2IU9A

Chlamydia trachomatis lpxd with 100mm udpglcnac (complex ii)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
346
structure length
346
Chain Sequence
MSQSTYSLEQLADFLKVEFQGNGATLLSGVEEIEEAKTAHITFLDNEKYAKHLKSSEAGAIIISRTQFQKYRDLNKNFLITSESPSLVFQKCLELFITPVDSGFPGIHPTAVIHPTAIIEDHVCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPGAVIGSCGFGYVTSAFGQHKHLKHLGKVIIEDDVEIGANTTIDRGRFKHSVVREGSKIDNLVQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPGIYGGAPARPYQEIHRQVAKVRNLPRLEERIAALEKLVQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Reactivity of Lpxd, the N-Acyltransferase of Lipid a Biosynthesis
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Transferase
molecule keywords UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-ACYLTRANSFERASE
total genus 111
structure length 346
sequence length 346
chains with identical sequence B, C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2iu9A02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 2iu9A01
3ST8A 2I5KA 1KK4A 2JF3A 5F42A 3TWDA 3ZM6A 3R8YA 3D8VA 4C13A 3FSBA 3OW5A 4M2AA 1XHDA 3BFPA 4R7PA 1FXJA 4KPZA 4E6TA 1Z90A 3KWCA 2IC7A 3CJ8A 3ECTA 1LXAA 2WLFA 3MQGA 2V0IA 4AC3A 2WLDA 4MYOA 1E8CA 5E3RA 3GUEA 3R5CA 5AFUU 4E75A 2AM2A 3V4EA 1HM0A 1T3DA 3FSXA 4HZCA 4ISXA 4FCEA 4G3SA 4IHGA 3DK5A 2V0JA 3EEVA 3DJ4A 4HZDA 2XJAA 4MZUA 3VBKA 3BSWA 4EGGA 3IGJA 4KPXA 2GGOA 1FWYA 1XATA 1QRMA 3I3AA 3TDTA 1TDTA 2TDTA 1V67A 5DEMA 1KRRA 3HSQA 3VBIA 3VBLA 2AM1A 2P2OA 4E6UA 3MQHA 4EA9A 4K6RA 5E3PA 5U2KA 4EA8A 3GOSA 2WTZA 3R1WA 4N6BA 3R5DA 3FTTA 4CVMA 1KGQA 1G97A 2IU9A 2W0WA 3FWWA 3MC4A 2FKOA 3R0SA 3DHOA 4IHFA 1KGTA 3FSCA 2OEFA 2OI5A 3OUPA 3P1BA 4KNRA 3TIOA 4EAAA 1OCXA 2WLEA 3FSYA 3EG4A 2QIVX 1QRLA 1KK5A 1HM9A 3R3IA 3T57A 4QF5A 4BUBA 2WLCA 4DCLA 2GGQA 2ICYA 4H7OA 2QKXA 3F1XA 1HM8A 5L6VA 4M9CA 1KHRA 3HJJA 2OI7A 3R5AA 1SSMA 3TISA 3FS8A 3OU9A 2JF2A 4G3QA 3JQYA 2OI6A 2OEGA 3BXYA 3C8VA 3SRTA 1J2ZA 3BSYA 2W0VA 3P47A 5E3QA 4E1KA 4E79A 4ZIYA 3OTZA 3GVDA 4N27A 1MR9A 3NZ2A 4KQLA 4M98A 3R2WA 5DEPA 3TV0A 1GG4A 4AAWA 2AQ9A 2IUAA 4M28A 5DG3A 2V0KA 3BSSA 3VBMA 4EA7A 4MFGA 5ADXV 3D98A 3VNPA 1MR7A 3R5BA 1QRFA 4HCQA 3SPTA 4R37A 1SSQA 3ZM5A 4N6AA 1QRGA 3PMOA 5L6SA 4R36A 1S80A 1KRUA 4HURA 5ADXU 2Q4JA 3ZL8A 1QQ0A 1SSTA 1YP4A 1HV9A 3R3RA 4M2BA 4EABA 1KRVA 3IXCA 4M99A 4J09A 4KNXA 3I3XA 4C12A 1MRLA 1YP3A 3BRKX 1G95A 4J18A 1QREA 4G87A 2VHEA 4QDIA 4CVLA 4EQYA 2V0HA 1THJA 3OTMA 3EH0A 4G3PA 2ICXA 2IU8A 2VD4A 1V3WA 2WLGA 3VBPA 5AFUV 2RIJA 4N69A 3FOQA 4CVKA 2NPOA 3KWEA 3Q1XA 3KWDA 4AA7A 3TK8A 1KQAA 2V0LA 2XATA 1KK6A 2QIAA 3VBJA 3VBNA 1YP2A 4IHHA 4HUSA
chains in the Genus database with same CATH superfamily
3ST8A 2I5KA 1KK4A 2JF3A 5F42A 3TWDA 2FYWA 3R8YA 3D8VA 3ZM6A 3FSBA 4C13A 3OW5A 4M2AA 1XHDA 3BFPA 4R7PA 1FXJA 4KPZA 4E6TA 1Z90A 3KWCA 2IC7A 3CJ8A 3ECTA 1LXAA 2WLFA 3MQGA 2V0IA 4AC3A 2WLDA 4MYOA 1E8CA 5E3RA 3GUEA 3R5CA 5AFUU 3WSGA 4E75A 2AM2A 3V4EA 1HM0A 1T3DA 3FSXA 3OH4A 4HZCA 4ISXA 2IOJA 1KO7A 4FCEA 4G3SA 4IHGA 1NMPA 3DK5A 2V0JA 3EEVA 3DJ4A 4HZDA 2XJAA 4MZUA 3VBKA 3BSWA 4EGGA 3IGJA 4KPXA 2GGOA 1FWYA 1XATA 1QRMA 3I3AA 3TDTA 1TDTA 2TDTA 1V67A 5DEMA 1KRRA 3HSQA 3VBIA 3VBLA 2AM1A 2P2OA 4E6UA 3MQHA 4EA9A 4K6RA 5E3PA 5U2KA 4EA8A 3GOSA 2WTZA 3R1WA 4N6BA 3R5DA 3FTTA 4CVMA 1KGQA 1G97A 2IU9A 2W0WA 3FWWA 3MC4A 2FKOA 3R0SA 3SUCA 3GQ9A 3DHOA 4IHFA 1KGTA 3FSCA 2OEFA 2OI5A 3OUPA 3P1BA 4KNRA 3TIOA 4EAAA 1OCXA 2WLEA 3FSYA 3EG4A 2QIVX 4IWMA 1QRLA 1KK5A 1HM9A 3R3IA 3T57A 4QF5A 4BUBA 2WLCA 4DCLA 3EEQA 2GGQA 2ICYA 4H7OA 1N4IA 2QKXA 3WSHA 3F1XA 1HM8A 5L6VA 1GG4A 4M9CA 1KHRA 3HJJA 2OI7A 3R5AA 1SSMA 3TISA 3FS8A 3OU9A 2JF2A 4G3QA 3JQYA 2OI6A 2OEGA 3BXYA 3C8VA 3SRTA 1EWWA 3OGZA 1J2ZA 3OH2A 3BSYA 3GQ8A 2W0VA 3P47A 5E3QA 3OH3A 4E1KA 4E79A 4ZIYA 3OTZA 3GVDA 4N27A 1MR9A 3NZ2A 4KQLA 4M98A 3R2WA 5DEPA 3TV0A 3GQ7A 4AAWA 2AQ9A 2IUAA 4M28A 5DG3A 2V0KA 3BSSA 3VBMA 4EA7A 3GQAA 4MFGA 5ADXV 3D98A 3VNPA 1MR7A 3R5BA 3L2BA 3WSEA 1QRFA 4HCQA 3SPTA 4R37A 1SSQA 3ZM5A 4N6AA 1QRGA 3PMOA 5L6SA 3L31A 4R36A 1S80A 1KRUA 1M8NA 4HURA 5ADXU 2Q4JA 3WSDA 3ZL8A 1QQ0A 1SSTA 1YP4A 3WSFA 4IWGA 1HV9A 3R3RA 1Z2FA 4M2BA 4EABA 1KRVA 3IXCA 4M99A 4J09A 4KNXA 3I3XA 4C12A 1MRLA 1YP3A 3BRKX 1G95A 1L0SA 4J18A 1QREA 4G87A 2VHEA 1NMOA 4QDIA 4EQYA 4CVLA 2V0HA 1THJA 3OTMA 3EH0A 4G3PA 2ICXA 2IU8A 2VD4A 3OH1A 1V3WA 2WLGA 3VBPA 3WSIA 5AFUV 2RIJA 4N69A 3FOQA 4CVKA 3OH0A 2NPOA 3KWEA 3Q1XA 3KWDA 4AA7A 3TK8A 1KQAA 2V0LA 2XATA 1KK6A 2QIAA 2YYBA 3VBJA 3VBNA 1KNXA 1YP2A 4IHHA 4HUSA
chains in the Genus database with same CATH topology
3ST8A 2I5KA 1KK4A 2JF3A 5F42A 3TWDA 3ZM6A 3R8YA 3D8VA 4C13A 3FSBA 3OW5A 4M2AA 1XHDA 3BFPA 4R7PA 1FXJA 4KPZA 4E6TA 1Z90A 3KWCA 2IC7A 3CJ8A 3ECTA 1LXAA 2WLFA 3MQGA 2V0IA 4AC3A 2WLDA 4MYOA 1E8CA 5E3RA 3GUEA 3R5CA 5AFUU 4E75A 2AM2A 3V4EA 1HM0A 1T3DA 3FSXA 4HZCA 4ISXA 4FCEA 4G3SA 4IHGA 3DK5A 2V0JA 3EEVA 3DJ4A 4HZDA 2XJAA 4MZUA 3VBKA 3BSWA 4EGGA 3IGJA 4KPXA 2GGOA 1FWYA 1XATA 1QRMA 3I3AA 3TDTA 1TDTA 2TDTA 1V67A 5DEMA 1KRRA 3HSQA 3VBIA 3VBLA 2AM1A 2P2OA 4E6UA 3MQHA 4EA9A 4K6RA 5E3PA 5U2KA 4EA8A 3GOSA 2WTZA 3R1WA 4N6BA 3R5DA 3FTTA 4CVMA 1KGQA 1G97A 2IU9A 2W0WA 3FWWA 3MC4A 2FKOA 3R0SA 3DHOA 4IHFA 1KGTA 3FSCA 2OEFA 2OI5A 3OUPA 3P1BA 4KNRA 3TIOA 4EAAA 1OCXA 2WLEA 3FSYA 3EG4A 2QIVX 1QRLA 1KK5A 1HM9A 3R3IA 3T57A 4QF5A 4BUBA 2WLCA 4DCLA 2GGQA 2ICYA 4H7OA 2QKXA 3F1XA 1HM8A 5L6VA 4M9CA 1KHRA 3HJJA 2OI7A 3R5AA 1SSMA 3TISA 3FS8A 3OU9A 2JF2A 4G3QA 3JQYA 2OI6A 2OEGA 3BXYA 3C8VA 3SRTA 1J2ZA 3BSYA 2W0VA 3P47A 5E3QA 4E1KA 4E79A 4ZIYA 3OTZA 3GVDA 4N27A 1MR9A 3NZ2A 4KQLA 4M98A 3R2WA 5DEPA 3TV0A 1GG4A 4AAWA 2AQ9A 2IUAA 4M28A 5DG3A 2V0KA 3BSSA 3VBMA 4EA7A 4MFGA 5ADXV 3D98A 3VNPA 1MR7A 3R5BA 1QRFA 4HCQA 3SPTA 4R37A 1SSQA 3ZM5A 4N6AA 1QRGA 3PMOA 5L6SA 4R36A 1S80A 1KRUA 4HURA 5ADXU 2Q4JA 3ZL8A 1QQ0A 1SSTA 1YP4A 1HV9A 3R3RA 4M2BA 4EABA 1KRVA 3IXCA 4M99A 4J09A 4KNXA 3I3XA 4C12A 1MRLA 1YP3A 3BRKX 1G95A 4J18A 1QREA 4G87A 2VHEA 4QDIA 4CVLA 4EQYA 2V0HA 1THJA 3OTMA 3EH0A 4G3PA 2ICXA 2IU8A 2VD4A 1V3WA 2WLGA 3VBPA 5AFUV 2RIJA 4N69A 3FOQA 4CVKA 2NPOA 3KWEA 3Q1XA 3KWDA 4AA7A 3TK8A 1KQAA 2V0LA 2XATA 1KK6A 2QIAA 3VBJA 3VBNA 1YP2A 4IHHA 4HUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ST8 A;  2I5K A;  1KK4 A;  2JF3 A;  5F42 A;  3TWD A;  3ZM6 A;  3R8Y A;  3D8V A;  4C13 A;  3FSB A;  3OW5 A;  4M2A A;  1XHD A;  3BFP A;  4R7P A;  1FXJ A;  4KPZ A;  4E6T A;  1Z90 A;  3KWC A;  2IC7 A;  3CJ8 A;  3ECT A;  1LXA A;  2WLF A;  3MQG A;  2V0I A;  4AC3 A;  2WLD A;  4MYO A;  1E8C A;  5E3R A;  3GUE A;  3R5C A;  5AFU U;  4E75 A;  2AM2 A;  3V4E A;  1HM0 A;  1T3D A;  3FSX A;  4HZC A;  4ISX A;  4FCE A;  4G3S A;  4IHG A;  3DK5 A;  2V0J A;  3EEV A;  3DJ4 A;  4HZD A;  2XJA A;  4MZU A;  3VBK A;  3BSW A;  4EGG A;  3IGJ A;  4KPX A;  2GGO A;  1FWY A;  1XAT A;  1QRM A;  3I3A A;  3TDT A;  1TDT A;  2TDT A;  1V67 A;  5DEM A;  1KRR A;  3HSQ A;  3VBI A;  3VBL A;  2AM1 A;  2P2O A;  4E6U A;  3MQH A;  4EA9 A;  4K6R A;  5E3P A;  5U2K A;  4EA8 A;  3GOS A;  2WTZ A;  3R1W A;  4N6B A;  3R5D A;  3FTT A;  4CVM A;  1KGQ A;  1G97 A;  2IU9 A;  2W0W A;  3FWW A;  3MC4 A;  2FKO A;  3R0S A;  3DHO A;  4IHF A;  1KGT A;  3FSC A;  2OEF A;  2OI5 A;  3OUP A;  3P1B A;  4KNR A;  3TIO A;  4EAA A;  1OCX A;  2WLE A;  3FSY A;  3EG4 A;  2QIV X;  1QRL A;  1KK5 A;  1HM9 A;  3R3I A;  3T57 A;  4QF5 A;  4BUB A;  2WLC A;  4DCL A;  2GGQ A;  2ICY A;  4H7O A;  2QKX A;  3F1X A;  1HM8 A;  5L6V A;  4M9C A;  1KHR A;  3HJJ A;  2OI7 A;  3R5A A;  1SSM A;  3TIS A;  3FS8 A;  3OU9 A;  2JF2 A;  4G3Q A;  3JQY A;  2OI6 A;  2OEG A;  3BXY A;  3C8V A;  3SRT A;  1J2Z A;  3BSY A;  2W0V A;  3P47 A;  5E3Q A;  4E1K A;  4E79 A;  4ZIY A;  3OTZ A;  3GVD A;  4N27 A;  1MR9 A;  3NZ2 A;  4KQL A;  4M98 A;  3R2W A;  5DEP A;  3TV0 A;  1GG4 A;  4AAW A;  2AQ9 A;  2IUA A;  4M28 A;  5DG3 A;  2V0K A;  3BSS A;  3VBM A;  4EA7 A;  4MFG A;  5ADX V;  3D98 A;  3VNP A;  1MR7 A;  3R5B A;  1QRF A;  4HCQ A;  3SPT A;  4R37 A;  1SSQ A;  3ZM5 A;  4N6A A;  1QRG A;  3PMO A;  5L6S A;  4R36 A;  1S80 A;  1KRU A;  4HUR A;  5ADX U;  2Q4J A;  3ZL8 A;  1QQ0 A;  1SST A;  1YP4 A;  1HV9 A;  3R3R A;  4M2B A;  4EAB A;  1KRV A;  3IXC A;  4M99 A;  4J09 A;  4KNX A;  3I3X A;  4C12 A;  1MRL A;  1YP3 A;  3BRK X;  1G95 A;  4J18 A;  1QRE A;  4G87 A;  2VHE A;  4QDI A;  4CVL A;  4EQY A;  2V0H A;  1THJ A;  3OTM A;  3EH0 A;  4G3P A;  2ICX A;  2IU8 A;  2VD4 A;  1V3W A;  2WLG A;  3VBP A;  5AFU V;  2RIJ A;  4N69 A;  3FOQ A;  4CVK A;  2NPO A;  3KWE A;  3Q1X A;  3KWD A;  4AA7 A;  3TK8 A;  1KQA A;  2V0L A;  2XAT A;  1KK6 A;  2QIA A;  3VBJ A;  3VBN A;  1YP2 A;  4IHH A;  4HUS A; 
#chains in the Genus database with same CATH topology
 3ST8 A;  2I5K A;  1KK4 A;  2JF3 A;  5F42 A;  3TWD A;  2FYW A;  3R8Y A;  3D8V A;  3ZM6 A;  3FSB A;  4C13 A;  3OW5 A;  4M2A A;  1XHD A;  3BFP A;  4R7P A;  1FXJ A;  4KPZ A;  4E6T A;  1Z90 A;  3KWC A;  2IC7 A;  3CJ8 A;  3ECT A;  1LXA A;  2WLF A;  3MQG A;  2V0I A;  4AC3 A;  2WLD A;  4MYO A;  1E8C A;  5E3R A;  3GUE A;  3R5C A;  5AFU U;  3WSG A;  4E75 A;  2AM2 A;  3V4E A;  1HM0 A;  1T3D A;  3FSX A;  3OH4 A;  4HZC A;  4ISX A;  2IOJ A;  1KO7 A;  4FCE A;  4G3S A;  4IHG A;  1NMP A;  3DK5 A;  2V0J A;  3EEV A;  3DJ4 A;  4HZD A;  2XJA A;  4MZU A;  3VBK A;  3BSW A;  4EGG A;  3IGJ A;  4KPX A;  2GGO A;  1FWY A;  1XAT A;  1QRM A;  3I3A A;  3TDT A;  1TDT A;  2TDT A;  1V67 A;  5DEM A;  1KRR A;  3HSQ A;  3VBI A;  3VBL A;  2AM1 A;  2P2O A;  4E6U A;  3MQH A;  4EA9 A;  4K6R A;  5E3P A;  5U2K A;  4EA8 A;  3GOS A;  2WTZ A;  3R1W A;  4N6B A;  3R5D A;  3FTT A;  4CVM A;  1KGQ A;  1G97 A;  2IU9 A;  2W0W A;  3FWW A;  3MC4 A;  2FKO A;  3R0S A;  3SUC A;  3GQ9 A;  3DHO A;  4IHF A;  1KGT A;  3FSC A;  2OEF A;  2OI5 A;  3OUP A;  3P1B A;  4KNR A;  3TIO A;  4EAA A;  1OCX A;  2WLE A;  3FSY A;  3EG4 A;  2QIV X;  4IWM A;  1QRL A;  1KK5 A;  1HM9 A;  3R3I A;  3T57 A;  4QF5 A;  4BUB A;  2WLC A;  4DCL A;  3EEQ A;  2GGQ A;  2ICY A;  4H7O A;  1N4I A;  2QKX A;  3WSH A;  3F1X A;  1HM8 A;  5L6V A;  1GG4 A;  4M9C A;  1KHR A;  3HJJ A;  2OI7 A;  3R5A A;  1SSM A;  3TIS A;  3FS8 A;  3OU9 A;  2JF2 A;  4G3Q A;  3JQY A;  2OI6 A;  2OEG A;  3BXY A;  3C8V A;  3SRT A;  1EWW A;  3OGZ A;  1J2Z A;  3OH2 A;  3BSY A;  3GQ8 A;  2W0V A;  3P47 A;  5E3Q A;  3OH3 A;  4E1K A;  4E79 A;  4ZIY A;  3OTZ A;  3GVD A;  4N27 A;  1MR9 A;  3NZ2 A;  4KQL A;  4M98 A;  3R2W A;  5DEP A;  3TV0 A;  3GQ7 A;  4AAW A;  2AQ9 A;  2IUA A;  4M28 A;  5DG3 A;  2V0K A;  3BSS A;  3VBM A;  4EA7 A;  3GQA A;  4MFG A;  5ADX V;  3D98 A;  3VNP A;  1MR7 A;  3R5B A;  3L2B A;  3WSE A;  1QRF A;  4HCQ A;  3SPT A;  4R37 A;  1SSQ A;  3ZM5 A;  4N6A A;  1QRG A;  3PMO A;  5L6S A;  3L31 A;  4R36 A;  1S80 A;  1KRU A;  1M8N A;  4HUR A;  5ADX U;  2Q4J A;  3WSD A;  3ZL8 A;  1QQ0 A;  1SST A;  1YP4 A;  3WSF A;  4IWG A;  1HV9 A;  3R3R A;  1Z2F A;  4M2B A;  4EAB A;  1KRV A;  3IXC A;  4M99 A;  4J09 A;  4KNX A;  3I3X A;  4C12 A;  1MRL A;  1YP3 A;  3BRK X;  1G95 A;  1L0S A;  4J18 A;  1QRE A;  4G87 A;  2VHE A;  1NMO A;  4QDI A;  4EQY A;  4CVL A;  2V0H A;  1THJ A;  3OTM A;  3EH0 A;  4G3P A;  2ICX A;  2IU8 A;  2VD4 A;  3OH1 A;  1V3W A;  2WLG A;  3VBP A;  3WSI A;  5AFU V;  2RIJ A;  4N69 A;  3FOQ A;  4CVK A;  3OH0 A;  2NPO A;  3KWE A;  3Q1X A;  3KWD A;  4AA7 A;  3TK8 A;  1KQA A;  2V0L A;  2XAT A;  1KK6 A;  2QIA A;  2YYB A;  3VBJ A;  3VBN A;  1KNX A;  1YP2 A;  4IHH A;  4HUS A; 
#chains in the Genus database with same CATH homology
 3ST8 A;  2I5K A;  1KK4 A;  2JF3 A;  5F42 A;  3TWD A;  3ZM6 A;  3R8Y A;  3D8V A;  4C13 A;  3FSB A;  3OW5 A;  4M2A A;  1XHD A;  3BFP A;  4R7P A;  1FXJ A;  4KPZ A;  4E6T A;  1Z90 A;  3KWC A;  2IC7 A;  3CJ8 A;  3ECT A;  1LXA A;  2WLF A;  3MQG A;  2V0I A;  4AC3 A;  2WLD A;  4MYO A;  1E8C A;  5E3R A;  3GUE A;  3R5C A;  5AFU U;  4E75 A;  2AM2 A;  3V4E A;  1HM0 A;  1T3D A;  3FSX A;  4HZC A;  4ISX A;  4FCE A;  4G3S A;  4IHG A;  3DK5 A;  2V0J A;  3EEV A;  3DJ4 A;  4HZD A;  2XJA A;  4MZU A;  3VBK A;  3BSW A;  4EGG A;  3IGJ A;  4KPX A;  2GGO A;  1FWY A;  1XAT A;  1QRM A;  3I3A A;  3TDT A;  1TDT A;  2TDT A;  1V67 A;  5DEM A;  1KRR A;  3HSQ A;  3VBI A;  3VBL A;  2AM1 A;  2P2O A;  4E6U A;  3MQH A;  4EA9 A;  4K6R A;  5E3P A;  5U2K A;  4EA8 A;  3GOS A;  2WTZ A;  3R1W A;  4N6B A;  3R5D A;  3FTT A;  4CVM A;  1KGQ A;  1G97 A;  2IU9 A;  2W0W A;  3FWW A;  3MC4 A;  2FKO A;  3R0S A;  3DHO A;  4IHF A;  1KGT A;  3FSC A;  2OEF A;  2OI5 A;  3OUP A;  3P1B A;  4KNR A;  3TIO A;  4EAA A;  1OCX A;  2WLE A;  3FSY A;  3EG4 A;  2QIV X;  1QRL A;  1KK5 A;  1HM9 A;  3R3I A;  3T57 A;  4QF5 A;  4BUB A;  2WLC A;  4DCL A;  2GGQ A;  2ICY A;  4H7O A;  2QKX A;  3F1X A;  1HM8 A;  5L6V A;  4M9C A;  1KHR A;  3HJJ A;  2OI7 A;  3R5A A;  1SSM A;  3TIS A;  3FS8 A;  3OU9 A;  2JF2 A;  4G3Q A;  3JQY A;  2OI6 A;  2OEG A;  3BXY A;  3C8V A;  3SRT A;  1J2Z A;  3BSY A;  2W0V A;  3P47 A;  5E3Q A;  4E1K A;  4E79 A;  4ZIY A;  3OTZ A;  3GVD A;  4N27 A;  1MR9 A;  3NZ2 A;  4KQL A;  4M98 A;  3R2W A;  5DEP A;  3TV0 A;  1GG4 A;  4AAW A;  2AQ9 A;  2IUA A;  4M28 A;  5DG3 A;  2V0K A;  3BSS A;  3VBM A;  4EA7 A;  4MFG A;  5ADX V;  3D98 A;  3VNP A;  1MR7 A;  3R5B A;  1QRF A;  4HCQ A;  3SPT A;  4R37 A;  1SSQ A;  3ZM5 A;  4N6A A;  1QRG A;  3PMO A;  5L6S A;  4R36 A;  1S80 A;  1KRU A;  4HUR A;  5ADX U;  2Q4J A;  3ZL8 A;  1QQ0 A;  1SST A;  1YP4 A;  1HV9 A;  3R3R A;  4M2B A;  4EAB A;  1KRV A;  3IXC A;  4M99 A;  4J09 A;  4KNX A;  3I3X A;  4C12 A;  1MRL A;  1YP3 A;  3BRK X;  1G95 A;  4J18 A;  1QRE A;  4G87 A;  2VHE A;  4QDI A;  4CVL A;  4EQY A;  2V0H A;  1THJ A;  3OTM A;  3EH0 A;  4G3P A;  2ICX A;  2IU8 A;  2VD4 A;  1V3W A;  2WLG A;  3VBP A;  5AFU V;  2RIJ A;  4N69 A;  3FOQ A;  4CVK A;  2NPO A;  3KWE A;  3Q1X A;  3KWD A;  4AA7 A;  3TK8 A;  1KQA A;  2V0L A;  2XAT A;  1KK6 A;  2QIA A;  3VBJ A;  3VBN A;  1YP2 A;  4IHH A;  4HUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...