2IUSA

E. coli ftsk motor domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
409
structure length
392
Chain Sequence
b'LPSLDLLTPPTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRDNPSPLTVVLGKDIAGEPVVADLAKMPHLLVAGTTGSGASVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALGVRNLAGYNEKIAEADRMMRPIPDPYWHPVLKKEPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQAGAESLLGMGDMLYSGPNSTLPVRVHGAFVRDQEVHAVVQDWKARGRPQYVDGITS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA TRANSLOCASE FTSK
publication title Double-Stranded DNA Translocation: Structure and Mechanism of Hexameric Ftsk
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 116
structure length 392
sequence length 409
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01580 FtsK_SpoIIIE FtsK/SpoIIIE family
A PF09397 FtsK_gamma Ftsk gamma domain
A PF17854 FtsK_alpha FtsK alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.980.40 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-tRNA Synthetase; Chain A, domain 2 2iusA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iusA02
3PFIA 1TF5A 1Q0UA 1SVLA 5JJLA 1BYUA 1TQ6A 4Q9IA 3QEOA 2JJ2D 2VSXA 3DOEA 4EPTA 1ANKA 2PZEA 1XJQA 1ZCBA 4URZR 4EPXA 1UBGA 3BH6A 1N6OA 1AKYA 3I3SR 1G3RA 4US2R 1MABB 2ZRBA 1T0HB 2OFOA 1II8B 1YR9A 3QBVA 4MKFA 1G7CA 2PZFA 3IPYA 2I1VB 1GILA 4Q7MB 1S3SA 3ZYCA 5B30A 3E2IA 1WRBA 4AY2A 4OYHA 2EW1A 3B7GA 5FPYA 2OAQ1 1N6KA 4DCTA 1FZQA 1F48A 3GJ0A 4CT5A 1E99A 4I1OA 4I1UA 4TQ9A 4EDHA 5FTLA 1W44A 4C30A 2P6RA 3WHKA 1MABA 4JLKA 4D4MA 2IYYA 3W8NA 1D2MA 3OFND 1COWD 2IEZA 1PUJA 4KBGA 1OFUX 2IHBA 4TYQA 5E7IA 2ZRNA 1VCOA 3PUVA 4QNRA 2BKEA 2VP6A 1QHHB 3BS4A 4P31A 4MDFA 1WDTA 3L2OB 4LI0A 1VCNA 3MG9A 3V9PA 1W5SA 1LTQA 1G9XA 1H65A 2JJ1D 2MMGA 3I8SA 3RRYA 4DCVA 1G16A 1KO5A 1OW3B 2C9CA 4LDJA 4XVQA 2ZRLA 5FI0B 3T15A 4JJZA 2O5VA 4PHHA 4DCSA 1ZD9A 3PR1A 4C0AC 2PEYA 2D2EA 4HAZA 1QHHA 1M8PA 3KJEA 1G5RA 1GUAA 2DR3A 2VHUA 3SQXA 1DG3A 1H8ED 4UNRA 3ADCA 3X1XA 3O8RA 1VKJA 1Z6XA 4OHZA 1TNDA 1KHTA 4YC7A 1CLUA 1U8AA 3NC0C 5AJVB 2ZPTX 4PC1A 4KI0A 3T5DA 3SJCA 2VO1A 4ESHA 5IK2D 2GXAA 1ZCAA 3FKQA 2FNAA 4LHVA 1LNZA 3DM5A 4HB3A 5HZKA 1QDEA 2NTYC 1LV7A 3EX7C 1JAHA 1NLYA 2ZRIA 4LJ9A 4NONA 3VNVA 1PZNA 1ZM2A 2DWQA 5FL7A 1RE0A 1JR6A 1X1RA 2VA8A 1IY2A 4XTCS 2VPPA 4PC2A 4YDSA 3RS2A 4AG5A 4AKHA 2NPFA 3BB1A 1US8B 2IXEA 4RD3A 3ETLA 5H70A 4W5HA 1NVVQ 4BFXA 2X77A 4G0NA 5HZHA 4JLAA 1SKQA 4YMWA 4ZDIA 2FSHA 1OJLA 1AGRA 2GETA 4TL8A 4EFLA 3EPKA 4DWJA 1P73A 4MUBA 1JPJA 2YV5A 2ZJ2A 5CB8A 1X1SA 3RRZA 4XD7A 1FNNA 5FOVA 3QVVA 3W3AA 2SHKA 1KNXA 4IDQA 2IBMA 2GEUA 2ZETA 3ZH9B 2IS2A 3GJ4A 2WWWA 3VKHA 3RS4A 1O3YA 2WPDD 1E9FA 2QNRA 3PUYA 4MYHA 4GRAA 1IJEA 1NVWQ 1DO0A 4BWYA 4L5BA 4EKDA 2ZTSA 4H9GA 2GCOB 1Z0FA 3CKLA 5GADl 1KDTA 2JLZA 1TQDA 2ZSAA 4LZZA 3I4LA 2GILA 4FMDF 3W9YA 1CR4A 2VHQA 1T91A 4YXWD 2O8CB 1XD8A 3T1OA 4WBSA 3O47A 2O0JA 3HYTA 4O3MA 4LK2A 1YR8A 2ORWA 3MWYW 1Q12A 2GK7A 1W4BA 2QM8A 1T5LA 2WWHA 2IWRA 4BFVA 2H18A 4BZXA 3IIJA 3HYRA 2GCOA 3C7KA 4R7ZA 1FNMA 4IW3B 2XZPA 3U7FB 1W7AA 2BM0A 4I81A 4TMWA 3W6OA 3ZZTA 3UMRA 1KAGA 5FBRB 2QL6A 2X2FA 5JHHB 4MYTA 3E70C 1KDOA 3DZDA 3NIBA 2B7BA 4D0GA 1G3IA 1AIPA 2YWEA 2CHGA 1W36C 4S2EA 1WBBA 4G01B 5TVKA 2FSGA 4QBFA 2HYDA 4A4DA 3PUXA 2XTNA 4MYUA 4Q02A 5CK4A 1Z0AA 2CXXA 2Q9BA 4JYCA 1YKSA 3MD0A 1RKBA 4DLRA 1XEFA 1XPRA 1P75A 3RDPA 2IX3A 4OKSA 1X8KA 1RJ9B 4DCUA 4A2PA 4LRWA 3X1ZA 1YRAA 4QBHA 4FN5A 1M7HA 2B7CA 3P27A 3CF6R 3VHLB 5TMPA 3L0PA 1WP9A 5EP4A 4YDHB 3GLIB 3WRXC 2FFQA 1KK0A 2RGAA 4PXAA 1HV8A 1CR0A 1BS1A 1RJ9A 2WSSD 4LHXA 3IIMA 3FPAA 2WJYA 2V1XA 1SVMA 1E4YA 2JDIA 2YNMA 4LYAA 1N5LA 3DEFA 4U02A 3GLIA 4G3XA 5KU1A 4TTRA 5IDVA 3OE7A 3SE0A 1G18A 2GXSA 4BEBA 4XWAA 1N0UA 3AF3A 2H92A 1FUUA 3AKDA 3WYGA 1L2TA 4R2IA 5J5CA 4TSFA 3SC3A 1EX6A 2IXGA 1GL7A 4D4JA 3H1TA 1G8HA 1NVUQ 1IN8A 3RANA 3NBZC 4V0LA 2XEXA 1KK1A 2ONJA 2YHSA 2XOKA 3EIHA 1N6IA 3K8YA 3BH0A 2G3YA 1UJ2A 1X8JA 1XCPA 2CHQA 2H1LA 1UEIA 4KYIB 1WCV1 4DLTA 2WSMA 2BVNA 3CNOA 4EJSA 1JPNA 1W0KA 4ZCLA 4EUNA 4YMUA 3V4FA 1KDRA 1S2MA 2A5GA 2DWOA 4V02A 2FU5C 4HSEA 3R7WB 5KSOA 1GG2A 3HPQA 2PX0A 1GNPA 2FZLA 4E5UA 1AJEA 4O25A 2EWVA 2R62A 2QQ0A 3BOSA 2C95A 3MWKA 3EPJA 2V6IA 2C9YA 1GKIA 4IRUB 2P2LA 1R0ZA 1AS3A 1R7RA 2WWIA 121PA 1Q21A 2ZRDA 3R7WA 3H4MA 4I4LA 3Q9LA 2EVWX 1QHXA 3CLVA 5TV2A 4WIAA 4HYYA 1ODFA 5FPTA 1L8QA 4MKIA 1DAIA 4Q9HA 4NCJA 1KSJA 3TUIC 1VMAA 3LQRA 2V55B 2OV2A 3EG5A 3EARA 3LX5A 4HDCA 4XTRA 4B2IA 2WMNB 2PH1A 4Z8YA 2WJIA 5BW8A 5FFMA 5DISB 5C46F 2LKCA 4M1TA 5EP1A 3BFKA 4Q21A 1RYHA 2OBMA 1ZAKA 3MAAC 3VR5A 1KYIA 3IHLA 5H8WA 3PCRB 2CLDX 4OK6A 3CZPA 1GAJA 3AKYA 3KDSE 4KLZA 3T35A 4IXNA 3AF0A 1CTQA 2VP4A 3TBKA 2ZIAA 4R71A 2RGCA 2HF9A 1DEKA 1NMZA 3O8DA 1XJCA 3OIWA 3TLXA 2ZITA 2DFNA 1JR3A 1TL7C 2ZU6A 1QHYA 4UQOA 1HE1C 3B82A 2AN9A 3IQWA 4WZ6A 3ASZA 2J0UB 2FZ4A 5LD2C 2IXFA 3Q7QA 1N6NA 3LW7A 1VIAA 5EQTA 5B58C 2PX3A 3T34A 3TUJC 3WYFA 1ZBDA 1RIFA 2HXSA 2ZI3A 1WA5A 4JBXA 2XTMA 1JEDA 4V0NA 2GEDA 4NPHA 2ONKA 3HWSA 1JB1A 3IBGA 2V4ZA 5BYJA 2ANCA 2VF8A 3K70D 3BE4A 4DB4A 1IHUA 1HUQA 4RCZA 4DCNA 2CJWA 3THWB 1E0SA 2DBYA 1Z0JA 2WV9A 4LHYA 3RWOA 1MV5A 4UNSA 2ZANA 1ZW6A 1CEEA 5LD2B 1W0JD 3B9QA 3PQCA 3FWYA 2ZJYA 4PPFA 2PJZA 2VP5A 2AK3A 2IYSA 4HB0A 3A4NA 1E0KA 1IY1A 2MSCB 4NCNA 4M1MA 4URUR 3THWA 1GKUB 3BFXA 5CDFA 1QF9A 4IJMA 3U7HB 2J87A 2F6RA 3Q5EA 1ESMA 4NDZA 4N1AA 4TLEA 1NY6A 2D74A 2UZ3A 4RFVA 1DPFA 2ZM5A 4DLSA 4JKIA 4Q7JB 4OJKA 4KFRA 2A5YB 2GEVA 1WE2A 3R9WA 1TEXA 3X2SA 4LPSA 2V6JA 2RH5A 3KJIA 1QVAA 2C5LA 3LW8A 4PPGA 4C4PA 2HXYA 2QEQA 3LD9A 4RD6A 1ZU5A 2QTVB 3CF0A 1E3MA 3EA5A 3K9LA 4FMDB 4B74A 2ZJ5A 5ELXA 4C2UA 5FH9A 3LLUA 4OK5A 4BLOA 3QEJA 2UVQA 2BMDA 3SFVA 3SJAA 5E4FA 3WNBA 3CH4B 1O87A 3TE6A 4WA7A 1UKEA 1AA9A 3CUEF 3N2IA 5G40A 4L9SA 2IYUA 1IONA 2NZ8A 1S9HA 5JS8A 1XJ0A 4JZKA 1A82A 4ZKEA 1UDXA 2I1QA 1EFUA 5FOXA 2CNWD 4XVRA 3CRRA 3DVLA 1NN0A 3NTUA 1KJWA 4IDPA 4JYBA 4GSYA 1TUEA 5G53C 4A0GA 1A2BA 4D6PA 1VG0B 4X8HA 5FPHA 5LB4A 3U60B 1UM8A 3UMSA 2W6JA 4EPYA 4TLAA 3TAHA 4M8NE 1UEJA 1HE8B 2JLSA 5J4YA 1GDDA 2A5JA 3EXAA 1UF9A 5E95A 4NH0A 1MH1A 2J41A 1OPXA 1SULA 4PPQA 3S1AB 5FBVB 4M1OA 4JVMA 1Q1ZA 1RZ3A 2PT5A 2V3CC 3M4YA 4NYIR 1LY1A 2OZEA 4Q03A 1P2SA 4ACAA 5FTNA 3KKOA 3EPHA 1SXJE 2FOLA 1G6HA 2FE4A 3QF4B 4Q1EA 5EUMA 1NIJA 1VPLA 4KU4A 2XGJA 4NYMR 1K5GA 3CRQA 4PSVA 4RD2A 3K0EA 4B44A 3S1AA 3TUZC 2D62A 3KQHA 4ZI3A 3RLFA 1CU1A 4DT1B 4OQXA 4QGHA 1IJFA 4LYFA 1B0UA 2QP4A 4AYXA 1GWNA 1E79A 3M6AA 4QOSA 4TQUS 3QF4A 1ZM3A 2AKAB 4ILEA 4RD4A 5DNYB 4ON9A 3BAFA 2LCFA 3EC2A 4Q4LA 3AVTA 3AGQA 2ODNA 2ECKA 4P0TA 1Z2AA 3DL0A 2E9SA 5DN6D 3VAAA 3U5ZB 2OM2A 4PHGA 4US0R 1E2QA 1ZRHA 2QSZA 1ETUA 1QHNA 1F2UB 1S1CA 4JS0A 3RSLA 2NO9A 4HB2A 3NDBB 2Q9AA 3CNLA 3CX7A 3SBDA 3B85A 2VHTA 3LBNA 1A4RA 4F4JA 4GDFA 3EIEA 1OH6A 2IL1A 4L4UA 4MA4A 4A1FA 2ZR7A 4HUQB 1J8YF 3T61A 1GM5A 3BIFA 5DHFA 2WMOB 3OEHA 4BFSA 2GAOA 4FCTA 1IQPA 4TYNA 4KO8A 2JIZA 2AHOA 1MO5A 2VSOA 3H0KA 1N5JA 1F2UA 2OO7A 4KSBA 3JVVA 4DHEA 1GFIA 3KXLA 1J90A 5DIFA 2NO6A 4PC6A 2REOA 4DIEA 3AVYA 1G291 4YONB 2J0QA 1S96A 4FCVA 4FMBB 4OI2A 3SZRA 2VYFA 2Q3HA 1MR3F 2F55A 1QHIA 3FTQA 2F1JA 4PZLA 4LJ8A 3AP2A 4XOIA 2QTFA 5H1YA 1G4UR 3RSOA 4MGKR 2ZXUA 4OHYA 1UPTA 1U0HC 4AWXA 6Q21A 3VNUA 2OUKA 4DLZA 3MWJA 5K8UA 1JNYA 5BN4A 2RKOA 2P0EA 1KIMA 3GLFE 5EXTA 2OBLA 3ADDA 2FSIA 4TMVA 1KI8A 3TW8B 1W47A 3VX3A 4LGMA 2F9MA 2H7VA 3LX8A 4BE7B 3D31A 1T8UA 3SN6A 3ZD6A 1PJRA 2WOOA 5EXPA 3GEIA 4MRSA 1KI9A 2C77A 2QT1A 5DHAA 5GJCA 1XXHE 2D2FA 3UIEA 3PEYA 1FQKA 5E3HA 1KJZA 4GP7A 1HT1E 2EFDB 4WZBE 1FUKA 1Z0KA 3RC8A 5L3RA 3RAPR 2Q6TA 4E22A 1WXQA 5F98A 4Q4AB 5B64A 4XVUA 3NHBA 4DC9A 2IUTA 4IVRA 4LV5B 4Q4JB 2CK3A 1DBSA 2WVJA 2FJUA 3K1JA 1F60A 4NP6A 1OIWA 2B8WA 1YQTA 2O8DB 3FB4A 4JL6A 2ZRKA 3IO3A 4F92B 3B1ZA 3NKVA 4PC7A 1D2EA 4Q4AA 1KKLA 1LFDB 4D4KA 2R2AA 3A1TA 1DE0A 5EE0A 2QY9A 3ZVLA 2EYQA 1P72A 3VR1A 3KUCA 3M0EA 1ZD8A 4IVPA 2CVFA 4GT1A 4Q4JA 2JLYA 2C03A 1SVWA 1U99A 3D8BA 1FTNA 4QHSA 4Z51A 1M6NA 1F2TA 2ZRCA 4NBSA 5KNBA 3C5HA 2AD5A 4ZPXA 1W36D 3EW9A 1XCGB 4Q1CA 1S4QA 4B34A 1P9NA 2ZAMA 1E2PA 5HKKA 3TAUA 1R4AA 3QPVA 1P3JA 4B47A 3LH5A 5FUXA 2JA1A 2HYIC 1OSNA 1J99A 1XEWY 2HV8A 2J9RA 3QXSA 4PAMA 4DSTA 4BLPA 2IS6A 1KSHA 2JJ8A 1UBCA 2CBZA 2Q3FA 5ANRB 2A2ZA 2P5SA 5AR1A 3NEYA 2GJ8A 2QN6A 1GP2A 4X8MA 1E2GA 1ZMXA 3PENA 4P4SB 5GJBA 1II0A 1ZUHA 2ZSFA 4DDWA 4BZPA 1Q1QA 2WWXA 1KDPA 1Q1EA 1BMFD 4FXPA 4KBFA 4OI1A 2WTUA 3WBKA 2OFWA 2RGDA 4V03A 3FKSD 4P3YA 4BECA 2AFIE 1RC8A 4BFWA 5JCPA 4ASUA 2XB2A 1G1MA 1JJ7A 1YZGA 2ZE7A 2V7QD 3NBFA 2MMCA 1OXUA 4ZDKA 1XRJA 5HR5A 2ZAOA 3I1FA 1G21E 4QM7A 2FFBA 4P4SA 4WXPA 4LV8B 5KNCA 4O2RA 3OEEA 1G4AE 4IOMA 821PA 3FDIA 1HY3A 2ZJZA 2H17A 1RRGA 3AGPA 3RWMB 3ZZ0A 1W49A 2XNSA 1U9IA 4ERNA 1E9DA 3KQNA 4TLCA 3LBHA 4CEJB 4QGGA 1K5DA 2G88A 2ZYUX 1Z8FA 3I92A 5UKDA 3SQWA 2WICA 2QPAA 4OI4A 4BZQA 2DYKA 1L4UA 1ZC3A 4F91B 4URWR 5CYOA 3EC1A 5J47A 3UANA 3IO5A 1JXOA 2BIFA 2FMXA 2R6DA 2WIAA 4NCHA 4CF7A 4BQSA 1TEVA 2RGGA 3GCGA 4CEJA 2IYWA 5FPKA 3GLGE 3ICQB 1ZNXA 2AKYA 4I1VA 1CJMA 1P6XA 3BGWA 2IF2A 4BPBA 1B23P 1D9XA 5JJIA 3MFYA 2NQ2C 3T12A 3VMFA 3D3QA 5KNDA 4Z1MA 5JI3E 1N0WA 4GOXA 3B2EA 4TN1A 4TMTA 4RCYA 4DSUA 1HTWA 4JSYA 5FOTA 4Y0VA 4CW7A 3AUXA 4BLSA 2ZI9A 1KZ7B 3MRSA 1MOZA 1J8MF 1DVRA 2IEYA 2YINC 3B1VA 5FUVA 5GJWC 2G1KA 2OILA 1F5NA 3KB1A 4H1UA 4A0RA 1IOZA 2NPIA 3DMDA 1TF7A 2C96A 2V54A 4M21A 5JEEA 1JEEA 4LUCA 2IUSA 1XDBA 1W2GA 2HJVA 2CE2X 4RVCA 3SS8A 1JQJC 4IVQA 3C8UA 3WNDA 1NBMA 3W34A 1Z6AA 3BORA 3CX8A 1Z6GA 5HCNA 2FWRA 3BC1A 4FWIB 4K81B 2H57A 2FFHA 2GESA 3AKCA 1NJFA 3EZ7A 1FQJA 1YE8A 1ZUNB 2ZI5A 2PEZA 2ZYWX 1LS6A 4BFZA 3CR8A 2RGNA 4A8JB 5FOSA 1MO6A 1ZM7A 3RYTC 1W2HA 2EFHB 1SVOA 3HR8A 4NU0A 3ZIAD 5TXGA 3W8RA 5DI9A 3SYKA 5C18A 1R0YA 3PITA 1CJUC 2A5FA 5FBWB 1YVDA 4ZCIA 2OG2A 1VYVA 1FX0B 1XEXB 2N1BA 2ZR9A 3CPJB 1XZPA 1YZKA 4IDHA 5EE3A 1PVOA 1G8PA 1ZNZA 4A8JA 3KTAB 3IGFA 3P4XA 2XNDA 3KUDA 3NBYC 1JBKA 1G19A 1X8LA 4PAOA 4DDVA 5CB6A 3IIKA 3TKLA 5JHGB 3LWNA 4UKDA 1P5ZB 3C5CA 2FEOA 2ORIA 4LHWA 1FX0A 1XEXA 2Z43A 3T1TA 4PZYA 1IY0A 1XMVA 3MLEA 3EZFA 1QZXA 4LWZA 3KTAA 3ZS8A 1VG9B 4Q1AA 2FGJA 1T8TA 2NIPA 4TMKA 4YMTA 1U98A 3EASA 2VHJA 1UDWA 2QE7D 3NC1C 2HCBA 4XJXA 3TSZA 4ZV4A 1LW7A 2ATXA 2J7PD 3I32A 4CEHB 3U2QA 4DUGD 4M9XA 4E07A 1I2MA 1Z08A 4GPTA 4JJKA 4IFEA 4LJ5A 5IHPA 3N2EA 3ZQ6A 3PUWA 3F0TA 3UG6A 2QAJA 1GIAA 3VR6A 2D4HA 4JVSB 2ZQ5A 1OIXA 4M1SA 3U3RA 3MMPA 2XJ4A 4ABYA 1E2HA 1RFLA 1XMSA 4PR0A 1ZINA 3KZ1E 1HA3A 4S35A 4AYWA 4CEHA 4GMDA 1EFRD 4D2IA 5EE9A 4A6PA 4EIWA 4AYTA 5J4LA 1AGPA 2CL7X 2A3RA 1Z47A 2IYVA 4BLRA 4JIMA 2F9LA 2OFXA 4M9QA 1NG9A 1RRPA 2VLIA 2XAUA 1BKDR 1R0XA 5DI3A 2CMKA 2FN4A 2V1UA 4G5SA 4W9MC 4M2LA 1HEIA 1GRNA 2W6ID 1DAKA 1E94E 1II9A 1U8ZA 2W2VA 3CO5A 3ONWA 2P5TB 4M9ZA 4EJSC 4W5JA 4CEIB 5G3ZA 1SXJB 1E9BA 3QKTA 1DTSA 2IYZA 3HU2A 2CVHA 2BBWA 2F1IA 1U2RA 4TT3D 1QG4A 4LSGA 2ZRMA 4US1R 4LJ6A 5TARA 1E0JA 3O8CA 1OXTA 5JRZA 1NF3A 4EFMA 2FFAA 1I4DD 1OKKD 3ASYA 2ZS8A 4JLOA 3HP1A 2JASA 4CEIA 1SXJA 3G5UA 1E1RA 3CH5A 1E9CA 3ZDQA 3CW2A 5JWHA 4EJSB 2RHDA 4NYJR 1T5IA 3VKGA 3P20A 2PJRA 3A4LA 4TTPA 4ZIRB 2CCGA 4O2LA 1V43A 1Z2CA 5JBQA 4NZYA 2G0NA 2D3WA 4MRRA 4RZUA 1ZJ6A 3L8YA 2WIBA 3BXZA 1QHSA 1W4CA 3EWAA 4B3FX 2Y8EA 4JBWA 4DDUA 3W90A 3LBIA 3KKPA 1CS4C 4M0LA 4QGAA 3OAAD 1KJYA 1FMLA 1KK3A 1UFQA 2WAXA 2IYQA 3QENA 4ZIRA 3OHMA 1KSFX 3BB3A 3QXXA 4GI7A 1TMKA 1PLJA 3B13B 2X2EA 1XTRA 4MGYR 1Q1BA 3RS3A 1PV4A 4IXMA 3AVVA 2PZGA 4EPRA 2WJGA 5LB2A 4HZUB 5JZVA 1G3QA 3ZJYA 5KOYA 4C3ZA 1LVGA 4K8OA 2JJ2A 3W6PA 1OXSC 2WJHA 4MITA 3QQ5A 4B33A 4PC3A 5KPJA 4CYMA 1WMSA 3K0CA 1S1MA 5AUQA 3FE2A 4C0QC 2BBOA 2PMDA 1G7RA 2GTPA 4HZUA 5JWOA 1YZUA 1E2IA 3BBPA 5EE5B 3R8CA 4DJTA 5EXSA 5FR1A 3M1IA 2QA5A 3EZ9A 5G41A 1R8SA 3TK1A 2XXAB 2HLDD 3WYAA 4UJ3A 4XWKA 1NVXQ 2C98A 1KI2A 2XSZD 4UXJA 2C04A 2ZJ8A 3B1WA 1EGAA 1P2VA 1S8FA 1TUIA 3E1SA 3RS0A 2ZUBA 2JLQA 4UNPA 4C7OB 1XXHB 2VHCA 2OCBA 4A36A 1XZQA 4XSHA 3OFNA 3CRMA 3UK6A 1Q3TA 4EPVA 2YWGA 5CM9C 4LBWA 2P6NA 3B5JA 4DEYA 4Z54A 2XXAA 2OE2A 4QKQA 3GLFA 2JAQA 3WNCA 1P62B 2NO7A 2R8RA 3EPLA 2GF0A 3GEEA 3OESA 1FOEB 3P4YA 4C7OA 5KO2A 5JCZA 1E1QD 1XXHA 5K8LA 2JJ1A 3PUZA 2CCKA 4OQMA 3R9XA 1CRPA 1G3UA 1NG1A 2ZU0C 3J81k 3SOPA 1FL9A 4RFSA 3WRYC 4LBYA 1C9KA 1YZLA 2VEDA 3RS7A 3ICEA 2CJWB 5DYIA 3V00A 2WOJA 1N5KA 2ZS9A 4F38A 1R6BX 4FINA 4BFUA 4LYHA 721PA 5AJZA 1H8EA 4TLBA 2A30A 2GCPA 3B8HA 4QC2A 3BH7A 1NN5A 3MWLA 5KDLA 4ZKDA 1DAMA 4JVNA 3PJRA 5F9HA 5A4JA 5IK2A 2R44A 2EU8A 2GA8A 5CIWA 2VTKA 2FV8A 3AF1A 5FR2A 1AS2A 4EPWA 2WHXA 4BFTA 1Q20A 3IKJA 4JBYA 3C14C 4G5QA 3VR3A 4Q19A 2QGNA 4ZCMA 2VP2A 1DAEA 4GOJA 3WMEA 3QBTA 1G8FA 3SU8A 4PQYA 4KSCA 5EXXA 1OHHD 3QKSB 4F7WA 1OV4A 2TMKA 1OB5A 4HEJA 3SNHA 1J7KA 2GK6A 5AJXA 5CYPA 2DHRA 2FPKA 3HR7A 4MKHA 4F4CA 1EWQA 2BMJA 2ZE8A 2GXUA 3A1VA 3AEZA 2X1VA 4QHTA 4IHQA 4A82A 1Z07A 4KFSA 1GRQA 4GFDA 3K0SA 2B21A 5FPSA 3BWDD 1CULC 3CWQA 4A6XA 2VP9A 1XFAA 2Z4SA 3QKSA 3AUYA 1ELOA 1Y3AA 2WPDA 2Z6VA 2ZROA 4I1SA 4KVGA 1UKYA 2BCJQ 1YZTA 3OIYA 4KJZA 5GVSA 3D6TB 1WBDA 4HATA 1NLZA 2KB0A 3QSYA 1DAFA 4PAQA 2ZRJA 3HDTA 4C9BA 5CIQA 1SKYE 3QXJA 4YXWA 2PCJA 1FW6A 1KZGB 2ZI7A 4LJ7A 4C0KA 5FTKA 2ZUCA 1AK2A 3O8BA 3OEED 3TW4A 1XPUA 2A7QA 3A1UA 5H68A 5KHOC 4BEJA 4E09A 3P32A 4TL6A 5DLQC 2VQSA 1OH8A 2KBFA 3MCAA 2XJ9A 1NVVR 2HT6A 4QHYA 3TJZA 4D82A 4PX9A 3R20A 3ZS9A 4MGZR 1TX4B 2FGKA 3CIOA 4DSNA 2K5UA 3GLGB 5A0FA 1EFTA 3UKDA 2IYXA 2VRWA 3EZ2A 2LKDA 4ZDJA 3W6NA 2F7SA 4UNNA 2P6UA 3X1DA 4KFUA 1ZIPA 3KKQA 5TB5A 2HJGA 1J2JA 1OH7A 2JLWA 1P7CA 1G7TA 5EJEA 4Q47A 4DVGA 2BV3A 2YYZA 1FFHA 3GLGA 1M2OB 3CRW1 5A5GA 3ZD7A 4G5GA 1K8RA 2OCAA 4PPNA 2NGRA 4ITRC 2J1LA 2C8VA 2H5EA 1T3LA 1Y63A 4KITB 4P4UA 1FPMA 2QMOA 4M9SA 1XNJA 4QBIA 1LB1B 3RRNA 3FFBA 1QG2A 3K9GA 2B8TA 3ZVRA 5DSZA 2ZI6A 1N6HA 3IHWA 2VF7A 4PHTA 2WSSA 4PSKA 4KFTA 4B3BA 4HLUA 4B32A 3RS5A 3GJXC 3NWJA 3W3ZB 2A78A 5FL7D 3R8FA 3V4RA 2NZJA 4F93B 2W58A 5K8IA 3NHAA 3FMPB 1NBMD 3FHOA 1WQ1R 2OHFA 1M1YE 3IUYA 3OIUA 4EQ6B 4MQBA 3Q85A 3QJYA 4JT2A 1M7GA 4PFSA 3ND8A 2ZJOA 2O8FA 2YC4C 4M1WA 3REGA 5JSZB 1HYQA 1E9EA 2ANBA 3B78A 1CJKC 2O52A 3QXHA 2OXRA 3K53A 4B75A 4NCIA 4BASA 3IILA 4NCKA 4BLTA 1N25A 2OESA 4X8OA 1ZVQA 4BRUA 2WBLC 2QPOA 1IXZA 1IBRA 1W5TA 1GNRA 1RRFA 4XD7D 5EE1A 3ND9A 5FTJA 3TQCA 4EQ6A 1XF9A 2QSYA 5AJWA 1E2FA 2PT7A 2IS4A 1MKYA 4M1YA 4NHOA 1PLLA 2J46A 4JLNA 1AM4D 5FBQB 3TR0A 5JSZA 1WF3A 1NP6A 3L0SA 3E5HA 4AK9A 5BWMA 4FWTA 1XPOA 2J3EA 2ZVQX 1P9RA 4JKYA 5TY0A 4AD8A 2R9VA 2WWYA 1CKEA 2MSEB 3ADKA 2BJWA 3THXB 1SHKA 2VBCA 4JLMA 1D9ZA 2DB3A 1R8QA 3NVAA 3KX2A 4HLCA 1CP2A 3N70A 2DCUA 5BYKA 1RYFA 3IEVA 1VECA 4B3GA 3Q5DA 5AWFC 2QU8A 621PA 5AUPB 1EFCA 1G41A 8OHMA 4PSAA 3NH6A 3THXA 1CR1A 1E96A 1U90A 4UXIA 3X1YA 2O8EB 2FX3A 3WY9A 1MO4A 4QBGB 3EAQA 4UNQA 2Q0HA 1XWIA 3RRMA 2G1JA 2GJSA 1GRRA 1UBFA 2RMKA 2YC2C 4A2WA 3IBYA 1VTKA 2P65A 3DKVA 4WZAE 4BUJA 5D3MB 3GFTA 4HUTA 2R6AA 1A2KC 3KB2A 5C4MA 2JLXA 3GMTA 1E2MA 2O8EA 4LPKA 1AKEA 3R9IA 3HU1A 3TNFA 2GHIA 4MUAA 3GJ6A 3AF2A 4ACBA 4JVLA 3SYNA 2WZQA 5GVRA 4UJ5A 1G17A 2XITA 1F2TB 1OFIA 4B3DA 4Q48A 2D7CA 3DKPA 4A0HA 2ZE6A 2CL0X 5D3MA 4N3NA 1KO7A 1ZNYA 2QGZA 1TU4A 1OFHA 3VTKA 3FHTA 2QAGA 2GVZC 5CM8B 1E9AA 1HURA 1IAQA 3BJIC 3K70B 3QF7A 4RKFA 3SR0A 1QBKC 2HUPA 2AL7A 4WXRA 3ZGXA 2GZDA 2JDID 3L0OA 1HQCA 2PCLA 221PA 3K09A 2AK2A 5E7JA 1OXXK 2QMHA 3H86A 3P26A 3OE7D 5CJ2A 2IWHA 1VHLA 3TR5A 4RKEA 1KAOA 3TIFA 1G3MA 1LF0A 2ZJAA 4V0ME 3UWKA 2ZE5A 1U9IC 1AN0A 4TSFD 4K46A 2R6FA 4AI6A 3H84A 4I99A 2Z5FA 3AVQA 5FI1B 3TSOA 1QHGA 4XH9B 3KXIA 4PHFA 5C4GB 2D7DA 2C78A 4QL3A 3CNNA 5D3QA 1VCMA 2XOKD 2Z83A 4XSGA 2EWWA 4YMSA 3F8TA 3U3OA 4L8GA 2X19A 2F1RA 2IC5A 4FCWA 5AUNB 4NKRA 5CDFE 1GITA 4IDOA 4U00A 3SHFA 1TADA 3LVQE 1W0KD 2AWNA 3BRWD 4YLGA 1P61B 4TWZA 1XU4A 1YJ5A 4Q9JA 1IN7A 1R2QA 5FUYA 1P2TA 3VFDA 3I62A 2GBLA 3I8XA 1D6JA 3GJ5A 4A0FA 3LQQA 3FMIA 4MGIR 4C0HA 4MDEA 5JECA 3N5CA 5FOWA 4MRVA 4XIGS 1Z6TA 5BXQC 1Z22A 4NMMA 4TMXA 5C2JB 5HCIA 1MRNA 2V9PA 2G6BA 3A1SA 4Q4HB 5K8TA 2W2TA 3GJ7A 3VKWA 4Z8XA 5HTKA 1IN6A 1KNQA 4JLBA 1FP7A 2ZYVX 3FMFA 3SI7A 3GJ3A 1HT2E 5C1BA 5L8VA 5LPNA 1GKYA 1FMJA 4LHZA 5FUWA 1ZU4A 2G0TA 2OAP1 2ZSBA 3CZQA 2WWGA 4AURA 4RSGA 3UXMA 1OF1A 3B1XA 3U61B 1GSIA 2RGBA 3B1YA 3T5GA 4JL8A 3PEUA 4L9WA 1RVDA 2FSFA 4Q4HA 4Q1DA 2RB4A 4QFMA 3LV8A 2GWHA 4FW9A 3U4QB 4Q9LA 3LNCA 1PUIA 2CNWA 4L15A 2FDCA 1II8A 4URVR 1U81A 1Z06A 2RGNC 4HZIA 4LV6A 2EFCB 4HAWA 2L0XA 4LCBA 1NY5A 3VQTA 2J7KA 2ORVA 4M53A 4TL9A 3VX4A 1G20E 1T4GA 2GKSA 4D4LA 1W48A 3LY5A 2PL3A 4QNMA 3U4QA 1E0AA 4PO1A 4OQLA 4JLVA 4OQFA 2P67A 1JR3D 3KQLA 1UKVY 1XTJA 3L8ZA 1YR7A 4A8JC 1M34E 2BBTA 3KKNA 2FH5B 1ZIOA 4B43A 2WAYA 2AWOA 3MUFA 2GJKA 3QKUA 3U7EB 4OL0A 4B76A 5GJVC 1OIVA 1K6MA 5FL3A 4LBZA 2FPMA 4KCGA 2REXB 2XX3A 4WW0A 1TF2A 3I5YA 3WHLA 3REFA 2ZRFA 3UG7A 3KL4A 1OE0A 3A1WA 4DBLC 4H1VA 1H8HA 2OXCA 2BHRA 4M1KA 4DRZA 3AH8A 2C9OA 2E87A 1NMXA 2ZRHA 1Z83A 4WAUA 5J4VA 2ODBA 1R5OA 1W46A 3TVTA 4U5XA 2BEKA 4O0MA 3CF2A 1JJVA 3LO5A 2NOAA 3QI2A 1NN3A 1ZM4A 1S9DA 3OF5A 1KTVA 4TYYA 1UAAA 4PQFA 1KK2A 1T3HA 4KAXA 5DN6A 2W83A 1LF5A 3LXRA 1L7VC 3I72A 5JWRA 1G8YA 3A37A 3B9PA 2Z0MA 4HAUA 2WKQA 5HE8A 4AG6A 4BRWA 2J59A 3Q7PA 2LWIA 1N2CE 2QP9X 1SQ5A 3ZQJA 2QTHA 4DSOA 3GD7A 2I3BA 1E9RA 3WP0A 3C41J 1ZD1A 4HI0E 3PEWA 1LS1A 4CRWB 4C2TA 1T6NA 1YRBA 2GJ9A 1EWRA 1G7SA 1X3SA 1E2LA 4Q01A 1P4SA 2H16A 4C0LA 1N0VC 1US8A 3DDCA 1SVSA 3U7GA 1GVNB 1SKYB 3TVDA 1ZC4A 4HDQB 2MSDB 3RABA 2HDNB 3GLHE 2G83A 4A92A 4KODA 2N42A 5SZIA 4P32A 3DOFA 4CDGA 1CBUA 5EZ5A 4ZO4A 4AIIA 4Q1BA 4LJYA 4DKXA 2ZREA 3WMGA 3QNUA 4LC1A 1S3GA 5JMTA 4NYIQ 2FEMA 3U6BA 5IRCD 4B3CA 2VIIA 2WKPA 4FI3C 2FG5A 4IKEA 4HB4A 2BMEA 3W5IA 5DI3B 2BMFA 4NYMQ 1CJTC 1IM2A 3LDAA 3BB4A 4WVFA 1SXJC 4PANA 4MRNA 1IN5A 2ZRPA 3NG1A 1KI6B 2ERYA 2WM9B 3A8TA 4NE2A 4D80A 3LRPA 3KFXA 2O8CA 3EIQA 3AM1A 4X8LA 4OHVA 4YQFA 5B57C 1NJGA 1TQ2A 1EESA 2ZI4A 3AP1A 421PA 2Q9CA 4Q9KA 4DZZA 2WJJA 2BKUA 4QJ5A 1DO2A 2YVUA 4MH0R 2OT3B 3AVUA 1KY3A 2W6JD 3TMKA 4JMPA 2HEIA 1KI6A 2GZAA 1AZSC 2AR7A 2GJAA 3DHWC 3KFVA 3DZ8A 3G0HA 4HLQB 3UMFA 2G77B 1BO6A 2QP3A 1ZM9A 1DELA 4DIDA 2IT1A 3KJHA 4LC0A 3KXKA 1UADA 2YOHA 3MSXA 4MKGA 2J5XA 3K0AB 1W36B 5KSYA 1JAIA 4URXR 5DGXA 2VSFA 1P60A 1ZUIA 3BFVA 4TMZA 2DFTA 3K0CC 2QROA 5KSZA 2GDJA 1E79D 1EXMA 4QJ3A 2E1RA 3U44B 4OK3A 4QRHA 2IS1A 4AKGA 1XTSA 1NI3A 3CR7A 4PO9A 2O0HA 1OB2A 2F1HA 3CPEA 3T06B 3WMFA 1G5PA 3QY0A 3QUSA 4TLDA 1Q44A 3K0AA 4HAXA 1XX6A 2XZLA 5E7MA 2AX4A 2I4IA 4RJLA 2QUZA 5KTYA 2JLVA 1TQ4A 1FTSA 2W2XA 3C15C 5EUQB 2KBEA 5IT5A 5L3SB 3AB3A 3U44A 3EZ6A 3AVPA 1JALA 1E2KA 2EFEB 1TTTA 2C99A 1T9HA 2OLJA 4KLNA 5L3QB 4EAQA 4CT4B 1KI4A 1EX7A 5F9FA 4V0KA 3OEHD 2OSBA 1HH4A 1V5WA 2JIZD 3BD9A 5P21A 3DM9B 1BMFA 3RHFA 3CX6A 1DAGA 2R6GA 3FKSA 1VIYA 5KSPA 3SEAA 5L3SA 4GNKA 1N6RA 3NDPA 2V7QA 2CEAA 5L3QA 1NKSA 1T0JB 4CGZA 2KE5A 4FIDA 1RW4A 2QM7A 3MGCA 3DO6A 2OCYC 5DO9A 3PVSA 2W00A 3DPUA 4OHXA 3G82C 3GLFB 2CLCX 3NEJA 2QRZA 3QG1A 4DEXA 1MT0A 5EP3A 5EP2A 4OHWA 4AC9A 4OI0A 5JS7A 1XD9A 3K9HA 2NO1A 3B60A 1Z29A 2KSQA 4POAA 4FMCF 4IOJA 4C0SA 3DMNA 4II7A 1VG8A 3D7MA 4N0EA 3RC3A 1COWA 5J40A 1E2NA 2GCNA 2IHYA 4RFSB 2BCGY 4B3XA 4A9AA 1XTKA 1I4TD 1VG1A 3GP8A 1CRQA 2QMEA 1DOAA 1Z0DA 4QGFA 4BFYA 1E2EA 4U7DA 4OBEA 1GOTA 4DLVA 4HAYA 2REBA 4DDTA 2JCSA 1GL6A 1ZYUA 4PO8A 4DB2A 2KJQA 2F3RA 4F4IA 2YJTD 2KI5A 2OBNA 1ZP6A 1NIPA 2QQEA 2J0VA 3IQXA 3QKRB 1W4AA 3AP3A 2ZR0A 3B6EA 4TZ6A 2QT0A 1MO3A 1XMJA 2CK3D 3AF4A 3RVBA 3UPUA 1PLKA 4PTLA 2ZEJA 1VYUA 1DG1G 3H2YA 2R65A 4N0DA 1T3SA 1NKTA 3ZVNA 1EG7A 1A5TA 1EK0A 2O0KA 2PBRA 2F43B 3L82B 4KVAA 1A1VA 2BOVA 2CLSA 2RHMA 3QKRA 1SHZA 1Z28A 1G6OA 1CXZA 2BEJA 3LVRE 1UBEA 4J0QA 3Q8XB 5EZ6B 2G9NA 1MRSA 4PZZA 4LJ4A 2ZVPX 3AVOA 3W5JA 1NBME 1OYWA 3FFAA 3F5FA 4ZI2A 4RZ3A 3PV0A 2IF0A 4RD1A 5KPDA 4KHZA 2EFGA 2F43A 4G5OA 4OJQA 3QPUA 4G5RA 4DLUA 1YR6A 1BYIA 4JL5A 1CJVC 2V8OA 5HKKD 4CIDA 3VU9B 1M7BA 4B71A 2J0UA 1R5NA 4V0MA 1Q22A 1SZPA 3CPHA 2BM1A 1E2DA 1Z3IX 5LBIA 1JXMA 2AFHE 4W5WA 5KDOA 2GRJA 3TRFA 3ZIAA 2NO0A 2VL7A 1U94A 3KQUA 2A9KA 3JVUA 2UKDA 1KGDA 2IYLD 3CBQA 3QE0A 1TPZA 1TAGA 3WBJA 2ZUDA 4A15A 1N3BA 3SHWA 2D06A 4TZ0A 4RY2A 4KYUA 4LY6A 3VU9A 2ZRAA 2JLUA 3C4JA 1N6PA 2GZHA 4GZMA 5G3YA 2W0SA 5FBLB 4D0NA 1R0WA 3IDQA 4ASUD 1BH2A 1EFHA 2RGXA 2ZS7A 1JQLB 4HAVA 4UXHA 2B6HA 3JZAA 5TDHA 1R10A 4HLDA 4IOKA 2W0MA 3U3MA 3X1WA 3QIAA 3NXSA 1YHNA 1GTVA 5LDDC 3CWZA 4LBVA 5CITA 5JLJA 2AD1A 2WJVA 3L43A 4D81A 3TGPA 1U0JA 1JI0A 3SBEA 1DARA 2ATVA 5BN3A 1KOFA 4R98A 3FMOB 1OT3A 1XBTA 1M74A 2QE7A 3NBXX 3I73A 1CR2A 5CLLA 2ERXA 2J7PA 2PLRA 2NMVA 3U3KA 4DUGA 2OCPA 1ESNA 1W1WA 4HLUC 4D25A 1I4LD 1XD2B 4LX0A 2RAPA 1IN4A 2HCJB 2FA9A 1AS0A 2NG1A 1VHTA 3MJHA 4CZ2A 4JLPA 2F3TA 1OH5A 2WKRA 1GNQA 3LXXA 1C4OA 5CLQA 1AQYA 4CVNA 2PLFA 1G5TA 1P2UA 1U0LA 1X6VA 5L3VA 3IPXA 2IK8A 3EA0A 1EFRA 5SZHB 1XD2A 3UATA 3AKEA 5M04A 1J70A 2DY1A 1FP6A 3LAWA 4GP6A 1KI1A 3AVWA 1KO1A 4IDNA 1ZNWA 4IOLA 1XP8A 1VYTA 4Z1MD 2ZSDA 1WB9A 1W4RA 1NNEA 2YOGA 2C2HA 1QVRA 2W6IA 1OFTA 3CM0A 2UZIR 2J45A 2QZ4A 1NLFA 2YZ2A 4Q66C 2BWJA 4BGDA 2O8FB 4TL7A 4WOPA 1KKMA 3CRVA 1KSGA 3P1JA 1IXRC 4LJAA 1I2DA 2VH5R 3T1VA 3Q3JB 3QOFA 4TT3A 4Q18A 3GLIE 5JEDA 1VDZA 1A7JA 4ARZB 4R2HA 1XB2A 4KXFB 1OKKA 1R5BA 3LFUA 1JECA 4G1UC 5KUTA 3PIRA 2WWFA 1H8HD 3KJGA 5DE3A 2N46A 2DPXA 2RGEA 4MYCA 4B73A 3OIVA 1SGWA 4B6FA 3U6KA 3OZXA 1AZTA 4DLYA 1Z5ZA 3SJBA 4ARZA 5AUOB 2RCNA 4QG7A 3L0IB 1Z0IA 3ECCA 2IYRA 4FD2A 4M4SA 2CL6X 3MJRA 1F3OA 4LOAA 3GFOA 3FGNA 1OXVA 3F3YA 3HPRA 3JZMA 4M22A 1KO4A 2GF9A 1XCMA 1D5CA 3OAAA 3QXCA 4PQRA 1NN1A 2XNDD 1P9WA 1E6CA 1E9SA 3T1QA 4DLXA 4DT1A 4D26A 3CB4A 4L16A 5SZJA 1RRCA 1G8GA 3QVUA 5DH9A 1BIFA 3PEVA 1XEWX 4GZLA 2R6CA 1KI3A 4R9UC 4GL2A 3GLHB 4DXAA 5AJYA 1DAHA 5FTMA 1DS6A 5IF9A 3A36A 2JATA 1Z63A 1XMIA 2Z4RA 3Q72A 5CJPA 1Z6YA 2QRNA 2DWPA 3THOA 5F3WB 3A4MA 4P4TA 3FYHA 3FHCB 5F2EA 2AXPA 2IUUA 2X8AA 3GFPA 4RD0A 4KV9A 1RPZA 5JJKA 4XWOA 5BN5A 4GOKA 2JEOA 3GLHA 2QENA 1GL9B 1X86B 2QAGC 2XB4A 4GBMA 3I5XA 3HJNA 3QPWA 4HUQA 3RNLA 5JFGA 4NL4H 2HF8A 4Q7KA 1E69A 3ZVMA 4ZDWA 1CIPA 4JSTA 2HT1A 2QPTA 2OLKA 1CF4A 1E2JA 2HLDA 1YZQA 3K09C 3TQFA 4B2LA 3I61A 2FPLA 1F6BA 5HE9A 3A58B 2EQBA 4W7SA 3SJZA 521PA 2XSZA 4FMCB 2H8KA 4JLJA 1E98A 2YKGA 4TYPA 1U8YA 2JLRA 3AVXA 1D8TA 4QM6A 3FVQA 1N6LA 4B2PA 4NYJQ 3WP1B 2J0SA 4B48A 1KI7A 2IYTA 3K70C 3AQ4A 2ODWA 3ZLJA 1Q3HA 1KMQA 1ONBA 3KKMA 1KMHB 4RZ2A 2ZJBA 2QAGB 2YWHA 3K9NA 4BLQA 5FOUA 4OQNA 2KWIA 2ZSEA 2P3SA 4LYJA 2XZOA 3THYB 4Q1FA 2A5DA 3GEHA 4TYWA 2EYUA 3C16C 4C0JA 1JR3E 2DFKB 4E03A 2O8BB 2FF7A 2GXQA 2PMKA 3CONA 5J4HA 1E1QA 1NRJB 3EWSA 3AV0B 2Q3MA 2B92A 3VR4A 4V0OA 3KQKA 1NSFA 2YOFA 4NTZA 3GPLA 2BDTA 3SYLA 1KMHA 1UKZA 3IEUA 4AKEA 4C0BA 3TSWA 2QBYB 5SZKB 5J4KA 2IA5A 2ODEA 2GBLC 4DLWA 1HQYE 4AKIA 3PG5A 1XTIA 1DADA 2CHVA 3U3JA 3VR2A 3THYA 2O8BA 1KY2A 3SFZA 3BK7A 1VCIA 2QI9C 2VP0A 1OLOA 3QG5A 2QG6A 5AK0A 5KYKA 2BBSA 2GNOA 1SVKA 1C1YA 2XTZA 2QORA 3GQBA 4GMXA 4YMVA 4ESVA 2Q21A 4TQAA 1IXSB 1L4YA 4MRPA 1SXJD 4IEEA 3PXGA 4HDOB 3BERA 1E1RD 5BQ5A 3UWOA 4IEIA 1KO8A 1GZSA 1SVIA 2IW3A 4QJ4A 1G64A 3LLMA 2QBYA 3A6PC 5HPYB 5KDDA 1QRAA 4JT4A 1XTQA 3HU3A 4JLDA 2AXNA 3K0FB 3NH9A 4D0LB 4Y0AA 1W0JA 1TU3A 2GAAA 2JGNA 2CE7A 3LA6A 2GVDC 3VHXA 3GJ8A 1Q57A 4B35A 2O8DA 2ZYTX 4TTQA 1AQUA 1NSTA 3SDZA 4P33A 3ADBA 3FOZA 2QMUA 1YZNA 4Q7LA 1S0UA 1OHHA 4IFBA 3WXMA 4RZXA 3TH5A 1E32A 1D2NA 3K0FA 5DYGA 2YWFA 1OYYA 5B2ZA 5JRJA 4EFNA 2CDNA 5CK5A 4Q5IA 2ASEA 2DFLA 2OEPA 5JI2E 4QXAA 1BOFA 2ZRGA 4Q00A 3ZZUA 2BC9A 1YU9A 2BJVA 1NL3A 4URYR 4A2QA 1N5IA 2CCJA 1E4VA 4B6EA 1NMYA
chains in the Genus database with same CATH superfamily
1K4MA 3PFIA 4AN1A 1TF5A 1HSZA 3QVXA 4PG7A 1HWYA 4UTOA 5JJLA 1KAHA 4JOBA 4P80A 3G2KA 4U2CA 3DOEA 4EPTA 1ANKA 5EOVA 3UK0A 1VSVA 3LGAA 3KT8A 3PC6A 3QU4A 4KIJA 3WKDA 3ZXIA 3UHPA 1AKYA 3I3SR 1G3RA 1QFYA 4FONA 4FT4A 5DGIA 4Z53A 3P52A 2V6MA 1II8B 4MKFA 1G2QA 4BGIA 5ICCA 1GILA 1S3SA 3STXA 1WRBA 4DLRA 4OYHA 4F85A 2E6UX 1Y4DE 2AI1A 5HF8A 4DV1B 1FZQA 1H5QA 3K31A 3VNSA 1TO1E 3MHTA 3MQFA 3TQOA 1COZA 4CM3A 4BO0A 4EDHA 3CX3A 5FTLA 1U3UA 1DP4A 3M5CA 1MABA 2GF2A 2IYYA 2PNFA 3OFND 1ZA1A 2G82A 3R24A 1X7WB 2QLNA 2VJMA 3DT9A 3WYEA 3ZWAA 4BGUA 1OU4A 5BNWA 4M3NA 4IGAA 1SPXA 5JNLA 2FMFA 3JAMA 1E18A 1WHSB 5C37A 3V3TA 1RQ2A 4MUMA 2IRWA 4B4WA 3VSEA 2E1BA 2MHCA 5B1IA 3PUVA 2J48A 5H9VA 4BKUA 4C76A 2P2YA 3P0FA 4MQFB 4YAWA 1WDTA 3I5UA 1X9HA 1GV0A 3H4IA 3L2OB 3IP6A 1N1EA 4J2TA 3V9PA 3EXHB 3WIDA 1G9XA 2JJ1D 1R0CA 2VH2A 3KSUA 3RRYA 3PFCA 4NK5A 1G16A 1KO5A 2HNAA 3AR3A 2VDJA 1PQUA 3D2AA 3GYGA 2VJAA 3ND6A 3KPWA 4GC5A 2JFGA 5FI0B 3T15A 3T7KA 3VVBA 2QX7A 2QZPA 4LJKA 4BVLA 4HAZA 1I6KA 1BRMA 5J2TA 3VXKA 2B5OA 4E2WA 3BSSA 2DETA 4FOTA 5ARDA 3ZWDA 4GWKA 1GUAA 2DR3A 2O0LA 4TTAA 5AP9A 3TRDA 5L45A 3SQXA 2QUKA 1X94A 2FR0A 3ADCA 1K7FB 4PR3A 2IXTA 3ZHZA 1BX1A 3AU8A 5CT9A 1CT9A 2OLEA 1W8IA 1T9GR 1Y8QB 2WWVD 1IQ0A 4KI0A 2GXAA 1CIJA 4RM2A 2WYOA 4TTSA 3HNPA 4MW4A 1RAGA 4AS1A 3LHKA 3DM5A 3ER8A 4KO3S 2XBMA 1LLCA 1JAHA 3G9TA 4NONA 5EKDA 4YCDA 4ER7A 3VNVA 2PS3A 2TMDA 3G68A 5FL7A 3CRZA 1MAAA 3B5IA 1R9NA 3VR3D 2A58A 2RC6A 5GIPE 1UKCA 4OMCA 5D2CA 5E6RA 3U3DA 1QKKA 5BWOA 3VA7A 2ZK7A 1G9TA 3IDZA 3RGGA 4JFAA 2NPFA 5JY1A 5JS1A 4AKHA 2GT1A 3R6LA 4HNAA 4LXIA 2XDQB 4RD3A 1RXVA 1H2RS 1R18A 3IC5A 1D1QA 3I4CA 1VBFA 3OLZA 2Y1CA 2VBFA 5K8IA 4J3NA 2X77A 2YMMA 3A1CA 5IYZB 1YDEA 3PNSA 1KEUA 2FSHA 2GETA 1AGRA 3PHJA 2WY2D 1OAOC 4YLYA 3FHJA 1JPJA 2YV5A 4L85A 1QYXA 1X1SA 3KB6A 1N1MA 4O33A 1P4RA 3VC2A 4XD7A 2C5HA 1LDGA 5M3BA 3TXYA 2QVZX 5IAJA 3W3AA 3C0KA 2SHKA 1KXJA 1KNXA 4KQWA 2GEUA 2IE0A 3U0VA 4AFNA 3WL3A 2WWWA 1DJQA 2X3FA 3PX3A 4Q3EA 1O3YA 3BXGA 5KHAA 2DPHA 5LZ2A 4BWYA 1C80A 4AMYA 4BTLA 5KYNA 3OFSA 2OOKA 2QB5A 4HFRA 1MQ9A 3S6JA 1Z0ZA 4HH0A 4EKDA 1U1FA 2GCOB 4H9GA 4KR0A 2QAIA 4ECEA 5EIBC 3H1FA 2GILA 4AUKA 2VHQA 2WWTA 1L7DA 2PGIA 3HNOA 4ZALA 1ID8A 1HBJA 2E0IA 3PICA 5JC8A 2ID9A 3QOYA 1AOXA 1P4GA 3OTGA 4NZMA 4LK2A 5BSRA 2AIRA 2ISCA 3O2QB 2QL9A 3OA2A 1Z4NA 1QCCA 5EJGA 3VKVA 2CHUA 1DZIA 5KYWA 1M2KA 4I19A 2O3RA 4WI1A 5C8ZA 4W9NC 1KPHA 1KQ3A 4R01A 4HVAA 5EPUA 3W6OA 4JHXA 4RNDB 2AX3A 3E9QA 5KCZA 4IMRA 4YRZA 1EFVA 4OLJA 5SY6A 3M3HA 4W8HA 5L9AA 5FBRB 3COZA 1RIIA 3RODA 3VPSA 4MV0A 3TRHA 5HRUA 3DQZA 3VPCA 3JYHA 1R9JA 2R48A 3T52A 3A6HA 1J2UA 2B7BA 5CBKA 2Q07A 5C7LO 2HSGA 4IQ4A 1A5SB 2WHRA 1IJKA 1PT6A 1V25A 3FIUA 3ITKA 4S2EA 1WBBA 3GR6A 4L27A 2FSGA 3ZX4A 2VA9A 3LYLA 3NT2A 4QBFA 3LWZA 4CGYA 2V7BA 5EHQA 3SS7X 1ACLA 3H9EO 2PUGA 2JZOA 4MYUA 2CXXA 5K6TA 2YW9A 4KAAA 3U1BA 4GM0A 2AXEA 4IVNA 4C3OB 5B7PA 5EERA 2C31A 1XMQB 1JB9A 3FCYA 5LBUA 4OKSA 1X8KA 4PYLA 4BFLA 1BZYA 4EHIA 2PL9A 1HQDA 3WDLA 2K87A 2Y1FA 1P7PA 4LRWA 4QARA 4QUGA 4WXYB 3UT0A 2P68A 4MROA 3RFUA 2FPSA 1U63A 4RW0A 2LXNA 2ET6A 4JR1A 3FTPA 1JEQB 4F3NA 3ZCUA 1T6BY 1A4XA 3BRQA 2ZIWB 2FMUA 3S27A 3J7AC 2P3QA 2G9QA 2R85A 4F56A 1SELA 1I6LA 1UBKS 2BI8A 4DBVO 4BQEA 3IDAA 1OWOA 4Q7EA 1L3BA 1W30A 1RJ9A 2ATCA 2FLWA 1RHKA 4LHXA 1B6GA 4KWEA 4XM1A 1OXBB 4GYKA 1WCWA 3V7WA 2CXPA 3IIMA 4C06A 1UK8A 4Y2QA 5AMXA 3D6VA 2WMDA 3NOQA 4G1EB 2X8WA 1E4YA 4AICA 4O2AB 4EHFA 4U02A 1TKBA 4JXXA 1E5TA 3KVNA 4KVFA 5HX7A 3OE7A 2OHGA 5IBCA 4LFBB 1PHPA 1U1IA 5AVVA 3ADPA 4BEBA 3AKDA 2CLKB 3AF3A 1FUUA 1GPKA 1Z56C 4GR9A 3KZOA 3O8OB 4B6SA 4COKA 9ATCA 1W2WB 4R2IA 4R54A 1BROA 1HKUA 2PTGA 2VHXA 3RC2A 2C7QA 2WUEA 2Q45A 4Z7QB 1L4EA 2NSYA 3FSGD 3BQNB 4O4HF 4RACA 3NHLA 4X1KB 1XLTC 4L3WA 1DKUA 2Y92A 3FTCA 3L6CA 4CKBB 1KK1A 3SLGA 5A06A 3EIHA 1Z5UA 1TO2E 4WN9B 1M83A 2OGZA 1KU0A 1UJ2A 1V6SA 1R4MA 3K0HA 4X94A 1PP4A 4DLTA 2BVNA 3DAGA 4L4YA 4EJSA 3DDNA 1GUYA 2C5FA 4EUNA 5KQPA 4YMUA 3V4FA 1NYRA 2GPSA 3TSCA 3R7WB 1OBVA 1GG2A 2HO5A 1NVFA 3UAWA 1GNPA 4E5UA 1AJEA 2JL1A 2OHJA 4A6DA 2EWVA 2BHLA 3FCCA 4MARA 3P0RA 3U4MA 2YUIA 3EPJA 1PZGA 3HGMA 1NGSA 5HDBB 2P2LA 3IBFA 3IKTA 2A1IA 4RVFA 5IKMA 5ITWA 1CYEA 121PA 2OY0A 2Y1WA 3U37A 3VH2A 5K3FA 3UEOA 4A6EA 3TFQA 4J4TA 1DC6A 2JFYA 3GLUA 1ZSYA 4L6CA 4ZC8A 4KR9A 5K0GA 1AUPA 3NOVA 4QDUA 4NAHA 5DMHA 3D3JA 4ZC1A 3WYBA 4UEQA 4WMLA 1NW6A 1NXOA 3OC0A 3NUQA 4CI2A 1U7PA 3IAS6 4Q9HA 1IOVA 2PMBA 4GPBA 5FEMA 3TUIC 4CM4A 3LQRA 2C7RA 3O92A 2GHQA 4HDCA 5DYWA 1N75A 2WJIA 1XVUA 3A0UA 1P7ZA 1U3CA 2ECOA 3N2ZB 1CUBA 4HQOA 3PB3A 5DISB 1E6EA 5BW8A 5C46F 2VNJA 4M1TA 1K75A 2R8XA 4Q21A 1ZAKA 2R4UA 4WNAA 5TF4A 3G85A 3ZEAA 1PDVA 2D7JA 4LSMA 5NULA 2I87A 3OLXA 5HSGA 1LRKA 4D45A 4QPZA 4FC7A 4RA6B 5T7BA 2HTEA 1T5OA 2NAPA 2Z1NA 3HABA 3KDSE 4LK3A 5KTOA 1E6UA 2IIPA 1CTQA 1MOSA 2W6PA 3C5EA 1GGHA 3M4ZA 2Q3LA 4DA7A 3NW9A 5JNVA 4QJBA 1QH8B 2XYQA 3BGOS 1P1JA 1XJCA 3OIWA 1WUIS 2JEZA 2ZITA 3IDFA 4I5DA 1SU8A 3GZTB 4ND7A 1UZAA 4UQOA 1U2DC 1N9ZA 3B82A 4QGBA 1OBCA 1LLDA 4PYMA 1L8XA 4WZ6A 3ASZA 2J0UB 2FZ4A 2JGIA 3Q7QA 1JQEA 1XCBA 1N6NA 2ZBQA 3Q9UA 3LW7A 5F2OA 5FOQA 4JLSA 1V1RB 3ZI0A 5EQTA 4R8SA 2PX3A 3T34A 1RYDA 3WGJA 1K98A 4R2KA 3WLMA 2FEKA 2HHAA 5ER9A 5CEFA 2HQRA 4V0NA 1JEDA 2QRQA 3EXIB 3IAFA 3MINA 4NPHA 1KXZA 3FSJX 3FVVA 1JB1A 2V7UA 3FCXA 3DH0A 3KHSA 2D1TA 2V4ZA 3GGPA 2ANCA 2VF8A 3WV4A 3BE4A 1IHUA 2EC5A 4DCNA 4EKNB 2QZJA 1E0SA 4ZVVA 4ZQBA 1EE9A 4YP0A 4LHYA 4M89A 3B38A 3RWOA 1I4EB 1KH2A 2ZANA 1ZW6A 1CEEA 4IUCS 4DBZA 2ZJYA 2CWWA 2FRDC 3O9VA 1JKIA 2BSXA 4X95A 1LBHA 3AONB 4CBVA 4LNAA 1E0KA 1IY1A 2G71A 2MSCB 4JOQA 3PHLA 4EKYA 4ALNA 1ZJWA 2CXNA 2PS1A 3BFXA 3HCBA 3LWDA 3G2MA 1QF9A 1GU0A 4IJMA 3T95A 4CN8A 1H94A 1YIAA 2J87A 3Q5EA 4U3JB 3GGDA 5ARCA 4DSAA 5JARA 5LQMA 1PTJA 5BSUA 1YJXA 4N1AA 4TLEA 1ABEA 3DVAA 2D74A 2UZ3A 1U9YA 2Q5EA 4JC5A 1DPFA 1QH9A 3OO0A 4RFVA 3H9BA 3KKEA 2Y50A 1YRHA 3SQLA 4OJKA 1BMTA 4R40A 4KFRA 3GH3A 2NYRA 4YUWA 4B3IA 3UGQA 1TEXA 3HY6A 4XQ9A 3X2SA 3UK1A 4ND2A 3L8FA 4N8SA 4HEA1 1NBAA 1RXUA 5ES4B 4GM1A 1TRKA 1S2OA 4NEHB 2XE6A 2JC3A 1CEQA 3CB2A 2QTVB 2VNHA 4JDUA 4PCVA 2ZJ5A 3S40A 4C2UA 3M1AA 5FH9A 1P0PA 5CDGA 1T9CA 5KQLA 1C1XB 2X1LA 1QV7A 2E6KA 4R1NA 3SJAA 2OKCA 4BXOA 1Z4JA 3KG2A 5E4FA 3WNBA 2HBRA 1JG2A 2EBUA 1D07A 1CCWA 1FDVA 3O74A 1RLMA 2Q50A 4NG5A 5EAIA 2LPMA 1IONA 2NZ8A 3FHLA 3QFTA 5JS8A 2NSLA 2FY8A 2G5CA 1HFKA 2WILA 4LHSA 5JCOA 1QGOA 3UK2A 4LRSB 1V8DA 2JFBA 3T4PA 2WR8A 2JKVA 2HLNA 1UDXA 4BBZA 2I1QA 5EXEA 1JF8A 4UVHA 3RSSA 2Y0BA 3PIIA 4DRXA 3DVLA 1E2BA 1SBCA 3NTUA 5D3KA 2ONZA 2H1WA 1EE2A 2HIHA 2J4CA 1N3YA 3L06A 1ZR2A 2RGYA 1NOKA 1NM5C 2BSAA 2ZYIA 4HH3C 4JYBA 3TMAA 3FLAA 1KZ9A 1H2XA 1UBSB 4GSYA 4C6TA 5U9CA 4D6PA 4J1TC 1WW8A 1VG0B 2FQXA 3ZDXB 3JQFC 3Q8KA 1JLLB 1YZHA 3OP4A 4DUZB 3O7MA 2GLXA 2W6JA 3L4BA 2CFIA 1FU4A 1MAWA 3DXXA 3PGJA 1UEJA 1HE8B 2QTCA 2SCUB 3V8RA 4IV5A 3TZCA 5J4YA 1EYZA 4AROA 4R9NA 3W04A 3ER9A 5DW0A 3KUUA 1XXLA 2ZYHA 5E95A 2JS7A 4HEHA 4X7BA 1HM5A 4TKUA 1OPXA 4PPQA 2ZULA 4BKOA 4UTPA 3VO8A 4G1BA 3VZQA 4M1OA 5FBVB 4U0JA 4F9TA 4PFQA 1HDOA 4HWTA 2BPOA 1Q1ZA 1RZ3A 2PT5A 1JI3A 1YR2A 2B5VA 1SBHA 3S8MA 2NSJA 1QV6A 3M4YA 1LY1A 4MI6A 4RQTA 1DQRA 2YCBA 1P2SA 4Q03A 3T7TA 3N6VA 2GN9A 3ROGA 3EPHA 1SXJE 2FOLA 5EQDA 2FE4A 4BKMA 1T2AA 2QUAA 1YOVB 3ZXUB 1VPLA 3FZEA 4TV8A 1VOTA 1Y1QA 3K0EA 4FEYA 4ZAXA 4MUKA 3ZHCA 3KQHA 5FLXA 3FYUB 4WFKA 5F7JA 4DMUB 3P8ZA 4DT1B 4GF5A 3O93A 4QGHA 2XXBA 1DJPA 3PXDA 3IV9A 3ZJ4A 4BCCA 1B0ZA 3K1TA 3M6AA 5KJEA 5KNCH 4DV5B 3QF4A 1ZM3A 2AKAB 1VL5A 1BA3A 1J20A 2VBGA 5KVSA 1S02A 4NFYA 3EC2A 3AVTA 3J80A 2UZAA 2VNAA 1LA2A 3Q7IA 1DWUA 1JR4A 1I3OA 1Z2AA 2WU3A 5AOBA 3A27A 3VAAA 3U5ZB 3KSZO 2GUWA 5F52A 4BX8A 3LRXA 2WLSA 3MK31 2O3SA 1ZITA 1ZRHA 2WD7B 4MWZA 1QHNA 3RSLA 1S1CA 3B2QA 5AHXA 2W9XA 4JUBA 1BX0A 3CNLA 1L3CA 3CX7A 2P4QA 2VHTA 5CA1B 4TXJA 2BKAA 3EIEA 1LEHA 3EN0A 4D6XA 1OTXA 2IL1A 4ENUA 2QWXA 2RONA 4HUQB 1J8YF 1NW3A 3T61A 3ZLBA 5DHFA 1B43A 2WMOB 3MWFA 2CBGA 4E88A 1AT1A 4N12A 3KR2A 2AHOA 3UB2A 1DRVA 1QIGA 4K86A 4WCFB 3T5CA 3UM9A 2V0GA 4DHEA 2O1XA 5IKEA 1VLMA 4YRQA 3K71B 1D1TA 1DJOA 3STWA 5I8WA 4JITA 2BGRA 4D79A 2J07A 2OFPA 1V35A 3PJDA 4HMQA 2Q3HA 4OD0A 1MR3F 3FTQA 2F1JA 4UARA 3LUHA 4KKXB 3IP3A 4U7FA 4XOIA 2NT4A 3JWEA 1JZSA 3CKYA 2P4UA 4GECA 5H1YA 5C7YA 3OEYA 5IEJA 4GPD1 4YWJA 1O95C 1T9GS 4FT2A 3KEOA 4QVGA 1UPTA 1CQIA 3C4QA 3CH7A 5ERXA 1ESZA 4ZGWA 2OUKA 3AZOA 1NVKA 1DCFA 4EUHA 5C81A 3MTEA 1JNYA 2PIDA 1GAWA 2P0EA 3A2NA 3C8HA 4RTRA 4TMVA 3E8MA 3PF8A 3K20A 1W47A 4HAOA 3VX3A 3SR4A 3C7DB 3EC7A 3FDZB 5AVQA 1T8UA 4L6IA 2WOOA 3GEIA 3NASA 4YRIA 5DHAA 2D2FA 2DPGA 2IDKA 2I80A 3LBFA 3DEKA 5E3HA 4Z9AA 4GP7A 3GK3A 3TXAA 4KV7A 1QB7A 1YQEA 1FUKA 1T3TA 2C5BA 3VPAA 3DOUA 2EJUA 3P9IA 5IP5A 4XIFA 2Q6TA 3PD0A 4OBXA 4FLMA 5F98A 4P3KA 4R8KA 4OHBA 5ALEA 3X1MA 2JIQA 1K3UB 1H93A 4FDAA 2VAPA 3C1UA 4RKYA 4DIKA 4DUYB 2HSDA 1N2BA 1O0SA 1H6CA 3K8QA 3OU7A 2IUTA 1DFGA 1NVBA 2B34A 4CJXA 4PRLA 1UZUA 2XDWA 3FB4A 3IO3A 1ISHA 1Q16A 2FETA 2QIOA 3O2NA 3FKJA 4FYPA 4MV8A 3GG2A 4F72A 2BN4A 2P6MA 1D2EA 4G8DA 4NE7A 4PC7A 1FSSA 1N2IA 4JCCA 4XB1A 1KOGA 1ZL0A 1KKLA 1FU7A 4A1OA 2EZTA 1DE0A 2BCEA 3PFHA 2QY9A 3BEOA 4PG8A 3GPBA 3KUCA 4E5KA 4Q4JA 1FP4A 2CVFA 3R3VA 2QTGA 3A9TA 5A9SB 3D8BA 2UVDA 3N8IA 1M6NA 5JD4A 5KNBA 4IQGA 1W5FA 4G65A 2WAMA 5CFOA 2M1XA 5CFZA 3ZJTA 3LUKA 2ZIVB 5CUQA 4RTJA 1OLUB 4PG6A 3A3KA 3FDFA 1S3IA 4MVJG 5EIWA 3MA0A 2P91A 1JHOA 4MNTA 5FUXA 3WWEA 5MGNA 3QXSA 3MCVA 1XZLA 3EISA 1KSHA 2JJ8A 3JQQA 2IPNA 5AVTA 1VRVA 4CCSA 5ANRB 4LY0A 4CHGA 4DKJA 4CCYB 2VQ6A 3G9QA 4RA9B 3RUPA 4B3FX 3NEYA 4JXKA 2GJ8A 2J9YB 5EINA 1E3SA 1RM5A 2O9JA 1E2GA 1XC7A 1ZMXA 4KO1S 4WESA 1II0A 3WK4A 1C3OA 4BOYA 4DDWA 5BV7A 4V24A 2NO4A 1QKJA 3IDSA 5CRIA 3AIOA 1UPFA 2VNKA 3O7WA 4P3YA 2AFIE 1A88A 2PTHA 2I2FA 3COYA 3N2LA 4RTPA 1RC8A 1XGKA 5ALWA 3D2LA 1G1MA 3AEQA 3NDJA 4G8CA 4UEJA 1XAGA 3U49A 1A9ZA 3DT8A 2Z95A 4K3VA 3F98A 3AJAA 4NV3A 3PX2A 4JP1A 1G21E 6NULA 3SHVA 4A73A 2RE8A 4E2XA 1V7CA 3ODGA 2E5WA 4M0MA 1WXWA 1G4AE 1T43A 5TMBA 4FEAA 4BMZA 3SZGA 3U7IA 821PA 2D1YA 3P2OA 2ZJZA 3RWMB 3AGPA 1PBNA 3ZZ0A 1U9IA 3GAMA 2VRCD 2ZZNA 3Q2KA 2ECQA 1KYWA 1LPBB 4TLCA 4IDEA 3KQNA 4A2CA 2CFCA 4R0NA 4CEJB 2VXOA 1YZ3A 2Y68A 2WPNA 3C1OA 4LKRA 5JZSA 2Y6IA 2FLVA 2REQB 2VVTA 4J0HA 1VIVA 5BMVA 2QPAA 2ZZEA 4OI4A 4BZQA 4BX9A 3U80A 4F91B 2CWDA 3EC1A 5IDYA 3R7FA 2EIXA 3IO5A 2HMUA 1PDOA 4NCHA 3Q6NA 1NBWB 2A67A 2VBIA 4AN4A 2HJ9A 5B6JA 2WIGA 4G67A 4BQSA 3UQYS 5FI5A 2RGGA 5IM4F 5ALPA 4TWJA 2Y6VA 1JIVA 3EFEA 3DB1A 1OAAA 2CZQA 2AOUA 2X8JA 1ZNXA 3B1KA 4OAOA 3N87A 2CB0A 1CUCA 2DSNA 1B23P 1D9XA 3EW7A 4XGNA 3MFYA 2NQ2C 4K1LA 3T12A 4D9FA 3D3QA 3TLZA 4Z2AA 5LZ9A 2XHZA 4Z1OA 1VJRA 4TN1A 3FETA 4EI8A 3G6WA 4TMTA 4KOAA 4OSPA 4RCYA 4W5TA 1HTWA 3AETB 4UM9D 4O4JB 2EQAA 2YRFA 4BLSA 1ZONA 3AY6A 5TSDA 4I1YA 1V16B 1J8MF 5I4CA 1CR6A 2YINC 2Z2XA 4PZCA 2X4GA 3AM5A 1JDTA 2OGUA 4MQ6A 3GHHA 3TAXA 4FLEA 1A8QA 2FZEA 3AYZB 2NPIA 4DNQA 2WUFA 2IEAA 3CU5A 5JXGA 2C96A 4M21A 5KB3A 1LGYA 4HNGA 2CE2X 3B6ZA 3OQ6A 5ESWA 1LWNA 3ORFA 5H0IA 4IVQA 3C8UA 4TKMA 4CG2A 2JAHA 1J8DA 5B1DA 5I9NA 2BY4A 1GVHA 2CFSA 2FWRA 1P81A 3QUAA 1EVZA 2H57A 4JH0A 3ESCA 4HGQA 5H83A 4D97A 3DE1X 4CMJA 3EZ7A 3ZHOA 1FQJA 4RHUA 1YE8A 1WAMA 4J76A 1EB8A 3ILXA 2ZYWX 2QJTA 2ZWPA 2RGNA 4KTVE 1KTIA 5FOSA 2NSHA 1JFFA 1MO6A 1GR0A 1ZM7A 1W2HA 2FN8A 2VH1A 4RESA 3U4DA 2OZPA 3CPSA 3WQBA 4LXUA 1NA5A 4BP3A 2VYCA 5TXGA 5HZMA 2DM6A 5DI9A 5HYVA 4M0KA 3IRVA 3LTEA 2ZT7A 4UZFA 3JQCA 4KK4A 1SQ0A 3DPSA 3F3KA 2VNIA 5JXIA 4BO1A 2F00A 3C48A 4JU9A 3NHSA 3GD5A 1U65A 3OP1A 3CPJB 4H31A 1ZUNA 4L8LA 5BVHA 1PQPA 5EE3A 2V7EA 3M5DA 4IUYA 1X7YB 1ZNZA 4MQ5A 4Y7CA 2BTOA 4FOPA 4QYTA 4DJFC 1EFPB 4RF5A 3QU2A 5H3CA 2NUPB 2M6KA 3DBRB 2PANA 4DDVA 1OUMA 3CVYA 3EDCA 4FE7A 1FA9A 1QUEA 3TKLA 3OQBA 4BNGA 2NV6A 4NQRA 4DMRA 1T4CB 5JHGB 2E2WA 4C4YA 1MP0A 2YWBA 1TTPB 2VAWA 3O21A 5AKGA 5BWLA 2FEOA 4CKWB 1DO8A 4JP2A 4LHWA 1XEXA 2EWMA 4DCPA 1L5HB 5AJUA 3HN2A 4FW8A 3EJWA 1ZGAA 3OTHA 3R3UA 1T8TA 2NIPA 5AKHA 5JMOA 4YMTA 1J07A 1WXOA 2RGUA 1RQRA 2VHJA 1H1LB 3ICVA 4N9QA 5CAEA 2X7XA 3VZSA 1UMBA 1YAJA 3KK0A 4KK3A 2J7PD 3I32A 3STUA 5C8DA 3QM1A 5LXTB 1I2MA 4P1ZA 4D3ZA 5TQJA 4BL5A 1ESDA 2B35A 3KYIB 2XA2A 3QBEA 3WK7A 2D1SA 2YS6A 3M89A 5ALQA 1W581 2B7LA 5IHPA 3NAQA 2YNMC 3F0TA 2QAJA 1GIAA 1PJQA 3DZKA 4QT0A 1NPTO 2X0FA 4M1SA 1G2PA 3MMPA 4RPLA 2CHEA 3U3RA 4ESEA 3WI7A 4QQRA 2FPWA 1WNUA 2BFPA 5AVUA 4H1TA 3HHPA 3TYXA 4GMDA 2CUTA 1EFRD 4YGXB 4A6PA 4I08A 5IWAB 4AYTA 3HZZA 1DC4A 4XFDA 1Z47A 3RE1A 3TQSA 2HGZA 3Q11A 3OG9A 4JIMA 3RUHA 4MR8A 4AZWA 3WLKX 4HRVA 3AEKB 1F6DA 1U7UA 4G5SA 2X76A 2HMVA 5CGQB 1UZNA 4Q6WA 5CVJA 2H63A 4W9MC 3ROKA 5HP4A 5KKAA 3FPFA 3BFPA 1DAKA 1Z68A 2IPMA 2WU1A 1U8ZA 3H17A 2P5TB 3WL7A 2O8BB 1EHCA 5IC5A 4CEIB 3O73A 1SXJB 3MC1A 3SIWA 1PR4A 4UFNA 4EMUA 5JBNA 4FD3A 2ZRQA 1E3LA 1JNXX 2BBWA 4KQ2A 2F1IA 4QQ8A 3RC7A 2ESRA 3S5JA 2ZOSA 3NVDA 2Z9DA 1E0JA 1Q15A 4EELA 5FJJA 3PNYA 4INPA 2RJ3A 1TM5E 1B73A 2FFAA 1Y5LA 2GNAA 3HP1A 1TK2A 2X9QA 2IHZA 5TEVA 2K7ZA 3RT7A 3LC0A 5ALYA 1RLJA 1QC5B 3U09A 3CW2A 5F7XA 4C3VA 5JWHA 1GDHA 2G4VA 3G0CA 2ZVJA 3ZYZA 1HE2A 4H3SA 1NXVA 3A4LA 2CCGA 4O2LA 1E4OA 4CLRA 4W5QA 5JBQA 1N5MA 3HSSA 1U7ZA 4QLBA 2G0NA 3MGAA 5HFJA 1MB3A 1AV6A 3HP4A 5K51A 5IAAA 1TAHA 3EWAA 4M8SA 3NB0A 3GUZA 4HNTA 2W7TA 3F6YA 4AQ7A 1FMLA 4N4AA 3M9XA 3N3BC 3OHMA 4EY5A 3NM4A 3TRJA 4ZIRA 1IRIA 1KSFX 1KOLA 4YPOA 2Y3UA 4ZZ1A 3HWRA 4O4LB 1V1MB 2QY6A 1RWWA 1PLJA 3B13B 3FUWA 3BZUA 2X2EA 3D8NA 1V9CA 2YIDA 1YFLA 2UZ1B 4PLZA 1L9XA 1PV4A 5AICA 2HDWA 3C6MA 4XOUA 4EPRA 4J29A 1O08A 2P2SA 4RTKA 2WSIA 5B58T 4YJFB 4DGQA 3KVYA 4LDPA 1ISMA 3EXEA 4P83A 4C3ZA 2VCEA 5JYBA 1L5GB 1OTYA 3W6PA 5BUZA 3MYRA 2Z6UA 3ST7A 3IAS1 2NVWA 4CG3A 2UU9B 1LD3A 1KRHA 1M33A 3KEGA 4DIFA 4MITA 4XX1A 3NM5A 1ZCJA 4OU5A 4CYMA 2NP6A 4F3TA 2WD8A 4H1HA 4XXHA 1HDRA 3HLKA 4TZTA 3UXYA 2GTPA 1GGJA 3AJ9A 1YZUA 4HZUA 4MJXA 1QX3A 3K05A 3PDIB 2OZVA 3QWBA 4N7BA 5EE5B 3N8HA 3TCKA 3AESB 4WDQA 2HLDD 3HKBB 1JQDA 4UJ3A 1WHTA 3WYAA 2WA2A 2WE7A 4XWKA 1NVXQ 3D3KA 2C98A 3OY7A 1KI2A 1CWUA 3HB1A 2C04A 1HMPA 1MAVA 1EGAA 1P2VA 1S8FA 1XQYA 3TNYA 3C3AA 2JLQA 4UNPA 5BW6B 2UYOA 3URMA 1OZ0A 1XZQA 4W1RA 4XSHA 4Y3UA 2IIBA 3QZUA 2YWGA 4HN4B 1YTUA 4RFLA 5FHRA 1FFEA 1QPBA 4QKQA 4HRAA 4UM5A 3WNCA 2GPBA 4HRYA 1H42A 2YHUA 4OHRA 3PRKE 4DABA 4DJAA 3TR6A 4FKBA 3GEEA 3WLIA 4ZHQB 5JTUA 1CQXA 2XQVA 5K0EA 3FYSA 5DNWA 1KIFA 3BRSA 2NXCA 3P4YA 4PGFA 1DQNA 5KO2A 2NVUB 5K8LA 4BCBA 2QG4A 1HDIA 4OQMA 1WLYA 1G3UA 5HIJA 3HRHA 4CUZA 1FS4A 1C30B 3J81k 3H99A 4RBNA 3BF8A 1EUQA 2QU7A 3EWIA 1LU9A 4WY5A 3K72B 2WYWA 4R1LA 3ICEA 2CJWB 1YBAA 2JW5A 3TLBA 3V00A 4E14A 5LJIA 1QGZA 4FEGA 4H7DA 2FVYA 2GARA 1VHDA 4PRKA 1N2OA 1P8JA 2A30A 2E3JA 1WMDA 3TPCA 3HO6A 5A4AA 4IMJB 4JI3B 3KYCA 1NN5A 3MCUA 1T2NA 4LDQA 3L1UA 2EW2A 5ED0A 4JVNA 1JT9A 1ZEMA 2ETXA 3EK2A 4RF3A 4RV5A 5F9HA 4FGZA 1YH3A 4M8IA 1ISGA 1U3FA 5A4JA 2B30A 4G85A 3FB1A 1ZNQO 1EM6A 2EU8A 3EEFA 3H2KA 1SKAA 2V7WA 2EGHA 2JEYA 2YVAA 3ABQB 2XAAA 2FV8A 4M37A 1JX6A 3AJDA 4ND4A 1N7HA 1R74A 3IKJA 2GX6A 4L8FA 3C14C 2FRVA 4R51A 4KE7A 4G5QA 5H80A 2D0OB 2PUCA 3Q3CA 2VP2A 4GOJA 1YR1A 5B36A 3AIKA 5AKZA 3SU8A 4KSCA 2ZWMA 3EOBI 3LQFA 2CW5A 3REOA 3PQ8A 3EMVA 3QKSB 4F7WA 1OV4A 2J9FA 1OB5A 4HEJA 2IY9A 3TLJA 5C8VA 4FYYA 2VJCA 1NZDA 4P2BA 4COOA 1HNNA 5CYPA 1NI5A 4MKHA 4KMOA 3SHTA 2BMJA 3MTGA 4XGIA 4BO4A 3JWIA 1XDSA 3GNTA 2NU8A 1K0UA 2AFIB 2WHPA 1BXRA 4ETIA 3JVIA 1QR6A 4GFDA 1RCFA 3DZJA 2B21A 3O84A 3SQDA 2QLLA 2MDTA 2JFXA 3BX1A 3NETA 3URKA 2EXXA 2Z4SA 2XDAA 2XBLA 4UFOA 1U0BB 2E7ZA 2VSNA 1G21B 2BH9A 5BMVF 4OHFA 1ELOA 1XZGA 1E58A 1IOWA 3MVEA 4DG5A 3WO1A 4YJ3B 4AF8A 1UKYA 4CKEB 1D2HA 2G8NA 4GMKA 1YACA 2Q7DA 1XTPA 2EDCA 4O4IA 3TZKA 1QZTA 1XP5A 3QFSA 3M8KA 2KB0A 4XWTA 3H7IA 3W1EA 1QKIA 3A1EA 4RF4A 2BTEA 2BTQB 2PCJA 2CFTA 3AKZA 1MDBA 2ICAA 2QTRA 3HLYA 5DLEA 4LJ7A 5ITZA 1TLLA 3CUKA 5FA8A 5FTKA 1QPZA 3TVYA 5DN9A 1AK2A 3OEED 2JCXA 5AXCA 2A7QA 1M0EA 4GKAA 2XMBA 3AR2A 4G36A 1CQPA 5A4KA 4RHYA 3DAOA 4ZCQA 4V0SA 3GRYA 4D8VA 3IQDB 5DOZA 5DLQC 2VQSA 4LNHA 4RPGA 4ETMA 1JHYA 1T9BA 4QHYA 3TJZA 3CEHA 4DARA 3R20A 2WQ6A 3D4IA 3F6PA 2Y1OA 3UUEA 1J33A 4MGZR 2G9VA 2K4MA 4XM2A 4J7AA 3ZWBA 3QXGA 5A0FA 5KOJB 1FLDA 4PZAA 3E8SA 1QO0A 4D0SA 1JZQA 2Y0PA 1EUYA 4ZDJA 3W6NA 1JSZA 2JH8A 1E6LA 4UNNA 3OOWA 1GA4A 3B3QA 3X1DA 4NZ9A 2JGMA 2AZTA 3FYUC 1JHXA 4PCUA 4GQAA 4HX2A 1C4WA 1TQHA 1JGTA 2OA0A 5C4IA 5HRCA 2JLWA 3C3PA 3WGMA 4D3FA 4Q47A 1GZ5A 5I9BA 3HCRA 4KXXA 1SCIA 1FFHA 4GLLA 4MO2A 2BFFB 3VH4A 3GVIA 1IEQA 2P7HA 1USVA 4HNRA 3O4JA 2BE7A 1WZIA 5DNAA 4BEWA 4ITRC 5J63A 3FPHA 3KOXA 2JAWA 1XZFA 4P4UA 4CUKA 1X87A 1Y1TA 4ENWA 4Q16A 3RIYA 2WABA 2JCYA 2Z57A 4M9SA 1EA5A 1XNJA 3OPVA 4BNFA 1ITZA 3DE4X 2RARA 4HN9A 4IWXA 4P4GA 3K9GA 2B8TA 1I7NA 2FN3A 3BT7A 1JIUA 3IHWA 4B3BA 4DQ0A 1GO2A 1PGNA 4R6XA 2L19A 3RS5A 1KL7A 2VXYA 3H5LA 4MP6A 5A3SA 4CLOA 3GJXC 1IBLB 2A78A 1I9CA 4N8EA 5FL7D 3D3WA 4FHFA 4QPDA 2BGLA 2ZSIA 3OIDA 2NZJA 1CV2A 4RADA 5CURA 2IU4A 1QMGA 3FYDA 1NT2A 3ITEA 2EZ8A 3IUYA 4XIJA 3KWJA 2CDBA 4UD2A 4ZXFA 2ISQA 3ND8A 2H54A 2ZJOA 2O8FA 3HJTA 1NBIA 3GZ4A 4EUEA 4DIMA 2P0AA 3DLHA 4CWAA 3M83A 3KL2A 3B78A 3V7UA 4Y6RA 1BWRA 3D54D 2O52A 1FZTA 2COUA 4NCIA 4BLTA 3IILA 1IAVA 3GDFA 3VO9A 1FFXB 1J22A 1VXOA 4G4SP 2GEBA 1HTTA 4AP5A 2QPOA 1QNFA 1MA3A 1W5TA 4XD7D 1RRFA 2PH7A 3ND9A 3TQCA 1K7CA 2QSYA 3W3AD 1F8GA 2HRZA 1R4NA 3IOEA 4M1YA 4NHOA 4AUMA 5CT6A 4ZVQA 5B3LA 2XNHA 5FBQB 1WF3A 3ZHQA 2QD5A 1VA4A 1RHMA 5JZBA 2O5RA 1EQUA 1V5GA 1A8HA 3E5HA 1XKLA 1TO6A 4GVLA 4JBHA 3ZW9A 4EDFA 3FJ1A 3HJAA 2JKZA 1JBQA 4YJHB 4PWYA 4JI6B 2O2ZA 1P9RA 3HKCA 4AD8A 3K5PA 4MB2A 2POQX 2R9VA 1E7QA 3IVMA 3NWBA 3HHEA 1WXXA 3WJAA 3ZE1B 1CKEA 4BKRA 4L07A 3PD1A 1X38A 5TJHA 3UAYA 2DR0A 2JFHA 2Y2VA 4TV9F 3W9UA 4BNDA 3OQJA 4PO3X 2ENWA 5TR9A 4NOKA 5ALVA 1PQWA 2DB3A 6ABPA 3EFHA 3MN1A 3ULKA 5F1PA 4UMDA 3D5EA 3KX2A 5A5DA 1IMJA 5DX1A 1GQSA 5AK4A 2C61A 2J9GA 2PUWA