2IU5A

Dihydroxyacetone kinase operon activator dhas
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
179
structure length
179
Chain Sequence
MEKSIITQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQTFYNYFQNQEELLSWIFENDFAELINDNSDYYGWQNELLLLLRYLDENQIFYQKIFVIDKNFEHFFLIQWENLLDKVIFDQEKKSDYHWSDLEKSFICRYNAAAICAITRESIIRGNSLEKLYSQIVNLLLAQIKIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-TYPE DHAKLM OPERON TRANSCRIPTIONAL ACTIVATOR DHAS
publication title Regulation of the Dha Operon of Lactococcus Lactis: A Deviation from the Rule Followed by the Tetr Family of Transcription Regulators
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis il1403
molecule tags Transcription
total genus 74
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2iu5A00
2UXPA 3BR2A 3NXCA 3BRUA 4AF5A 1RPWA 2EH3A 3G1OA 2HXOA 5F1JA 1JT0A 2VKEA 2D6YA 2G7SA 1QPIA 3BTCA 3EUPA 2HXIA 2ZOYA 3KZ9A 5FKMA 2Y30A 3COLA 4G12A 3B6AA 2ZCMA 1A6IA 3AQSA 3QBMA 5F27A 4GCTA 3Q0VA 3VPRA 5CW8A 1Z77A 3BT9A 2JK3A 5CXGA 2GBYA 2IBDA 5K7FA 1SGMA 3HTJA 2IEKA 4MK6A 4B1RA 3VW2A 4I76A 3NPIA 5FKOA 5HSZA 5HAWA 4HKUA 3F1BA 2QKOA 2XPUA 3ZQFA 4D5FA 1ZKGA 1JUPA 3LJLA 3PPBA 3VIBA 3LSRA 3LSJA 3MVPA 4I6ZA 3FRQA 2OI8A 4NN1A 3CDLA 2GUHA 2NP5A 5K58A 4D7MA 2NS8A 2Y2ZA 3CJDA 3G56A 2XGEA 3VP5A 4AC0A 3GZIA 1U9NA 2NS7A 3Q0UA 2FX0A 4AC6A 3ZQIA 2G0EA 5K7HA 2G7GA 3HTHA 3ZQLA 3V78A 2G3BA 2HYTA 3HTIA 1ORKA 2NP3A 3ANGA 3BCGA 4KWAA 3RD3A 2DG8A 2OF7A 3AQTA 4B3AA 2OERA 1JTYA 2RAEA 5F08A 2XGCA 2ZCNA 2O7OA 2FBQA 4M3BA 5EZGA 1ZK8A 2HQ5A 2QOPA 2XDNA 5FMPA 2OPTA 5FKKA 2HYJA 4M3GA 3LWJA 3BTJA 5CXIA 5K7ZA 4YZEA 2X6OA 2WUIA 3IUVA 3QPLA 3B81A 1JT6A 5IOZA 3BQYA 2W53A 3BTLA 3CRJA 2TRTA 2XB5A 4D5CA 3BQZA 3WHCA 4M3FA 4GCKA 3VVYA 2GENA 3SFIA 3CWRA 2QTQA 2Q24A 5IP6A 5F04A 3LHQA 2REKA 4GFLA 3BTIA 3ANPA 3Q0WA 4GFKA 4L62A 5D19A 2XRLA 4ICHA 3HGYA 3KKDA 5FKNA 4CGRA 3HGGA 3HTAA 5IOYA 2QWTA 3FK6A 3IH3A 4GCLA 4JYKA 5FKLA 3CCYA 3B6CA 4ACIA 3Q3SA 4MO7A 4AUXA 4V2GA 5J1YA 5FGLA 5J1UA 3E7QA 5FHPA 2FD5A 3BR3A 3QKXA 5F0FA 2PZ9A 2WV1A 3F0CA 5GP9A 2ZOZA 3IH4A 3LSPA 3FIWA 5J1RA 1QVUA 3KNWA 3LOCA 3TP0A 3G7RA 2NX4A 4JL3A 2RHAA 3GEUA 3KKCA 5GPCA 4D7NA 1QVTA 1JUMA 3VOXA 2VKVA 2X9DA 5AQCA 4V2FA 4JNNA 3ZQGA 3O8GA 3QPSA 4ME9A 1VI0A 4JKZA 4NELA 2DTZA 2DG7A 2ZB9A 3ON4A 2JJ7A 2WGBA 3ZQHA 3IH2A 2UXUA 2O7TA 5EZHA 2RASA 2F07A 3PASA 1JUSA 2QIBA 5C4YA 3BNIA 1BJZA 1JTXA 3BR1A 1RKWA 4PXIA 2QCOA 2XPWA 5H9TA 3ON2A 3VVXA 2ID3A 5F0HA 3DEWA 3RH2A 4W97A 2FJ1A 2XGDA 3DCFA 5HBUA 3S5RA 4UDSA 5IPAA 1UI6A 5EFYA 1U9OA 1UI5A 3WHBA 2UXOA 1RKTA 3HE0A 4M3DA 2HKUA 4ABZA 2IU5A 3SDGA 3HIMA 3NI7A 2XPVA 3NNRA 3TP3A 3VW1A 2Y31A 3BHQA 3QQAA 3VUQA 3G1LA 5D1RA 5J3LA 3FK7A 3VVZA 2FQ4A 4DW6A 4XK4A 2VPRA 4MXMA 2PBXA 1T56A 2UXIA 3BR6A 3O8HA 2G7LA 3P9TA 2GFNA 2I10A 3V6GA 5EYRA 3C2BA 5GPAA 3DPJA 4M3EA 3VOKA 1T33A 2YVHA 3T6NA 3NRGA 2V57A 3BJBA 5D18A 5DAJA 3PM1A 4X1EA 5F0CA 3C07A 3BR5A 3EGQA 3MNLA 2ID6A 2UXHA 2YVEA 3JSJA 2ZCXA 2IAIA 3G1MA 1Z0XA 3O60A 4W1UA 3BR0A 2TCTA 3VW0A
chains in the Genus database with same CATH superfamily
2UXPA 3BR2A 3NXCA 3BRUA 4AF5A 1RPWA 2EH3A 3G1OA 2HXOA 5F1JA 1JT0A 2VKEA 2D6YA 2G7SA 1QPIA 3BTCA 3EUPA 2HXIA 2ZOYA 2PFVA 3KYLA 3KZ9A 5FKMA 2Y30A 3COLA 4G12A 3B6AA 2ZCMA 2FJI1 1A6IA 3AQSA 3QBMA 2R7TA 5F27A 4GCTA 3Q0VA 3FHNA 3VPRA 4U9LA 5CW8A 1Z77A 3BT9A 2JK3A 5CXGA 2GBYA 2IBDA 5K7FA 1SGMA 3HTJA 2IEKA 4MK6A 3K8PC 4B1RA 2B1EA 3VW2A 4I76A 3NPIA 5FKOA 5HSZA 5HAWA 4HKUA 3F1BA 2QKOA 2XPUA 3ZQFA 4D5FA 1ZKGA 1JUPA 3LJLA 3PPBA 3VIBA 3LSRA 3LSJA 3MVPA 4I6ZA 3FRQA 4IRVA 2OI8A 4NN1A 3CDLA 2GUHA 2NP5A 5K58A 4D7MA 2NS8A 2Y2ZA 3SWHA 3CJDA 3G56A 2XGEA 3VP5A 4AC0A 3GZIA 1U9NA 2NS7A 3Q0UA 2FX0A 4AC6A 3ZQIA 2G0EA 5K7HA 2G7GA 3HTHA 3ZQLA 3V78A 2G3BA 2HYTA 3HTIA 1ORKA 2NP3A 3ANGA 3BCGA 4KWAA 3RD3A 2DG8A 2OF7A 3AQTA 4B3AA 2OERA 1JTYA 2RAEA 4DVYP 5F08A 2XGCA 2ZCNA 2A2FX 4OD4A 2O7OA 2FBQA 4M3BA 5EZGA 1ZK8A 4OD5A 2HQ5A 2QOPA 2XDNA 5FMPA 2OPTA 5FKKA 2R7QA 2HYJA 4M3GA 3LWJA 3BTJA 5CXIA 5K7ZA 4YZEA 2X6OA 2WUIA 3IUVA 3QPLA 2R7WA 3B81A 1JT6A 5IOZA 3BQYA 2W53A 3BTLA 3CRJA 2TRTA 2XB5A 4D5CA 3BQZA 3WHCA 4M3FA 4GCKA 3VVYA 2GENA 3SFIA 3CWRA 2QTQA 2Q24A 5IP6A 5F04A 3LHQA 2REKA 4GFLA 3BTIA 3ANPA 3Q0WA 4GFKA 4L62A 5D19A 2XRLA 4ICHA 3HGYA 3KKDA 5FKNA 4CGRA 3HGGA 3HTAA 5IOYA 2QWTA 3FK6A 3IH3A 4GCLA 4JYKA 5FKLA 3CCYA 3B6CA 4ACIA 3Q3SA 4MO7A 4AUXA 4V2GA 5J1YA 5FGLA 5J1UA 3E7QA 5FHPA 2FD5A 4C2MA 3BR3A 3QKXA 2R7OA 5F0FA 2PZ9A 2WV1A 2ZY9A 3F0CA 5GP9A 2ZOZA 3IH4A 3LSPA 3FIWA 5J1RA 1QVUA 3KNWA 3LOCA 3TP0A 3G7RA 2NX4A 4JL3A 2RHAA 3GEUA 3KKCA 5GPCA 4D7NA 1QVTA 1JUMA 3VOXA 2VKVA 2X9DA 5AQCA 4V2FA 4JNNA 3ZQGA 3O8GA 3QPSA 4ME9A 1VI0A 4JKZA 4NELA 2DTZA 2DG7A 2ZB9A 3ON4A 2JJ7A 2WGBA 3ZQHA 3IH2A 2UXUA 2O7TA 5EZHA 2RASA 2F07A 3PASA 1JUSA 2QIBA 5C4YA 3BNIA 1BJZA 1JTXA 3BR1A 4WIBA 1RKWA 3DU6A 4PXIA 2QCOA 2XPWA 5H9TA 3ON2A 3VVXA 2ID3A 5F0HA 3DEWA 2R7VA 3RH2A 4W97A 2FJ1A 2XGDA 3DCFA 5HBUA 3S5RA 2R7SA 4UDSA 5IPAA 1UI6A 5EFYA 1U9OA 1UI5A 3WHBA 2UXOA 1RKTA 3HE0A 4M3DA 2HKUA 4ABZA 2IU5A 3SDGA 3HIMA 3VTIA 3NI7A 2XPVA 3NNRA 3TP3A 3VW1A 2Y31A 3BHQA 3QQAA 3VUQA 3G1LA 4U9NA 5D1RA 5J3LA 2YVXA 2B3WA 3FK7A 3VVZA 2R7UA 2FQ4A 4DW6A 3DU5A 4XK4A 2VPRA 4MXMA 2PBXA 5CQGA 3NS4A 1T56A 2UXIA 3BR6A 3O8HA 2G7LA 3P9TA 2GFNA 2I10A 3V6GA 5EYRA 3C2BA 5GPAA 3DPJA 4M3EA 3VOKA 1T33A 2YVHA 3T6NA 3NRGA 2V57A 3BJBA 5D18A 5DAJA 3PM1A 4X1EA 5F0CA 3C07A 2R7RA 3BR5A 3EGQA 3MNLA 2ID6A 2UXHA 2YVEA 3JSJA 2R7XA 2ZCXA 2IAIA 3G1MA 1Z0XA 3O60A 4W1UA 3BR0A 2TCTA 3VW0A
chains in the Genus database with same CATH topology
2UXPA 3BR2A 3NXCA 3BRUA 4AF5A 1RPWA 2EH3A 3G1OA 2HXOA 5F1JA 1JT0A 2VKEA 2D6YA 2G7SA 1QPIA 3BTCA 3EUPA 2HXIA 2ZOYA 3KZ9A 5FKMA 2Y30A 3COLA 4G12A 3B6AA 2ZCMA 1A6IA 3AQSA 3QBMA 5F27A 4GCTA 3Q0VA 3VPRA 5CW8A 1Z77A 3BT9A 2JK3A 5CXGA 2GBYA 2IBDA 5K7FA 1SGMA 3HTJA 2IEKA 4MK6A 4B1RA 3VW2A 4I76A 3NPIA 5FKOA 5HSZA 5HAWA 4HKUA 3F1BA 2QKOA 2XPUA 3ZQFA 4D5FA 1ZKGA 1JUPA 3LJLA 3PPBA 3VIBA 3LSRA 3LSJA 3MVPA 4I6ZA 3FRQA 2OI8A 4NN1A 3CDLA 2GUHA 2NP5A 5K58A 4D7MA 2NS8A 2Y2ZA 3CJDA 3G56A 2XGEA 3VP5A 4AC0A 3GZIA 1U9NA 2NS7A 3Q0UA 2FX0A 4AC6A 3ZQIA 2G0EA 5K7HA 2G7GA 3HTHA 3ZQLA 3V78A 2G3BA 2HYTA 3HTIA 1ORKA 2NP3A 3ANGA 3BCGA 4KWAA 3RD3A 2DG8A 2OF7A 3AQTA 4B3AA 2OERA 1JTYA 2RAEA 5F08A 2XGCA 2ZCNA 2O7OA 2FBQA 4M3BA 5EZGA 1ZK8A 2HQ5A 2QOPA 2XDNA 5FMPA 2OPTA 5FKKA 2HYJA 4M3GA 3LWJA 3BTJA 5CXIA 5K7ZA 4YZEA 2X6OA 2WUIA 3IUVA 3QPLA 3B81A 1JT6A 5IOZA 3BQYA 2W53A 3BTLA 3CRJA 2TRTA 2XB5A 4D5CA 3BQZA 3WHCA 4M3FA 4GCKA 3VVYA 2GENA 3SFIA 3CWRA 2QTQA 2Q24A 5IP6A 5F04A 3LHQA 2REKA 4GFLA 3BTIA 3ANPA 3Q0WA 4GFKA 4L62A 5D19A 2XRLA 4ICHA 3HGYA 3KKDA 5FKNA 4CGRA 3HGGA 3HTAA 5IOYA 2QWTA 3FK6A 3IH3A 4GCLA 4JYKA 5FKLA 3CCYA 3B6CA 4ACIA 3Q3SA 4MO7A 4AUXA 4V2GA 5J1YA 5FGLA 5J1UA 3E7QA 5FHPA 2FD5A 3BR3A 3QKXA 5F0FA 2PZ9A 2WV1A 3F0CA 5GP9A 2ZOZA 3IH4A 3LSPA 3FIWA 5J1RA 1QVUA 3KNWA 3LOCA 3TP0A 3G7RA 2NX4A 4JL3A 2RHAA 3GEUA 3KKCA 5GPCA 4D7NA 1QVTA 1JUMA 3VOXA 2VKVA 2X9DA 5AQCA 4V2FA 4JNNA 3ZQGA 3O8GA 3QPSA 4ME9A 1VI0A 4JKZA 4NELA 2DTZA 2DG7A 2ZB9A 3ON4A 2JJ7A 2WGBA 3ZQHA 3IH2A 2UXUA 2O7TA 5EZHA 2RASA 2F07A 3PASA 1JUSA 2QIBA 5C4YA 3BNIA 1BJZA 1JTXA 3BR1A 1RKWA 4PXIA 2QCOA 2XPWA 5H9TA 3ON2A 3VVXA 2ID3A 5F0HA 3DEWA 3RH2A 4W97A 2FJ1A 2XGDA 3DCFA 5HBUA 3S5RA 4UDSA 5IPAA 1UI6A 5EFYA 1U9OA 1UI5A 3WHBA 2UXOA 1RKTA 3HE0A 4M3DA 2HKUA 4ABZA 2IU5A 3SDGA 3HIMA 3NI7A 2XPVA 3NNRA 3TP3A 3VW1A 2Y31A 3BHQA 3QQAA 3VUQA 3G1LA 5D1RA 5J3LA 3FK7A 3VVZA 2FQ4A 4DW6A 4XK4A 2VPRA 4MXMA 2PBXA 1T56A 2UXIA 3BR6A 3O8HA 2G7LA 3P9TA 2GFNA 2I10A 3V6GA 5EYRA 3C2BA 5GPAA 3DPJA 4M3EA 3VOKA 1T33A 2YVHA 3T6NA 3NRGA 2V57A 3BJBA 5D18A 5DAJA 3PM1A 4X1EA 5F0CA 3C07A 3BR5A 3EGQA 3MNLA 2ID6A 2UXHA 2YVEA 3JSJA 2ZCXA 2IAIA 3G1MA 1Z0XA 3O60A 4W1UA 3BR0A 2TCTA 3VW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXP A;  3BR2 A;  3NXC A;  3BRU A;  4AF5 A;  1RPW A;  2EH3 A;  3G1O A;  2HXO A;  5F1J A;  1JT0 A;  2VKE A;  2D6Y A;  2G7S A;  1QPI A;  3BTC A;  3EUP A;  2HXI A;  2ZOY A;  3KZ9 A;  5FKM A;  2Y30 A;  3COL A;  4G12 A;  3B6A A;  2ZCM A;  1A6I A;  3AQS A;  3QBM A;  5F27 A;  4GCT A;  3Q0V A;  3VPR A;  5CW8 A;  1Z77 A;  3BT9 A;  2JK3 A;  5CXG A;  2GBY A;  2IBD A;  5K7F A;  1SGM A;  3HTJ A;  2IEK A;  4MK6 A;  4B1R A;  3VW2 A;  4I76 A;  3NPI A;  5FKO A;  5HSZ A;  5HAW A;  4HKU A;  3F1B A;  2QKO A;  2XPU A;  3ZQF A;  4D5F A;  1ZKG A;  1JUP A;  3LJL A;  3PPB A;  3VIB A;  3LSR A;  3LSJ A;  3MVP A;  4I6Z A;  3FRQ A;  2OI8 A;  4NN1 A;  3CDL A;  2GUH A;  2NP5 A;  5K58 A;  4D7M A;  2NS8 A;  2Y2Z A;  3CJD A;  3G56 A;  2XGE A;  3VP5 A;  4AC0 A;  3GZI A;  1U9N A;  2NS7 A;  3Q0U A;  2FX0 A;  4AC6 A;  3ZQI A;  2G0E A;  5K7H A;  2G7G A;  3HTH A;  3ZQL A;  3V78 A;  2G3B A;  2HYT A;  3HTI A;  1ORK A;  2NP3 A;  3ANG A;  3BCG A;  4KWA A;  3RD3 A;  2DG8 A;  2OF7 A;  3AQT A;  4B3A A;  2OER A;  1JTY A;  2RAE A;  5F08 A;  2XGC A;  2ZCN A;  2O7O A;  2FBQ A;  4M3B A;  5EZG A;  1ZK8 A;  2HQ5 A;  2QOP A;  2XDN A;  5FMP A;  2OPT A;  5FKK A;  2HYJ A;  4M3G A;  3LWJ A;  3BTJ A;  5CXI A;  5K7Z A;  4YZE A;  2X6O A;  2WUI A;  3IUV A;  3QPL A;  3B81 A;  1JT6 A;  5IOZ A;  3BQY A;  2W53 A;  3BTL A;  3CRJ A;  2TRT A;  2XB5 A;  4D5C A;  3BQZ A;  3WHC A;  4M3F A;  4GCK A;  3VVY A;  2GEN A;  3SFI A;  3CWR A;  2QTQ A;  2Q24 A;  5IP6 A;  5F04 A;  3LHQ A;  2REK A;  4GFL A;  3BTI A;  3ANP A;  3Q0W A;  4GFK A;  4L62 A;  5D19 A;  2XRL A;  4ICH A;  3HGY A;  3KKD A;  5FKN A;  4CGR A;  3HGG A;  3HTA A;  5IOY A;  2QWT A;  3FK6 A;  3IH3 A;  4GCL A;  4JYK A;  5FKL A;  3CCY A;  3B6C A;  4ACI A;  3Q3S A;  4MO7 A;  4AUX A;  4V2G A;  5J1Y A;  5FGL A;  5J1U A;  3E7Q A;  5FHP A;  2FD5 A;  3BR3 A;  3QKX A;  5F0F A;  2PZ9 A;  2WV1 A;  3F0C A;  5GP9 A;  2ZOZ A;  3IH4 A;  3LSP A;  3FIW A;  5J1R A;  1QVU A;  3KNW A;  3LOC A;  3TP0 A;  3G7R A;  2NX4 A;  4JL3 A;  2RHA A;  3GEU A;  3KKC A;  5GPC A;  4D7N A;  1QVT A;  1JUM A;  3VOX A;  2VKV A;  2X9D A;  5AQC A;  4V2F A;  4JNN A;  3ZQG A;  3O8G A;  3QPS A;  4ME9 A;  1VI0 A;  4JKZ A;  4NEL A;  2DTZ A;  2DG7 A;  2ZB9 A;  3ON4 A;  2JJ7 A;  2WGB A;  3ZQH A;  3IH2 A;  2UXU A;  2O7T A;  5EZH A;  2RAS A;  2F07 A;  3PAS A;  1JUS A;  2QIB A;  5C4Y A;  3BNI A;  1BJZ A;  1JTX A;  3BR1 A;  1RKW A;  4PXI A;  2QCO A;  2XPW A;  5H9T A;  3ON2 A;  3VVX A;  2ID3 A;  5F0H A;  3DEW A;  3RH2 A;  4W97 A;  2FJ1 A;  2XGD A;  3DCF A;  5HBU A;  3S5R A;  4UDS A;  5IPA A;  1UI6 A;  5EFY A;  1U9O A;  1UI5 A;  3WHB A;  2UXO A;  1RKT A;  3HE0 A;  4M3D A;  2HKU A;  4ABZ A;  2IU5 A;  3SDG A;  3HIM A;  3NI7 A;  2XPV A;  3NNR A;  3TP3 A;  3VW1 A;  2Y31 A;  3BHQ A;  3QQA A;  3VUQ A;  3G1L A;  5D1R A;  5J3L A;  3FK7 A;  3VVZ A;  2FQ4 A;  4DW6 A;  4XK4 A;  2VPR A;  4MXM A;  2PBX A;  1T56 A;  2UXI A;  3BR6 A;  3O8H A;  2G7L A;  3P9T A;  2GFN A;  2I10 A;  3V6G A;  5EYR A;  3C2B A;  5GPA A;  3DPJ A;  4M3E A;  3VOK A;  1T33 A;  2YVH A;  3T6N A;  3NRG A;  2V57 A;  3BJB A;  5D18 A;  5DAJ A;  3PM1 A;  4X1E A;  5F0C A;  3C07 A;  3BR5 A;  3EGQ A;  3MNL A;  2ID6 A;  2UXH A;  2YVE A;  3JSJ A;  2ZCX A;  2IAI A;  3G1M A;  1Z0X A;  3O60 A;  4W1U A;  3BR0 A;  2TCT A;  3VW0 A; 
#chains in the Genus database with same CATH topology
 2UXP A;  3BR2 A;  3NXC A;  3BRU A;  4AF5 A;  1RPW A;  2EH3 A;  3G1O A;  2HXO A;  5F1J A;  1JT0 A;  2VKE A;  2D6Y A;  2G7S A;  1QPI A;  3BTC A;  3EUP A;  2HXI A;  2ZOY A;  2PFV A;  3KYL A;  3KZ9 A;  5FKM A;  2Y30 A;  3COL A;  4G12 A;  3B6A A;  2ZCM A;  2FJI 1;  1A6I A;  3AQS A;  3QBM A;  2R7T A;  5F27 A;  4GCT A;  3Q0V A;  3FHN A;  3VPR A;  4U9L A;  5CW8 A;  1Z77 A;  3BT9 A;  2JK3 A;  5CXG A;  2GBY A;  2IBD A;  5K7F A;  1SGM A;  3HTJ A;  2IEK A;  4MK6 A;  3K8P C;  4B1R A;  2B1E A;  3VW2 A;  4I76 A;  3NPI A;  5FKO A;  5HSZ A;  5HAW A;  4HKU A;  3F1B A;  2QKO A;  2XPU A;  3ZQF A;  4D5F A;  1ZKG A;  1JUP A;  3LJL A;  3PPB A;  3VIB A;  3LSR A;  3LSJ A;  3MVP A;  4I6Z A;  3FRQ A;  4IRV A;  2OI8 A;  4NN1 A;  3CDL A;  2GUH A;  2NP5 A;  5K58 A;  4D7M A;  2NS8 A;  2Y2Z A;  3SWH A;  3CJD A;  3G56 A;  2XGE A;  3VP5 A;  4AC0 A;  3GZI A;  1U9N A;  2NS7 A;  3Q0U A;  2FX0 A;  4AC6 A;  3ZQI A;  2G0E A;  5K7H A;  2G7G A;  3HTH A;  3ZQL A;  3V78 A;  2G3B A;  2HYT A;  3HTI A;  1ORK A;  2NP3 A;  3ANG A;  3BCG A;  4KWA A;  3RD3 A;  2DG8 A;  2OF7 A;  3AQT A;  4B3A A;  2OER A;  1JTY A;  2RAE A;  4DVY P;  5F08 A;  2XGC A;  2ZCN A;  2A2F X;  4OD4 A;  2O7O A;  2FBQ A;  4M3B A;  5EZG A;  1ZK8 A;  4OD5 A;  2HQ5 A;  2QOP A;  2XDN A;  5FMP A;  2OPT A;  5FKK A;  2R7Q A;  2HYJ A;  4M3G A;  3LWJ A;  3BTJ A;  5CXI A;  5K7Z A;  4YZE A;  2X6O A;  2WUI A;  3IUV A;  3QPL A;  2R7W A;  3B81 A;  1JT6 A;  5IOZ A;  3BQY A;  2W53 A;  3BTL A;  3CRJ A;  2TRT A;  2XB5 A;  4D5C A;  3BQZ A;  3WHC A;  4M3F A;  4GCK A;  3VVY A;  2GEN A;  3SFI A;  3CWR A;  2QTQ A;  2Q24 A;  5IP6 A;  5F04 A;  3LHQ A;  2REK A;  4GFL A;  3BTI A;  3ANP A;  3Q0W A;  4GFK A;  4L62 A;  5D19 A;  2XRL A;  4ICH A;  3HGY A;  3KKD A;  5FKN A;  4CGR A;  3HGG A;  3HTA A;  5IOY A;  2QWT A;  3FK6 A;  3IH3 A;  4GCL A;  4JYK A;  5FKL A;  3CCY A;  3B6C A;  4ACI A;  3Q3S A;  4MO7 A;  4AUX A;  4V2G A;  5J1Y A;  5FGL A;  5J1U A;  3E7Q A;  5FHP A;  2FD5 A;  4C2M A;  3BR3 A;  3QKX A;  2R7O A;  5F0F A;  2PZ9 A;  2WV1 A;  2ZY9 A;  3F0C A;  5GP9 A;  2ZOZ A;  3IH4 A;  3LSP A;  3FIW A;  5J1R A;  1QVU A;  3KNW A;  3LOC A;  3TP0 A;  3G7R A;  2NX4 A;  4JL3 A;  2RHA A;  3GEU A;  3KKC A;  5GPC A;  4D7N A;  1QVT A;  1JUM A;  3VOX A;  2VKV A;  2X9D A;  5AQC A;  4V2F A;  4JNN A;  3ZQG A;  3O8G A;  3QPS A;  4ME9 A;  1VI0 A;  4JKZ A;  4NEL A;  2DTZ A;  2DG7 A;  2ZB9 A;  3ON4 A;  2JJ7 A;  2WGB A;  3ZQH A;  3IH2 A;  2UXU A;  2O7T A;  5EZH A;  2RAS A;  2F07 A;  3PAS A;  1JUS A;  2QIB A;  5C4Y A;  3BNI A;  1BJZ A;  1JTX A;  3BR1 A;  4WIB A;  1RKW A;  3DU6 A;  4PXI A;  2QCO A;  2XPW A;  5H9T A;  3ON2 A;  3VVX A;  2ID3 A;  5F0H A;  3DEW A;  2R7V A;  3RH2 A;  4W97 A;  2FJ1 A;  2XGD A;  3DCF A;  5HBU A;  3S5R A;  2R7S A;  4UDS A;  5IPA A;  1UI6 A;  5EFY A;  1U9O A;  1UI5 A;  3WHB A;  2UXO A;  1RKT A;  3HE0 A;  4M3D A;  2HKU A;  4ABZ A;  2IU5 A;  3SDG A;  3HIM A;  3VTI A;  3NI7 A;  2XPV A;  3NNR A;  3TP3 A;  3VW1 A;  2Y31 A;  3BHQ A;  3QQA A;  3VUQ A;  3G1L A;  4U9N A;  5D1R A;  5J3L A;  2YVX A;  2B3W A;  3FK7 A;  3VVZ A;  2R7U A;  2FQ4 A;  4DW6 A;  3DU5 A;  4XK4 A;  2VPR A;  4MXM A;  2PBX A;  5CQG A;  3NS4 A;  1T56 A;  2UXI A;  3BR6 A;  3O8H A;  2G7L A;  3P9T A;  2GFN A;  2I10 A;  3V6G A;  5EYR A;  3C2B A;  5GPA A;  3DPJ A;  4M3E A;  3VOK A;  1T33 A;  2YVH A;  3T6N A;  3NRG A;  2V57 A;  3BJB A;  5D18 A;  5DAJ A;  3PM1 A;  4X1E A;  5F0C A;  3C07 A;  2R7R A;  3BR5 A;  3EGQ A;  3MNL A;  2ID6 A;  2UXH A;  2YVE A;  3JSJ A;  2R7X A;  2ZCX A;  2IAI A;  3G1M A;  1Z0X A;  3O60 A;  4W1U A;  3BR0 A;  2TCT A;  3VW0 A; 
#chains in the Genus database with same CATH homology
 2UXP A;  3BR2 A;  3NXC A;  3BRU A;  4AF5 A;  1RPW A;  2EH3 A;  3G1O A;  2HXO A;  5F1J A;  1JT0 A;  2VKE A;  2D6Y A;  2G7S A;  1QPI A;  3BTC A;  3EUP A;  2HXI A;  2ZOY A;  3KZ9 A;  5FKM A;  2Y30 A;  3COL A;  4G12 A;  3B6A A;  2ZCM A;  1A6I A;  3AQS A;  3QBM A;  5F27 A;  4GCT A;  3Q0V A;  3VPR A;  5CW8 A;  1Z77 A;  3BT9 A;  2JK3 A;  5CXG A;  2GBY A;  2IBD A;  5K7F A;  1SGM A;  3HTJ A;  2IEK A;  4MK6 A;  4B1R A;  3VW2 A;  4I76 A;  3NPI A;  5FKO A;  5HSZ A;  5HAW A;  4HKU A;  3F1B A;  2QKO A;  2XPU A;  3ZQF A;  4D5F A;  1ZKG A;  1JUP A;  3LJL A;  3PPB A;  3VIB A;  3LSR A;  3LSJ A;  3MVP A;  4I6Z A;  3FRQ A;  2OI8 A;  4NN1 A;  3CDL A;  2GUH A;  2NP5 A;  5K58 A;  4D7M A;  2NS8 A;  2Y2Z A;  3CJD A;  3G56 A;  2XGE A;  3VP5 A;  4AC0 A;  3GZI A;  1U9N A;  2NS7 A;  3Q0U A;  2FX0 A;  4AC6 A;  3ZQI A;  2G0E A;  5K7H A;  2G7G A;  3HTH A;  3ZQL A;  3V78 A;  2G3B A;  2HYT A;  3HTI A;  1ORK A;  2NP3 A;  3ANG A;  3BCG A;  4KWA A;  3RD3 A;  2DG8 A;  2OF7 A;  3AQT A;  4B3A A;  2OER A;  1JTY A;  2RAE A;  5F08 A;  2XGC A;  2ZCN A;  2O7O A;  2FBQ A;  4M3B A;  5EZG A;  1ZK8 A;  2HQ5 A;  2QOP A;  2XDN A;  5FMP A;  2OPT A;  5FKK A;  2HYJ A;  4M3G A;  3LWJ A;  3BTJ A;  5CXI A;  5K7Z A;  4YZE A;  2X6O A;  2WUI A;  3IUV A;  3QPL A;  3B81 A;  1JT6 A;  5IOZ A;  3BQY A;  2W53 A;  3BTL A;  3CRJ A;  2TRT A;  2XB5 A;  4D5C A;  3BQZ A;  3WHC A;  4M3F A;  4GCK A;  3VVY A;  2GEN A;  3SFI A;  3CWR A;  2QTQ A;  2Q24 A;  5IP6 A;  5F04 A;  3LHQ A;  2REK A;  4GFL A;  3BTI A;  3ANP A;  3Q0W A;  4GFK A;  4L62 A;  5D19 A;  2XRL A;  4ICH A;  3HGY A;  3KKD A;  5FKN A;  4CGR A;  3HGG A;  3HTA A;  5IOY A;  2QWT A;  3FK6 A;  3IH3 A;  4GCL A;  4JYK A;  5FKL A;  3CCY A;  3B6C A;  4ACI A;  3Q3S A;  4MO7 A;  4AUX A;  4V2G A;  5J1Y A;  5FGL A;  5J1U A;  3E7Q A;  5FHP A;  2FD5 A;  3BR3 A;  3QKX A;  5F0F A;  2PZ9 A;  2WV1 A;  3F0C A;  5GP9 A;  2ZOZ A;  3IH4 A;  3LSP A;  3FIW A;  5J1R A;  1QVU A;  3KNW A;  3LOC A;  3TP0 A;  3G7R A;  2NX4 A;  4JL3 A;  2RHA A;  3GEU A;  3KKC A;  5GPC A;  4D7N A;  1QVT A;  1JUM A;  3VOX A;  2VKV A;  2X9D A;  5AQC A;  4V2F A;  4JNN A;  3ZQG A;  3O8G A;  3QPS A;  4ME9 A;  1VI0 A;  4JKZ A;  4NEL A;  2DTZ A;  2DG7 A;  2ZB9 A;  3ON4 A;  2JJ7 A;  2WGB A;  3ZQH A;  3IH2 A;  2UXU A;  2O7T A;  5EZH A;  2RAS A;  2F07 A;  3PAS A;  1JUS A;  2QIB A;  5C4Y A;  3BNI A;  1BJZ A;  1JTX A;  3BR1 A;  1RKW A;  4PXI A;  2QCO A;  2XPW A;  5H9T A;  3ON2 A;  3VVX A;  2ID3 A;  5F0H A;  3DEW A;  3RH2 A;  4W97 A;  2FJ1 A;  2XGD A;  3DCF A;  5HBU A;  3S5R A;  4UDS A;  5IPA A;  1UI6 A;  5EFY A;  1U9O A;  1UI5 A;  3WHB A;  2UXO A;  1RKT A;  3HE0 A;  4M3D A;  2HKU A;  4ABZ A;  2IU5 A;  3SDG A;  3HIM A;  3NI7 A;  2XPV A;  3NNR A;  3TP3 A;  3VW1 A;  2Y31 A;  3BHQ A;  3QQA A;  3VUQ A;  3G1L A;  5D1R A;  5J3L A;  3FK7 A;  3VVZ A;  2FQ4 A;  4DW6 A;  4XK4 A;  2VPR A;  4MXM A;  2PBX A;  1T56 A;  2UXI A;  3BR6 A;  3O8H A;  2G7L A;  3P9T A;  2GFN A;  2I10 A;  3V6G A;  5EYR A;  3C2B A;  5GPA A;  3DPJ A;  4M3E A;  3VOK A;  1T33 A;  2YVH A;  3T6N A;  3NRG A;  2V57 A;  3BJB A;  5D18 A;  5DAJ A;  3PM1 A;  4X1E A;  5F0C A;  3C07 A;  3BR5 A;  3EGQ A;  3MNL A;  2ID6 A;  2UXH A;  2YVE A;  3JSJ A;  2ZCX A;  2IAI A;  3G1M A;  1Z0X A;  3O60 A;  4W1U A;  3BR0 A;  2TCT A;  3VW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...