2IU5A

Dihydroxyacetone kinase operon activator dhas
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
179
structure length
179
Chain Sequence
b'MEKSIITQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQTFYNYFQNQEELLSWIFENDFAELINDNSDYYGWQNELLLLLRYLDENQIFYQKIFVIDKNFEHFFLIQWENLLDKVIFDQEKKSDYHWSDLEKSFICRYNAAAICAITRESIIRGNSLEKLYSQIVNLLLAQIKIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-TYPE DHAKLM OPERON TRANSCRIPTIONAL ACTIVATOR DHAS
publication title Regulation of the Dha Operon of Lactococcus Lactis: A Deviation from the Rule Followed by the Tetr Family of Transcription Regulators
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis il1403
molecule tags Transcription
total genus 74
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2iu5A00
2FD5A 3DEWA 2WUIA 2JJ7A 3CWRA 4AC0A 3QKXA 4NELA 5J1RA 2REKA 3TP3A 4GFKA 2F07A 3LJLA 3T6NA 3PPBA 5K7FA 5CXGA 5F0FA 4JYKA 3BR2A 2HYJA 5EYRA 1Z77A 3VOXA 5K58A 4D7NA 2XB5A 4M3DA 2Y30A 1RPWA 3CCYA 3VW1A 3NXCA 4V2FA 1BJZA 1JUSA 2FQ4A 3EUPA 3HE0A 2ZOZA 3BR0A 2XPWA 2G0EA 1RKTA 5EZGA 5EZHA 3RH2A 1UI5A 2XPVA 5GPCA 3PM1A 3BQZA 2PBXA 5FMPA 3NPIA 5AQCA 1A6IA 2JK3A 3AQTA 4JL3A 5K7ZA 3HTHA 5J1YA 3MNLA 4GCTA 3BR3A 2HXOA 2GFNA 3F1BA 3V78A 4DW6A 2RAEA 3LSJA 2RASA 2QIBA 3AQSA 3CDLA 3ANPA 2TRTA 3G1OA 2OI8A 2X6OA 4YZEA 3BTCA 1SGMA 3O8HA 3BNIA 2ZCXA 2W53A 4XK4A 3BHQA 1JT6A 2GUHA 3HTAA 2XGCA 2DG7A 2WGBA 3LOCA 3VVZA 3ZQLA 3LSRA 1JT0A 3CRJA 2NX4A 2IEKA 3IH3A 5GP9A 4D5FA 4W1UA 3BR5A 3B81A 5F27A 4I6ZA 3COLA 3SDGA 2RHAA 3E7QA 4JKZA 4G12A 2NP5A 2ZOYA 3NRGA 3G1MA 2O7OA 4PXIA 5FKMA 3BTIA 2YVEA 4M3EA 2UXHA 2QWTA 2UXOA 2UXIA 4UDSA 3DPJA 2IBDA 2OF7A 5F0CA 2Q24A 2QTQA 2QCOA 3FK6A 5IOYA 2GENA 2YVHA 1ZK8A 2O7TA 3QQAA 5FKNA 3B6AA 3G7RA 4X1EA 3KZ9A 4AUXA 2G7SA 3BCGA 5F1JA 3IUVA 4AC6A 3G1LA 1QVTA 2VPRA 3NI7A 3ZQIA 2G7GA 4B3AA 3VIBA 3VVXA 3ZQGA 3G56A 4MK6A 5FKOA 5GPAA 4W97A 3QBMA 1JUPA 3BRUA 4M3GA 5IP6A 2NS7A 4ME9A 3BJBA 5F04A 2DG8A 3RD3A 2VKVA 2HXIA 3S5RA 4CGRA 3C07A 1QPIA 5IPAA 3GZIA 5J1UA 2OPTA 3C2BA 3VW0A 3LHQA 3SFIA 3ON4A 4ACIA 5FKKA 5FHPA 2G7LA 3LWJA 3KKCA 5HSZA 4V2GA 2VKEA 1RKWA 3QPLA 5CXIA 2QKOA 4M3BA 4B1RA 2Y2ZA 3BQYA 2HYTA 2XGDA 5IOZA 2FX0A 3ZQHA 1UI6A 3ON2A 5D1RA 3Q0WA 3FRQA 5C4YA 3P9TA 1VI0A 1U9NA 2UXUA 3BT9A 3VOKA 5K7HA 3NNRA 3VP5A 3WHBA 4MO7A 3VPRA 3HGYA 3F0CA 3LSPA 3BTJA 4D7MA 4GCLA 2D6YA 4HKUA 2ID6A 3TP0A 3PASA 3IH2A 2ZB9A 3Q3SA 3GEUA 2I10A 3EGQA 2HKUA 2EH3A 2GBYA 3B6CA 1Z0XA 4JNNA 3ANGA 2Y31A 5HAWA 3V6GA 2IAIA 3HTIA 5EFYA 1T56A 2DTZA 2OERA 2ZCNA 2XGEA 4L62A 4GFLA 4M3FA 5CW8A 2WV1A 3KKDA 4KWAA 1ORKA 1T33A 2IU5A 2XPUA 2UXPA 4MXMA 2NS8A 3O60A 5D18A 3WHCA 4NN1A 1U9OA 2TCTA 3VW2A 2NP3A 4ABZA 1JTYA 2QOPA 3VUQA 2XDNA 5J3LA 3ZQFA 2G3BA 3BR1A 4ICHA 2PZ9A 4GCKA 1ZKGA 4D5CA 2ID3A 3O8GA 5H9TA 1JTXA 3CJDA 5F0HA 1JUMA 3FIWA 2HQ5A 3HGGA 3Q0VA 2V57A 3HTJA 3QPSA 4I76A 5HBUA 3DCFA 5FKLA 2X9DA 5D19A 2ZCMA 1QVUA 3FK7A 3Q0UA 3VVYA 2XRLA 3BR6A 2FJ1A 3JSJA 3BTLA 3IH4A 3KNWA 4AF5A 5DAJA 2FBQA 3MVPA 3HIMA 5F08A 5FGLA
chains in the Genus database with same CATH superfamily
2FD5A 3SWHA 3DEWA 2WUIA 2JJ7A 3CWRA 4AC0A 3QKXA 4NELA 5J1RA 2REKA 3TP3A 4GFKA 2F07A 3LJLA 3T6NA 2B3WA 3PPBA 5K7FA 5CXGA 5F0FA 4JYKA 3BR2A 2R7RA 2HYJA 5EYRA 1Z77A 3VOXA 5K58A 4D7NA 2XB5A 4M3DA 3VTIA 2Y30A 1RPWA 3CCYA 3VW1A 3NXCA 4V2FA 1BJZA 1JUSA 2FQ4A 3EUPA 3HE0A 2ZOZA 3BR0A 2XPWA 2G0EA 1RKTA 5EZGA 5EZHA 3RH2A 1UI5A 2R7UA 2XPVA 5GPCA 3PM1A 3BQZA 2PBXA 5FMPA 3NPIA 5AQCA 1A6IA 2JK3A 3AQTA 4JL3A 5K7ZA 3HTHA 5J1YA 3MNLA 4GCTA 3BR3A 2HXOA 2GFNA 3F1BA 3V78A 4DW6A 2RAEA 3LSJA 2RASA 2QIBA 3AQSA 3CDLA 3ANPA 2TRTA 3G1OA 2OI8A 2X6OA 4YZEA 5CQGA 3BTCA 1SGMA 3O8HA 3BNIA 2ZCXA 2W53A 4XK4A 3BHQA 1JT6A 2GUHA 3HTAA 2XGCA 2DG7A 2WGBA 3K8PC 3LOCA 3VVZA 3ZQLA 3LSRA 1JT0A 3CRJA 2NX4A 2IEKA 3IH3A 5GP9A 4D5FA 4W1UA 3BR5A 3B81A 5F27A 4I6ZA 3COLA 3DU6A 3SDGA 2RHAA 3E7QA 4JKZA 4G12A 2NP5A 2ZOYA 3NRGA 3G1MA 2O7OA 4PXIA 5FKMA 2YVXA 3BTIA 2YVEA 4M3EA 2UXHA 4C2MA 2QWTA 2UXOA 2UXIA 4UDSA 3DPJA 2IBDA 2OF7A 5F0CA 2Q24A 2QTQA 2QCOA 3FK6A 5IOYA 2GENA 2YVHA 1ZK8A 2O7TA 2A2FX 3QQAA 5FKNA 3B6AA 3G7RA 4X1EA 3KZ9A 4AUXA 2G7SA 3BCGA 5F1JA 3IUVA 4AC6A 3G1LA 1QVTA 2VPRA 3NI7A 3ZQIA 2G7GA 2FJI1 4B3AA 3VIBA 3VVXA 3ZQGA 3G56A 4MK6A 5FKOA 2B1EA 5GPAA 4W97A 3QBMA 1JUPA 3BRUA 2R7WA 4M3GA 5IP6A 2NS7A 4ME9A 3BJBA 5F04A 2DG8A 4OD5A 3RD3A 2VKVA 2HXIA 3S5RA 4CGRA 3C07A 1QPIA 3DU5A 5IPAA 3GZIA 5J1UA 2OPTA 3C2BA 3VW0A 3LHQA 3KYLA 3SFIA 3ON4A 4ACIA 5FKKA 5FHPA 2G7LA 3LWJA 3KKCA 5HSZA 4V2GA 2VKEA 1RKWA 3QPLA 5CXIA 2QKOA 4M3BA 4B1RA 2Y2ZA 3BQYA 2HYTA 2XGDA 5IOZA 2FX0A 3ZQHA 1UI6A 3ON2A 5D1RA 3Q0WA 3FRQA 5C4YA 3P9TA 1VI0A 2R7OA 1U9NA 3FHNA 4DVYP 2UXUA 3BT9A 3VOKA 5K7HA 3NNRA 3VP5A 3WHBA 4MO7A 3VPRA 3HGYA 3F0CA 3LSPA 3BTJA 4D7MA 4GCLA 2D6YA 4HKUA 2ID6A 3TP0A 3PASA 3IH2A 2ZB9A 3Q3SA 3GEUA 2I10A 2R7XA 3EGQA 2HKUA 2EH3A 2GBYA 3B6CA 1Z0XA 3NS4A 4JNNA 3ANGA 2Y31A 5HAWA 3V6GA 2IAIA 3HTIA 4WIBA 5EFYA 1T56A 2R7QA 2R7TA 2DTZA 2OERA 2ZCNA 4U9NA 2XGEA 4L62A 4GFLA 4M3FA 5CW8A 2WV1A 3KKDA 4KWAA 1ORKA 1T33A 2IU5A 2XPUA 2UXPA 4MXMA 4U9LA 2NS8A 3O60A 5D18A 3WHCA 4NN1A 1U9OA 2TCTA 3VW2A 2NP3A 4ABZA 1JTYA 2QOPA 3VUQA 2XDNA 5J3LA 4IRVA 3ZQFA 2R7SA 2G3BA 3BR1A 4ICHA 2PZ9A 4GCKA 2PFVA 1ZKGA 4D5CA 2ID3A 3O8GA 5H9TA 1JTXA 4OD4A 3CJDA 5F0HA 1JUMA 3FIWA 2HQ5A 3HGGA 3Q0VA 2V57A 3HTJA 3QPSA 4I76A 5HBUA 3DCFA 5FKLA 2X9DA 2ZY9A 5D19A 2ZCMA 1QVUA 3FK7A 3Q0UA 3VVYA 2XRLA 3BR6A 2FJ1A 3JSJA 2R7VA 3BTLA 3IH4A 3KNWA 4AF5A 5DAJA 2FBQA 3MVPA 3HIMA 5F08A 5FGLA
chains in the Genus database with same CATH topology
2FD5A 3DEWA 2WUIA 2JJ7A 3CWRA 4AC0A 3QKXA 4NELA 5J1RA 2REKA 3TP3A 4GFKA 2F07A 3LJLA 3T6NA 3PPBA 5K7FA 5CXGA 5F0FA 4JYKA 3BR2A 2HYJA 5EYRA 1Z77A 3VOXA 5K58A 4D7NA 2XB5A 4M3DA 2Y30A 1RPWA 3CCYA 3VW1A 3NXCA 4V2FA 1BJZA 1JUSA 2FQ4A 3EUPA 3HE0A 2ZOZA 3BR0A 2XPWA 2G0EA 1RKTA 5EZGA 5EZHA 3RH2A 1UI5A 2XPVA 5GPCA 3PM1A 3BQZA 2PBXA 5FMPA 3NPIA 5AQCA 1A6IA 2JK3A 3AQTA 4JL3A 5K7ZA 3HTHA 5J1YA 3MNLA 4GCTA 3BR3A 2HXOA 2GFNA 3F1BA 3V78A 4DW6A 2RAEA 3LSJA 2RASA 2QIBA 3AQSA 3CDLA 3ANPA 2TRTA 3G1OA 2OI8A 2X6OA 4YZEA 3BTCA 1SGMA 3O8HA 3BNIA 2ZCXA 2W53A 4XK4A 3BHQA 1JT6A 2GUHA 3HTAA 2XGCA 2DG7A 2WGBA 3LOCA 3VVZA 3ZQLA 3LSRA 1JT0A 3CRJA 2NX4A 2IEKA 3IH3A 5GP9A 4D5FA 4W1UA 3BR5A 3B81A 5F27A 4I6ZA 3COLA 3SDGA 2RHAA 3E7QA 4JKZA 4G12A 2NP5A 2ZOYA 3NRGA 3G1MA 2O7OA 4PXIA 5FKMA 3BTIA 2YVEA 4M3EA 2UXHA 2QWTA 2UXOA 2UXIA 4UDSA 3DPJA 2IBDA 2OF7A 5F0CA 2Q24A 2QTQA 2QCOA 3FK6A 5IOYA 2GENA 2YVHA 1ZK8A 2O7TA 3QQAA 5FKNA 3B6AA 3G7RA 4X1EA 3KZ9A 4AUXA 2G7SA 3BCGA 5F1JA 3IUVA 4AC6A 3G1LA 1QVTA 2VPRA 3NI7A 3ZQIA 2G7GA 4B3AA 3VIBA 3VVXA 3ZQGA 3G56A 4MK6A 5FKOA 5GPAA 4W97A 3QBMA 1JUPA 3BRUA 4M3GA 5IP6A 2NS7A 4ME9A 3BJBA 5F04A 2DG8A 3RD3A 2VKVA 2HXIA 3S5RA 4CGRA 3C07A 1QPIA 5IPAA 3GZIA 5J1UA 2OPTA 3C2BA 3VW0A 3LHQA 3SFIA 3ON4A 4ACIA 5FKKA 5FHPA 2G7LA 3LWJA 3KKCA 5HSZA 4V2GA 2VKEA 1RKWA 3QPLA 5CXIA 2QKOA 4M3BA 4B1RA 2Y2ZA 3BQYA 2HYTA 2XGDA 5IOZA 2FX0A 3ZQHA 1UI6A 3ON2A 5D1RA 3Q0WA 3FRQA 5C4YA 3P9TA 1VI0A 1U9NA 2UXUA 3BT9A 3VOKA 5K7HA 3NNRA 3VP5A 3WHBA 4MO7A 3VPRA 3HGYA 3F0CA 3LSPA 3BTJA 4D7MA 4GCLA 2D6YA 4HKUA 2ID6A 3TP0A 3PASA 3IH2A 2ZB9A 3Q3SA 3GEUA 2I10A 3EGQA 2HKUA 2EH3A 2GBYA 3B6CA 1Z0XA 4JNNA 3ANGA 2Y31A 5HAWA 3V6GA 2IAIA 3HTIA 5EFYA 1T56A 2DTZA 2OERA 2ZCNA 2XGEA 4L62A 4GFLA 4M3FA 5CW8A 2WV1A 3KKDA 4KWAA 1ORKA 1T33A 2IU5A 2XPUA 2UXPA 4MXMA 2NS8A 3O60A 5D18A 3WHCA 4NN1A 1U9OA 2TCTA 3VW2A 2NP3A 4ABZA 1JTYA 2QOPA 3VUQA 2XDNA 5J3LA 3ZQFA 2G3BA 3BR1A 4ICHA 2PZ9A 4GCKA 1ZKGA 4D5CA 2ID3A 3O8GA 5H9TA 1JTXA 3CJDA 5F0HA 1JUMA 3FIWA 2HQ5A 3HGGA 3Q0VA 2V57A 3HTJA 3QPSA 4I76A 5HBUA 3DCFA 5FKLA 2X9DA 5D19A 2ZCMA 1QVUA 3FK7A 3Q0UA 3VVYA 2XRLA 3BR6A 2FJ1A 3JSJA 3BTLA 3IH4A 3KNWA 4AF5A 5DAJA 2FBQA 3MVPA 3HIMA 5F08A 5FGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FD5 A;  3DEW A;  2WUI A;  2JJ7 A;  3CWR A;  4AC0 A;  3QKX A;  4NEL A;  5J1R A;  2REK A;  3TP3 A;  4GFK A;  2F07 A;  3LJL A;  3T6N A;  3PPB A;  5K7F A;  5CXG A;  5F0F A;  4JYK A;  3BR2 A;  2HYJ A;  5EYR A;  1Z77 A;  3VOX A;  5K58 A;  4D7N A;  2XB5 A;  4M3D A;  2Y30 A;  1RPW A;  3CCY A;  3VW1 A;  3NXC A;  4V2F A;  1BJZ A;  1JUS A;  2FQ4 A;  3EUP A;  3HE0 A;  2ZOZ A;  3BR0 A;  2XPW A;  2G0E A;  1RKT A;  5EZG A;  5EZH A;  3RH2 A;  1UI5 A;  2XPV A;  5GPC A;  3PM1 A;  3BQZ A;  2PBX A;  5FMP A;  3NPI A;  5AQC A;  1A6I A;  2JK3 A;  3AQT A;  4JL3 A;  5K7Z A;  3HTH A;  5J1Y A;  3MNL A;  4GCT A;  3BR3 A;  2HXO A;  2GFN A;  3F1B A;  3V78 A;  4DW6 A;  2RAE A;  3LSJ A;  2RAS A;  2QIB A;  3AQS A;  3CDL A;  3ANP A;  2TRT A;  3G1O A;  2OI8 A;  2X6O A;  4YZE A;  3BTC A;  1SGM A;  3O8H A;  3BNI A;  2ZCX A;  2W53 A;  4XK4 A;  3BHQ A;  1JT6 A;  2GUH A;  3HTA A;  2XGC A;  2DG7 A;  2WGB A;  3LOC A;  3VVZ A;  3ZQL A;  3LSR A;  1JT0 A;  3CRJ A;  2NX4 A;  2IEK A;  3IH3 A;  5GP9 A;  4D5F A;  4W1U A;  3BR5 A;  3B81 A;  5F27 A;  4I6Z A;  3COL A;  3SDG A;  2RHA A;  3E7Q A;  4JKZ A;  4G12 A;  2NP5 A;  2ZOY A;  3NRG A;  3G1M A;  2O7O A;  4PXI A;  5FKM A;  3BTI A;  2YVE A;  4M3E A;  2UXH A;  2QWT A;  2UXO A;  2UXI A;  4UDS A;  3DPJ A;  2IBD A;  2OF7 A;  5F0C A;  2Q24 A;  2QTQ A;  2QCO A;  3FK6 A;  5IOY A;  2GEN A;  2YVH A;  1ZK8 A;  2O7T A;  3QQA A;  5FKN A;  3B6A A;  3G7R A;  4X1E A;  3KZ9 A;  4AUX A;  2G7S A;  3BCG A;  5F1J A;  3IUV A;  4AC6 A;  3G1L A;  1QVT A;  2VPR A;  3NI7 A;  3ZQI A;  2G7G A;  4B3A A;  3VIB A;  3VVX A;  3ZQG A;  3G56 A;  4MK6 A;  5FKO A;  5GPA A;  4W97 A;  3QBM A;  1JUP A;  3BRU A;  4M3G A;  5IP6 A;  2NS7 A;  4ME9 A;  3BJB A;  5F04 A;  2DG8 A;  3RD3 A;  2VKV A;  2HXI A;  3S5R A;  4CGR A;  3C07 A;  1QPI A;  5IPA A;  3GZI A;  5J1U A;  2OPT A;  3C2B A;  3VW0 A;  3LHQ A;  3SFI A;  3ON4 A;  4ACI A;  5FKK A;  5FHP A;  2G7L A;  3LWJ A;  3KKC A;  5HSZ A;  4V2G A;  2VKE A;  1RKW A;  3QPL A;  5CXI A;  2QKO A;  4M3B A;  4B1R A;  2Y2Z A;  3BQY A;  2HYT A;  2XGD A;  5IOZ A;  2FX0 A;  3ZQH A;  1UI6 A;  3ON2 A;  5D1R A;  3Q0W A;  3FRQ A;  5C4Y A;  3P9T A;  1VI0 A;  1U9N A;  2UXU A;  3BT9 A;  3VOK A;  5K7H A;  3NNR A;  3VP5 A;  3WHB A;  4MO7 A;  3VPR A;  3HGY A;  3F0C A;  3LSP A;  3BTJ A;  4D7M A;  4GCL A;  2D6Y A;  4HKU A;  2ID6 A;  3TP0 A;  3PAS A;  3IH2 A;  2ZB9 A;  3Q3S A;  3GEU A;  2I10 A;  3EGQ A;  2HKU A;  2EH3 A;  2GBY A;  3B6C A;  1Z0X A;  4JNN A;  3ANG A;  2Y31 A;  5HAW A;  3V6G A;  2IAI A;  3HTI A;  5EFY A;  1T56 A;  2DTZ A;  2OER A;  2ZCN A;  2XGE A;  4L62 A;  4GFL A;  4M3F A;  5CW8 A;  2WV1 A;  3KKD A;  4KWA A;  1ORK A;  1T33 A;  2IU5 A;  2XPU A;  2UXP A;  4MXM A;  2NS8 A;  3O60 A;  5D18 A;  3WHC A;  4NN1 A;  1U9O A;  2TCT A;  3VW2 A;  2NP3 A;  4ABZ A;  1JTY A;  2QOP A;  3VUQ A;  2XDN A;  5J3L A;  3ZQF A;  2G3B A;  3BR1 A;  4ICH A;  2PZ9 A;  4GCK A;  1ZKG A;  4D5C A;  2ID3 A;  3O8G A;  5H9T A;  1JTX A;  3CJD A;  5F0H A;  1JUM A;  3FIW A;  2HQ5 A;  3HGG A;  3Q0V A;  2V57 A;  3HTJ A;  3QPS A;  4I76 A;  5HBU A;  3DCF A;  5FKL A;  2X9D A;  5D19 A;  2ZCM A;  1QVU A;  3FK7 A;  3Q0U A;  3VVY A;  2XRL A;  3BR6 A;  2FJ1 A;  3JSJ A;  3BTL A;  3IH4 A;  3KNW A;  4AF5 A;  5DAJ A;  2FBQ A;  3MVP A;  3HIM A;  5F08 A;  5FGL A; 
#chains in the Genus database with same CATH topology
 2FD5 A;  3SWH A;  3DEW A;  2WUI A;  2JJ7 A;  3CWR A;  4AC0 A;  3QKX A;  4NEL A;  5J1R A;  2REK A;  3TP3 A;  4GFK A;  2F07 A;  3LJL A;  3T6N A;  2B3W A;  3PPB A;  5K7F A;  5CXG A;  5F0F A;  4JYK A;  3BR2 A;  2R7R A;  2HYJ A;  5EYR A;  1Z77 A;  3VOX A;  5K58 A;  4D7N A;  2XB5 A;  4M3D A;  3VTI A;  2Y30 A;  1RPW A;  3CCY A;  3VW1 A;  3NXC A;  4V2F A;  1BJZ A;  1JUS A;  2FQ4 A;  3EUP A;  3HE0 A;  2ZOZ A;  3BR0 A;  2XPW A;  2G0E A;  1RKT A;  5EZG A;  5EZH A;  3RH2 A;  1UI5 A;  2R7U A;  2XPV A;  5GPC A;  3PM1 A;  3BQZ A;  2PBX A;  5FMP A;  3NPI A;  5AQC A;  1A6I A;  2JK3 A;  3AQT A;  4JL3 A;  5K7Z A;  3HTH A;  5J1Y A;  3MNL A;  4GCT A;  3BR3 A;  2HXO A;  2GFN A;  3F1B A;  3V78 A;  4DW6 A;  2RAE A;  3LSJ A;  2RAS A;  2QIB A;  3AQS A;  3CDL A;  3ANP A;  2TRT A;  3G1O A;  2OI8 A;  2X6O A;  4YZE A;  5CQG A;  3BTC A;  1SGM A;  3O8H A;  3BNI A;  2ZCX A;  2W53 A;  4XK4 A;  3BHQ A;  1JT6 A;  2GUH A;  3HTA A;  2XGC A;  2DG7 A;  2WGB A;  3K8P C;  3LOC A;  3VVZ A;  3ZQL A;  3LSR A;  1JT0 A;  3CRJ A;  2NX4 A;  2IEK A;  3IH3 A;  5GP9 A;  4D5F A;  4W1U A;  3BR5 A;  3B81 A;  5F27 A;  4I6Z A;  3COL A;  3DU6 A;  3SDG A;  2RHA A;  3E7Q A;  4JKZ A;  4G12 A;  2NP5 A;  2ZOY A;  3NRG A;  3G1M A;  2O7O A;  4PXI A;  5FKM A;  2YVX A;  3BTI A;  2YVE A;  4M3E A;  2UXH A;  4C2M A;  2QWT A;  2UXO A;  2UXI A;  4UDS A;  3DPJ A;  2IBD A;  2OF7 A;  5F0C A;  2Q24 A;  2QTQ A;  2QCO A;  3FK6 A;  5IOY A;  2GEN A;  2YVH A;  1ZK8 A;  2O7T A;  2A2F X;  3QQA A;  5FKN A;  3B6A A;  3G7R A;  4X1E A;  3KZ9 A;  4AUX A;  2G7S A;  3BCG A;  5F1J A;  3IUV A;  4AC6 A;  3G1L A;  1QVT A;  2VPR A;  3NI7 A;  3ZQI A;  2G7G A;  2FJI 1;  4B3A A;  3VIB A;  3VVX A;  3ZQG A;  3G56 A;  4MK6 A;  5FKO A;  2B1E A;  5GPA A;  4W97 A;  3QBM A;  1JUP A;  3BRU A;  2R7W A;  4M3G A;  5IP6 A;  2NS7 A;  4ME9 A;  3BJB A;  5F04 A;  2DG8 A;  4OD5 A;  3RD3 A;  2VKV A;  2HXI A;  3S5R A;  4CGR A;  3C07 A;  1QPI A;  3DU5 A;  5IPA A;  3GZI A;  5J1U A;  2OPT A;  3C2B A;  3VW0 A;  3LHQ A;  3KYL A;  3SFI A;  3ON4 A;  4ACI A;  5FKK A;  5FHP A;  2G7L A;  3LWJ A;  3KKC A;  5HSZ A;  4V2G A;  2VKE A;  1RKW A;  3QPL A;  5CXI A;  2QKO A;  4M3B A;  4B1R A;  2Y2Z A;  3BQY A;  2HYT A;  2XGD A;  5IOZ A;  2FX0 A;  3ZQH A;  1UI6 A;  3ON2 A;  5D1R A;  3Q0W A;  3FRQ A;  5C4Y A;  3P9T A;  1VI0 A;  2R7O A;  1U9N A;  3FHN A;  4DVY P;  2UXU A;  3BT9 A;  3VOK A;  5K7H A;  3NNR A;  3VP5 A;  3WHB A;  4MO7 A;  3VPR A;  3HGY A;  3F0C A;  3LSP A;  3BTJ A;  4D7M A;  4GCL A;  2D6Y A;  4HKU A;  2ID6 A;  3TP0 A;  3PAS A;  3IH2 A;  2ZB9 A;  3Q3S A;  3GEU A;  2I10 A;  2R7X A;  3EGQ A;  2HKU A;  2EH3 A;  2GBY A;  3B6C A;  1Z0X A;  3NS4 A;  4JNN A;  3ANG A;  2Y31 A;  5HAW A;  3V6G A;  2IAI A;  3HTI A;  4WIB A;  5EFY A;  1T56 A;  2R7Q A;  2R7T A;  2DTZ A;  2OER A;  2ZCN A;  4U9N A;  2XGE A;  4L62 A;  4GFL A;  4M3F A;  5CW8 A;  2WV1 A;  3KKD A;  4KWA A;  1ORK A;  1T33 A;  2IU5 A;  2XPU A;  2UXP A;  4MXM A;  4U9L A;  2NS8 A;  3O60 A;  5D18 A;  3WHC A;  4NN1 A;  1U9O A;  2TCT A;  3VW2 A;  2NP3 A;  4ABZ A;  1JTY A;  2QOP A;  3VUQ A;  2XDN A;  5J3L A;  4IRV A;  3ZQF A;  2R7S A;  2G3B A;  3BR1 A;  4ICH A;  2PZ9 A;  4GCK A;  2PFV A;  1ZKG A;  4D5C A;  2ID3 A;  3O8G A;  5H9T A;  1JTX A;  4OD4 A;  3CJD A;  5F0H A;  1JUM A;  3FIW A;  2HQ5 A;  3HGG A;  3Q0V A;  2V57 A;  3HTJ A;  3QPS A;  4I76 A;  5HBU A;  3DCF A;  5FKL A;  2X9D A;  2ZY9 A;  5D19 A;  2ZCM A;  1QVU A;  3FK7 A;  3Q0U A;  3VVY A;  2XRL A;  3BR6 A;  2FJ1 A;  3JSJ A;  2R7V A;  3BTL A;  3IH4 A;  3KNW A;  4AF5 A;  5DAJ A;  2FBQ A;  3MVP A;  3HIM A;  5F08 A;  5FGL A; 
#chains in the Genus database with same CATH homology
 2FD5 A;  3DEW A;  2WUI A;  2JJ7 A;  3CWR A;  4AC0 A;  3QKX A;  4NEL A;  5J1R A;  2REK A;  3TP3 A;  4GFK A;  2F07 A;  3LJL A;  3T6N A;  3PPB A;  5K7F A;  5CXG A;  5F0F A;  4JYK A;  3BR2 A;  2HYJ A;  5EYR A;  1Z77 A;  3VOX A;  5K58 A;  4D7N A;  2XB5 A;  4M3D A;  2Y30 A;  1RPW A;  3CCY A;  3VW1 A;  3NXC A;  4V2F A;  1BJZ A;  1JUS A;  2FQ4 A;  3EUP A;  3HE0 A;  2ZOZ A;  3BR0 A;  2XPW A;  2G0E A;  1RKT A;  5EZG A;  5EZH A;  3RH2 A;  1UI5 A;  2XPV A;  5GPC A;  3PM1 A;  3BQZ A;  2PBX A;  5FMP A;  3NPI A;  5AQC A;  1A6I A;  2JK3 A;  3AQT A;  4JL3 A;  5K7Z A;  3HTH A;  5J1Y A;  3MNL A;  4GCT A;  3BR3 A;  2HXO A;  2GFN A;  3F1B A;  3V78 A;  4DW6 A;  2RAE A;  3LSJ A;  2RAS A;  2QIB A;  3AQS A;  3CDL A;  3ANP A;  2TRT A;  3G1O A;  2OI8 A;  2X6O A;  4YZE A;  3BTC A;  1SGM A;  3O8H A;  3BNI A;  2ZCX A;  2W53 A;  4XK4 A;  3BHQ A;  1JT6 A;  2GUH A;  3HTA A;  2XGC A;  2DG7 A;  2WGB A;  3LOC A;  3VVZ A;  3ZQL A;  3LSR A;  1JT0 A;  3CRJ A;  2NX4 A;  2IEK A;  3IH3 A;  5GP9 A;  4D5F A;  4W1U A;  3BR5 A;  3B81 A;  5F27 A;  4I6Z A;  3COL A;  3SDG A;  2RHA A;  3E7Q A;  4JKZ A;  4G12 A;  2NP5 A;  2ZOY A;  3NRG A;  3G1M A;  2O7O A;  4PXI A;  5FKM A;  3BTI A;  2YVE A;  4M3E A;  2UXH A;  2QWT A;  2UXO A;  2UXI A;  4UDS A;  3DPJ A;  2IBD A;  2OF7 A;  5F0C A;  2Q24 A;  2QTQ A;  2QCO A;  3FK6 A;  5IOY A;  2GEN A;  2YVH A;  1ZK8 A;  2O7T A;  3QQA A;  5FKN A;  3B6A A;  3G7R A;  4X1E A;  3KZ9 A;  4AUX A;  2G7S A;  3BCG A;  5F1J A;  3IUV A;  4AC6 A;  3G1L A;  1QVT A;  2VPR A;  3NI7 A;  3ZQI A;  2G7G A;  4B3A A;  3VIB A;  3VVX A;  3ZQG A;  3G56 A;  4MK6 A;  5FKO A;  5GPA A;  4W97 A;  3QBM A;  1JUP A;  3BRU A;  4M3G A;  5IP6 A;  2NS7 A;  4ME9 A;  3BJB A;  5F04 A;  2DG8 A;  3RD3 A;  2VKV A;  2HXI A;  3S5R A;  4CGR A;  3C07 A;  1QPI A;  5IPA A;  3GZI A;  5J1U A;  2OPT A;  3C2B A;  3VW0 A;  3LHQ A;  3SFI A;  3ON4 A;  4ACI A;  5FKK A;  5FHP A;  2G7L A;  3LWJ A;  3KKC A;  5HSZ A;  4V2G A;  2VKE A;  1RKW A;  3QPL A;  5CXI A;  2QKO A;  4M3B A;  4B1R A;  2Y2Z A;  3BQY A;  2HYT A;  2XGD A;  5IOZ A;  2FX0 A;  3ZQH A;  1UI6 A;  3ON2 A;  5D1R A;  3Q0W A;  3FRQ A;  5C4Y A;  3P9T A;  1VI0 A;  1U9N A;  2UXU A;  3BT9 A;  3VOK A;  5K7H A;  3NNR A;  3VP5 A;  3WHB A;  4MO7 A;  3VPR A;  3HGY A;  3F0C A;  3LSP A;  3BTJ A;  4D7M A;  4GCL A;  2D6Y A;  4HKU A;  2ID6 A;  3TP0 A;  3PAS A;  3IH2 A;  2ZB9 A;  3Q3S A;  3GEU A;  2I10 A;  3EGQ A;  2HKU A;  2EH3 A;  2GBY A;  3B6C A;  1Z0X A;  4JNN A;  3ANG A;  2Y31 A;  5HAW A;  3V6G A;  2IAI A;  3HTI A;  5EFY A;  1T56 A;  2DTZ A;  2OER A;  2ZCN A;  2XGE A;  4L62 A;  4GFL A;  4M3F A;  5CW8 A;  2WV1 A;  3KKD A;  4KWA A;  1ORK A;  1T33 A;  2IU5 A;  2XPU A;  2UXP A;  4MXM A;  2NS8 A;  3O60 A;  5D18 A;  3WHC A;  4NN1 A;  1U9O A;  2TCT A;  3VW2 A;  2NP3 A;  4ABZ A;  1JTY A;  2QOP A;  3VUQ A;  2XDN A;  5J3L A;  3ZQF A;  2G3B A;  3BR1 A;  4ICH A;  2PZ9 A;  4GCK A;  1ZKG A;  4D5C A;  2ID3 A;  3O8G A;  5H9T A;  1JTX A;  3CJD A;  5F0H A;  1JUM A;  3FIW A;  2HQ5 A;  3HGG A;  3Q0V A;  2V57 A;  3HTJ A;  3QPS A;  4I76 A;  5HBU A;  3DCF A;  5FKL A;  2X9D A;  5D19 A;  2ZCM A;  1QVU A;  3FK7 A;  3Q0U A;  3VVY A;  2XRL A;  3BR6 A;  2FJ1 A;  3JSJ A;  3BTL A;  3IH4 A;  3KNW A;  4AF5 A;  5DAJ A;  2FBQ A;  3MVP A;  3HIM A;  5F08 A;  5FGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...