIQC 4L2YA 1UOHA 2XENA 5G04C 4DI3A 4BX9A 2WXFA 5CRUA 1UJKA 2FULA 3RIBA 2KCVA 5JA4D 3EJNA 4DK5A 5BPPA 4CCAA 3CLJA 5EDSA 4HOTA 3PH0C 2LNIA 3CHSA 4HXIA 2OV8A 2ZGGA 4U95D 3G2UA 3CVVA 1IQRA 5ENRD 1H2TC 3PZ3A 4EZLA 2RD0A 1NZNA 3UTMA 2OOEA 3TAXA 3PS6A 2B0OE 4GTSA 3LYAA 1ZB1A 3QDNA 4OAVB 2EIME 2WPVA 3D9NA 3LJ3A 1A5EA 3MEKA 3V30A 4A1SA 4CZ2D 5KWDA 2AXZA 4CDMA 5ENSD 2L0IA 1H6PA 3WXXA 3TJPA 1O1RA 4F6RD 2R05A 1LD7A 4GTVA 2QY7A 3CVQA 5G55A 3FHEA 4O60A 4L2LA 3CHMA 4BY6A 1FT2A 2V5QC 1B89A 3P2BA 4HNAD 4DLQA 1D9SA 2XGSA 3Q4AB 4KXKB 4UUCA 4GZCA 4L7TA 1V54E 2XCCA 3U64A 3W9FA 2NYJA 4J8FA 4N2QA 3CSFA 4M7CA 3WG7E 4U07A 4BFRA 3DSWA 2WM9A 4C0MA 1FVHA 4J0UA 4MRUA 1H6KA 4I6EA 2NSZA 3RRMB 4KBQA 1K1AA 1QYMA 3D9KA 4MS6A 3PDNA 2BF0X 1QZ2A 2Y4UA 1AP7A 2H6HA 4PS3A 4JZYA 4GMJA 3KSLA 4I9EA 3DXMG 5JJTA 2JLBA 5C1DA 4GZ5A 5EKQD 3TWUA 3BU8A 3TXMA 4ZFHA 5CBNA 2ETBA 4FLBA 3BEEA 4TV3A 2UY1A 3VLDA 1SZAA 5A6CA 2AW6A 3JXJA 3DSSA 2IQCA 4AJWA 2BKKB 4UQXA 4K5BA 1SW6A 2CHXA 2HO1A 4GTMA 4GTOA 5ENTD 3FH5A 1U2VG 3PE4A 4EPZA 4IYPA 3NBNB 2KXPC 2A4ZA 5HS0A 4ATGA 1N11A 3E32A 4HRMB 4DX7D 3TWSA 3DSUA 1DC2A 4KZCA 3DRAA 3CVLA 5AQ7A 3ZU7B 4AP2A 1H0AA 4DJAA 3SFXA 3UT7A 3AU5A 4QQIA 5CMYA 4D10C 3HRAA 4F1SA 3MYVA 5ANRA 3PZ1A 1JCRA 2OVBA 4BT9A 2DZOA 4UWGA 3TWRA 2P9PG 2LXMA 1KZPA 3S7FA 1HO8A 3D9HA 4UWLA 4F1PA 2F37A 4N5CA 4JB8P 1HH8A 4KVOA 4B8AA 3T5XA 3ASOE 2A5EA 4YDOA 4N3BA 5E75A 3SF4A 3ZKJA 2KM4A 1FCHA 4G11A 5FQ8A 4UI9K 4E6HA 2KZTB 4CDNA 4H7YA 4G8LA 3UI2A 3OTNA 3FUJA 3O48A 1NA0A 4FJYA 3S7JA 1INZA 4FU3A 3CK8A 3R7QA 4O1PA 4I2WA 1U3DA 4JC8A 4G8KA 4MKTA 4G24A 4JA7A 3TXNA 1DCEA 3AG1E 2CHWA 4C9BB 4HB5A 2XS8A 4GZ3A 4TUMA 2J9QA 4U63A 3JUEA 4CGVA 3GYZA 3EHQA 3E34A 4RG9A 3JCKC 4GZ6A 3PEVB 2VSOE 2I1KA 2P58C 4EBAA 2R03A 3FUNA 5FINA 2PQRA 4K5CA 2XEVA 4M3OA 3MX3A 3FU5A 3RO3A 3ESKA 2XEEA 1HZ4A 4F53A 2OVFA 1BI7B 3ASGA 4OVUA 2ONDA 1P5QA 4H7XA 1KZOA 3C98A 4AM9A 4GTTA 2V5FA 4GPMA 3ULEG 5CRVA 1JWGA 4CEMA 3QC1A 4K03A 5LCWJ 1KT0A 1TJFA 4JD2G 5EYLA 3KSQA 3D9LA 2C0LA 3T9KA 1ZU2A 2IO2C 2OEVA 4N3CA 3DPDA 2CG2A 3NOGD 4WWOA 3E33A 1N95A 3ABME 3RRNB 5J08A 5T3RA 4YDEA 1PC2A 3APCA 3QAQA 4FHJA 3HYMB 2ZIRA 3LDZA 5FQ6A 2RFMA 3Q75A 2L0TB 4U8VD 4L9PA 5G04J 4LNGA 2JABA 3HG0D 4LEUA 2Y0BG 1XGWA 2ZISA 2WXOA 5G2NA 4A55A 2IFUA 4HI8A 2XHEA 1S64A 2J4BA 3JXIA 4HI9A 1IQUA 1HG2A 1YA0A 3L22A 5FTPA 3DXKG 1TYQG 3D9IA 3CQGB 3E30A 3NZUA 4I6JA 3EU9A 4JHRA 5G05C 4ILIA 3CK7A 5M72A 5DBKA 3VTXA 3QKYA 2ZU6B 5FQ4A 2X3MA 2DIWA 1DCQA 3FUKA 4HQDA 1EYHA 1OUVA 2KATA 2HR2A 2MRIA 3MA5A 1SZ9A 2UY1B 2UWJG 1OT8A 3LPZA 3L13A 4HLLA 1ZBPA 3Q5MA 3UINC 3VLEA 2XPIA 1N0RA 2YQ8A 3FTXA 2VGYA 4DRXE 1NP7A 3UM1A 3VTYA 5AYWD 3W9GA 4U7EB 3BUAA 3ZVVA 4HORA 2I1JA 2V0PA 1Z3XA 1N4RA 1MJ0A 3NOCD 2HM8A 4NRHB 4N5QA 3U66A 3APFA 3I4GA 2R2LA 1HX8A 1OY3D 3C3RA 3L08A 3D9MA 2X38A 5ENOD 3C72A 1SA5A 3AJIA 3KD7A 5LOZA 3DBSA 1V55E 1BI8B 4GYWA 4RQIA 2DWZA 3CR3A 5JJ6A 5EIBE 1NA3A 1ELKA 1TJCA 2J4DA 2V4LA 3Q73A 5HRYA 3ZPJA 2MHKA 3ISMC 3FUFA 2WMOA 2XZDG 5ENQD 2YHCA 4UI9C 4XI0A 1WM5A 3ESLA 4MBGA 3X2QE 2KBXA 4JL0A 1MX4A 2VJ8A 2GRPB 4DLOA 2ILRA 4A3VA 4Z68A 1YMPA 3OAWA 4LCTA 3PZDA 3Q78A 2J49A 5JHBA 4FHKA 4HRLA 1TNOA 1TNUA 4LUNU 4RG6A 2XRZA 4HBDA 3FY4A 2R5SA 2VGEA 4PS7A 4EBAG 5AARA 1MX2A 3UPVA 5DIZA 3N71A 1S63A 3ASNE 5ITZF 4TRQA 2LAIA 1SA4A 3DWLG 4ANUA 3L17A 2VGXB 3G2WA 3CVNA 3UKUG 4G2VA 1N4PA 3PNTB 2NC9A 2OCCE 3D9JA 2IJGX 2R02A 3ULYA 2GRRB 3OXFA 3R7RA 3T8KA 4DI4A 2I6HA 4YNDA 2CHZA 3ZYQA 1BU9A 4WNFA 4AEZC 3T5VA 4BWRA 4BSZB 3GW4A 4FP7A 2OEWA 3RRUA 4N3AA 3CV0A 4PH4B 3FH7A 2LO6A 4ZHBA 4K0RA 4FJZA 3TGOA 3TWVA 4PUCA 1AWCB 1BD8A 1X81A 4CT4A 2BTDA 4YDWA 3UM3A 2PZIA 4LRZA 1MHQA 4RVBA 1E7UA 3IEGA 5BV1A 3CVWA 1MQSA 1YCSB 2H6FA 4XE0A 3JQ0A 3LY8A 4HFGA 3SI5A 3FTYA 4W9RA 4URKA 4UQYA 2XPYA 3J5PA 3C3OA 2C0MA 4LNUD 3UM2A 4JW1A 4A63B 2MOWA 5EYPF 4K5AB 4HS2A 4I1MA 5A7DB 1D8EA 3ASFA 2YHEA 2AXUA 5AAOA 4P29A 3UT8A 2XCBA 3DSXA 3TL5A 1H2VC 4GB9A 3KAEA 4OAUC 3HIZA 4E85A 4G23A 2LXLA 3GZ1A 3CQCB 1JCSA 1JUQA 2WMNA 3FWVA 4NQ0A 1XNFA 2X6JA 2IU1A 1TR4A 3AG2E 1O1SA 1HXIA 4IRUA 3PEUB 1QNFA 4Q94A 5B3SE 4GA0A 3LY9A 3LEWA 1IKND 1NFIE 3SNXA 3RU0A 3HXBA 3OXLA 1BLXB 3SY2A 1H2UA 2WXQA 3FU0A 5EIDA 3LVQE 4R7LA 2IF4A 5A23A 4BTAA 4ME2A 2GW1A 1ELWA 1Q2ZA 5KCMA 2FO7A 3NF1A 4NURA 1O5MA 3QB2A 5B1AE 3ZGQA 3QK0A 2KCKA 4WWPA 2BKGA 3MJWA 2P2CP 3K9IA 4PDXA 3EIJA 2WXGA 1E8YA 4XIFA 3FP3A 4A3TA 2IEJA 4GA2A 3JQ1A 5FJYA 1X5BA 2CG3A 4I6GA 4RLYA 3UKRG 1HU3A 5KNGA 3SBSA 3IXEA 3CHOA 4Y6WA 5EN5D 1N0QA 3JUIA 3RO2A 4I1AA 4CT0A 3ONLA 4F7AA 4FLHA 3AS8A 2WXPA 4JXTA 3SQVA 1Z3YA 2J8SD 2LSUA 1A17A 5D66A 5CECB 2VGXA 4ATZD 3FUEA 3TWQA 2LUHA 1HG5A 3RJVA 4ANXA 2Y3AA 4XI9A 4YVQC 3D9PA 5AQ9A 3CK9A 5G05J 3I3NA 1H6OA 1TN6A 3FUDA 3Q15A 3MV3B 2P9SG 4EZKA 3AG3E 3IHYA 4ACLA 3C5RA 3AAAC 3I4RB 2MYOA 3V2XA 4N39A 5E76A 3DSTA 3J5QB 3FUMA 2QZAA 5FZRA 3KEZA 4MLPA 5FWQA 3VLFA 4XKCA 3QNKA 3MZLB 2IONA 1QBQA 3CKCA 4ANVA 3L54A 3CHRA 4TXRA 3ZYKA 1TNBA 3FUIA 4YDYA 2QYJA 3ZYMA 5FIOA 2XZTG 2P9KG 4BTBA 2WXHA 5KBAA 2RFAA 3Q49B 4LG6A 1EDUA 3FTSA 2E2EA 3DEOA 2GGFA 1FT1A 1SQMA 3D3MA 1KT1A 1N54A 1L5JA 2IY0C 1FPPA 3R9MA 3NZSA 5CCMA 3HDXA 3FU3A 3E4BA 3BQOA 2WXRA 3S7BA 4NACA 2F8XK 1W3BA 4TXQA 3ABLE 1UN8A 3FULA 4KYOB 3TWWA 4IULA 3EHRA 4HRNA 3RKVA 1OWNA 4B0ZA 2HYZA 3ENEA 1MYOA 1MX6A 1Z6TA 3SFYA 3SBTB 5CBOA 2LAHA 2E0IA 4WNGA 1WAO1 4DX1A 4U8HA 3V2OA 4KZ0A 4JVSA 1N9AA 2DYRE 1N52A 3B7UX 5D2MC 4TXPA 3HXCA 4BERA 2Y4TA 4I2ZA 3ZXPA 1KLXA 1OWMA 2PL2A 4BETA 2X6IA 3FTWA 1E96B 2FBNA 3L9TA 3MKQA 1WDYA 2IOLA 4A1GA 3FUHA 4LSZE 1DNPA 4XEIG 4AXHA 3B13A 2AXVA 3LXUX 2WB2A 4PS8A 2P9IG 1E90A 4GMRA 5JMND 1S0PA 4ABNA 4AV7A
chains in the Genus database with same CATH topology
2FF4A 4GA1A 4GU5A 5HI7A 4GAAA 4TRQA 2C2LA 4KZCA 2LAIA 4ANUA 3L17A 3IV0A 3ZHEB 3CVLA 3O4ZA 2I2OA 4V3IA 3B7SA 2VGXB 3G2WA 4AP2A 3CVNA 4B8CB 1H0AA 4DJAA 4XKBA 4G2VA 5HQ8A 3UT7A 4HOQA 3URZA 2VYIA 3PNTB 3AU5A 4Q96A 3APDA 5FQ7A 2FEZA 5CMYA 2J09A 5T4YA 3CVXA 4UQZA 4BSXA 2NC9A 2L6JA 4HOUA 4D10C 3AS5A 3QWWA 5C2YA 3D9JA 2IJGX 5D0OD 2L9BA 4B89A 4F1SA 3MYVA 5ANRA 3OXFA 5LP0A 3R9AB 3R7RA 4ACKA 4DI4A 2I6HA 4YNDA 2CHZA 3ZYQA 4AOFA 5BV0A 4WNFA 4AEZC 2OVBA 3T5VA 4BT9A 1E8ZA 2VTBA 4EZJA 4UWGA 5LCWC 4AVXA 1E7VA 2WXLA 4BWRA 5KJMA 3GW4A 4FP7A 3LCAA 4WNDA 3S7FA 3UMVA 1HO8A 3RRUA 2CFUA 3CV0A 1QQEA 4N3AA 4PH4B 3FH7A 4UWLA 2VSNA 4HLEA 2J08A 1HE8A 3RK6A 2XGOA 4N5CA 1GW6A 1HH8A 2LO6A 4GYYA 4K0RA 4ANWA 4FJZA 4KVOA 4EQFA 4B8AA 3T5XA 4QFVA 3TGOA 4PUCA 4F3VA 5LX8A 4GPKA 4CT4A 4IN3B 3EDTB 4N3BA 2BTDA 5E75A 3SF4A 4N2SA 3IHVA 4TUUA 2KM4A 1FCHA 3IBEA 4G11A 2PZIA 4LRZA 5FQ8A 3MV2B 3ZFWA 1UN9A 1MHQA 3QWVA 4UI9K 4BX8A 2YNQA 4E6HA 4RVBA 2KZTB 1WY6A 4UWHA 2GRLA 4H7YA 4CDNA 5DIZA 3OTNA 1JPLA 1PAQA 1U3CA 3FUJA 3O48A 3IKOB 1NA0A 1E7UA 4FJYA 3IEGA 4UI9J 3S7JA 2VQ2A 1INZA 5FT9A 5BV1A 4JA9A 4FULA 4XX5A 5KJKA 3CVWA 5BUZA 4FU3A 3AU4A 1MQSA 2PQNA 3CK8A 4XE0A 3PUKA 4C0EA 3G2SA 4J8SA 3R7QA 3JQ0A 3LY8A 4HFGA 2WXKA 3TG4A 4I2WA 4I17A 5CCLA 2X6FA 3SI5A 3AS4A 3FTYA 1U3DA 4JC8A 4ILGA 4W9RA 1HFAA 4URKA 4UQYA 3UUXA 4Q69A 2AVPA 2XPYA 3QOUA 4MKTA 3BG0B 4G24A 5ARGA 4JA7A 3ASHA 4FA6A 3TXNA 2C0MA 5LFAA 4HOSA 3PREA 3CVUA 2CHWA 4DPRA 4C9BB 4JW1A 2A5UA 5ARFA 2MOWA 3ZHEA 4GZ3A 4HS2A 3T8MA 2J9QA 1UW4B 4U63A 1PY1A 4I1MA 4CGVA 1OWLA 5A7DB 5J90A 2WXNA 3ASFA 2YHEA 3GYZA 3FTUA 3L6AA 2AXUA 3ML9A 3BG1B 5CMWA 4FC8A 4KMOA 4P29A 1Y8MA 3UT8A 2XCBA 3LVRE 3TL5A 4WWNA 4RG9A 1H2VC 1UJJA 4GB9A 3GZ2A 3JCKC 3KAEA 3ASDA 3ULQA 4B94A 4GZ6A 3HVEA 4EECA 2IOSA 3PEVB 4HVBA 3LKUA 2VSOE 2I1KA 3HIZA 4E85A 3UT4A 4G23A 2P58C 3MKRA 4EBAA 1E8XA 2VSXE 4GYOA 3FTZA 3PUJA 3FFLA 3GZ1A 2WVIA 3FUNA 3PNLB 4J8EA 5ANLA 3Q47B 3UQ3A 3CQCB 2PQRA 2XEVA 4M3OA 1JUQA 3CIAA 2WMNA 2PM6A 3FWVA 4NQ0A 3HHMA 1H19A 1XNFA 3MX3A 4OVVA 2X6JA 2IU1A 4CRWA 1VDYA 5EX0A 3FU5A 4J8DA 3RO3A 4G26A 3ESKA 1HXIA 4IRUA 3PEUB 4J6IA 3SHFA 5BT1A 1QNFA 4GCNA 2XGMA 3FDHA 4O6FA 3PVLA 1HZ4A 4Q94A 4ILHB 4F53A 2OVFA 3ASGA 4OVUA 2ONDA 3LS8A 1P5QA 4GA0A 4H7XA 2DBAA 4I1OB 5JJ7A 3LY9A 2VSYA 3ZYLA 3C98A 4AM9A 3CVPA 1FVFA 1JWFA 3LEWA 2V5FA 5AJLA 4APFA 3SNXA 3MGBA 1IHGA 1JWGA 4U0ZA 3QC1A 3RU0A 4CEMA 3CEQA 4K03A 2LSVA 3CKBA 3GZSA 5LCWJ 1KT0A 1TJFA 3OXLA 3CHPA 3B7RL 1H2UA 2R17C 2WXQA 3FU0A 3UX4A 1DVPA 2KZTA 3LVQE 3FTVA 4R7LA 3ONKA 2IF4A 3D9LA 2C0LA 5EX3A 5A23A 4BTAA 1ZU2A 2R59A 4ME2A 3G2TA 3JYSA 4BT8A 2GW1A 1ELWA 3NQPA 4N3CA 2FO7A 3DPDA 3NF1A 4L1BA 3CSTA 4NURA 4LERA 4U0UA 5KCMA 4AY5A 2CG2A 3QB2A 3CVYA 4WUYA 3ZGQA 3QK0A 3FH8A 4WWOA 2QFCA 2I9CA 1HS6A 4Y6CA 3RRNB 5J08A 2KCKA 5T3RA 4WWPA 1PC2A 3APCA 3QAQA 2NXPA 3MJWA 4FHJA 3HYMB 3QJZA 2KC7A 2RG8A 3EIQC 4L2YA 3K9IA 3LDZA 4PDXA 5ENNA 3EIJA 5FQ6A 5FZQA 2WXGA 5G04C 4DI3A 4BX9A 1E8YA 5JHAA 4XIFA 2WXFA 3FP3A 2L0TB 5G04J 4A3TA 3PRZA 4GA2A 1UJKA 4JHJA 3JQ1A 2FULA 3L16A 4UWFA 2VTBB 4LEUA 5FJYA 1X5BA 2CG3A 1XGWA 4I6GA 3RIBA 1HU3A 2WXOA 3QARA 5G2NA 3SBSA 4A55A 2J07A 2IFUA 3CHOA 4Y6WA 3CHQA 2KCVA 2XHEA 5AENA 5KJLA 3JUIA 2WXMA 2J4BA 3RO2A 3EJNA 1IQUA 4I1AA 4DK5A 1HG2A 4CT0A 3ONLA 4F7AA 5BPPA 1YA0A 3L22A 4FLHA 3AS8A 2WXPA 4JXTA 4CCAA 5FTPA 1TEZA 5T8IA 1BPOA 3CLJA 1Z3YA 5EDSA 2LSUA 2X6HA 1A17A 4HOTA 4APOA 3D9IA 3PH0C 2FI7A 3CQGB 2LNIA 2VGXA 2M63A 3CHSA 4GZDA 4HXIA 3NZUA 3FUEA 5AJDA 4I6JA 2OV8A 3ZIMA 1HG5A 3RJVA 4ANXA 1EPUA 2Y3AA 3CGHA 1HF8A 3ZEFA 2WXIA 3S7DA 3LY7A 4JHRA 5G05C 4ILIA 3CK7A 4XI9A 4YVQC 5M72A 3D9PA 3G2UA 3CVVA 1IQRA 5DBKA 1H2TC 3CK9A 5G05J 4EZLA 2RD0A 4GCOA 3VTXA 3QKYA 1NZNA 3B7TA 2OOEA 2ZU6B 3I3NA 3FUDA 3U4TA 3TAXA 3Q15A 3MV3B 3PS6A 5FQ4A 5AIJA 2X3MA 1OWOA 3LYAA 2DIWA 3FUKA 1EYHA 1OUVA 3QDNA 4EZKA 2KATA 2HR2A 2MRIA 3FEYA 3MA5A 2EQXA 3ZW3A 2WPVA 1UG3A 3D9NA 3IHYA 1SZ9A 3LJ3A 2PM7A 3MEKA 4ACLA 4A1SA 3SZ7A 4KT6B 2AXZA 3I4RB 2UY1B 2UWJG 3ZXSA 4N39A 4CDMA 5E76A 3LPZA 2JEKA 3FUMA 2GRMA 3L13A 3MKQB 1ZBPA 5FZRA 3Q5MA 2L0IA 3WXXA 4I43A 3VLEA 3KEZA 3MCXA 1OWPA 2XPIA 4MLPA 5FWQA 3TJPA 3VLFA 4XKCA 3QNKA 5D0QD 3MZLB 2IONA 4OYSA 3EHNA 2V8SE 2YQ8A 3FTXA 3QWPA 2VGYA 2QY7A 3CVQA 5G55A 3CKCA 3FHEA 4L2LA 1NP7A 4ANVA 4XZ4A 3KS2A 3VTYA 3ML8A 2WXJA 3CHMA 3L54A 4BY6A 3CHRA 3SD5A 4U0SA 5AYWD 3ZYKA 3U3WA 1B89A 2BUGA 3ZVVA 4HORA 4UWKA 3FUIA 3P2BA 2I1JA 4DLQA 2V0PA 1Z3XA 3ZYMA 4U04A 2XGSA 2HM8A 3Q4AB 2XPZA 3HVEB 4NRHB 4BTBA 4KXKB 2WXHA 3Q49B 3U66A 1EDUA 1LF8A 3FTSA 2E2EA 2KCLA 3APFA 4GZCA 3I4GA 3G2VA 2GGFA 4L7TA 1HX8A 1SQMA 2XCCA 3D3MA 3U64A 1KT1A 1N54A 4J8FA 4KVMA 4N2QA 1L5JA 3L08A 3D9MA 3NZSA 5CCMA 3HDXA 3FU3A 2X38A 3E4BA 3FU6A 3CSFA 2WXRA 3S7BA 4NACA 4U07A 4GMLA 1W3BA 2DCPA 2Q7FA 4BFRA 2WQHA 2XRYA 1UN8A 3KD7A 3FULA 3ZRHA 3I5PA 2WM9A 4C0MA 4KYOB 5LOZA 1FVHA 4AIFA 3DBSA 4J0UA 4MRUA 1H6KA 4FADA 4IULA 3PE3A 4I6EA 3RKVA 1OWNA 2NSZA 4B0ZA 3FEXA 3SFZA 2HYZA 1EF1C 3RRMB 1Y6IA 3ENEA 4GYWA 4KBQA 5KJNA 1Z6TA 3CR3A 5JJ6A 3SBTB 3D9KA 2LAHA 4MS6A 1NA3A 2E0IA 4WNGA 1ELKA 1TJCA 4RSYA 1WAO1 3EHMA 2J4DA 2BF0X 1QZ2A 2V4LA 2Y4UA 3PDNA 4JVSA 4KZ0A 4PS3A 4U8HA 2MHKA 3ZPJA 1ELRA 4JZYA 4GMJA 3FUFA 4I9EA 2WMOA 2YHCA 5JJTA 4G25A 2JLBA 4UI9C 4XI0A 5BNWA 1N52A 5C1DA 4JEHA 2XQ0A 3B7UX 4YVOA 4GZ5A 1WM5A 5EKQD 3ESLA 5CHEE 2Y4TA 4L23A 3D9OA 2CFZA 3TG5A 3TXMA 4JL0A 4WNEA 4I2ZA 2VJ8A 4WAFA 4FLBA 3SGHA 1KLXA 1OWMA 3BEEA 3ZN3A 3OXGA 3U9WA 4DLOA 2PL2A 1E8WA 4JEUA 4TV3A 2X6IA 2UY1A 3FTWA 3VLDA 1SZAA 1E96B 2ILRA 4A3VA 5A6CA 2FBNA 3MKQA 2AW6A 2IOLA 4A1GA 3OAWA 4JHKA 4LCTA 4AY6A 2IQCA 3PZDA 4AJWA 3FUHA 4G1TA 1DNPA 2J49A 4UQXA 5JHBA 4AXHA 4FHKA 2CHXA 2HO1A 3B13A 2WQ7A 4LUNU 5BW8C 3S2AA 2AXVA 3LXUX 4RG6A 2WB2A 2AWIA 4I9CA 4JPSA 3FH5A 2XRZA 1IYGA 3PE4A 3FY4A 4PS8A 2R5SA 1E90A 4EPZA 2X6KA 4CGWA 4CDRA 4IYPA 1S0PA 4PS7A 3P1UA 4EBAG 3UPVA 2A4ZA 4AV7A 4ABNA 3N71A 2YINA 2WQ6A 4ATGA 5FZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HM8 A;  1H2V C;  2IOL A;  2RG8 A;  1H2U A;  3EIQ C;  3JUI A;  1N52 A;  4JHK A;  2IOS A;  1H2T C;  2KZT B;  3EIJ A;  2VSO E;  2KZT A;  1PAQ A;  4C9B B;  2ION A;  1H6K A;  2GGF A;  2ZU6 B;  4IUL A;  4B89 A;  3D3M A;  1N54 A;  2NSZ A;  2VSX E;  3FEX A;  5ANR A;  3RK6 A;  4LUN U;  4JHJ A;  2I2O A;  2FUL A;  1UW4 B;  3FEY A;  4B8A A;  4B8C B;  1UG3 A;  1HU3 A;  3L6A A;  4CT4 A;  4GML A;  4CEM A;  4GMJ A;  2IU1 A;  4CRW A; 
#chains in the Genus database with same CATH topology
 4GU5 A;  2C2L A;  3IV0 A;  3O4Z A;  1N94 A;  4V3I A;  4XKB A;  4HOQ A;  2VYI A;  2V4H C;  3Q9N C;  2FEZ A;  2J09 A;  5T4Y A;  4UQZ A;  4BSX A;  3TWT A;  4NIK A;  3DSV A;  4B93 B;  3QWW A;  5D0O D;  3UXG A;  4ACK A;  4AOF A;  2P9N G;  4EZJ A;  5LCW C;  5KJM A;  1JCQ A;  3ABK E;  2GRN B;  2CFU A;  4HLE A;  2J08 A;  3RK6 A;  2XGO A;  1GW6 A;  4GYY A;  1K3Z D;  4EQF A;  1O1T A;  1YYH A;  3EDT B;  2P9U G;  5CEA A;  4N2S A;  3ZNG A;  3IHV A;  3F6Q A;  3IBE A;  5EIL A;  3QWV A;  2YNQ A;  4C48 B;  4UWH A;  1U3C A;  4JA9 A;  5KJK A;  5BUZ A;  4CYM D;  4C0E A;  3UIO C;  2F8Y A;  2DYS E;  3TG4 A;  5CCL A;  3KEA A;  3ZUV B;  5H7P A;  3UUX A;  4Q69 A;  2AVP A;  3QOU A;  3ASH A;  4FA6 A;  5LFA A;  2Y69 E;  3PRE A;  3CVU A;  2A5U A;  5ARF A;  3B7B A;  3ZHE A;  2EIJ E;  2HE0 A;  2P9L G;  4GTQ A;  3V31 A;  5J90 A;  2WXN A;  2F0Y A;  3FTU A;  3L6A A;  5CMW A;  4FC8 A;  4WWN A;  1UJJ A;  3GZ2 A;  4LNB A;  4B94 A;  4EEC A;  2IOS A;  3LKU A;  3HXF A;  1E8X A;  1OCR E;  2VSX E;  3PZ2 A;  2ETC A;  3FTZ A;  3PUJ A;  3UIP C;  2WVI A;  3EU5 A;  4DX2 A;  3C3Q A;  3CIA A;  2PM6 A;  4OVV A;  4CRW A;  1VDY A;  5BT1 A;  4GCN A;  4O6F A;  4DUI A;  3PVL A;  4ILH B;  2DBA A;  4I1O B;  5JJ7 A;  3ZYL A;  3CVP A;  1FVF A;  2ZXW E;  1RZ4 A;  5AJL A;  1IHG A;  2GRQ B;  2LSV A;  3CKB A;  3GZS A;  3CHP A;  2R17 C;  2XS1 A;  1OCC E;  3UX4 A;  1DVP A;  3ONK A;  3B95 A;  4O1O A;  2R59 A;  3G2T A;  3JYS A;  4BT8 A;  5AN8 A;  4AY5 A;  4LER A;  4WUY A;  3FH8 A;  3AG4 E;  3PZ4 A;  2QFC A;  2I9C A;  1HS6 A;  1N4Q A;  4Y6C A;  2RG8 A;  5ENN A;  5FZQ A;  5JHA A;  2IO3 C;  3PRZ A;  3Q7A A;  4JHJ A;  3L16 A;  4UWF A;  2VTB B;  3QAR A;  2EIL E;  2J07 A;  3CHQ A;  5AEN A;  5KJL A;  2WXM A;  2PNN A;  2B6C A;  1TEZ A;  5T8I A;  1BPO A;  2Y1L E;  2X6H A;  4APO A;  2FI7 A;  4GZD A;  5AJD A;  2M63 A;  3ZIM A;  1EPU A;  3CGH A;  5AQA A;  3ZEF A;  1HF8 A;  2WXI A;  3S7D A;  3LY7 A;  4DX6 D;  3RAU A;  3Q9U C;  1KPS B;  4GCO A;  3B7T A;  3U4T A;  5AIJ A;  1OWO A;  3Q79 A;  1WG0 A;  3FEY A;  2EQX A;  1TNZ A;  1RW2 A;  3ZW3 A;  1UG3 A;  2PM7 A;  3SZ7 A;  4KT6 B;  3ZXS A;  3HXD A;  2ZGD A;  2JEK A;  4X8Q A;  2GRM A;  3MKQ B;  4I43 A;  3MCX A;  1OWP A;  5D0Q D;  3DPY A;  4OYS A;  2EIN E;  3EHN A;  2V8S E;  3QWP A;  1G3N B;  3NAW A;  4XZ4 A;  3KS2 A;  3ML8 A;  2WXJ A;  3SD5 A;  4U0S A;  3U3W A;  4GTP A;  2BUG A;  4J8Y A;  4UWK A;  4U04 A;  2XEH A;  2XPZ A;  3HVE B;  1LF8 A;  2KCL A;  3G2V A;  4KVM A;  1IHB A;  4DX5 D;  3FU6 A;  4GML A;  2RKK A;  1Z5S C;  2DCP A;  2Q7F A;  2WQH A;  2XRY A;  1MZC A;  5KNH D;  3ZRH A;  3I5P A;  4AIF A;  4FAD A;  3PE3 A;  3FEX A;  3SFZ A;  1EF1 C;  1Y6I A;  4EHM A;  5KJN A;  1NI1 A;  4RSY A;  1IXV A;  3EHM A;  1S70 B;  1ELR A;  5AQB A;  5HKP A;  4G25 A;  5BNW A;  4JEH A;  2XQ0 A;  4YVO A;  5CHE E;  1TNY A;  1OXJ A;  4L23 A;  3D9O A;  2CFZ A;  3TG5 A;  4WNE A;  5CER B;  4WAF A;  3SGH A;  3TWX A;  3OXG A;  3U9W A;  3ZN3 A;  3V79 K;  1E8W A;  4JEU A;  2QC9 A;  4JHK A;  1SVX A;  4AY6 A;  2H6G A;  4G1T A;  2WQ7 A;  5BW8 C;  3S2A A;  4U8Y D;  2AWI A;  4I9C A;  4JPS A;  1IYG A;  1LD8 A;  2X6K A;  4CGW A;  4J7W A;  4CDR A;  3P1U A;  2YIN A;  2WQ6 A;  5FZS A;  2FF4 A;  5IY5 E;  4GA1 A;  1TN8 A;  1LTX A;  5HI7 A;  4GAA A;  3ZHE B;  2DZN A;  2I2O A;  3B7S A;  2ETA A;  4B8C B;  5HQ8 A;  3URZ A;  4Q96 A;  3APD A;  5FQ7 A;  3CVX A;  3SO8 A;  2L6J A;  4HOU A;  3AS5 A;  5C2Y A;  2L9B A;  4B89 A;  5LP0 A;  3R9A B;  5BV0 A;  1E8Z A;  2VTB A;  4AVX A;  1E7V A;  2WXL A;  3UM0 A;  1D8D A;  3LCA A;  4WND A;  3UMV A;  2AJA A;  1QQE A;  2VSN A;  1HE8 A;  4ANW A;  5CED B;  4QFV A;  4F3V A;  1N4S A;  5LX8 A;  4GPK A;  4IN3 B;  4TUU A;  2GRO B;  1OCZ E;  3ZFW A;  3MV2 B;  1UN9 A;  4BX8 A;  1WY6 A;  2GRL A;  1JPL A;  1PAQ A;  3IKO B;  4UI9 J;  2VQ2 A;  5FT9 A;  4FUL A;  4XX5 A;  3AU4 A;  2PQN A;  1K1B A;  3PUK A;  3G2S A;  3L82 A;  4J8S A;  2WXK A;  4I17 A;  2X6F A;  3AS4 A;  4ILG A;  1HFA A;  3Q7F A;  2QYU A;  1OCO E;  3BG0 B;  5ARG A;  4HOS A;  4DPR A;  3RSE G;  1NL4 A;  3E37 A;  3T8M A;  1UW4 B;  1PY1 A;  4BES A;  1OWL A;  2EIK E;  3ML9 A;  3BG1 B;  4KMO A;  1Y8M A;  3LVR E;  3HXE A;  3ULQ A;  3ASD A;  4HVB A;  3HVE A;  1TN7 A;  3UT4 A;  3MKR A;  4GYO A;  3FFL A;  3PNL B;  5ANL A;  2BED A;  4J8E A;  3Q47 B;  3UQ3 A;  2H6I A;  3HHM A;  1H19 A;  4BEP A;  2L6B A;  5EX0 A;  3DEP A;  4J8D A;  4G26 A;  4J6I A;  3SHF A;  2XGM A;  3FDH A;  3NB2 A;  3LS8 A;  1K8K G;  2VSY A;  5BXU A;  1JWF A;  3EUV A;  4APF A;  5BXO A;  3MGB A;  4U0Z A;  3CEQ A;  3B7R L;  4U96 D;  2FO1 E;  3LJN A;  2KZT A;  3FTV A;  5EX3 A;  2DVW A;  3NQP A;  4L1B A;  3CST A;  4U0U A;  4GTR A;  3CVY A;  5B1B E;  5ENP D;  2NXP A;  3QJZ A;  2KC7 A;  3EIQ C;  4L2Y A;  1UOH A;  2XEN A;  5G04 C;  4DI3 A;  4BX9 A;  2WXF A;  5CRU A;  1UJK A;  2FUL A;  3RIB A;  2KCV A;  5JA4 D;  3EJN A;  4DK5 A;  5BPP A;  4CCA A;  3CLJ A;  5EDS A;  4HOT A;  3PH0 C;  2LNI A;  3CHS A;  4HXI A;  2OV8 A;  2ZGG A;  4U95 D;  3G2U A;  3CVV A;  1IQR A;  5ENR D;  1H2T C;  3PZ3 A;  4EZL A;  2RD0 A;  1NZN A;  3UTM A;  2OOE A;  3TAX A;  3PS6 A;  2B0O E;  4GTS A;  3LYA A;  1ZB1 A;  3QDN A;  4OAV B;  2EIM E;  2WPV A;  3D9N A;  3LJ3 A;  1A5E A;  3MEK A;  3V30 A;  4A1S A;  4CZ2 D;  5KWD A;  2AXZ A;  4CDM A;  5ENS D;  2L0I A;  1H6P A;  3WXX A;  3TJP A;  1O1R A;  4F6R D;  2R05 A;  1LD7 A;  4GTV A;  2QY7 A;  3CVQ A;  5G55 A;  3FHE A;  4O60 A;  4L2L A;  3CHM A;  4BY6 A;  1FT2 A;  2V5Q C;  1B89 A;  3P2B A;  4HNA D;  4DLQ A;  1D9S A;  2XGS A;  3Q4A B;  4KXK B;  4UUC A;  4GZC A;  4L7T A;  1V54 E;  2XCC A;  3U64 A;  3W9F A;  2NYJ A;  4J8F A;  4N2Q A;  3CSF A;  4M7C A;  3WG7 E;  4U07 A;  4BFR A;  3DSW A;  2WM9 A;  4C0M A;  1FVH A;  4J0U A;  4MRU A;  1H6K A;  4I6E A;  2NSZ A;  3RRM B;  4KBQ A;  1K1A A;  1QYM A;  3D9K A;  4MS6 A;  3PDN A;  2BF0 X;  1QZ2 A;  2Y4U A;  1AP7 A;  2H6H A;  4PS3 A;  4JZY A;  4GMJ A;  3KSL A;  4I9E A;  3DXM G;  5JJT A;  2JLB A;  5C1D A;  4GZ5 A;  5EKQ D;  3TWU A;  3BU8 A;  3TXM A;  4ZFH A;  5CBN A;  2ETB A;  4FLB A;  3BEE A;  4TV3 A;  2UY1 A;  3VLD A;  1SZA A;  5A6C A;  2AW6 A;  3JXJ A;  3DSS A;  2IQC A;  4AJW A;  2BKK B;  4UQX A;  4K5B A;  1SW6 A;  2CHX A;  2HO1 A;  4GTM A;  4GTO A;  5ENT D;  3FH5 A;  1U2V G;  3PE4 A;  4EPZ A;  4IYP A;  3NBN B;  2KXP C;  2A4Z A;  5HS0 A;  4ATG A;  1N11 A;  3E32 A;  4HRM B;  4DX7 D;  3TWS A;  3DSU A;  1DC2 A;  4KZC A;  3DRA A;  3CVL A;  5AQ7 A;  3ZU7 B;  4AP2 A;  1H0A A;  4DJA A;  3SFX A;  3UT7 A;  3AU5 A;  4QQI A;  5CMY A;  4D10 C;  3HRA A;  4F1S A;  3MYV A;  5ANR A;  3PZ1 A;  1JCR A;  2OVB A;  4BT9 A;  2DZO A;  4UWG A;  3TWR A;  2P9P G;  2LXM A;  1KZP A;  3S7F A;  1HO8 A;  3D9H A;  4UWL A;  4F1P A;  2F37 A;  4N5C A;  4JB8 P;  1HH8 A;  4KVO A;  4B8A A;  3T5X A;  3ASO E;  2A5E A;  4YDO A;  4N3B A;  5E75 A;  3SF4 A;  3ZKJ A;  2KM4 A;  1FCH A;  4G11 A;  5FQ8 A;  4UI9 K;  4E6H A;  2KZT B;  4CDN A;  4H7Y A;  4G8L A;  3UI2 A;  3OTN A;  3FUJ A;  3O48 A;  1NA0 A;  4FJY A;  3S7J A;  1INZ A;  4FU3 A;  3CK8 A;  3R7Q A;  4O1P A;  4I2W A;  1U3D A;  4JC8 A;  4G8K A;  4MKT A;  4G24 A;  4JA7 A;  3TXN A;  1DCE A;  3AG1 E;  2CHW A;  4C9B B;  4HB5 A;  2XS8 A;  4GZ3 A;  4TUM A;  2J9Q A;  4U63 A;  3JUE A;  4CGV A;  3GYZ A;  3EHQ A;  3E34 A;  4RG9 A;  3JCK C;  4GZ6 A;  3PEV B;  2VSO E;  2I1K A;  2P58 C;  4EBA A;  2R03 A;  3FUN A;  5FIN A;  2PQR A;  4K5C A;  2XEV A;  4M3O A;  3MX3 A;  3FU5 A;  3RO3 A;  3ESK A;  2XEE A;  1HZ4 A;  4F53 A;  2OVF A;  1BI7 B;  3ASG A;  4OVU A;  2OND A;  1P5Q A;  4H7X A;  1KZO A;  3C98 A;  4AM9 A;  4GTT A;  2V5F A;  4GPM A;  3ULE G;  5CRV A;  1JWG A;  4CEM A;  3QC1 A;  4K03 A;  5LCW J;  1KT0 A;  1TJF A;  4JD2 G;  5EYL A;  3KSQ A;  3D9L A;  2C0L A;  3T9K A;  1ZU2 A;  2IO2 C;  2OEV A;  4N3C A;  3DPD A;  2CG2 A;  3NOG D;  4WWO A;  3E33 A;  1N95 A;  3ABM E;  3RRN B;  5J08 A;  5T3R A;  4YDE A;  1PC2 A;  3APC A;  3QAQ A;  4FHJ A;  3HYM B;  2ZIR A;  3LDZ A;  5FQ6 A;  2RFM A;  3Q75 A;  2L0T B;  4U8V D;  4L9P A;  5G04 J;  4LNG A;  2JAB A;  3HG0 D;  4LEU A;  2Y0B G;  1XGW A;  2ZIS A;  2WXO A;  5G2N A;  4A55 A;  2IFU A;  4HI8 A;  2XHE A;  1S64 A;  2J4B A;  3JXI A;  4HI9 A;  1IQU A;  1HG2 A;  1YA0 A;  3L22 A;  5FTP A;  3DXK G;  1TYQ G;  3D9I A;  3CQG B;  3E30 A;  3NZU A;  4I6J A;  3EU9 A;  4JHR A;  5G05 C;  4ILI A;  3CK7 A;  5M72 A;  5DBK A;  3VTX A;  3QKY A;  2ZU6 B;  5FQ4 A;  2X3M A;  2DIW A;  1DCQ A;  3FUK A;  4HQD A;  1EYH A;  1OUV A;  2KAT A;  2HR2 A;  2MRI A;  3MA5 A;  1SZ9 A;  2UY1 B;  2UWJ G;  1OT8 A;  3LPZ A;  3L13 A;  4HLL A;  1ZBP A;  3Q5M A;  3UIN C;  3VLE A;  2XPI A;  1N0R A;  2YQ8 A;  3FTX A;  2VGY A;  4DRX E;  1NP7 A;  3UM1 A;  3VTY A;  5AYW D;  3W9G A;  4U7E B;  3BUA A;  3ZVV A;  4HOR A;  2I1J A;  2V0P A;  1Z3X A;  1N4R A;  1MJ0 A;  3NOC D;  2HM8 A;  4NRH B;  4N5Q A;  3U66 A;  3APF A;  3I4G A;  2R2L A;  1HX8 A;  1OY3 D;  3C3R A;  3L08 A;  3D9M A;  2X38 A;  5ENO D;  3C72 A;  1SA5 A;  3AJI A;  3KD7 A;  5LOZ A;  3DBS A;  1V55 E;  1BI8 B;  4GYW A;  4RQI A;  2DWZ A;  3CR3 A;  5JJ6 A;  5EIB E;  1NA3 A;  1ELK A;  1TJC A;  2J4D A;  2V4L A;  3Q73 A;  5HRY A;  3ZPJ A;  2MHK A;  3ISM C;  3FUF A;  2WMO A;  2XZD G;  5ENQ D;  2YHC A;  4UI9 C;  4XI0 A;  1WM5 A;  3ESL A;  4MBG A;  3X2Q E;  2KBX A;  4JL0 A;  1MX4 A;  2VJ8 A;  2GRP B;  4DLO A;  2ILR A;  4A3V A;  4Z68 A;  1YMP A;  3OAW A;  4LCT A;  3PZD A;  3Q78 A;  2J49 A;  5JHB A;  4FHK A;  4HRL A;  1TNO A;  1TNU A;  4LUN U;  4RG6 A;  2XRZ A;  4HBD A;  3FY4 A;  2R5S A;  2VGE A;  4PS7 A;  4EBA G;  5AAR A;  1MX2 A;  3UPV A;  5DIZ A;  3N71 A;  1S63 A;  3ASN E;  5ITZ F;  4TRQ A;  2LAI A;  1SA4 A;  3DWL G;  4ANU A;  3L17 A;  2VGX B;  3G2W A;  3CVN A;  3UKU G;  4G2V A;  1N4P A;  3PNT B;  2NC9 A;  2OCC E;  3D9J A;  2IJG X;  2R02 A;  3ULY A;  2GRR B;  3OXF A;  3R7R A;  3T8K A;  4DI4 A;  2I6H A;  4YND A;  2CHZ A;  3ZYQ A;  1BU9 A;  4WNF A;  4AEZ C;  3T5V A;  4BWR A;  4BSZ B;  3GW4 A;  4FP7 A;  2OEW A;  3RRU A;  4N3A A;  3CV0 A;  4PH4 B;  3FH7 A;  2LO6 A;  4ZHB A;  4K0R A;  4FJZ A;  3TGO A;  3TWV A;  4PUC A;  1AWC B;  1BD8 A;  1X81 A;  4CT4 A;  2BTD A;  4YDW A;  3UM3 A;  2PZI A;  4LRZ A;  1MHQ A;  4RVB A;  1E7U A;  3IEG A;  5BV1 A;  3CVW A;  1MQS A;  1YCS B;  2H6F A;  4XE0 A;  3JQ0 A;  3LY8 A;  4HFG A;  3SI5 A;  3FTY A;  4W9R A;  4URK A;  4UQY A;  2XPY A;  3J5P A;  3C3O A;  2C0M A;  4LNU D;  3UM2 A;  4JW1 A;  4A63 B;  2MOW A;  5EYP F;  4K5A B;  4HS2 A;  4I1M A;  5A7D B;  1D8E A;  3ASF A;  2YHE A;  2AXU A;  5AAO A;  4P29 A;  3UT8 A;  2XCB A;  3DSX A;  3TL5 A;  1H2V C;  4GB9 A;  3KAE A;  4OAU C;  3HIZ A;  4E85 A;  4G23 A;  2LXL A;  3GZ1 A;  3CQC B;  1JCS A;  1JUQ A;  2WMN A;  3FWV A;  4NQ0 A;  1XNF A;  2X6J A;  2IU1 A;  1TR4 A;  3AG2 E;  1O1S A;  1HXI A;  4IRU A;  3PEU B;  1QNF A;  4Q94 A;  5B3S E;  4GA0 A;  3LY9 A;  3LEW A;  1IKN D;  1NFI E;  3SNX A;  3RU0 A;  3HXB A;  3OXL A;  1BLX B;  3SY2 A;  1H2U A;  2WXQ A;  3FU0 A;  5EID A;  3LVQ E;  4R7L A;  2IF4 A;  5A23 A;  4BTA A;  4ME2 A;  2GW1 A;  1ELW A;  1Q2Z A;  5KCM A;  2FO7 A;  3NF1 A;  4NUR A;  1O5M A;  3QB2 A;  5B1A E;  3ZGQ A;  3QK0 A;  2KCK A;  4WWP A;  2BKG A;  3MJW A;  2P2C P;  3K9I A;  4PDX A;  3EIJ A;  2WXG A;  1E8Y A;  4XIF A;  3FP3 A;  4A3T A;  2IEJ A;  4GA2 A;  3JQ1 A;  5FJY A;  1X5B A;  2CG3 A;  4I6G A;  4RLY A;  3UKR G;  1HU3 A;  5KNG A;  3SBS A;  3IXE A;  3CHO A;  4Y6W A;  5EN5 D;  1N0Q A;  3JUI A;  3RO2 A;  4I1A A;  4CT0 A;  3ONL A;  4F7A A;  4FLH A;  3AS8 A;  2WXP A;  4JXT A;  3SQV A;  1Z3Y A;  2J8S D;  2LSU A;  1A17 A;  5D66 A;  5CEC B;  2VGX A;  4ATZ D;  3FUE A;  3TWQ A;  2LUH A;  1HG5 A;  3RJV A;  4ANX A;  2Y3A A;  4XI9 A;  4YVQ C;  3D9P A;  5AQ9 A;  3CK9 A;  5G05 J;  3I3N A;  1H6O A;  1TN6 A;  3FUD A;  3Q15 A;  3MV3 B;  2P9S G;  4EZK A;  3AG3 E;  3IHY A;  4ACL A;  3C5R A;  3AAA C;  3I4R B;  2MYO A;  3V2X A;  4N39 A;  5E76 A;  3DST A;  3J5Q B;  3FUM A;  2QZA A;  5FZR A;  3KEZ A;  4MLP A;  5FWQ A;  3VLF A;  4XKC A;  3QNK A;  3MZL B;  2ION A;  1QBQ A;  3CKC A;  4ANV A;  3L54 A;  3CHR A;  4TXR A;  3ZYK A;  1TNB A;  3FUI A;  4YDY A;  2QYJ A;  3ZYM A;  5FIO A;  2XZT G;  2P9K G;  4BTB A;  2WXH A;  5KBA A;  2RFA A;  3Q49 B;  4LG6 A;  1EDU A;  3FTS A;  2E2E A;  3DEO A;  2GGF A;  1FT1 A;  1SQM A;  3D3M A;  1KT1 A;  1N54 A;  1L5J A;  2IY0 C;  1FPP A;  3R9M A;  3NZS A;  5CCM A;  3HDX A;  3FU3 A;  3E4B A;  3BQO A;  2WXR A;  3S7B A;  4NAC A;  2F8X K;  1W3B A;  4TXQ A;  3ABL E;  1UN8 A;  3FUL A;  4KYO B;  3TWW A;  4IUL A;  3EHR A;  4HRN A;  3RKV A;  1OWN A;  4B0Z A;  2HYZ A;  3ENE A;  1MYO A;  1MX6 A;  1Z6T A;  3SFY A;  3SBT B;  5CBO A;  2LAH A;  2E0I A;  4WNG A;  1WAO 1;  4DX1 A;  4U8H A;  3V2O A;  4KZ0 A;  4JVS A;  1N9A A;  2DYR E;  1N52 A;  3B7U X;  5D2M C;  4TXP A;  3HXC A;  4BER A;  2Y4T A;  4I2Z A;  3ZXP A;  1KLX A;  1OWM A;  2PL2 A;  4BET A;  2X6I A;  3FTW A;  1E96 B;  2FBN A;  3L9T A;  3MKQ A;  1WDY A;  2IOL A;  4A1G A;  3FUH A;  4LSZ E;  1DNP A;  4XEI G;  4AXH A;  3B13 A;  2AXV A;  3LXU X;  2WB2 A;  4PS8 A;  2P9I G;  1E90 A;  4GMR A;  5JMN D;  1S0P A;  4ABN A;  4AV7 A; 
#chains in the Genus database with same CATH homology
 2FF4 A;  4GA1 A;  4GU5 A;  5HI7 A;  4GAA A;  4TRQ A;  2C2L A;  4KZC A;  2LAI A;  4ANU A;  3L17 A;  3IV0 A;  3ZHE B;  3CVL A;  3O4Z A;  2I2O A;  4V3I A;  3B7S A;  2VGX B;  3G2W A;  4AP2 A;  3CVN A;  4B8C B;  1H0A A;  4DJA A;  4XKB A;  4G2V A;  5HQ8 A;  3UT7 A;  4HOQ A;  3URZ A;  2VYI A;  3PNT B;  3AU5 A;  4Q96 A;  3APD A;  5FQ7 A;  2FEZ A;  5CMY A;  2J09 A;  5T4Y A;  3CVX A;  4UQZ A;  4BSX A;  2NC9 A;  2L6J A;  4HOU A;  4D10 C;  3AS5 A;  3QWW A;  5C2Y A;  3D9J A;  2IJG X;  5D0O D;  2L9B A;  4B89 A;  4F1S A;  3MYV A;  5ANR A;  3OXF A;  5LP0 A;  3R9A B;  3R7R A;  4ACK A;  4DI4 A;  2I6H A;  4YND A;  2CHZ A;  3ZYQ A;  4AOF A;  5BV0 A;  4WNF A;  4AEZ C;  2OVB A;  3T5V A;  4BT9 A;  1E8Z A;  2VTB A;  4EZJ A;  4UWG A;  5LCW C;  4AVX A;  1E7V A;  2WXL A;  4BWR A;  5KJM A;  3GW4 A;  4FP7 A;  3LCA A;  4WND A;  3S7F A;  3UMV A;  1HO8 A;  3RRU A;  2CFU A;  3CV0 A;  1QQE A;  4N3A A;  4PH4 B;  3FH7 A;  4UWL A;  2VSN A;  4HLE A;  2J08 A;  1HE8 A;  3RK6 A;  2XGO A;  4N5C A;  1GW6 A;  1HH8 A;  2LO6 A;  4GYY A;  4K0R A;  4ANW A;  4FJZ A;  4KVO A;  4EQF A;  4B8A A;  3T5X A;  4QFV A;  3TGO A;  4PUC A;  4F3V A;  5LX8 A;  4GPK A;  4CT4 A;  4IN3 B;  3EDT B;  4N3B A;  2BTD A;  5E75 A;  3SF4 A;  4N2S A;  3IHV A;  4TUU A;  2KM4 A;  1FCH A;  3IBE A;  4G11 A;  2PZI A;  4LRZ A;  5FQ8 A;  3MV2 B;  3ZFW A;  1UN9 A;  1MHQ A;  3QWV A;  4UI9 K;  4BX8 A;  2YNQ A;  4E6H A;  4RVB A;  2KZT B;  1WY6 A;  4UWH A;  2GRL A;  4H7Y A;  4CDN A;  5DIZ A;  3OTN A;  1JPL A;  1PAQ A;  1U3C A;  3FUJ A;  3O48 A;  3IKO B;  1NA0 A;  1E7U A;  4FJY A;  3IEG A;  4UI9 J;  3S7J A;  2VQ2 A;  1INZ A;  5FT9 A;  5BV1 A;  4JA9 A;  4FUL A;  4XX5 A;  5KJK A;  3CVW A;  5BUZ A;  4FU3 A;  3AU4 A;  1MQS A;  2PQN A;  3CK8 A;  4XE0 A;  3PUK A;  4C0E A;  3G2S A;  4J8S A;  3R7Q A;  3JQ0 A;  3LY8 A;  4HFG A;  2WXK A;  3TG4 A;  4I2W A;  4I17 A;  5CCL A;  2X6F A;  3SI5 A;  3AS4 A;  3FTY A;  1U3D A;  4JC8 A;  4ILG A;  4W9R A;  1HFA A;  4URK A;  4UQY A;  3UUX A;  4Q69 A;  2AVP A;  2XPY A;  3QOU A;  4MKT A;  3BG0 B;  4G24 A;  5ARG A;  4JA7 A;  3ASH A;  4FA6 A;  3TXN A;  2C0M A;  5LFA A;  4HOS A;  3PRE A;  3CVU A;  2CHW A;  4DPR A;  4C9B B;  4JW1 A;  2A5U A;  5ARF A;  2MOW A;  3ZHE A;  4GZ3 A;  4HS2 A;  3T8M A;  2J9Q A;  1UW4 B;  4U63 A;  1PY1 A;  4I1M A;  4CGV A;  1OWL A;  5A7D B;  5J90 A;  2WXN A;  3ASF A;  2YHE A;  3GYZ A;  3FTU A;  3L6A A;  2AXU A;  3ML9 A;  3BG1 B;  5CMW A;  4FC8 A;  4KMO A;  4P29 A;  1Y8M A;  3UT8 A;  2XCB A;  3LVR E;  3TL5 A;  4WWN A;  4RG9 A;  1H2V C;  1UJJ A;  4GB9 A;  3GZ2 A;  3JCK C;  3KAE A;  3ASD A;  3ULQ A;  4B94 A;  4GZ6 A;  3HVE A;  4EEC A;  2IOS A;  3PEV B;  4HVB A;  3LKU A;  2VSO E;  2I1K A;  3HIZ A;  4E85 A;  3UT4 A;  4G23 A;  2P58 C;  3MKR A;  4EBA A;  1E8X A;  2VSX E;  4GYO A;  3FTZ A;  3PUJ A;  3FFL A;  3GZ1 A;  2WVI A;  3FUN A;  3PNL B;  4J8E A;  5ANL A;  3Q47 B;  3UQ3 A;  3CQC B;  2PQR A;  2XEV A;  4M3O A;  1JUQ A;  3CIA A;  2WMN A;  2PM6 A;  3FWV A;  4NQ0 A;  3HHM A;  1H19 A;  1XNF A;  3MX3 A;  4OVV A;  2X6J A;  2IU1 A;  4CRW A;  1VDY A;  5EX0 A;  3FU5 A;  4J8D A;  3RO3 A;  4G26 A;  3ESK A;  1HXI A;  4IRU A;  3PEU B;  4J6I A;  3SHF A;  5BT1 A;  1QNF A;  4GCN A;  2XGM A;  3FDH A;  4O6F A;  3PVL A;  1HZ4 A;  4Q94 A;  4ILH B;  4F53 A;  2OVF A;  3ASG A;  4OVU A;  2OND A;  3LS8 A;  1P5Q A;  4GA0 A;  4H7X A;  2DBA A;  4I1O B;  5JJ7 A;  3LY9 A;  2VSY A;  3ZYL A;  3C98 A;  4AM9 A;  3CVP A;  1FVF A;  1JWF A;  3LEW A;  2V5F A;  5AJL A;  4APF A;  3SNX A;  3MGB A;  1IHG A;  1JWG A;  4U0Z A;  3QC1 A;  3RU0 A;  4CEM A;  3CEQ A;  4K03 A;  2LSV A;  3CKB A;  3GZS A;  5LCW J;  1KT0 A;  1TJF A;  3OXL A;  3CHP A;  3B7R L;  1H2U A;  2R17 C;  2WXQ A;  3FU0 A;  3UX4 A;  1DVP A;  2KZT A;  3LVQ E;  3FTV A;  4R7L A;  3ONK A;  2IF4 A;  3D9L A;  2C0L A;  5EX3 A;  5A23 A;  4BTA A;  1ZU2 A;  2R59 A;  4ME2 A;  3G2T A;  3JYS A;  4BT8 A;  2GW1 A;  1ELW A;  3NQP A;  4N3C A;  2FO7 A;  3DPD A;  3NF1 A;  4L1B A;  3CST A;  4NUR A;  4LER A;  4U0U A;  5KCM A;  4AY5 A;  2CG2 A;  3QB2 A;  3CVY A;  4WUY A;  3ZGQ A;  3QK0 A;  3FH8 A;  4WWO A;  2QFC A;  2I9C A;  1HS6 A;  4Y6C A;  3RRN B;  5J08 A;  2KCK A;  5T3R A;  4WWP A;  1PC2 A;  3APC A;  3QAQ A;  2NXP A;  3MJW A;  4FHJ A;  3HYM B;  3QJZ A;  2KC7 A;  2RG8 A;  3EIQ C;  4L2Y A;  3K9I A;  3LDZ A;  4PDX A;  5ENN A;  3EIJ A;  5FQ6 A;  5FZQ A;  2WXG A;  5G04 C;  4DI3 A;  4BX9 A;  1E8Y A;  5JHA A;  4XIF A;  2WXF A;  3FP3 A;  2L0T B;  5G04 J;  4A3T A;  3PRZ A;  4GA2 A;  1UJK A;  4JHJ A;  3JQ1 A;  2FUL A;  3L16 A;  4UWF A;  2VTB B;  4LEU A;  5FJY A;  1X5B A;  2CG3 A;  1XGW A;  4I6G A;  3RIB A;  1HU3 A;  2WXO A;  3QAR A;  5G2N A;  3SBS A;  4A55 A;  2J07 A;  2IFU A;  3CHO A;  4Y6W A;  3CHQ A;  2KCV A;  2XHE A;  5AEN A;  5KJL A;  3JUI A;  2WXM A;  2J4B A;  3RO2 A;  3EJN A;  1IQU A;  4I1A A;  4DK5 A;  1HG2 A;  4CT0 A;  3ONL A;  4F7A A;  5BPP A;  1YA0 A;  3L22 A;  4FLH A;  3AS8 A;  2WXP A;  4JXT A;  4CCA A;  5FTP A;  1TEZ A;  5T8I A;  1BPO A;  3CLJ A;  1Z3Y A;  5EDS A;  2LSU A;  2X6H A;  1A17 A;  4HOT A;  4APO A;  3D9I A;  3PH0 C;  2FI7 A;  3CQG B;  2LNI A;  2VGX A;  2M63 A;  3CHS A;  4GZD A;  4HXI A;  3NZU A;  3FUE A;  5AJD A;  4I6J A;  2OV8 A;  3ZIM A;  1HG5 A;  3RJV A;  4ANX A;  1EPU A;  2Y3A A;  3CGH A;  1HF8 A;  3ZEF A;  2WXI A;  3S7D A;  3LY7 A;  4JHR A;  5G05 C;  4ILI A;  3CK7 A;  4XI9 A;  4YVQ C;  5M72 A;  3D9P A;  3G2U A;  3CVV A;  1IQR A;  5DBK A;  1H2T C;  3CK9 A;  5G05 J;  4EZL A;  2RD0 A;  4GCO A;  3VTX A;  3QKY A;  1NZN A;  3B7T A;  2OOE A;  2ZU6 B;  3I3N A;  3FUD A;  3U4T A;  3TAX A;  3Q15 A;  3MV3 B;  3PS6 A;  5FQ4 A;  5AIJ A;  2X3M A;  1OWO A;  3LYA A;  2DIW A;  3FUK A;  1EYH A;  1OUV A;  3QDN A;  4EZK A;  2KAT A;  2HR2 A;  2MRI A;  3FEY A;  3MA5 A;  2EQX A;  3ZW3 A;  2WPV A;  1UG3 A;  3D9N A;  3IHY A;  1SZ9 A;  3LJ3 A;  2PM7 A;  3MEK A;  4ACL A;  4A1S A;  3SZ7 A;  4KT6 B;  2AXZ A;  3I4R B;  2UY1 B;  2UWJ G;  3ZXS A;  4N39 A;  4CDM A;  5E76 A;  3LPZ A;  2JEK A;  3FUM A;  2GRM A;  3L13 A;  3MKQ B;  1ZBP A;  5FZR A;  3Q5M A;  2L0I A;  3WXX A;  4I43 A;  3VLE A;  3KEZ A;  3MCX A;  1OWP A;  2XPI A;  4MLP A;  5FWQ A;  3TJP A;  3VLF A;  4XKC A;  3QNK A;  5D0Q D;  3MZL B;  2ION A;  4OYS A;  3EHN A;  2V8S E;  2YQ8 A;  3FTX A;  3QWP A;  2VGY A;  2QY7 A;  3CVQ A;  5G55 A;  3CKC A;  3FHE A;  4L2L A;  1NP7 A;  4ANV A;  4XZ4 A;  3KS2 A;  3VTY A;  3ML8 A;  2WXJ A;  3CHM A;  3L54 A;  4BY6 A;  3CHR A;  3SD5 A;  4U0S A;  5AYW D;  3ZYK A;  3U3W A;  1B89 A;  2BUG A;  3ZVV A;  4HOR A;  4UWK A;  3FUI A;  3P2B A;  2I1J A;  4DLQ A;  2V0P A;  1Z3X A;  3ZYM A;  4U04 A;  2XGS A;  2HM8 A;  3Q4A B;  2XPZ A;  3HVE B;  4NRH B;  4BTB A;  4KXK B;  2WXH A;  3Q49 B;  3U66 A;  1EDU A;  1LF8 A;  3FTS A;  2E2E A;  2KCL A;  3APF A;  4GZC A;  3I4G A;  3G2V A;  2GGF A;  4L7T A;  1HX8 A;  1SQM A;  2XCC A;  3D3M A;  3U64 A;  1KT1 A;  1N54 A;  4J8F A;  4KVM A;  4N2Q A;  1L5J A;  3L08 A;  3D9M A;  3NZS A;  5CCM A;  3HDX A;  3FU3 A;  2X38 A;  3E4B A;  3FU6 A;  3CSF A;  2WXR A;  3S7B A;  4NAC A;  4U07 A;  4GML A;  1W3B A;  2DCP A;  2Q7F A;  4BFR A;  2WQH A;  2XRY A;  1UN8 A;  3KD7 A;  3FUL A;  3ZRH A;  3I5P A;  2WM9 A;  4C0M A;  4KYO B;  5LOZ A;  1FVH A;  4AIF A;  3DBS A;  4J0U A;  4MRU A;  1H6K A;  4FAD A;  4IUL A;  3PE3 A;  4I6E A;  3RKV A;  1OWN A;  2NSZ A;  4B0Z A;  3FEX A;  3SFZ A;  2HYZ A;  1EF1 C;  3RRM B;  1Y6I A;  3ENE A;  4GYW A;  4KBQ A;  5KJN A;  1Z6T A;  3CR3 A;  5JJ6 A;  3SBT B;  3D9K A;  2LAH A;  4MS6 A;  1NA3 A;  2E0I A;  4WNG A;  1ELK A;  1TJC A;  4RSY A;  1WAO 1;  3EHM A;  2J4D A;  2BF0 X;  1QZ2 A;  2V4L A;  2Y4U A;  3PDN A;  4JVS A;  4KZ0 A;  4PS3 A;  4U8H A;  2MHK A;  3ZPJ A;  1ELR A;  4JZY A;  4GMJ A;  3FUF A;  4I9E A;  2WMO A;  2YHC A;  5JJT A;  4G25 A;  2JLB A;  4UI9 C;  4XI0 A;  5BNW A;  1N52 A;  5C1D A;  4JEH A;  2XQ0 A;  3B7U X;  4YVO A;  4GZ5 A;  1WM5 A;  5EKQ D;  3ESL A;  5CHE E;  2Y4T A;  4L23 A;  3D9O A;  2CFZ A;  3TG5 A;  3TXM A;  4JL0 A;  4WNE A;  4I2Z A;  2VJ8 A;  4WAF A;  4FLB A;  3SGH A;  1KLX A;  1OWM A;  3BEE A;  3ZN3 A;  3OXG A;  3U9W A;  4DLO A;  2PL2 A;  1E8W A;  4JEU A;  4TV3 A;  2X6I A;  2UY1 A;  3FTW A;  3VLD A;  1SZA A;  1E96 B;  2ILR A;  4A3V A;  5A6C A;  2FBN A;  3MKQ A;  2AW6 A;  2IOL A;  4A1G A;  3OAW A;  4JHK A;  4LCT A;  4AY6 A;  2IQC A;  3PZD A;  4AJW A;  3FUH A;  4G1T A;  1DNP A;  2J49 A;  4UQX A;  5JHB A;  4AXH A;  4FHK A;  2CHX A;  2HO1 A;  3B13 A;  2WQ7 A;  4LUN U;  5BW8 C;  3S2A A;  2AXV A;  3LXU X;  4RG6 A;  2WB2 A;  2AWI A;  4I9C A;  4JPS A;  3FH5 A;  2XRZ A;  1IYG A;  3PE4 A;  3FY4 A;  4PS8 A;  2R5S A;  1E90 A;  4EPZ A;  2X6K A;  4CGW A;  4CDR A;  4IYP A;  1S0P A;  4PS7 A;  3P1U A;  4EBA G;  3UPV A;  2A4Z A;  4AV7 A;  4ABN A;  3N71 A;  2YIN A;  2WQ6 A;  4ATG A;  5FZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...