2IU5A

Dihydroxyacetone kinase operon activator dhas
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
179
structure length
179
Chain Sequence
MEKSIITQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQTFYNYFQNQEELLSWIFENDFAELINDNSDYYGWQNELLLLLRYLDENQIFYQKIFVIDKNFEHFFLIQWENLLDKVIFDQEKKSDYHWSDLEKSFICRYNAAAICAITRESIIRGNSLEKLYSQIVNLLLAQIKIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of the Dha Operon of Lactococcus Lactis: A Deviation from the Rule Followed by the Tetr Family of Transcription Regulators
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis il1403
molecule tags Transcription
molecule keywords HTH-TYPE DHAKLM OPERON TRANSCRIPTIONAL ACTIVATOR DHAS
total genus 74
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2iu5A00
2ZCXA 5DAJA 1JTYA 3G56A 3BRUA 3HTIA 4M3DA 4AC6A 2IU5A 3ZQFA 3O8GA 3QKXA 4ICHA 3NI7A 3VIBA 1Z77A 2ZCNA 5F1JA 4GCTA 3QPLA 3BTIA 5F0HA 2Y31A 1VI0A 3QPSA 3EUPA 4ME9A 2DTZA 3NXCA 3QBMA 3BR6A 5J1YA 2QTQA 4D7MA 2QCOA 2FQ4A 2G7SA 3GEUA 3HIMA 3VW1A 2O7TA 3ANGA 3BTCA 3BHQA 4GFLA 3BR0A 5GP9A 3GZIA 1RKTA 2NP3A 4CGRA 4V2FA 2GENA 2FBQA 2NX4A 1U9OA 2EH3A 5EYRA 4JL3A 3V78A 4NELA 3IUVA 1ORKA 2FD5A 5FHPA 2Y2ZA 1ZKGA 3HTJA 3HGGA 2XDNA 3IH3A 2ZOZA 4L62A 2ZB9A 3BR2A 2XGEA 3BQZA 3VW2A 1JUSA 3SFIA 4PXIA 4W97A 5C4YA 3BQYA 3BCGA 3C2BA 2WV1A 2D6YA 4MXMA 5J3LA 1Z0XA 3VUQA 5F0FA 2XRLA 3DPJA 2XGCA 3DCFA 2NP5A 5GPAA 2G7LA 2NS8A 2JK3A 1QPIA 2OI8A 3BR1A 2TRTA 4HKUA 2V57A 2QIBA 5F08A 2FJ1A 2FX0A 3NPIA 5FGLA 3G7RA 3CRJA 3CDLA 2IEKA 2VKEA 3IH2A 5D19A 3O60A 3VVYA 5HBUA 5K7FA 5FKNA 3KZ9A 5CXIA 4XK4A 2UXUA 4JNNA 3AQTA 3MVPA 2RASA 2XPWA 4G12A 3ZQLA 3B6AA 3B81A 5FMPA 4W1UA 3BTJA 3VVXA 3MNLA 4DW6A 2WUIA 2IAIA 3PPBA 1UI5A 5AQCA 5IP6A 1JT6A 3ZQGA 3G1LA 5EZHA 3TP3A 2VKVA 3LSJA 2X9DA 4M3EA 2GUHA 3BTLA 4M3FA 3KKCA 3WHBA 2ID3A 4X1EA 4JKZA 1JUMA 4MK6A 3Q0UA 3RH2A 3BT9A 2ZCMA 2HQ5A 5CW8A 2RAEA 2QWTA 1T33A 4B3AA 5IOZA 2HXOA 1QVUA 4V2GA 5F27A 1T56A 3FIWA 5K7HA 3KNWA 2XB5A 5F0CA 5IOYA 3BR3A 3HTHA 5K58A 2PBXA 5IPAA 5J1RA 2VPRA 2UXOA 4M3GA 2G3BA 3HTAA 4NN1A 3DEWA 3ZQHA 1JT0A 3NRGA 5FKOA 2GBYA 2YVHA 2W53A 4KWAA 3PM1A 2QKOA 3F1BA 4UDSA 2TCTA 3RD3A 2G7GA 5EFYA 3VVZA 4MO7A 2X6OA 3BJBA 2PZ9A 2ZOYA 3E7QA 3G1OA 3VP5A 2O7OA 3LJLA 2DG8A 4M3BA 3AQSA 3LSRA 3VW0A 3Q3SA 2Y30A 4AUXA 3ZQIA 3F0CA 5EZGA 3PASA 2UXHA 2HXIA 3B6CA 3VOKA 5FKLA 3Q0VA 5D1RA 1U9NA 2IBDA 2OPTA 3FK6A 1RPWA 3QQAA 2G0EA 1QVTA 5D18A 4B1RA 2HYJA 3CCYA 4GFKA 4ABZA 3ON4A 2REKA 3S5RA 3COLA 3ANPA 4D7NA 1BJZA 3BNIA 3Q0WA 2QOPA 4D5FA 2XPUA 3CWRA 2Q24A 1A6IA 4D5CA 1JTXA 3CJDA 4GCKA 5HAWA 5CXGA 2F07A 3NNRA 3WHCA 3TP0A 3EGQA 3P9TA 4YZEA 2UXPA 2YVEA 2HYTA 3V6GA 5H9TA 2HKUA 3ON2A 3BR5A 2I10A 3FRQA 1ZK8A 5GPCA 4ACIA 2WGBA 2RHAA 4I76A 5FKMA 1RKWA 2XGDA 1SGMA 3C07A 5F04A 4I6ZA 3SDGA 2GFNA 2NS7A 3T6NA 3HE0A 2JJ7A 5FKKA 3HGYA 4AC0A 5J1UA 2UXIA 3IH4A 3O8HA 3VOXA 3KKDA 4AF5A 2DG7A 3VPRA 3LSPA 3G1MA 1UI6A 3JSJA 3LOCA 1JUPA 2OF7A 5HSZA 4GCLA 5K7ZA 3FK7A 2ID6A 3LWJA 4JYKA 3LHQA 2OERA 2XPVA
chains in the Genus database with same CATH superfamily
2ZCXA 5DAJA 1JTYA 2B3WA 3G56A 3BRUA 3K8PC 3HTIA 4M3DA 4AC6A 2IU5A 3ZQFA 3O8GA 3QKXA 4ICHA 3NI7A 3VIBA 1Z77A 2ZCNA 5F1JA 4GCTA 2R7OA 3QPLA 4U9LA 3BTIA 5F0HA 2Y31A 1VI0A 3QPSA 2R7WA 3EUPA 4ME9A 2DTZA 3NXCA 3QBMA 3BR6A 5J1YA 2QTQA 4D7MA 2QCOA 2FQ4A 2G7SA 3GEUA 3HIMA 3VW1A 2O7TA 3DU5A 2ZY9A 3ANGA 3BTCA 3BHQA 4GFLA 4C2MA 3BR0A 5GP9A 3GZIA 1RKTA 2NP3A 4CGRA 4V2FA 2GENA 2FBQA 2NX4A 1U9OA 2EH3A 5EYRA 4JL3A 3V78A 4NELA 3IUVA 1ORKA 2FD5A 5FHPA 2Y2ZA 1ZKGA 3HTJA 3HGGA 2XDNA 3IH3A 2ZOZA 4L62A 2ZB9A 4U9NA 3BR2A 2XGEA 3BQZA 3VW2A 1JUSA 3SFIA 4PXIA 4W97A 5C4YA 3BQYA 3BCGA 3C2BA 2WV1A 2D6YA 4MXMA 5J3LA 1Z0XA 3VUQA 5F0FA 2XRLA 3DPJA 3DU6A 2XGCA 3DCFA 2NP5A 5GPAA 2G7LA 2NS8A 2JK3A 1QPIA 3VTIA 2OI8A 3BR1A 2TRTA 4HKUA 2R7TA 2V57A 2QIBA 5F08A 2FJ1A 2FX0A 3NPIA 5FGLA 4OD4A 3G7RA 3CRJA 3CDLA 2IEKA 2VKEA 3IH2A 5D19A 3O60A 3VVYA 5HBUA 5K7FA 5FKNA 3KZ9A 5CXIA 4XK4A 2UXUA 4JNNA 3AQTA 3MVPA 2RASA 2XPWA 4G12A 3ZQLA 3B6AA 3B81A 5FMPA 4W1UA 3BTJA 3VVXA 3MNLA 4DW6A 2WUIA 2IAIA 3PPBA 1UI5A 5AQCA 5IP6A 1JT6A 2YVXA 3ZQGA 3G1LA 5CQGA 5EZHA 3TP3A 2VKVA 3LSJA 2X9DA 4M3EA 2GUHA 3BTLA 4M3FA 3KKCA 3WHBA 2ID3A 4X1EA 4JKZA 1JUMA 4MK6A 3Q0UA 3RH2A 3BT9A 2ZCMA 2HQ5A 5CW8A 2RAEA 2QWTA 2A2FX 2R7VA 1T33A 4B3AA 2R7RA 5IOZA 2HXOA 1QVUA 4V2GA 5F27A 1T56A 3FIWA 5K7HA 3KNWA 2XB5A 5F0CA 5IOYA 2R7SA 3BR3A 3HTHA 3KYLA 5K58A 2PBXA 5IPAA 5J1RA 3FHNA 2VPRA 2UXOA 4M3GA 2G3BA 3HTAA 4NN1A 3DEWA 3ZQHA 1JT0A 3NRGA 5FKOA 2GBYA 2YVHA 2R7UA 2W53A 4KWAA 3PM1A 2QKOA 3F1BA 4UDSA 2TCTA 3RD3A 2G7GA 5EFYA 3VVZA 2FJI1 4MO7A 2X6OA 3BJBA 2PZ9A 2ZOYA 3E7QA 3G1OA 3VP5A 2O7OA 3LJLA 2DG8A 4M3BA 3AQSA 3LSRA 3VW0A 3Q3SA 2Y30A 4AUXA 3ZQIA 3F0CA 5EZGA 3PASA 2UXHA 2HXIA 3B6CA 3VOKA 3SWHA 5FKLA 3Q0VA 5D1RA 1U9NA 2IBDA 2OPTA 3FK6A 1RPWA 3QQAA 2G0EA 1QVTA 5D18A 4B1RA 2HYJA 4OD5A 3CCYA 4GFKA 4ABZA 3ON4A 2REKA 3S5RA 3COLA 3ANPA 4D7NA 1BJZA 3BNIA 3Q0WA 2QOPA 4D5FA 2XPUA 3CWRA 2Q24A 1A6IA 4D5CA 1JTXA 3CJDA 4GCKA 5HAWA 5CXGA 2F07A 4IRVA 3NNRA 2B1EA 3WHCA 4WIBA 3TP0A 3EGQA 3P9TA 4YZEA 2UXPA 2YVEA 3NS4A 2HYTA 3V6GA 5H9TA 2HKUA 3ON2A 3BR5A 2I10A 2R7XA 3FRQA 1ZK8A 5GPCA 4ACIA 2WGBA 2RHAA 4I76A 5FKMA 1RKWA 2XGDA 1SGMA 3C07A 5F04A 4DVYP 4I6ZA 3SDGA 2GFNA 2NS7A 3T6NA 3HE0A 2JJ7A 5FKKA 2R7QA 3HGYA 4AC0A 5J1UA 2UXIA 3IH4A 3O8HA 3VOXA 3KKDA 4AF5A 2PFVA 2DG7A 3VPRA 3LSPA 3G1MA 1UI6A 3JSJA 3LOCA 1JUPA 2OF7A 5HSZA 4GCLA 5K7ZA 3FK7A 2ID6A 3LWJA 4JYKA 3LHQA 2OERA 2XPVA
chains in the Genus database with same CATH topology
2ZCXA 5DAJA 1JTYA 3G56A 3BRUA 3HTIA 4M3DA 4AC6A 2IU5A 3ZQFA 3O8GA 3QKXA 4ICHA 3NI7A 3VIBA 1Z77A 2ZCNA 5F1JA 4GCTA 3QPLA 3BTIA 5F0HA 2Y31A 1VI0A 3QPSA 3EUPA 4ME9A 2DTZA 3NXCA 3QBMA 3BR6A 5J1YA 2QTQA 4D7MA 2QCOA 2FQ4A 2G7SA 3GEUA 3HIMA 3VW1A 2O7TA 3ANGA 3BTCA 3BHQA 4GFLA 3BR0A 5GP9A 3GZIA 1RKTA 2NP3A 4CGRA 4V2FA 2GENA 2FBQA 2NX4A 1U9OA 2EH3A 5EYRA 4JL3A 3V78A 4NELA 3IUVA 1ORKA 2FD5A 5FHPA 2Y2ZA 1ZKGA 3HTJA 3HGGA 2XDNA 3IH3A 2ZOZA 4L62A 2ZB9A 3BR2A 2XGEA 3BQZA 3VW2A 1JUSA 3SFIA 4PXIA 4W97A 5C4YA 3BQYA 3BCGA 3C2BA 2WV1A 2D6YA 4MXMA 5J3LA 1Z0XA 3VUQA 5F0FA 2XRLA 3DPJA 2XGCA 3DCFA 2NP5A 5GPAA 2G7LA 2NS8A 2JK3A 1QPIA 2OI8A 3BR1A 2TRTA 4HKUA 2V57A 2QIBA 5F08A 2FJ1A 2FX0A 3NPIA 5FGLA 3G7RA 3CRJA 3CDLA 2IEKA 2VKEA 3IH2A 5D19A 3O60A 3VVYA 5HBUA 5K7FA 5FKNA 3KZ9A 5CXIA 4XK4A 2UXUA 4JNNA 3AQTA 3MVPA 2RASA 2XPWA 4G12A 3ZQLA 3B6AA 3B81A 5FMPA 4W1UA 3BTJA 3VVXA 3MNLA 4DW6A 2WUIA 2IAIA 3PPBA 1UI5A 5AQCA 5IP6A 1JT6A 3ZQGA 3G1LA 5EZHA 3TP3A 2VKVA 3LSJA 2X9DA 4M3EA 2GUHA 3BTLA 4M3FA 3KKCA 3WHBA 2ID3A 4X1EA 4JKZA 1JUMA 4MK6A 3Q0UA 3RH2A 3BT9A 2ZCMA 2HQ5A 5CW8A 2RAEA 2QWTA 1T33A 4B3AA 5IOZA 2HXOA 1QVUA 4V2GA 5F27A 1T56A 3FIWA 5K7HA 3KNWA 2XB5A 5F0CA 5IOYA 3BR3A 3HTHA 5K58A 2PBXA 5IPAA 5J1RA 2VPRA 2UXOA 4M3GA 2G3BA 3HTAA 4NN1A 3DEWA 3ZQHA 1JT0A 3NRGA 5FKOA 2GBYA 2YVHA 2W53A 4KWAA 3PM1A 2QKOA 3F1BA 4UDSA 2TCTA 3RD3A 2G7GA 5EFYA 3VVZA 4MO7A 2X6OA 3BJBA 2PZ9A 2ZOYA 3E7QA 3G1OA 3VP5A 2O7OA 3LJLA 2DG8A 4M3BA 3AQSA 3LSRA 3VW0A 3Q3SA 2Y30A 4AUXA 3ZQIA 3F0CA 5EZGA 3PASA 2UXHA 2HXIA 3B6CA 3VOKA 5FKLA 3Q0VA 5D1RA 1U9NA 2IBDA 2OPTA 3FK6A 1RPWA 3QQAA 2G0EA 1QVTA 5D18A 4B1RA 2HYJA 3CCYA 4GFKA 4ABZA 3ON4A 2REKA 3S5RA 3COLA 3ANPA 4D7NA 1BJZA 3BNIA 3Q0WA 2QOPA 4D5FA 2XPUA 3CWRA 2Q24A 1A6IA 4D5CA 1JTXA 3CJDA 4GCKA 5HAWA 5CXGA 2F07A 3NNRA 3WHCA 3TP0A 3EGQA 3P9TA 4YZEA 2UXPA 2YVEA 2HYTA 3V6GA 5H9TA 2HKUA 3ON2A 3BR5A 2I10A 3FRQA 1ZK8A 5GPCA 4ACIA 2WGBA 2RHAA 4I76A 5FKMA 1RKWA 2XGDA 1SGMA 3C07A 5F04A 4I6ZA 3SDGA 2GFNA 2NS7A 3T6NA 3HE0A 2JJ7A 5FKKA 3HGYA 4AC0A 5J1UA 2UXIA 3IH4A 3O8HA 3VOXA 3KKDA 4AF5A 2DG7A 3VPRA 3LSPA 3G1MA 1UI6A 3JSJA 3LOCA 1JUPA 2OF7A 5HSZA 4GCLA 5K7ZA 3FK7A 2ID6A 3LWJA 4JYKA 3LHQA 2OERA 2XPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCX A;  5DAJ A;  1JTY A;  3G56 A;  3BRU A;  3HTI A;  4M3D A;  4AC6 A;  2IU5 A;  3ZQF A;  3O8G A;  3QKX A;  4ICH A;  3NI7 A;  3VIB A;  1Z77 A;  2ZCN A;  5F1J A;  4GCT A;  3QPL A;  3BTI A;  5F0H A;  2Y31 A;  1VI0 A;  3QPS A;  3EUP A;  4ME9 A;  2DTZ A;  3NXC A;  3QBM A;  3BR6 A;  5J1Y A;  2QTQ A;  4D7M A;  2QCO A;  2FQ4 A;  2G7S A;  3GEU A;  3HIM A;  3VW1 A;  2O7T A;  3ANG A;  3BTC A;  3BHQ A;  4GFL A;  3BR0 A;  5GP9 A;  3GZI A;  1RKT A;  2NP3 A;  4CGR A;  4V2F A;  2GEN A;  2FBQ A;  2NX4 A;  1U9O A;  2EH3 A;  5EYR A;  4JL3 A;  3V78 A;  4NEL A;  3IUV A;  1ORK A;  2FD5 A;  5FHP A;  2Y2Z A;  1ZKG A;  3HTJ A;  3HGG A;  2XDN A;  3IH3 A;  2ZOZ A;  4L62 A;  2ZB9 A;  3BR2 A;  2XGE A;  3BQZ A;  3VW2 A;  1JUS A;  3SFI A;  4PXI A;  4W97 A;  5C4Y A;  3BQY A;  3BCG A;  3C2B A;  2WV1 A;  2D6Y A;  4MXM A;  5J3L A;  1Z0X A;  3VUQ A;  5F0F A;  2XRL A;  3DPJ A;  2XGC A;  3DCF A;  2NP5 A;  5GPA A;  2G7L A;  2NS8 A;  2JK3 A;  1QPI A;  2OI8 A;  3BR1 A;  2TRT A;  4HKU A;  2V57 A;  2QIB A;  5F08 A;  2FJ1 A;  2FX0 A;  3NPI A;  5FGL A;  3G7R A;  3CRJ A;  3CDL A;  2IEK A;  2VKE A;  3IH2 A;  5D19 A;  3O60 A;  3VVY A;  5HBU A;  5K7F A;  5FKN A;  3KZ9 A;  5CXI A;  4XK4 A;  2UXU A;  4JNN A;  3AQT A;  3MVP A;  2RAS A;  2XPW A;  4G12 A;  3ZQL A;  3B6A A;  3B81 A;  5FMP A;  4W1U A;  3BTJ A;  3VVX A;  3MNL A;  4DW6 A;  2WUI A;  2IAI A;  3PPB A;  1UI5 A;  5AQC A;  5IP6 A;  1JT6 A;  3ZQG A;  3G1L A;  5EZH A;  3TP3 A;  2VKV A;  3LSJ A;  2X9D A;  4M3E A;  2GUH A;  3BTL A;  4M3F A;  3KKC A;  3WHB A;  2ID3 A;  4X1E A;  4JKZ A;  1JUM A;  4MK6 A;  3Q0U A;  3RH2 A;  3BT9 A;  2ZCM A;  2HQ5 A;  5CW8 A;  2RAE A;  2QWT A;  1T33 A;  4B3A A;  5IOZ A;  2HXO A;  1QVU A;  4V2G A;  5F27 A;  1T56 A;  3FIW A;  5K7H A;  3KNW A;  2XB5 A;  5F0C A;  5IOY A;  3BR3 A;  3HTH A;  5K58 A;  2PBX A;  5IPA A;  5J1R A;  2VPR A;  2UXO A;  4M3G A;  2G3B A;  3HTA A;  4NN1 A;  3DEW A;  3ZQH A;  1JT0 A;  3NRG A;  5FKO A;  2GBY A;  2YVH A;  2W53 A;  4KWA A;  3PM1 A;  2QKO A;  3F1B A;  4UDS A;  2TCT A;  3RD3 A;  2G7G A;  5EFY A;  3VVZ A;  4MO7 A;  2X6O A;  3BJB A;  2PZ9 A;  2ZOY A;  3E7Q A;  3G1O A;  3VP5 A;  2O7O A;  3LJL A;  2DG8 A;  4M3B A;  3AQS A;  3LSR A;  3VW0 A;  3Q3S A;  2Y30 A;  4AUX A;  3ZQI A;  3F0C A;  5EZG A;  3PAS A;  2UXH A;  2HXI A;  3B6C A;  3VOK A;  5FKL A;  3Q0V A;  5D1R A;  1U9N A;  2IBD A;  2OPT A;  3FK6 A;  1RPW A;  3QQA A;  2G0E A;  1QVT A;  5D18 A;  4B1R A;  2HYJ A;  3CCY A;  4GFK A;  4ABZ A;  3ON4 A;  2REK A;  3S5R A;  3COL A;  3ANP A;  4D7N A;  1BJZ A;  3BNI A;  3Q0W A;  2QOP A;  4D5F A;  2XPU A;  3CWR A;  2Q24 A;  1A6I A;  4D5C A;  1JTX A;  3CJD A;  4GCK A;  5HAW A;  5CXG A;  2F07 A;  3NNR A;  3WHC A;  3TP0 A;  3EGQ A;  3P9T A;  4YZE A;  2UXP A;  2YVE A;  2HYT A;  3V6G A;  5H9T A;  2HKU A;  3ON2 A;  3BR5 A;  2I10 A;  3FRQ A;  1ZK8 A;  5GPC A;  4ACI A;  2WGB A;  2RHA A;  4I76 A;  5FKM A;  1RKW A;  2XGD A;  1SGM A;  3C07 A;  5F04 A;  4I6Z A;  3SDG A;  2GFN A;  2NS7 A;  3T6N A;  3HE0 A;  2JJ7 A;  5FKK A;  3HGY A;  4AC0 A;  5J1U A;  2UXI A;  3IH4 A;  3O8H A;  3VOX A;  3KKD A;  4AF5 A;  2DG7 A;  3VPR A;  3LSP A;  3G1M A;  1UI6 A;  3JSJ A;  3LOC A;  1JUP A;  2OF7 A;  5HSZ A;  4GCL A;  5K7Z A;  3FK7 A;  2ID6 A;  3LWJ A;  4JYK A;  3LHQ A;  2OER A;  2XPV A; 
#chains in the Genus database with same CATH topology
 2ZCX A;  5DAJ A;  1JTY A;  2B3W A;  3G56 A;  3BRU A;  3K8P C;  3HTI A;  4M3D A;  4AC6 A;  2IU5 A;  3ZQF A;  3O8G A;  3QKX A;  4ICH A;  3NI7 A;  3VIB A;  1Z77 A;  2ZCN A;  5F1J A;  4GCT A;  2R7O A;  3QPL A;  4U9L A;  3BTI A;  5F0H A;  2Y31 A;  1VI0 A;  3QPS A;  2R7W A;  3EUP A;  4ME9 A;  2DTZ A;  3NXC A;  3QBM A;  3BR6 A;  5J1Y A;  2QTQ A;  4D7M A;  2QCO A;  2FQ4 A;  2G7S A;  3GEU A;  3HIM A;  3VW1 A;  2O7T A;  3DU5 A;  2ZY9 A;  3ANG A;  3BTC A;  3BHQ A;  4GFL A;  4C2M A;  3BR0 A;  5GP9 A;  3GZI A;  1RKT A;  2NP3 A;  4CGR A;  4V2F A;  2GEN A;  2FBQ A;  2NX4 A;  1U9O A;  2EH3 A;  5EYR A;  4JL3 A;  3V78 A;  4NEL A;  3IUV A;  1ORK A;  2FD5 A;  5FHP A;  2Y2Z A;  1ZKG A;  3HTJ A;  3HGG A;  2XDN A;  3IH3 A;  2ZOZ A;  4L62 A;  2ZB9 A;  4U9N A;  3BR2 A;  2XGE A;  3BQZ A;  3VW2 A;  1JUS A;  3SFI A;  4PXI A;  4W97 A;  5C4Y A;  3BQY A;  3BCG A;  3C2B A;  2WV1 A;  2D6Y A;  4MXM A;  5J3L A;  1Z0X A;  3VUQ A;  5F0F A;  2XRL A;  3DPJ A;  3DU6 A;  2XGC A;  3DCF A;  2NP5 A;  5GPA A;  2G7L A;  2NS8 A;  2JK3 A;  1QPI A;  3VTI A;  2OI8 A;  3BR1 A;  2TRT A;  4HKU A;  2R7T A;  2V57 A;  2QIB A;  5F08 A;  2FJ1 A;  2FX0 A;  3NPI A;  5FGL A;  4OD4 A;  3G7R A;  3CRJ A;  3CDL A;  2IEK A;  2VKE A;  3IH2 A;  5D19 A;  3O60 A;  3VVY A;  5HBU A;  5K7F A;  5FKN A;  3KZ9 A;  5CXI A;  4XK4 A;  2UXU A;  4JNN A;  3AQT A;  3MVP A;  2RAS A;  2XPW A;  4G12 A;  3ZQL A;  3B6A A;  3B81 A;  5FMP A;  4W1U A;  3BTJ A;  3VVX A;  3MNL A;  4DW6 A;  2WUI A;  2IAI A;  3PPB A;  1UI5 A;  5AQC A;  5IP6 A;  1JT6 A;  2YVX A;  3ZQG A;  3G1L A;  5CQG A;  5EZH A;  3TP3 A;  2VKV A;  3LSJ A;  2X9D A;  4M3E A;  2GUH A;  3BTL A;  4M3F A;  3KKC A;  3WHB A;  2ID3 A;  4X1E A;  4JKZ A;  1JUM A;  4MK6 A;  3Q0U A;  3RH2 A;  3BT9 A;  2ZCM A;  2HQ5 A;  5CW8 A;  2RAE A;  2QWT A;  2A2F X;  2R7V A;  1T33 A;  4B3A A;  2R7R A;  5IOZ A;  2HXO A;  1QVU A;  4V2G A;  5F27 A;  1T56 A;  3FIW A;  5K7H A;  3KNW A;  2XB5 A;  5F0C A;  5IOY A;  2R7S A;  3BR3 A;  3HTH A;  3KYL A;  5K58 A;  2PBX A;  5IPA A;  5J1R A;  3FHN A;  2VPR A;  2UXO A;  4M3G A;  2G3B A;  3HTA A;  4NN1 A;  3DEW A;  3ZQH A;  1JT0 A;  3NRG A;  5FKO A;  2GBY A;  2YVH A;  2R7U A;  2W53 A;  4KWA A;  3PM1 A;  2QKO A;  3F1B A;  4UDS A;  2TCT A;  3RD3 A;  2G7G A;  5EFY A;  3VVZ A;  2FJI 1;  4MO7 A;  2X6O A;  3BJB A;  2PZ9 A;  2ZOY A;  3E7Q A;  3G1O A;  3VP5 A;  2O7O A;  3LJL A;  2DG8 A;  4M3B A;  3AQS A;  3LSR A;  3VW0 A;  3Q3S A;  2Y30 A;  4AUX A;  3ZQI A;  3F0C A;  5EZG A;  3PAS A;  2UXH A;  2HXI A;  3B6C A;  3VOK A;  3SWH A;  5FKL A;  3Q0V A;  5D1R A;  1U9N A;  2IBD A;  2OPT A;  3FK6 A;  1RPW A;  3QQA A;  2G0E A;  1QVT A;  5D18 A;  4B1R A;  2HYJ A;  4OD5 A;  3CCY A;  4GFK A;  4ABZ A;  3ON4 A;  2REK A;  3S5R A;  3COL A;  3ANP A;  4D7N A;  1BJZ A;  3BNI A;  3Q0W A;  2QOP A;  4D5F A;  2XPU A;  3CWR A;  2Q24 A;  1A6I A;  4D5C A;  1JTX A;  3CJD A;  4GCK A;  5HAW A;  5CXG A;  2F07 A;  4IRV A;  3NNR A;  2B1E A;  3WHC A;  4WIB A;  3TP0 A;  3EGQ A;  3P9T A;  4YZE A;  2UXP A;  2YVE A;  3NS4 A;  2HYT A;  3V6G A;  5H9T A;  2HKU A;  3ON2 A;  3BR5 A;  2I10 A;  2R7X A;  3FRQ A;  1ZK8 A;  5GPC A;  4ACI A;  2WGB A;  2RHA A;  4I76 A;  5FKM A;  1RKW A;  2XGD A;  1SGM A;  3C07 A;  5F04 A;  4DVY P;  4I6Z A;  3SDG A;  2GFN A;  2NS7 A;  3T6N A;  3HE0 A;  2JJ7 A;  5FKK A;  2R7Q A;  3HGY A;  4AC0 A;  5J1U A;  2UXI A;  3IH4 A;  3O8H A;  3VOX A;  3KKD A;  4AF5 A;  2PFV A;  2DG7 A;  3VPR A;  3LSP A;  3G1M A;  1UI6 A;  3JSJ A;  3LOC A;  1JUP A;  2OF7 A;  5HSZ A;  4GCL A;  5K7Z A;  3FK7 A;  2ID6 A;  3LWJ A;  4JYK A;  3LHQ A;  2OER A;  2XPV A; 
#chains in the Genus database with same CATH homology
 2ZCX A;  5DAJ A;  1JTY A;  3G56 A;  3BRU A;  3HTI A;  4M3D A;  4AC6 A;  2IU5 A;  3ZQF A;  3O8G A;  3QKX A;  4ICH A;  3NI7 A;  3VIB A;  1Z77 A;  2ZCN A;  5F1J A;  4GCT A;  3QPL A;  3BTI A;  5F0H A;  2Y31 A;  1VI0 A;  3QPS A;  3EUP A;  4ME9 A;  2DTZ A;  3NXC A;  3QBM A;  3BR6 A;  5J1Y A;  2QTQ A;  4D7M A;  2QCO A;  2FQ4 A;  2G7S A;  3GEU A;  3HIM A;  3VW1 A;  2O7T A;  3ANG A;  3BTC A;  3BHQ A;  4GFL A;  3BR0 A;  5GP9 A;  3GZI A;  1RKT A;  2NP3 A;  4CGR A;  4V2F A;  2GEN A;  2FBQ A;  2NX4 A;  1U9O A;  2EH3 A;  5EYR A;  4JL3 A;  3V78 A;  4NEL A;  3IUV A;  1ORK A;  2FD5 A;  5FHP A;  2Y2Z A;  1ZKG A;  3HTJ A;  3HGG A;  2XDN A;  3IH3 A;  2ZOZ A;  4L62 A;  2ZB9 A;  3BR2 A;  2XGE A;  3BQZ A;  3VW2 A;  1JUS A;  3SFI A;  4PXI A;  4W97 A;  5C4Y A;  3BQY A;  3BCG A;  3C2B A;  2WV1 A;  2D6Y A;  4MXM A;  5J3L A;  1Z0X A;  3VUQ A;  5F0F A;  2XRL A;  3DPJ A;  2XGC A;  3DCF A;  2NP5 A;  5GPA A;  2G7L A;  2NS8 A;  2JK3 A;  1QPI A;  2OI8 A;  3BR1 A;  2TRT A;  4HKU A;  2V57 A;  2QIB A;  5F08 A;  2FJ1 A;  2FX0 A;  3NPI A;  5FGL A;  3G7R A;  3CRJ A;  3CDL A;  2IEK A;  2VKE A;  3IH2 A;  5D19 A;  3O60 A;  3VVY A;  5HBU A;  5K7F A;  5FKN A;  3KZ9 A;  5CXI A;  4XK4 A;  2UXU A;  4JNN A;  3AQT A;  3MVP A;  2RAS A;  2XPW A;  4G12 A;  3ZQL A;  3B6A A;  3B81 A;  5FMP A;  4W1U A;  3BTJ A;  3VVX A;  3MNL A;  4DW6 A;  2WUI A;  2IAI A;  3PPB A;  1UI5 A;  5AQC A;  5IP6 A;  1JT6 A;  3ZQG A;  3G1L A;  5EZH A;  3TP3 A;  2VKV A;  3LSJ A;  2X9D A;  4M3E A;  2GUH A;  3BTL A;  4M3F A;  3KKC A;  3WHB A;  2ID3 A;  4X1E A;  4JKZ A;  1JUM A;  4MK6 A;  3Q0U A;  3RH2 A;  3BT9 A;  2ZCM A;  2HQ5 A;  5CW8 A;  2RAE A;  2QWT A;  1T33 A;  4B3A A;  5IOZ A;  2HXO A;  1QVU A;  4V2G A;  5F27 A;  1T56 A;  3FIW A;  5K7H A;  3KNW A;  2XB5 A;  5F0C A;  5IOY A;  3BR3 A;  3HTH A;  5K58 A;  2PBX A;  5IPA A;  5J1R A;  2VPR A;  2UXO A;  4M3G A;  2G3B A;  3HTA A;  4NN1 A;  3DEW A;  3ZQH A;  1JT0 A;  3NRG A;  5FKO A;  2GBY A;  2YVH A;  2W53 A;  4KWA A;  3PM1 A;  2QKO A;  3F1B A;  4UDS A;  2TCT A;  3RD3 A;  2G7G A;  5EFY A;  3VVZ A;  4MO7 A;  2X6O A;  3BJB A;  2PZ9 A;  2ZOY A;  3E7Q A;  3G1O A;  3VP5 A;  2O7O A;  3LJL A;  2DG8 A;  4M3B A;  3AQS A;  3LSR A;  3VW0 A;  3Q3S A;  2Y30 A;  4AUX A;  3ZQI A;  3F0C A;  5EZG A;  3PAS A;  2UXH A;  2HXI A;  3B6C A;  3VOK A;  5FKL A;  3Q0V A;  5D1R A;  1U9N A;  2IBD A;  2OPT A;  3FK6 A;  1RPW A;  3QQA A;  2G0E A;  1QVT A;  5D18 A;  4B1R A;  2HYJ A;  3CCY A;  4GFK A;  4ABZ A;  3ON4 A;  2REK A;  3S5R A;  3COL A;  3ANP A;  4D7N A;  1BJZ A;  3BNI A;  3Q0W A;  2QOP A;  4D5F A;  2XPU A;  3CWR A;  2Q24 A;  1A6I A;  4D5C A;  1JTX A;  3CJD A;  4GCK A;  5HAW A;  5CXG A;  2F07 A;  3NNR A;  3WHC A;  3TP0 A;  3EGQ A;  3P9T A;  4YZE A;  2UXP A;  2YVE A;  2HYT A;  3V6G A;  5H9T A;  2HKU A;  3ON2 A;  3BR5 A;  2I10 A;  3FRQ A;  1ZK8 A;  5GPC A;  4ACI A;  2WGB A;  2RHA A;  4I76 A;  5FKM A;  1RKW A;  2XGD A;  1SGM A;  3C07 A;  5F04 A;  4I6Z A;  3SDG A;  2GFN A;  2NS7 A;  3T6N A;  3HE0 A;  2JJ7 A;  5FKK A;  3HGY A;  4AC0 A;  5J1U A;  2UXI A;  3IH4 A;  3O8H A;  3VOX A;  3KKD A;  4AF5 A;  2DG7 A;  3VPR A;  3LSP A;  3G1M A;  1UI6 A;  3JSJ A;  3LOC A;  1JUP A;  2OF7 A;  5HSZ A;  4GCL A;  5K7Z A;  3FK7 A;  2ID6 A;  3LWJ A;  4JYK A;  3LHQ A;  2OER A;  2XPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...