2IUSA

E. coli ftsk motor domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
409
structure length
392
Chain Sequence
b'LPSLDLLTPPTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRDNPSPLTVVLGKDIAGEPVVADLAKMPHLLVAGTTGSGASVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALGVRNLAGYNEKIAEADRMMRPIPDPYWHPVLKKEPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQAGAESLLGMGDMLYSGPNSTLPVRVHGAFVRDQEVHAVVQDWKARGRPQYVDGITS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA TRANSLOCASE FTSK
publication title Double-Stranded DNA Translocation: Structure and Mechanism of Hexameric Ftsk
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 116
structure length 392
sequence length 409
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01580 FtsK_SpoIIIE FtsK/SpoIIIE family
A PF09397 FtsK_gamma Ftsk gamma domain
A PF17854 FtsK_alpha FtsK alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.980.40 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-tRNA Synthetase; Chain A, domain 2 2iusA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iusA02
1S1MA 4GFDA 3QY0A 1T8TA 3BB1A 4AKHA 1GFIA 3T1OA 1YZNA 1M1YE 2QTVB 1E2NA 1OKKA 3QKSA 4QBHA 4TN1A 4GMXA 3TK1A 5CB8A 2ZSAA 3B1WA 1SVWA 3TRFA 1JR3A 4X8LA 3V00A 1SVMA 4ZDJA 5E7JA 1D8TA 1QHNA 2KB0A 3PENA 3W5IA 2BM1A 1F5NA 4G5SA 2YC4C 4FD2A 1R0XA 3P4XA 3UK6A 3GLGE 2K5UA 1VTKA 5K8TA 3RRZA 1A5TA 5CJPA 4YLGA 3TUIC 1KMHA 1L4YA 3K0FB 2AKYA 3RS5A 3R7WA 3ONWA 1IY2A 2WWXA 2NG1A 4G5GA 1FTSA 1R6BX 2X1VA 4NL4H 1RC8A 1E9DA 1PLLA 4JJKA 3X1WA 3H2YA 4Q4JB 3M6AA 1MO4A 1KMQA 2BWJA 3M0EA 2A5DA 3B78A 1R8SA 1JQJC 2P65A 1E9RA 2QT0A 4UXHA 1OV4A 3W6OA 4A2PA 4C0HA 2J0UA 1CJUC 4HB3A 2CNWA 3HPRA 3CX8A 1GZSA 5G41A 3SHFA 2BEJA 1IN6A 3QBTA 1G6OA 4TYPA 1G9XA 1X6VA 3X2SA 5E4FA 1FOEB 4Q4HA 3MWYW 3GLGA 2ERXA 3U2QA 2V7QD 1M34E 1T9HA 3ASYA 3C8UA 4KV9A 1SKYB 5CM8B 1KDRA 1ZAKA 5KDOA 2NO1A 2IYSA 3CPEA 3ZZUA 3GLFE 2YWHA 2NMVA 3IIKA 1KSJA 1N0UA 3CX7A 2G0TA 2IUTA 2P6NA 4C7OB 2OZEA 4LJAA 1IQPA 4NCHA 1P61B 3OEED 1Q21A 1LV7A 2X19A 4FXPA 4CGZA 3I1FA 3OAAD 5J5CA 4B73A 3LXXA 4PC3A 5JHHB 1OB2A 4MRPA 3A6PC 5DYIA 5C4GB 1GWNA 3NC1C 3TVTA 4ZCIA 5L3QA 1FUKA 2ZYVX 1LS6A 3DHWC 3QXXA 5SZJA 4IVRA 5E7MA 4EPXA 1D2EA 5JCZA 5JEDA 5L3VA 3SQWA 5KPDA 3IQWA 4UNRA 1Z28A 4G5OA 5TVKA 3B82A 1W0JA 1KSHA 2RGXA 1JPNA 4LBWA 2D7DA 2CL6X 4E07A 3A1VA 1XJCA 3PUXA 3TAHA 4JLJA 1YRAA 2OESA 2QAGA 1GVNB 1US8B 4CVNA 1XMSA 2FPLA 2WBLC 4LHWA 4B2PA 3SFVA 3VKWA 1OXVA 5DO9A 4F38A 3GQBA 2DFTA 5JMTA 2VO1A 3U7GA 4I1UA 4EQ6B 1Z0KA 4OK3A 1ZUIA 2D2EA 1YZGA 1G64A 3QXSA 1SXJE 4LZZA 1R2QA 2RB4A 3PEYA 4MYCA 1TF7A 5BXQC 4WXRA 3NBYC 5FL7A 2QZ4A 3GEIA 4BLQA 4DUGD 2H18A 4I1VA 4MKFA 2PMKA 3SYKA 3DM5A 4X8HA 1TADA 2IEYA 2J7KA 3EC2A 5SZKB 1W48A 3TNFA 4M1KA 5DNYB 3TSOA 2DCUA 4DLSA 1GNQA 2YVUA 4FWIB 3C15C 5GJCA 4B6FA 3THXB 4YDSA 1VPLA 1OH7A 4ZI3A 3R8CA 3SDZA 4G5QA 1QVRA 1L2TA 4Q19A 2X8AA 4GPTA 3EWAA 3VFDA 3GP8A 5EE5B 4D80A 1EWQA 4XOIA 1IN7A 4WIAA 2ZE7A 1M74A 4UJ3A 4DLXA 1OIWA 2ONJA 2QPTA 4GP6A 4KFUA 1W2HA 1OXTA 1WDTA 1UBEA 3AP3A 4P4SA 4M1MA 2CXXA 4Z8YA 4EPWA 4JSYA 2CL7X 3FHOA 4PAOA 4ZCMA 4LHZA 4QJ4A 2VP6A 4ACAA 3I72A 4YQFA 1AA9A 2FGJA 4CEHA 3PUWA 5EQTA 3RS3A 1P4SA 1TL7C 2YV5A 3MSXA 4IFEA 5CDFE 4CT5A 4OYHA 1G18A 3BH7A 4Q66C 5SZIA 4NU0A 3CWQA 4NCNA 1XTSA 2WJHA 3K9GA 3IQXA 4Q9IA 3U3OA 1ZU5A 3TSZA 2PZFA 1OYYA 2FZLA 4E22A 2RH5A 4Q47A 3H1TA 3Q3JB 2QROA 5D3QA 1OB5A 5GADl 3KXKA 2RHMA 1E96A 4LRWA 2EWWA 3GJXC 3KJIA 2OSBA 3WYAA 2A5YB 5JZVA 1T5IA 4XVUA 4I1OA 4RD4A 1P6XA 2Q9BA 5TY0A 3U7EB 4DJTA 2RGNA 4OBEA 1U99A 2CVHA 2JJ2D 2V6JA 1KSFX 2ANCA 2WV9A 1KI9A 3AF3A 3LBNA 4NYIQ 5BN3A 5CDFA 1EFRA 2F9MA 4B74A 4TLCA 1G7RA 1KYIA 2O8DB 2CK3A 5HE9A 2H5EA 2F1RA 3CLVA 2FPMA 2IYRA 3LLMA 1XZPA 2PZEA 4C0JA 2ZS7A 1DAKA 2NZ8A 2QRZA 1DE0A 5E3HA 1W0KA 3CF6R 1YHNA 4M9ZA 5SZHB 1G291 4QHYA 4OQFA 3B5JA 5CLLA 4Q4AA 1PUJA 2IHBA 2J3EA 1AS3A 1FNNA 4KYIB 3VMFA 3EIEA 4LHYA 4E09A 2IHYA 1AGRA 2BJWA 3B13B 2PEYA 3MRSA 1P75A 2TMKA 2EFEB 4MRNA 4HUTA 1N0WA 4R2HA 4KITB 3TMKA 2R6DA 1A7JA 3IILA 4MRVA 3GPLA 2CHVA 1E1QA 1UAAA 4EPRA 1VG9B 1ZC3A 2NZJA 5DGXA 4HLCA 1Z83A 4WZAE 1N6NA 1GDDA 5DN6D 3U6BA 4XD7D 1IXZA 2IYYA 1CP2A 2HJVA 4OHWA 5EXPA 3AGQA 2O8CB 1OYWA 2DWOA 3EW9A 2VSXA 2KBFA 4IEEA 4ZDKA 2DB3A 3CIOA 1FNMA 1ZUHA 3T12A 2GJ9A 5EP3A 4YMVA 4DLRA 3L0IB 1YZKA 4V0KA 3RS4A 5F98A 4GZLA 2C9OA 4F7WA 1QG4A 2QPOA 1Z0DA 1QHSA 1HE8B 1I4LD 1K5DA 1YR8A 1G1MA 1ZIPA 2UVQA 1OXUA 4TL6A 1AKEA 4YMWA 2WMOB 2C04A 4B3CA 2PL3A 1ZU4A 3TQCA 3D6TB 2XJ4A 4LBYA 1NG9A 3LFUA 3L43A 4I81A 5HZKA 5DHFA 1KNXA 3U5ZB 3K0FA 3IBGA 2NO7A 4LYJA 4PZZA 3H4MA 4RD2A 4BLSA 1UADA 4MYHA 2J1LA 3M1IA 4XTCS 3UG6A 1XXHB 2W58A 4EPVA 1COWD 1F6BA 3EIQA 3LLUA 2GXSA 3W8NA 1T91A 2FN4A 5FOWA 2N1BA 4FMCB 3GEEA 3X1ZA 4DSOA 1BMFD 2H17A 3BAFA 4BASA 5JECA 4YC7A 1JBKA 2DR3A 3DEFA 3FTQA 1XNJA 3F8TA 5DLQC 1KO8A 2J59A 4HLUC 1KHTA 5BYKA 2JEOA 1E9CA 4LBVA 4ACBA 1SHKA 3I92A 4H1UA 2VA8A 4MKGA 2XZLA 1TAGA 2WM9B 5CITA 3QVUA 2ZSDA 1NJGA 2ZI7A 1XTIA 1E1RD 4B32A 5E95A 3UKDA 3ZJYA 2A5JA 3N5CA 1G8YA 3THYB 3BWDD 4A92A 2GAAA 4A8JC 4Q7MB 1DADA 2I3BA 4QBFA 4CZ2A 1W7AA 1W36D 3FVQA 2WWIA 2ORWA 4TMVA 2ZU0C 4ZPXA 4C7OA 1U2RA 2W0SA 3QKSB 1ZJ6A 2IA5A 3AVXA 2FSGA 4BFWA 4M1OA 3FPAA 1G20E 3ZZ0A 1E32A 4X8MA 5F9HA 4XIGS 4PPGA 2JLWA 1OF1A 4BFVA 4KODA 2QU8A 5AJWA 1N25A 4Q9KA 5LDDC 2C99A 2WZQA 1PV4A 4O0MA 4Q9LA 3QPUA 2PJRA 2JGNA 3SR0A 3RWOA 2F1HA 1ANKA 1G41A 1N6LA 3P26A 3OIUA 4UNQA 4AD8A 2DFLA 3HR8A 2IEZA 2ZI6A 3BH0A 4BFZA 1KMHB 2ZSBA 5LB2A 3NC0C 3R7WB 1NMYA 3LO5A 2GA8A 4Q1BA 3O47A 2FEOA 1GSIA 2V8OA 2O52A 4HUQB 4D6PA 2B8WA 4MQBA 5EE1A 1R4AA 1UKYA 2IXEA 4NCJA 1Z0JA 1S3SA 5DYGA 2QMHA 5KSYA 3A1TA 2ZVPX 4DLUA 3SNHA 3CRQA 4US0R 3PV0A 3GJ5A 3T5DA 4C0AC 3L0SA 5AJYA 2HF9A 2I4IA 1WP9A 1W36B 3V4FA 4GNKA 2ECKA 1MT0A 4G0NA 2JCSA 2P3SA 4JLNA 3GLGB 1YZUA 2NQ2C 1CBUA 1E2HA 3RRYA 1R8QA 2PX0A 4IFBA 4P4UA 5DI3A 1YQTA 3BB4A 3LH5A 3O8BA 3OEEA 4RZXA 4TYNA 1KI7A 2FFAA 3IHLA 1SVIA 1QG2A 1SHZA 3KUCA 4LSGA 1NL3A 2WJJA 3FFAA 4BWYA 4OHYA 4JT4A 3THXA 1LB1B 4FMBB 3REFA 2GXQA 2RKOA 4DLWA 1Z6YA 3L8YA 1GILA 2GEDA 1XEWY 2V54A 4RJLA 3F0TA 1OFIA 3K70C 2WOJA 1RPZA 3PVSA 1P60A 2PZGA 4FMDB 4BFTA 1EX6A 1Z3IX 3U44B 4LJ5A 4KJZA 1OE0A 3A4LA 1T5LA 3TR0A 4B3XA 4C2UA 4LV6A 4ZO4A 2FX3A 4K46A 2G1KA 2R6CA 1VCNA 2GCNA 3LW8A 3QKUA 2F3TA 4IEIA 1PZNA 5IT5A 2LKCA 5EXXA 4Q1EA 2ONKA 5C1BA 4URYR 1NF3A 2GJAA 3PEUA 1HT2E 1XZQA 2ZJZA 2YNMA 3GFTA 2PH1A 3AF1A 1G17A 5JCPA 3IHWA 2CMKA 1VHLA 4M21A 2QORA 1P2SA 5JI3E 3GLFB 2AK2A 2EFHB 2GILA 4HDCA 3Q7PA 2QAGB 1NJFA 1S96A 1SXJD 3TAUA 3U7HB 1P2VA 4MUBA 1IY0A 3CZQA 1HQCA 1H65A 3BB3A 2NO0A 3IO3A 3PFIA 4ZCLA 2H7VA 4MGIR 4KO8A 4DUGA 3HU3A 2PEZA 2ZRHA 4AIIA 2WJVA 5DIFA 4D4KA 1NY6A 4B3FX 3O8DA 4LJ8A 1BYIA 1MRNA 2CDNA 4D25A 3FE2A 2GEVA 2DYKA 2GXUA 4XWOA 2YWFA 3EA5A 4O2LA 2JA1A 4IDQA 5EZ5A 3BFVA 5FOSA 3LNCA 4WBSA 4BE7B 2ZM5A 2O0KA 5KNCA 1NIPA 4EAQA 1GOTA 5CK5A 5IHPA 4JLPA 4KXFB 3EZ2A 4D0GA 3MWJA 1MO5A 1XWIA 3WNCA 3FFBA 2VHCA 1HH4A 1S4QA 2WIBA 3BGWA 4M1WA 2O8DA 4PSVA 3ECCA 1F3OA 1WCV1 4QXAA 4ESHA 1LVGA 4HB0A 4E03A 5JJKA 2Z5FA 4ON9A 1XD2B 3E70C 5HKKD 1YR7A 1P3JA 4NHOA 221PA 2F55A 2CCJA 3QSYA 1P2TA 1EFRD 4OK6A 1KK1A 3GJ4A 4JVSB 1IJFA 2FMXA 1II8A 4QJ5A 1VCIA 1SULA 2J7PD 4L15A 1SXJB 1D2MA 2W2XA 1E2FA 1MR3F 2ZS9A 3A1UA 2GJSA 2LKDA 1AKYA 4TTPA 4JL8A 1G3IA 1NKTA 2UKDA 4LJ7A 4BEBA 4CEHB 5F3WB 4DZZA 2P2LA 2GF0A 1X8KA 3C41J 4B3BA 4UNSA 1N5JA 4I1SA 1J90A 3EX7C 4R9UC 3AQ4A 4NE2A 3TH5A 4B3GA 4BLOA 2JDID 2OV2A 1YU9A 4DCTA 2IXFA 3I8XA 4QKQA 4K8OA 3HP1A 4PQRA 1UF9A 3Q85A 5KDLA 1NG1A 4NTZA 4OL0A 4B2IA 2JJ2A 2O8CA 3ETLA 3MMPA 5GVSA 3MWLA 2REXB 2R9VA 4A36A 4DKXA 2XAUA 4ASUA 1GITA 4PZYA 3EZFA 1E98A 1U9IC 4U02A 2ZUBA 2VP4A 1ZIOA 4UJ5A 4AI6A 5FR1A 1RYHA 1N3BA 2ZJAA 3AEZA 3IIJA 2C2HA 1E4VA 2IYWA 4RFSA 4R7ZA 2F1JA 3I5XA 2ATXA 2QN6A 3PCRB 1Y63A 3CW2A 3NBFA 1A82A 3RS2A 4AG6A 5JSZA 3EIHA 1DS6A 5BYJA 2WJIA 5HPYB 3T1TA 1Z6XA 2ZJ5A 3CRMA 4A2QA 3WHKA 3KB1A 2HCJB 2VPPA 2DFKB 1K5GA 3I8SA 4DLYA 3QUSA 4HZUB 1KSGA 4B47A 2ODNA 4NONA 2CJWA 4UNNA 3NG1A 1G16A 3U7FB 4B33A 2XNSA 5LD2C 2IXGA 3GMTA 4JLBA 4A9AA 4D82A 4Q4AB 1JNYA 3CNNA 1II0A 4NMMA 2CE7A 3OIWA 1TF5A 3CONA 4MDEA 2ZRKA 3BS4A 1F2TB 4FMCF 2ZRFA 2Q3MA 2YWGA 3GFPA 3CRVA 4KFRA 4DB4A 2FA9A 2GBLA 4C9BA 2GTPA 3T5GA 5B57C 1TTTA 1I2MA 1TEVA 2HCBA 3QVVA 1ZM9A 4G5RA 3RAPR 3RVBA 4BECA 1YKSA 1OT3A 1HUQA 1DOAA 1UBFA 3NH9A 4HB2A 1NLYA 3P32A 3UG7A 3UMRA 2FSIA 3DKVA 2QPAA 5HCIA 3TUZC 3TJZA 4A0RA 2IL1A 3THYA 2EVWX 4BFUA 2Z4RA 3IUYA 4L9WA 3EZ9A 5EP2A 4D4JA 1CR4A 4QGHA 4U5XA 3UIEA 1RRFA 1KJYA 4RCZA 2QNRA 1F48A 2JASA 4Q00A 2D62A 4IOJA 3K1JA 1UKVY 3CR8A 3S1AB 2QEQA 2ZROA 3K0EA 3KKNA 2C77A 1PLJA 3D7MA 2X2FA 421PA 5IK2A 1M7GA 1N5IA 4HAYA 1U8AA 4GOXA 1GUAA 1W2GA 1S9DA 1FQKA 2RHDA 1Z6TA 1Z06A 2Q0HA 1COWA 2OHFA 1HTWA 1XX6A 2GJKA 2QTFA 4B75A 2XNDD 2QQ0A 4I99A 1ESMA 2IS6A 1BMFA 1RKBA 2A78A 2OE2A 1PVOA 1E94E 2QP3A 4PAQA 1J2JA 1DAMA 1TEXA 3IDQA 3KJHA 3MD0A 2ZE6A 4HUQA 3C5HA 2OBMA 2DWQA 5FBLB 5C4MA 521PA 4TSFD 2BMFA 2ZSEA 5KSOA 3CNOA 5ANRB 1MH1A 4P0TA 1X1SA 1WRBA 3SJAA 3KL4A 3UPUA 1S2MA 4PHTA 1Z63A 1JXMA 2PCJA 1DBSA 1E1RA 3QJYA 1QHGA 5D3MA 4DBLC 2OAQ1 1NY5A 1R5NA 2XTMA 4EJSA 3NDBB 1Q22A 4YMTA 4NH0A 4D81A 4KVAA 4WZBE 4WXPA 2OCAA 1MO3A 3WYGA 4JLMA 2ZUDA 1JALA 4XVRA 1G7CA 1TU4A 1HY3A 1VIYA 1YZTA 2QQEA 3CPHA 2H92A 5KU1A 2R62A 3LDAA 2MSEB 4AKGA 1CTQA 3AUYA 1CR2A 1Z0IA 2BC9A 3B1VA 1RJ9A 3TR5A 4TLBA 4DXAA 1OFTA 2OT3B 5AJVB 4D0NA 4C2TA 1V43A 2VYFA 3SFZA 3EPLA 4CEIB 1AS2A 3EZ7A 3KDSE 1RE0A 1LNZA 1WF3A 3KKOA 4M0LA 3SJCA 1R10A 3B1ZA 4PO9A 4JL5A 2JLQA 2WJGA 4OK5A 3CWZA 1EWRA 4WA7A 1R5OA 1QRAA 3U44A 4C0BA 3F3YA 5KO2A 5JRJA 4FMDF 1VIAA 5CIWA 4OQMA 1BO6A 3QG5A 3ADCA 2C5LA 1ODFA 1UKZA 4TTQA 2UZ3A 2IW3A 3RSOA 4Q02A 4Q7KA 1FFHA 4LI0A 3T1VA 3P4YA 2RAPA 1E2EA 1UFQA 1Z6GA 2R6AA 2ZEJA 1G21E 2GJ8A 1E9FA 1RYFA 3NBZC 2I1VB 1NVXQ 3GLFA 2Y8EA 4ITRC 1NI3A 2PLFA 3GEHA 1XJ0A 5KYKA 3WMFA 2IF2A 3ADBA 1LW7A 1Z0AA 2ERYA 2XOKA 1G8FA 4C4PA 4L16A 4NYMQ 5FFMA 3CX6A 4H9GA 5FTNA 1G7TA 2ZRPA 4Q7LA 4B34A 2OXRA 2GZDA 1E2QA 1Z29A 1LS1A 4MYTA 1NKSA 2YKGA 2RGEA 2KE5A 3PEVA 1AN0A 3HYRA 1OLOA 5F9FA 1ELOA 1OXSC 1IJEA 1XP8A 5DI3B 3PR1A 4ARZA 4PAMA 1NVVR 4Z8XA 2CHGA 3VR3A 1UDWA 4B6EA 1D9ZA 3SYLA 5HE8A 2AN9A 1GRNA 2VF8A 5AUOB 3ZIAD 3W3ZB 4OQNA 2FE4A 1XD2A 1T3HA 1TU3A 4OHXA 3TKLA 2YINC 3FOZA 4LJ4A 4P33A 1DO0A 1F2UB 4F4IA 1N2CE 1CU1A 4FIDA 3KQUA 4A0GA 4DSTA 1P9NA 4QHTA 2ZRNA 1OH5A 3T61A 3EAQA 3W6NA 1ZP6A 1IN4A 2ZE8A 3B85A 1YVDA 4LYHA 1VKJA 1KI3A 1C4OA 2RGGA 1VYVA 1SXJA 1YE8A 3FYHA 2XB4A 2A7QA 3SC3A 2DPXA 1SKQA 4HYYA 1IY1A 1WQ1R 3WMEA 3U4QB 2IYUA 1JAIA 1N6RA 1U94A 2NPIA 2WWHA 1ZINA 2W6ID 2ZJYA 3CKLA 1NVWQ 3L82B 2REBA 3AV0B 1E2LA 2QGNA 5BN5A 3WYFA 2PBRA 5C46F 2P5SA 1PLKA 1TUIA 3H86A 2RCNA 5AJXA 3EWSA 5UKDA 3TBKA 4DSUA 5L3SB 5FTLA 4GI7A 4WZ6A 4R71A 5ELXA 4G1UC 2BKUA 2AD5A 2ZR9A 4S35A 4EDHA 4GOKA 4LC1A 2NIPA 4IVQA 3HR7A 4Y0VA 3RC3A 3T35A 1JXOA 1CJTC 2O8FA 1JB1A 4BPBA 1GL6A 4OJKA 1E0AA 5HKKA 3BJIC 2CVFA 4BFYA 5M04A 4TMWA 1NBME 2GETA 3SYNA 1G5PA 2QTHA 2EYQA 3BE4A 4NBSA 1KZGB 3KQNA 4ASUD 3WRXC 3IPXA 3FMOB 1GKYA 2GAOA 2J7PA 1KI4A 3BXZA 3AKEA 3OZXA 4TT3D 3G0HA 1Q44A 3A58B 4HZUA 3R9IA 2JJ1D 3NHBA 3PUZA 1Z2CA 3V4RA 2X2EA 1M2OB 4MH0R 1N6KA 2ZJOA 2FEMA 4PQYA 2F1IA 2CL0X 3EXAA 2SHKA 4XSHA 1H8ED 3LV8A 1II8B 1DO2A 4IKEA 5H1YA 1JPJA 3MLEA 2VP9A 3FMIA 1F2TA 4NYJQ 4BZQA 4WAUA 2W0MA 2JDIA 4GZMA 1DG1G 3BFXA 4ZIRA 4CEIA 1E2DA 4QNRA 4YDHB 3KQKA 1E4YA 2HLDD 1KIMA 4JL6A 2W83A 3RDPA 3NIBA 4JBWA 4Q21A 4RD0A 4Q1AA 2BCGY 3ZVLA 3C16C 1W5SA 1E9AA 3LRPA 4TQ9A 4AKIA 2XSZD 5E7IA 2J9RA 3VR4A 3MAAC 3B7GA 1LTQA 4PZLA 1NN1A 2C8VA 5J4VA 5KHOC 4NP6A 2ZR7A 4JYCA 2VHJA 2P67A 3S1AA 2HT1A 1TPZA 4LPSA 3NTUA 1NLFA 1UKEA 1RIFA 4NYMR 5JBQA 2J0VA 3LAWA 4PX9A 4Q1DA 1IM2A 1E2PA 1ZNYA 4JLAA 3QPVA 1E6CA 1HT1E 4RFSB 4D0LB 3IPYA 2MSCB 4M1YA 5F2EA 5JSZB 4JKYA 3BH6A 1X8JA 1ZNZA 2OLJA 3M4YA 2L0XA 3C4JA 3PITA 4PFSA 3TSWA 1CEEA 4JJZA 3BIFA 4XWKA 5IK2D 1Q12A 4LJYA 3K70D 2F6RA 5EZ6B 2GK6A 3BC1A 3PXGA 4IOKA 1XD8A 1RRCA 2VIIA 3RS7A 2CJWB 3GLIE 4N3NA 2OUKA 5IRCD 3E5HA 4URUR 3VU9B 2WWFA 3P27A 4TL8A 1FZQA 3K09C 1U0HC 3DVLA 4HI0E 1BS1A 3KFXA 3QIAA 2Z4SA 3K0CC 1DAIA 1QBKC 3D8BA 4A6PA 4PPNA 5JS8A 1FMJA 3FGNA 2MMGA 1AQUA 3KFVA 3T06B 4KLNA 2OLKA 1U8YA 1KOFA 3CRW1 4DLZA 2JAQA 1CS4C 1E0SA 4B35A 5C18A 4NCKA 2WWYA 4LPKA 1E9SA 2A2ZA 3KTAB 4F4CA 1HE1C 1VYTA 2EU8A 2FSHA 2GZAA 1EK0A 2NOAA 5DHAA 2XB2A 2XEXA 3LXRA 3VX4A 2P6UA 2EFCB 1S0UA 4Z1MA 3NVAA 4RD1A 2V9PA 3ICEA 1TQ4A 3RLFA 3RYTC 1M6NA 3U3MA 2JJ8A 3W5JA 5J4LA 4QM7A 4CT4B 3HU1A 4M1SA 2JLVA 2O8EA 4NCIA 3GLHE 2J5XA 3GLIA 2A5GA 1QHIA 2QP4A 2WKQA 5FR2A 3I32A 3SE0A 3VR2A 1RRGA 2D4HA 4AK9A 5BW8A 3GJ7A 3KJEA 2XNDA 1KGDA 5TARA 3MCAA 4J0QA 1EFTA 2HV8A 1D6JA 3DOFA 4A0HA 1X8LA 4LV5B 4DVGA 4A15A 3K70B 4MKHA 3THOA 1G6HA 3IEVA 2REOA 1E9BA 1Q1QA 2PCLA 5J4KA 4LYFA 5B58C 2O0HA 4L4UA 4TSFA 5L3RA 2DBYA 2XZPA 3SJBA 3GFOA 3LBHA 4TYYA 1M7HA 2LCFA 3JVUA 2OILA 3U6KA 1ZNXA 3U3KA 2FU5C 2FOLA 1B0UA 2ZXUA 1X1RA 3PG5A 4AKEA 2GF9A 2XTNA 4B44A 1MABB 3GLHA 1VG0B 3CNLA 3JZAA 2OCPA 5TV2A 2RGCA 4DEXA 2PT5A 4LX0A 4MITA 4PC7A 5EP4A 3QKRB 1B23P 1P7CA 4GBMA 4IDNA 4V0NA 1WBDA 5D3MB 4OHVA 2EQBA 4V02A 4EJSB 1FL9A 3QXHA 1ZYUA 3FKSA 2XZOA 1N5LA 3SJZA 5TXGA 1LY1A 1NMZA 4Q18A 2ZRIA 4YXWD 3BOSA 2QSZA 1FX0B 2J45A 4NYJR 5KNBA 3H84A 1TMKA 3KX2A 4DDVA 1J7KA 2XOKD 2FWRA 4V03A 5CK4A 1XCPA 1IAQA 3BD9A 3GJ8A 4FINA 2QENA 4NPHA 1ZM3A 3RS0A 3G82C 1MRSA 1ZMXA 2W2TA 4IDOA 4QGAA 1ETUA 2G0NA 1SVSA 3ADDA 1RJ9B 5JLJA 1Q57A 3ZLJA 1JI0A 2E9SA 4PR0A 2ORIA 1G4UR 4PPQA 1I4TD 2RMKA 1T0HB 3X1XA 2JLXA 1E2KA 1S9HA 2G77B 1JJVA 2B8TA 1NSFA 2XXAA 1F2UA 3ICQB 4L8GA 2AFHE 2YOFA 2YOGA 1P72A 2VQSA 2YJTD 4MGKR 3ZZTA 1WMSA 1R7RA 2ZRGA 4FCVA 4II7A 1M7BA 1R0WA 2CLCX 2OBLA 2VLIA 4BEJA 1FP6A 1WB9A 4DLTA 2Q3FA 1TUEA 5FUWA 2UZIR 2A9KA 4CEJA 4DC9A 1JQLB 5KTYA 1IHUA 1KDTA 2ZRBA 4R2IA 4KBFA 1JJ7A 3AVWA 3CM0A 4IRUB 4URVR 3U4QA 2ZPTX 4UXJA 4PO1A 3TE6A 1P9WA 2F43B 1HV8A 1RW4A 2O5VA 2CHQA 2IUSA 5AWFC 4B43A 4PANA 3IO5A 3BORA 1LFDB 2VBCA 3P20A 3OE7D 1K6MA 3EG5A 4MYUA 1Z08A 3RRNA 3SI7A 5L3SA 1XD9A 3E2IA 4C30A 5J4HA 1DAHA 5KOYA 4F4JA 1OJLA 2AL7A 2LWIA 1U8ZA 2OXCA 5LB4A 2OFXA 3ZIAA 4MRSA 2JATA 2ZI4A 5FH9A 6Q21A 1NVUQ 3VAAA 1I4DD 2QMUA 1G7SA 3T15A 4ARZB 1XTRA 1A2KC 4D2IA 4M9QA 5FPSA 3LQRA 3LX8A 1DTSA 1VCMA 2FFBA 4B48A 2CBZA 4HB4A 3ZS9A 5HTKA 1T3SA 1W36C 4Q48A 1WBBA 2VF7A 5H8WA 1CXZA 1YR9A 4F93B 4TLEA 1PJRA 5FOUA 3IBYA 5A5GA 4M9SA 3WNDA 1GNRA 1KKMA 3MJHA 2BJVA 4RKEA 3BK7A 3R9XA 2FDCA 1KO4A 3RABA 5EE0A 4YONB 3WRYC 1KY2A 4BUJA 2W6IA 1IONA 2ZU6A 2QGZA 4B3DA 2N46A 3A4MA 5J47A 1ZRHA 1KI6A 1XMVA 2GESA 5FBVB 1U0LA 3VR1A 5L8VA 4P31A 4D4LA 3VKHA 1KKLA 3A36A 1EXMA 4V0LA 1JECA 2HYDA 1U98A 4FW9A 4HLUA 3KUDA 4HDOB 5FI1B 2BDTA 1JEDA 2CLDX 2IYTA 2QBYA 5AUNB 1I2DA 3UWKA 1MV5A 2WVJA 3EARA 2JLZA 5FOVA 5IDVA 4LJ9A 1GTVA 1N0VC 4OJQA 5EUMA 2D7CA 5GJWC 3VTKA 1N6HA 4Q1CA 1BYUA 2V55B 1NMXA 4JVLA 2AWNA 4Q03A 1XMIA 1NBMD 1KO1A 4Q4LA 2FNAA 4A8JA 1ZCAA 2DWPA 1HEIA 1DELA 1LF0A 1DEKA 3W34A 2QAGC 1VCOA 2R65A 5AUQA 3FB4A 621PA 2JLRA 1H8HD 4U00A 3U60B 2O8FB 5TMPA 2BVNA 1OIVA 4OI4A 4QG7A 4TLAA 5FOXA 3ZYCA 4TT3A 4DWJA 2R2AA 4XTRA 2HYIC 2JJ1A 1L8QA 1IBRA 1J99A 4XSGA 2CEAA 4W5JA 4DLVA 3AB3A 2ZJ2A 4PSAA 1BKDR 4EFMA 1H8EA 2WICA 1PUIA 1CR1A 2EFGA 2ZI9A 4HLDA 1AQYA 1G8HA 3K0AB 2VP2A 1QHHB 2ZYUX 4F92B 1CF4A 4BZXA 4GL2A 2N42A 4GP7A 4TWZA 5J40A 1KY3A 1W4CA 2FGKA 1II9A 1DVRA 2V3CC 2OAP1 2ZSFA 2C95A 2ZAOA 3VU9A 1NSTA 3AUXA 4PHGA 1CJMA 1FQJA 2HLDA 2KWIA 3CBQA 3D31A 4AG5A 2HT6A 1T3LA 2Q9AA 3HYTA 4PC2A 2AK3A 2ZI3A 1UBGA 3LX5A 3QXJA 5AJZA 1YJ5A 3MJRA 4C0SA 2XSZA 4ZIRB 1NVVQ 1E0JA 1Q3TA 4BRUA 1NN3A 4ABYA 4A2WA 4OKSA 1VHTA 3KTAA 3MWKA 1KZ7B 2QSYA 3OEHD 8OHMA 3AM1A 5FUVA 2OCYC 1SXJC 4LK2A 3PUVA 2ZITA 3SQXA 1JR3E 3Q72A 3MGCA 5JJLA 2OFOA 2OM2A 1Q1EA 2GDJA 1Z07A 4LCBA 4BLRA 5JRZA 5G53C 4AYWA 1OH8A 4CF7A 1J70A 2ZRMA 4D26A 3CR7A 2PJZA 4V0ME 1UEIA 1CLUA 1JAHA 2IYXA 3AKYA 3QF4A 3QXCA 4ZKDA 4Z1MD 5EE3A 1ZVQA 2ZJBA 4P4TA 5CB6A 4RY2A 3AF2A 2AWOA 2HJGA 3CH5A 2QI9C 4O3MA 3WBKA 1QVAA 4IW3B 1E79D 4PO8A 3I5YA 1X3SA 2ZANA 4FWTA 2GKSA 5JHGB 2QUZA 1EESA 3KKMA 3AP2A 4Z51A 1R0ZA 3PEWA 2RGNC 2AHOA 2H57A 2EW1A 2ZYWX 1G3UA 3TLXA 5FPYA 4LY6A 3G5UA 1RZ3A 1KK0A 5LPNA 1DG3A 1XU4A 3BRWD 1G5RA 3IEUA 1MABA 1U81A 3ZVMA 1UPTA 3LA6A 4N0EA 4V0MA 3QKRA 1KO5A 3PIRA 1O87A 1F60A 2WAXA 3UMFA 4BRWA 1CJKC 2D06A 4DCUA 5JFGA 2ATVA 4BZPA 4DT1B 4LV8B 4O25A 2WWGA 1XDBA 1P5ZB 1UDXA 4MRRA 4WOPA 2QAJA 3AP1A 1FX0A 2WJYA 3CZPA 4PXAA 3N2IA 4IXNA 1C9KA 1TQ6A 1ZW6A 5CYPA 1G4AE 1UM8A 4EIWA 3SBEA 2PX3A 3WNBA 4GOJA 1TF2A 5FPTA 4BQSA 4QHSA 4JVNA 1BH2A 1C1YA 4KFSA 5FBQB 3FKSD 3WY9A 4LDJA 1Z5ZA 2VP0A 1XTQA 2PLRA 3VKGA 2R6FA 3AKCA 4IJMA 2O8EB 2BBWA 1MOZA 1KO7A 4DCVA 3GLIB 3C7KA 2ODEA 5KNDA 4RZ3A 3NWJA 3WP1B 3SOPA 1QZXA 2WAYA 4G3XA 2C9YA 2JLUA 1CULC 2G9NA 2ZAMA 721PA 2ASEA 3F5FA 4EUNA 2ZIAA 3IKJA 2AXPA 1E2IA 1SVKA 1XEFA 1XCGB 1OFUX 1RVDA 3AVQA 3H0KA 4GSYA 4Z54A 2XX3A 5CJ2A 4EFNA 1O3YA 4KBGA 4URZR 3EASA 3QI2A 1Q0UA 5JWHA 2WKPA 1E2GA 3ZQ6A 3C14C 3B6EA 2YZ2A 1E2JA 2H16A 5H68A 4QJ3A 4TZ0A 3GJ0A 2Z0MA 3V9PA 2QA5A 3ZS8A 3SHWA 4HAVA 1E2MA 3WMGA 1AZSC 1YZLA 2CCKA 2XTZA 5TDHA 2GCPA 1G19A 2IK8A 2F43A 4Q01A 2IWHA 2JLYA 4M22A 1DAFA 2BIFA 2ANBA 1GP2A 2QL6A 3GLHB 2DHRA 2Q9CA 3W3AA 4KCGA 4YXWA 4WVFA 1Z47A 3NDPA 1ZM7A 2MSDB 1ZM2A 4B76A 5H70A 2DY1A 3NEJA 3LW7A 3KQLA 5FOTA 2YYZA 1Z22A 1ZNWA 5FPKA 4YMSA 3EC1A 2GWHA 3EPKA 3LVRE 1ESNA 2VHTA 2W6JD 3HPQA 3K53A 3EA0A 4NDZA 1RRPA 1KK2A 1VYUA 2GRJA 4HAXA 4QRHA 3X1YA 4CYMA 4EPTA 4A6XA 3NH6A 1XEXB 1TQDA 2YC2C 3ZGXA 5FL3A 2V1XA 1J8YF 1ZD8A 3OFND 4I4LA 1U9IA 2PT7A 3Q5EA 3Q8XB 3UATA 1Z2AA 2P5TB 1D9XA 1R0YA 2RGBA 3DZDA 121PA 5B30A 1N6OA 1Z8FA 4RCYA 3QE0A 4UXIA 3ZH9B 2IYLD 4CDGA 4TMKA 2ZVQX 3VNUA 3Q9LA 1XF9A 4OI2A 1D5CA 2C03A 3WHLA 2WPDD 2EFDB 2HEIA 2AKAB 2XXAB 3HU2A 2QY9A 1NIJA 4XWAA 2W2VA 1M8PA 1AZTA 2GZHA 4DCNA 3MUFA 4RD6A 4EFLA 4AC9A 3THWB 1QDEA 1MKYA 5DISB 1P73A 4IHQA 2WSSD 1W4RA 3A8TA 4JMPA 1NN5A 1Z6AA 3DMNA 4P32A 2ORVA 3K9HA 4CEJB 1VG8A 3NXSA 5IF9A 2FF7A 2NO6A 4EPYA 3OE7A 5TB5A 5J4YA 3R8FA 3TGPA 1JR6A 2ZUCA 1W49A 5A4JA 5FI0B 1FUUA 4JS0A 2FSFA 1TQ2A 2KSQA 1VECA 1CRPA 1FP7A 1CR0A 2YOHA 4ILEA 1L4UA 3OESA 4BLPA 4HEJA 3QENA 5G3YA 4LYAA 1AS0A 1XTJA 4Q1FA 4BGDA 2G88A 2CCGA 3IGFA 4L9SA 2C9CA 1G5TA 2ZQ5A 5K8UA 1ZBDA 4US2R 2JIZD 1E99A 1E9EA 2VH5R 3B9QA 4LGMA 1JEEA 1AJEA 4JYBA 3UMSA 1Q1ZA 1XBTA 2VSOA 1WXQA 3FDIA 2WWWA 4TYQA 4DRZA 1L7VC 3CB4A 3BBPA 1DAGA 1RFLA 3CUEF 1GKIA 2BHRA 4ZDWA 3W8RA 3ZVNA 4TLDA 1G3QA 2IT1A 3AVOA 2ZJ8A 4JBYA 2QE7D 4C0LA 3U61B 4MGYR 3ND8A 2MMCA 5DI9A 4IXMA 1ONBA 1EX7A 3K0AA 1QHHA 2FZ4A 5LBIA 1ZUNB 4JVMA 5JS7A 3TUJC 2IBMA 2ZYTX 3FKQA 4Q7JB 4TMTA 5EUQB 3VX3A 5EJEA 4NZYA 4U7DA 2ODWA 3KKQA 4B71A 4DEYA 4DDTA 2ZR0A 1KAGA 4QC2A 3AF0A 2G83A 1KK3A 4LOAA 5FBRB 2HXYA 3AVPA 4TQUS 4PPFA 4LBZA 2F7SA 1UBCA 3QKTA 1CJVC 1KI6B 2GXAA 5JJIA 1EG7A 1TNDA 1XRJA 1OHHD 4FN5A 4HSEA 2ZRLA 3CH4B 4RZUA 2CE2X 1XJQA 1CKEA 4ESVA 1P9RA 1A4RA 3QBVA 3B60A 4PC1A 1HYQA 2BMEA 1NBMA 4AWXA 1SZPA 2A5FA 2QBYB 4W5WA 5EE9A 1OSNA 4KLZA 2YHSA 3K0SA 1XPOA 1U90A 1DARA 2QM7A 3LWNA 3UANA 4URXR 1HURA 3A1SA 3RANA 3REGA 2D74A 1H8HA 2X77A 3KJGA 3EPJA 2ZI5A 3I3SR 1GAJA 3B1YA 4N1AA 3SN6A 5GVRA 1SQ5A 2B7BA 3FHCB 1Q3HA 2Z83A 1CRQA 2IS1A 3CF0A 4A8JB 3J81k 1VMAA 1XCMA 2XITA 4CRWB 2AR7A 3I61A 4HAZA 3Q5DA 1KAOA 3CO5A 1NRJB 4GT1A 4Q5IA 4BLTA 3VNVA 3OIVA 2GCOB 5BQ5A 3AVYA 3ND9A 2VHUA 3C5CA 3A37A 4W7SA 2O8BA 3I73A 4BFXA 2QT1A 3GJ6A 3DMDA 4G01B 2Z43A 2Z6VA 3SEAA 4HAUA 5DSZA 3R9WA 1FMLA 4A0FA 1T4GA 4S2EA 2OCBA 4Q9JA 4QNMA 3QEJA 1GRRA 1GRQA 2QRNA 5FBWB 2IYQA 2KBEA 3L8ZA 1A2BA 1XPUA 1E69A 2HXSA 4AYXA 1MO6A 2V6IA 5B2ZA 4E5UA 4AYTA 2C96A 3TQFA 4OI1A 4PHHA 1OKKD 4LHXA 3OEHA 1T0JB 5BWMA 3VHLB 3AF4A 2EYUA 2J46A 4OQXA 1BIFA 1SKYE 1ZM4A 1J8MF 1JR3D 2OFWA 5K8LA 4DT1A 1OPXA 3LD9A 5HZHA 4D4MA 2ZE5A 1W47A 4TMXA 4CW7A 4C0QC 2ZTSA 3DOEA 1S3GA 2RGAA 4M9XA 5KSZA 4QM6A 2BMJA 4Q4JA 2NTYC 2PMDA 1SVLA 2BKEA 2RGDA 5P21A 2IC5A 3ZD7A 3Q7QA 1FPMA 2AXNA 2OEPA 5EXTA 2I1QA 3GJ3A 4JLOA 1NLZA 2B92A 2DFNA 5FTJA 1KDOA 1KDPA 2FFHA 3JVVA 2ZS8A 3TW8B 4HLQB 4QGFA 5DE3A 3QQ5A 5FTMA 2GNOA 1E79A 3QPWA 2WSMA 3QF4B 3TIFA 4IDPA 3VHXA 3TVDA 4LHVA 4IOLA 4PQFA 5KPJA 2Q3HA 2WTUA 1OXXK 2CNWD 3X1DA 2VEDA 2FPKA 2BOVA 3AGPA 4Q9HA 1G3MA 1ZD1A 2OBNA 5B64A 3OHMA 2FH5B 4R98A 3E1SA 2FJUA 3AVVA 4TZ6A 2NGRA 2BCJQ 3OF5A 4W9MC 4LWZA 2H8KA 3DM9B 4X8OA 4YMUA 3DL0A 1DAEA 3VR6A 3WXMA 1XB2A 1ZD9A 5FPHA 4UKDA 3ASZA 3U3JA 3KZ1E 1IXSB 2BMDA 2V4ZA 2VTKA 1KI1A 3ZDQA 2O0JA 2IYZA 2IX3A 1GL9B 1T8UA 4IVPA 4KSBA 3SBDA 1AM4D 4A1FA 2QM8A 4KI0A 3QNUA 1AK2A 2G6BA 4RFVA 3OIYA 4XH9B 2GVZC 5FUXA 3PJRA 2GK7A 2F3RA 1KI8A 1GL7A 3IIMA 3KB2A 3AKDA 4F91B 3QOFA 4DIDA 4NYIR 1WE2A 3B1XA 4KSCA 4KAXA 3EZ6A 2GVDC 1XEXA 1US8A 2VSFA 4MDFA 1LF5A 4H1VA 2Q21A 4JLKA 4AY2A 2J0QA 4M53A 4UQOA 2YWEA 3GCGA 1EFCA 3QG1A 4K81B 1UJ2A 4RD3A 2V7QA 1W0JD 3GD7A 2J0UB 2NPFA 4WW0A 2GBLC 4QBIA 3L2OB 4EQ6A 1XEWX 5GJBA 2WHXA 2HF8A 2FV8A 4JIMA 4TL7A 1VG1A 4B2LA 3NEYA 1OFHA 4FI3C 3WBJA 4MKIA 2BM0A 4QOSA 4Q4HB 4DSNA 4DDWA 2NO9A 1EFHA 4XJXA 2WOOA 1GG2A 1OW3B 5JEEA 4Y0AA 4GRAA 2J0SA 1GKUB 3TW4A 2B6HA 5EP1A 3THWA 1SGWA 2FG5A 2ZREA 3OAAA 2IS2A 4JSTA 3ZVRA 3DDCA 2HUPA 1FW6A 5FL7D 4L5BA 5AR1A 2J41A 4JLVA 4O2RA 2KJQA 5KUTA 2IS4A 4BFSA 1P2UA 3FMFA 3L0OA 4QFMA 3RWMB 1XMJA 4V0OA 1GNPA 4HATA 1D2NA 2H1LA 1HQYE 1FTNA 1S8FA 4QBGB 4OQLA 4TTRA 3ZD6A 3B2EA 3N70A 2W6JA 5L3QB 4OI0A 1IXRC 4DB2A 1XFAA 3NBXX 2CLSA 3RSLA 1CIPA 3OFNA 3UWOA 1SVOA 2B7CA 2JLSA 3T1QA 1N6PA 1BOFA 3LBIA 5AUPB 4W5HA 3N2EA 1OIXA 2ZRDA 2ODBA 3A4NA 2ZRAA 1XTKA 4NKRA 1V5WA 3K9NA 3SS8A 4RKFA 4C3ZA 3QEOA 4ZV4A 3O8CA 4UNPA 4HDQB 4A82A 4DCSA 1TX4B 2WPDA 3CPJB 1W5TA 2A3RA 3DPUA 1KTVA 3SZRA 5CYOA 2P0EA 1NNEA 4FCTA 4EJSC 5JWRA 3AVTA 1Q1BA 2IUUA 2C78A 3SU8A 3ZQJA 2R6GA 4DIEA 3PQCA 4DDUA 5JI2E 4RSGA 4TYWA 1ZC4A 2WSSA 4LJ6A 4PSKA 3I62A 2QP9X 5CIQA 3HWSA 1NP6A 3BFKA 3VQTA 5A0FA 3W90A 1IOZA 1W1WA 4ZI2A 2B21A 3JZMA 1R5BA 2GEUA 3CF2A 4RZ2A 4GDFA 3BERA 1KJZA 2XJ9A 3MFYA 5LD2B 5HCNA 1KNQA 4KFTA 2R44A 3K09A 3QF7A 3KXIA 5CLQA 4P3YA 1X86B 2ZETA 1K8RA 3MG9A 3K0CA 4QL3A 2GHIA 1YZQA 5FTKA 4DHEA 3KKPA 3T34A 2D2FA 4M4SA 4ZKEA 3NHAA 2OO7A 2QG6A 5C2JB 2R8RA 1UEJA 2J87A 4M8NE 1S1CA 2JIZA 4ERNA 2CK3D 3DZ8A 3RC8A 1A1VA 2EWVA 2BBOA 5GJVC 4P4SB 3U3RA 1W4AA 1WA5A 2WIAA 4URWR 4QGGA 3DO6A 1KI2A 5HR5A 1ZCBA 3D3QA 5DH9A 2VL7A 4JLDA 4KU4A 2QMEA 3UXMA 5K8IA 1W0KD 3KQHA 1G8PA 2QE7A 1W46A 2ZRJA 2GCOA 3PUYA 1U0JA 3K8YA 1DPFA 4US1R 4MUAA 4MGZR 3W6PA 1EFUA 1T6NA 1N6IA 2BBSA 1XPRA 1P62B 2G1JA 3HDTA 2Q6TA 3NKVA 2XGJA 1E0KA 3L0PA 1GM5A 4TQAA 821PA 2G3YA 1XXHE 1QF9A 2IYVA 1AGPA 4LC0A 5G3ZA 1Q20A 1QHYA 2D3WA 4IOMA 5FUYA 1E1QD 4MA4A 2BEKA 2BV3A 3AVUA 3FWYA 4XVQA 2W00A 3EPHA 1OHHA 2WMNB 4KYUA 4TL9A 1W44A 1VDZA 4IDHA 3RRMA 5BN4A 5G40A 3K9LA 2P6RA 5KSPA 2BBTA 1G3RA 3W9YA 1YRBA 1QHXA 2VP5A 3KXLA 4LUCA 3CRRA 5KDDA 4JBXA 4FCWA 2AX4A 3FMPB 3LQQA 3P1JA 1Y3AA 2C98A 4RVCA 5CM9C 2A30A 3AH8A 2AFIE 2HDNB 4HAWA 1GIAA 2AD1A 3B9PA 4JKIA 1IN5A 1AIPA 5JWOA 3FHTA 4TMZA 1Z0FA 1N5KA 4KVGA 3RHFA 4POAA 1YR6A 1HA3A 1G8GA 4CIDA 4A4DA 5EXSA 2VHQA 3LY5A 1E3MA 3VR5A 1XXHA 3B8HA 3RNLA 3HJNA 4HZIA 2QMOA 4EKDA 2V1UA 4C0KA 3R20A 5AK0A 1KJWA 4JT2A 1EGAA 3O8RA 2OG2A 2E87A 1IN8A 2IF0A 3DKPA 3LVQE 4M1TA 3I4LA 2E1RA 4PHFA 4JZKA 4M2LA 4KHZA 3A1WA 5DN6A 4PTLA 2VRWA 2F9LA 1NN0A 2ZRCA 3ADKA 4XD7A 2IWRA 2KI5A 4GMDA 4PC6A 4AURA 1W4BA 2WKRA 1OH6A 3WP0A 4ZDIA 2FFQA 4OHZA 2O8BB 4N0DA
chains in the Genus database with same CATH superfamily
1P8AA 1S1MA 2PIDA 1K5PA 1U0TA 5C37A 1EZZA 1TEHA 1DAOA 4QDOA 2FOXA 8GPBA 2FFJA 4KNWA 5K6RA 2WJ3A 2Z5VA 3ELWA 2QTVB 3IQIX 1CY4A 1E2NA 1UOEA 4QBHA 5FNVF 1H6CA 2ZSAA 3B1WA 3K73O 5HF5A 1SVWA 2HQRA 3DC7A 3NV7A 5K0EA 1JW9B 4YXFA 5B58T 2I6XA 5BMVB 2JZOA 4BXOA 3UOWA 4OJMX 4ZDJA 5E7JA 1BRMA 3PENA 3HV0A 4WGFA 1T1IA 2YCBA 3WLHA 4NXMB 2BM1A 3KJZA 4G5SA 4G4SO 4KBYA 4HY3A 3H2ZA 4RL4A 3TLJA 2E6KA 1V6SA 4U3JB 1N2OA 2R8BA 4MRMA 5EIAA 3W7AA 3RRZA 3V8PA 1R12A 2E82A 4YLGA 3TUIC 1J2UA 4D8UA 5DM1A 3F9RA 3S2ZA 4WE3A 5ADVA 3RS5A 4FHDA 1UP7A 2NG1A 1FTWA 3N8KA 1LBIA 3DNPA 3OZFA 1E9DA 4F86A 1U3GA 1CG6A 1BQ3A 5C4IA 3T3OA 1OX6A 4IF4A 4KE8A 1KMQA 1GCIA 1QIGA 2A5DA 1MB9A 2X4DA 3IEIA 3LUAA 3M0EA 3PDCA 4RVHA 3WIEA 2WHRA 4LRYA 4WDRA 5JYDA 1JQJC 4WOBA 4DPKA 3W6OA 3ZZNA 2H9YA 5A04A 3UJPA 3IYLW 2D0PB 2W6MA 4P6VF 4Q6WA 3WGZA 4K05A 1GZSA 2ZFUA 5IDYA 2Q2QA 4KLCA 4W4TA 1SG9A 3QBTA 1Q95A 1G6OA 1L9KA 1C30A 2XVMA 4OX9B 1X6VA 3TSCA 1N3LA 1EDBA 1SIWA 3JWEA 4OB8A 1G5IA 2B37A 2RAFA 3U40A 3RJ9A 2G04A 1J20A 1FY2A 2HHAA 4HH4A 2J5KA 4WECA 5EHIA 3KEOA 3A10A 4FX2A 1IZ8A 1BDJA 1UT8A 2IZ1A 3C8UA 3OMWA 4E6EA 5BQFA 2FMIA 2PRJA 4KV9A 3UJNA 2JGAA 2COKA 2FPPA 2BP7B 2PG3A 2PV0A 2JARA 2ZTUA 3GLQA 3RKUA 4D97A 3MS2A 4KLAA 2I34A 1WIWA 1C9DB 3LJKA 1L4KA 1DJLA 2FW8A 4NBKA 4M1ZA 4U5QA 4HNSA 1QH8A 4NAVA 3L7NA 2BH9A 4YK7A 1V37A 1L8LA 4S3MA 1IIBA 2E37A 2VK8A 2WR8A 4LWOA 5TSDA 5A5EA 5CH3A 3GVHA 2X19A 3HFSA 3LP5A 3NHMA 4HNAB 1EDOA 3WGLA 1U5BB 4B73A 4PC3A 1OB2A 4DADA 1SCJA 1O97D 4JUFA 5EUCA 5JR3A 4UM9D 3JQEA 2ZYVX 3LHDA 1PN3A 9LDBA 1YB4A 2I3DA 2ZBFA 4YO8A 3DDHA 4BO0A 4J0EA 1CT9A 5H4GA 1SCDA 5JCZA 2EF0A 3UWSA 5AJHA 5KPDA 2VYVA 4ZVTA 2VQFB 4R7TA 1VJ0A 4K6HA 4OA5A 1JPNA 1BKSB 3KVOA 3GYGA 4LBWA 2PJDA 3OFSA 3PUXA 5ITZB 1PGQA 2CXRA 1SBQA 4G8DA 4CETA 1QGYA 1YRAA 1QMPA 3T99A 4LJRA 2OESA 2YTZA 1FQWA 2IV2X 2G4CA 2VT2A 1XMSA 4MI9A 4YI5A 3UJCA 3F6EX 4NEHB 5IT4A 3OKPA 2CJFA 4AO8A 1X7YB 1TM5E 1WHTA 4F38A 2IELA 3RVKA 3WQBA 4H3KB 2V0CA 5JMTA 3ROZA 4XXHA 3U7GA 2AJTA 1R6UA 2J6CA 1ZK3A 2NSHA 3NO4A 4MPDA 1OX5A 2I7DA 4HGNA 2D2EA 2NZXA 1N7JA 3WL3A 1YZGA 4EARA 3FCSB 2XBMA 1CNEA 3ND7A 2OBXA 1XSEA 3MZ0A 4HP8A 5F3DA 4ALKA 3PEYA 4B4UA 1MB0A 5BP7A 2EKPA 2M9MA 3GEIA 2OENG 4DUGD 5ICEA 1LPAB 1DFIA 4A2CA 2PMKA 2JFFA 2VTBA 4X8HA 2IEYA 4ND8B 1QV7A 5C7LO 1P7YA 4X6YA 5LZ4A 5DNYB 1U7UA 4WRRA 3TSOA 4DLSA 3ENVA 1K63A 3G2LA 4FWIB 3JALA 5CT9A 1H93A 3U13A 3V9AA 4OP1A 1DGQA 2RHGB 1AHHA 1GTRA 4R6WA 1VPLA 2QB5A 3GFVA 4XB2A 4G67A 1EFLA 4X84A 1FXWF 4ZI3A 3W0LB 4K88A 4N03A 4WLVA 3A11A 5A7FA 3GP8A 5JPDA 2AYZA 3ETCA 3V3TA 3OKAA 4YEDA 2FX2A 1J8FA 3T8YA 1OAOC 1VLJA 5FUBA 4EYGA 1OIWA 3WTBA 2DP4E 4WEQA 2QPTA 3HDGA 3I5UA 4GP6A 1CZKA 3X44A 2BGJA 4MCJA 1QBGA 1W2HA 4ZPJA 3R5HA 4CPDA 1C41A 3AP3A 4P4SA 2QTGA 2BI8A 2CXXA 2W8BB 3OZWA 1X38A 4IH1A 3DS8A 5H4HA 3U17A 1AMNA 4FR5A 3OQPA 3ROTA 2COEA 3CJTA 4LHZA 1KA9H 4W6QA 4ACAA 1O1YA 3PUWA 2BMAA 3RS3A 1U11A 1TL7C 2YV5A 4IFEA 2PO5A 3L6DA 5DCYA 3O0DA 4DJAA 5HEKA 4MIEA 4JQSA 1P19A 2ID8A 4YRFA 2DKOA 4OD0A 2CLIB 5FUMA 2JJMA 4R9NA 3HKDB 1P44A 1Z8DA 4UBOA 2I1WA 1U1IA 4CM8B 4WOCA 5HXAA 5D6OA 4DXHA 4ESVA 5IJ0B 1OYYA 2YRFA 4Z9BA 1EWYA 5AVJA 4E22A 1ND6A 2O4UX 4QTTB 4MKZA 1W5EA 4Q47A 1NXPA 1H5QA 3H1TA 1AXRA 3Q3JB 1ZN7A 4BNDB 1OB5A 2MYPA 3KXKA 1JT9A 4Q0MA 1FSZA 2O7NA 3KJIA 3GJXC 3L4JA 3TEJA 1RWKA 4R9RA 1B6SA 2OGTA 3UBTA 4I1OA 3JTEA 5TY0A 1X74A 3U7EB 1XI2A 4N5LA 3B7PA 2QMYA 3ILHA 2G5TA 4JOCA 4WWHA 8ATCA 2WWVD 3KS9A 5FEMA 2Q5JA 4XJSA 3CVUA 1LQ2A 3W6ZA 9LDTA 4MVJG 1GZUA 2JGKA 3D1LA 3K8QA 3LBNA 3NUZA 5BN3A 1XNQB 1HMYA 3T38A 2O8DB 1KYIA 3GP3A 3II6X 4YRJA 2NACA 1NR5A 3G02A 2VA9A 4JLWA 1NUSA 5I3ZA 3RREA 2IYRA 2J85A 3WBBA 3HS3A 5JE8A 4C0JA 1DAKA 1FMFA 4KN8A 1W0KA 3CF6R 1YHNA 1AMUA 2D2XA 2H4HA 4G2TA 5SZHB 1P9OA 3B5JA 1CDDA 1AS3A 1S2OA 1XV5A 2J3EA 2JGJA 3EGVA 3MXOA 4KYIB 4PYOA 4YJHB 4L50A 3TGWA 1UPCA 4PV7A 2G9VA 2IHYA 3GGOA 2FCAA 1AGRA 1BD3A 4KQCA 4PSDA 4PX2A 4FXOA 1XT6A 1T35A 3FNBA 3MRSA 1P75A 4GGMX 1T0BA 3D2CA 2EFEB 1ORVA 3F2IA 5DNDA 4HUTA 5LLTA 3BGDA 5H9WA 5K9ZA 1IN1A 5FBKA 4R2XA 4ALLA 3VKVA 3TNYA 1QTIA 4RTMA 1O6BA 1VYHA 1T8PA 4MRVA 3TF5A 1UAAA 1B6RA 2H48A 4WLOA 4C0XA 3EQ8A 5HRAA 1TAHA 1B41A 1JVBA 3NALA 2GNAA 4WZAE 4RNDB 2C42A 2JCGA 2XRYA 5ICSA 3HVIA 3EAGA 4GICA 4ARSA 1GU0A 1OYWA 2DWOA 2OD9A 2QTVA 1UZUA 2KBFA 3GHYA 4NWIA 5GZ1A 2O6LA 3KHUA 3L93A 1KQFA 3VZRA 5JMOA 1X7XB 3I52A 2X0IA 4Z0TA 5D2CA 4WMLA 2GJ9A 5EP3A 4KREA 1PJQA 5D1HA 5JIBA 1QJ4A 1GRCA 5E38A 4LN1A 1Q7EA 4V0KA 1GAQA 2Y1DA 1V8OA 1QP8A 1Y3BE 2B69A 4MGHA 4F7WA 5BN4B 2JFYA 2GPJA 1A71A 3DTVA 1VJRA 1ZIPA 1K5DA 3ABQB 4UARA 4F3CA 2Z5GA 1OXUA 2YJ5A 3JQBC 3AYZB 4TL6A 2OBYA 4BWVA 2ISSD 5KJ6A 5J2UF 2RIRA 2PBFA 2ZXFA 4LAFA 3SLGA 1KWKA 1H3FA 1XU9A 6YASA 5B53A 4LBYA 4P7FA 4CHTA 3LFUA 3L43A 1EFAA 1BSVA 4JJ7A 1KNXA 2RFLA 3K2BA 3IBGA 2NO7A 3TYXA 2PFKA 3EEYA 4LYJA 3PLNA 1YONA 4X1KB 3PFGA 4RD2A 2VBIA 3BDIA 1GU7A 4XGKA 2GN6A 1CUEA 1KKUA 4HWSA 4JVOA 2W4IA 1U7WA 1D7OA 1B8NA 4PLWA 1COWD 3ROKA 4A16A 1F6BA 1XAJA 3MGKA 4IGEA 1X7ZB 3O4HA 3T9EA 4BTLA 4FMCB 2VPXA 4ARVA 3BAFA 2C0PA 4FS8A 4YC7A 3KOYA 3AKZA 2JFOA 2P2NA 1XNJA 2VSYA 2Y93A 5BYKA 2HSEA 3GLUA 1VGVA 4LBVA 4B83A 4IUBS 3BG5A 5I47A 3I92A 1X19A 4J2TA 3SIWA 3VGPA 3PNBA 1TAGA 2Q5HA 3MCUA 4Y98A 4O4JA 3AI3A 2PPVA 3H2SA 2W8ZA 3P2YA 3QVUA 5CP8A 1AHIA 1XTIA 5I9BA 3UJ6A 2BP7A 3JVDA 3N5CA 4X7BA 3THYB 3BWDD 3CRZA 2GJ4A 5K7SA 4A92A 1QYCA 5JNUA 1ZD2P 4Q7MB 4QBFA 4CZ2A 4EI9A 3H6HA 4RTJA 3FVQA 1W36D 4ZEWA 2PVCA 3QITA 4ZJPA 4ZPXA 2RAVA 2ACEA 3G13A 2HWUA 5BO5A 2W0SA 3QKSB 4RHFA 3L7OA 3MJDA 1K66A 2MSLA 3WL8A 1OBVA 2BFEB 3E05A 3FF4A 4QUDA 1ZA1A 4X8MA 4AU1A 2XVYA 1J8QA 1L6IA 2MHCA 5F9HA 1OF1A 4KODA 3L8DA 1MAUA 1N25A 4IJ6A 4CKYA 2DKFA 2Z9CA 5LDDC 1PV4A 4O4IF 5EJAA 4RZIA 1FRFS 1SAYA 2IOFA 2ZB8A 4BBJA 2PJRA 4QSMA 3I8EA 1KFBB 1WXEA 2O7SA 2B82A 4XJTA 4EHFA 5IN4A 1Y1TA 4UNQA 4AD8A 1R16A 1B8UA 3VSBA 2DFLA 2Y2VA 3FSRA 2O2JA 3BH0A 3R5FA 4RVNA 1MUUA 4BFZA 3QKWA 1JR4A 3NC0C 3QFTA 3ZHOA 3LF2A 5AP9A 2E4UA 5JZMA 3OURA 4UDXX 3O47A 2C07A 1X7WA 2FEOA 1GSIA 2OGSA 4HUQB 4AZWA 1M8FA 4M55A 4X7PA 3WMXA 4MQBA 3T5CA 2CUKA 2IXEA 3G8CA 2BELA 4NCJA 4JNKA 1FVHA 3DQQA 1JJBA 2I4MA 5DYGA 3MSCA 1RXYA 3A1TA 4RH0A 4C4TA 1BXKA 3C6QA 4NZOA 4L0QA 3SNHA 1L1FA 1A9PA 3IT3A 3N0TA 4US0R 3SHTA 1UZLA 1BVUA 2D0OB 3A4VA 3B38A 2HF9A 3VO2A 5EA2A 3IOCA 4O5AA 5U4XA 4LRQA 3V4FA 2XOEA 3D6AA 4ZICA 3GLGB 5MF6A 3DVSX 4PZ0A 2C8KA 1CBUA 1N75A 1SCUB 3VOBA 3DVAB 1R8QA 4P4UA 5KYXB 1IQRA 4UPDA 1P0QA 4ND8A 1MGPA 1WVMA 4FOLA 4KUGA 1KI7A 3AI2A 4HAIA 4NE7A 4YFVA 2JEYA 3CU5A 4E4RA 1SHZA 2C4MA 2AJBA 2Z58A 4PQGA 1HE2A 4ENTA 4W5NA 1NL3A 3FFAA 2JD2A 3SK0A 4AKSA 2IRWA 4I9UA 4FGJA 1B3RA 4CI1A 3IB6A 1CUJA 2C31A 3NMUF 3E9ZA 2O2XA 2VZ8A 1MJHA 4RETA 1ZK2A 2C7BA 5EKTA 4P7GA 5DBOA 4DLWA 3TZLA 3KKLA 3A27A 2QDKA 3FMGA 2WOJA 5GM2A 5GZ6A 3PVSA 3I04M 3U7RA 1E5QA 4BFTA 4GF5A 4D56A 1KY4A 4K6MA 2XYPA 1OE0A 3K8OE 1M9NA 2RKBA 4B3XA 4MV6A 3D6VA 5J5AA 4XB1A 4LV6A 1V4PA 3WMWA 2FX3A 3D8HA 2GCNA 4DHWA 3K05A 3GRPA 3TZCA 5BSMA 2VPWA 3U0BA 4PS1A 4M46A 3WKEA 4D3FA 4CKCB 2ROQA 3D64A 4FEAA 2OV1A 4OXQA 1XZQA 3MT0A 3ROEA 3PC8A 1I3LA 2B83A 3RU3A 5KTSA 3C3MA 4J7UA 3LQ1A 2AFVA 5EIOA 1RE1A 1LRJA 4M21A 4EO7A 2QORA 2PUDA 5FO1A 2IODA 2GILA 4HDCA 3GEPA 3IVMA 2G1UA 4JELA 3HKDA 1SXJD 3P0IA 3U7HB 4FZ5A 1Y3CE 5FX2A 4G8CA 3C3CA 4IQ4A 3ZHCA 3GZ4A 4OO3A 2X9LA 3BB3A 4JX9A 2H7VA 4KO8A 4AIIA 2ZRHA 3INTA 5J58A 1D04A 3IDZA 2I9PA 2GUWA 1NY6A 2HTEA 2JLCA 4PSUA 2D5IA 3O8DA 1BYIA 3EI1A 1TXGA 3ZU3A 1V1RB 5KI6A 4DKJA 4BNDA 4DV0B 3VC3A 2WTAA 2GXUA 1Y6FA 4PZDA 2IY9A 1SIOA 4O2LA 4EEXA 4KSYA 2A59A 2K7ZA 2WF8A 2JRLA 1X2EA 4BE7B 4CMEA 5JBNA 5EJIA 3ISTA 1E8DA 4DPLA 1UQTA 1GL3A 1SG0A 4KPUB 3GEDA 5BOVA 3O6VA 1VMIA 4F1WA 1JQDA 5DJ5A 3VR5H 5A6SA 4UQLA 2O8DA 2NU9A 1EUCB 1WCV1 2Y4OA 3LBAA 1KAMA 4QXAA 4ND4A 3T54A 4LNHA 4GBED 4BKQA 1E1KA 3G89A 2FWJA 1G59A 3E70C 2PX5A 1T43A 3W5SA 5K03A 3I9KA 2VJPA 4QLAA 5JCOA 5DULA 4MWEA 3ZJUA 4B85A 2JAUA 1VJ5A 4N8SA 4OK6A 3JS5A 1FMCA 2GBIA 2ACKA 2YYSA 1II8A 3NWEA 1FU8A 1SULA 1OI3A 1VCIA 2P6PA 4FT4A 4QJ5A 5DGIA 4ZC8A 4D3DA 2GM4A 1UL1X 4RQTA 1D2MA 4CM4A 2W2XA 2QTNA 2PUCA 1YMUA 2I7XA 4X5OA 4D9NA 1DEOA 1MR3F 2EAUA 2ZS9A 5IANA 2XB9A 4TTPA 4JL8A 2VRBA 1NKTA 1F06A 2PSHA 2W6OA 3GK3A 4G9EA 4DLPA 2YVAA 2DJIA 1UKCA 2JFXA 3NKLA 4UNSA 4I1SA 4B3BA 5ITWA 1J90A 2D5BA 3WGMA 4MLCA 3UNXA 4C3VA 5B37A 2P11A 4K9PA 3FR7A 2PQ2A 3HYLA 2ZB2A 4B3GA 5LQRA 1Q84A 4E31A 1QAOA 3OUZA 1AUPA 3HBAA 4LVNA 2OV2A 2PE5A 3CZRA 3GDHA 1YU9A 3I8XA 5AVWA 3NHPA 3HP1A 1K7CA 1NG1A 4PLHA 4B0OA 1DV2A 1KC3A 1MGOA 1A76A 3GYBA 4B5KA 2Z3WA 5D85A 2V5VA 5FWYB 1KFJB 1X7XA 3O84A 3V2UA 2R9VA 3VYRB 1GITA 2R6ZA 2Y76A 3EZFA 1E98A 1M2NA 3UICA 3RYHB 4RORA 5JNVA 3EISA 2VP4A 1ZIOA 4OHMA 4UJ5A 3WOHA 2JI9A 1TYZA 2Q8QA 3DNFA 5DMHA 3ZGNA 4IDAA 3VR4D 4B74A 5KYYA 5LN1A 2ZJAA 3IIJA 2YZNA 3RHTA 2QN6A 3PCRB 5JSZA 1LC0A 2VF2A 1A82A 3CW2A 3NBFA 4AG6A 4EECA 3TR6A 4AMBA 3NQ41 1EP3B 1OFGA 1Z6XA 1UBNA 3LWDA 1WW8A 1XJ5A 4RZQA 3KB1A 1XZCA 4FLMA 1FFAA 2VPPA 3VU1A 2DFKB 1K5GA 1QYIA 2WD9A 3I8SA 4ALNA 5ULLA 4X1KA 4DLYA 2VH2A 4B47A 2ODNA 3TLMA 1ECGA 1CQJB 1YJXA 4IKOA 2DTDA 1NOIA 5LD2C 3JQRA 4JLBA 1VKHA 1T3GA 3UBMA 4ND3A 1EFPA 1X7ZA 3KVRA 1NJSA 4CMJA 4NMMA 1QVWA 2ADFA 2W11A 3CONA 4MDEA 2ZRKA 3BS4A 2LIVA 2YWGA 2Q0QA 3M2TA 4RSMA 4ZYZA 4DB4A 5K6AA 1SMKA 3K6RA 3DMTC 3R24A 5ALSA 1RQPA 3IT0A 4B4OA 5E0OA 1MO2A 1I2MA 4CEIB 4J2OA 3MAJA 2HLPA 3RVBA 1OT3A 3DR3A 1DOAA 2VJMA 3FGOA 3ZHUA 2J3DA 2W2OA 3CF4G 3P32A 3QWFA 3WK4A 2QN2A 2YMLA 3HCBA 3T7RA 5KCZA 3GGJA 4FFPA 4L4YA 3NYRA 3GT3A 3THYA 1GAXA 3CZ4A 1SUBA 2G76A 4ADSG 4Z9XA 3VV3A 4BFUA 3EZ9A 5TRTA 4QGSA 4UDOA 3A2NA 2NT4A 3EIWA 4U5XA 3UIEA 4BO2A 5REQB 2QNRA 3RJMA 1F48A 2FEWB 1K7EB 2QLLA 3H13A 3I7OA 5BR7A 4Q00A 1PBNA 3O1JC 1IEXA 5DYYA 2IXBA 2GGSA 4WH0A 3DEJA 5AW6A 5KJCA 4MYDA 3EGCA 2G80A 421PA 4S2UA 4M36A 5IK2A 3HJHA 1N2JA 4HAYA 1QKKA 2G5GX 4KQHA 1TK3A 4MJ7A 1U8AA 2GBCA 4GOXA 4UTXA 2HA0A 3MCZA 4NARA 5KU7A 2RHDA 4RHYA 5DNUA 1Z6TA 2QRLA 2Q0HA 1LVUA 4AO7A 2QTFA 2OHFA 1HTWA 1XX6A 1Z9BA 3OM1A 3UK2A 3LCUA 2C4KA 4RMIA 4ZQCB 2A78A 1RBQA 2VSNA 3GB9A 4AZSA 3IODA 2PQ6A 5IBPA 1EVYA 4PAQA 4RTNA 5EHQA 3IV7A 1PZGA 1TEXA 1IIRA 1JIVA 1T2DA 3C3JA 3MD0A 4Y67A 1TD1A 3DV2A 3KD3A 4ROSA 4HUQA 3TTSA 1E2BA 3HUTA 1MC5A 4IPTA 5BRAA 2DWQA 3IKVA 5C4MA 3WIVA 4EABA 4N7MA 4HWRA 3L8MA 5KSOA 1MH1A 4P0TA 4QFDA 4J91A 1X1SA 1WRBA 1X9GA 2BEUB 4MV1A 4Y6OA 3UPUA 1S2MA 4ZA2A 3RIXA 4JROA 1Z63A 1R6VA 4AY5A 3H0CA 1V47A 3LECA 3IQGX 5GONF 3NB0A 3QJYA 4OHUA 3T5TA 2VHWA 5D3MA 3RSHA 1NY5A 2XTMA 4RXUA 1XKQA 4NH0A 4BKOA 2WDPA 2OBBA 4KDCA 2ZVDA 4YJGB 1BWSA 3LUPA 4RJ2A 3EBPA 4YUAA 3DDSA 4JLMA 2ZUDA 4X1YA 4XVRA 4G4JA 1G7CA 2QQEA 1HY3A 1YZTA 4UU0A 5F9MA 4F4HA 3ZD8A 1EUDA 4GECA 2H92A 3OU6A 4MVJD 1ZN2A 2C83A 5IUNC 2RHJA 2MSEB 3BXOA 4EKEA 3ZV7A 2YCLA 3DBRA 4AKGA 1HZZC 4Y18A 2OZVA 3TR5A 4TLBA 4I50F 1DXHA 2XF2A 3VTZA 4DXAA 2QD4A 5L95A 1V43A 1Y9AA 3GBVA 2XCRB 4LF7B 1KERA 5KNBD 2PZAA 4YTEA 3EZ7A 3KDSE 1HYBA 5IKPA 3KKOA 4M0LA 3SJCA 4BLWA 2JLQA 2GFQA 1C7IA 1R88A 1WEHA 3DCNA 2O7VA 2RGYA 3OT1B 1L7QA 1QRAA 3EVGA 1G5QA 2G5CA 3C97A 4LKOA 5D01A 1P6UA 1QCDA 1SQGA 4GLLA 1VIAA 5CIWA 3R3HA 1BO6A 4LW8A 2C5LA 2VWHA 4CKCA 2WTNA 4J0GA 2Q8PA 1NW5A 1C3XA 4G5FA 4LI0A 3T1VA 2WF5A 3Q40A 3OTQA 4AIRA 5EYPB 5JD4A 3W2IA 1Y8AA 2FVYA 3CZAA 3NGLA 3R09A 3BGOS 1NVTA 4XLTA 2Q7DA 1E3TA 3OTIA 2Y8EA 4ITRC 2ZBDA 3N07A 4DQKA 2XH8A 1Z2PX 3FNRA 3H18A 5IVDA 4RK0A 2ZUFA 1ZR2A 1ZG3A 4QSHA 1KOJA 3R7LA 4RTSA 3P94A 1SBIA 1UPXA 3BKXA 2EGGA 4W9NA 4BOYA 1G20B 1CB0A 1Z73A 3QTTA 1V7QA 4LTMA 4Q3AA 3F6CA 4Y1RB 3CX6A 5ERXA 5F12A 1NNSA 1E66A 2ECOA 5I51A 1G7TA 2ZRPA 5I7HA 4UDYX 1L1RA 4L8LA 3Q5GA 3V1KA 1E2QA 1Z29A 1FS4A 1L5KA 1V9SA 1SOAA 2RGEA 3LUKA 2YKGA 1FRNA 4O2BB 3GLSA 3K3PA 3K9WA 3D3WB 4QTXA 2Q5LA 4MWOA 3FTNA 3D4PA 3H2GA 3PPVA 5EMLA 3ZU4A 4BB6A 3A2LA 2E89A 5E6UB 4MS4B 3PR1A 3S3TA 3VC1A 4XFDA 2CHGA 2C2YA 5K3AA 2BFNA 3L9WA 5HE8A 1P45A 2RC5A 2XA9A 3E6AA 1QANA 4LXYA 1GHTA 3RIHA 1ZVMA 1DIRA 2OAEA 5DT9A 1DJMA 5EAIA 5K8CA 1TU3A 4OHXA 3RSZA 3TKLA 4BCCA 4OXIA 3FOZA 1AF7A 2DPLA 1MDFA 4F4IA 2QUKA 4XAQA 1K4KA 1RP1A 3D43A 3JYOA 3OJLA 3TLBA 1JWLA 4QHTA 1FDTA 3BE8A 1OH5A 1X94A 4FKBA 2O57A 5CNKA 2EC5A 5EN4A 1VL8A 3FUCA 4LYHA 4PLFA 1YVDA 3T7CA 1MB4A 1DAPA 1BXZA 3VZDA 3UV7A 4MVJI 4ND5A 4YA6A 1ZY2A 3FYHA 4AN4A 3FTEA 4ZXPA 4CLEA 1VLMA 1HORA 2QX6A 4KKVA 1M6VB 4LOHA 4P7BA 3MCWA 1IY1A 2FLKA 2BFPA 5H81A 4EY8A 1PFVA 1SKAA 2YIJA 3IMFA 3R40A 4NZNA 1ZA2A 2XMDA 1A8IA 2O3QA 4CG2A 3MBKA 1ZINA 5A9SB 2CBXA 3CKLA 2E4AA 2WILA 4V2UA 1H9AA 1AKRA 2X0FA 5BN5A 3IPAA 2EZ4A 4TVSA 1THMA 1PP4A 2ZJ0A 3KFLA 5C46F 3RIYA 4CLHA 5J1TB 5TGZA 5AJXA 5B1SA 2IGBA 5LJIA 1K7YA 1ABBA 2ZYSA 4YB8A 5IN5A 4BVFA 2AC2A 5DBIA 2PH7A 4R71A 1FLVA 1ILWA 2DPHA 3O38A 2PK3A 2EEZA 2BKUA 2AD5A 1UWCA 3VUEA 3CUSA 4EDHA 2PJUA 3AUFA 4L7QA 4R1QA 4ZK6A 1FNBA 5EJ2A 4BMXA 1NU8A 4GPIB 3O1HB 2LDBA 1L5SA 3OJCA 2O8FA 1SKBA 1UMBB 1SIBE 4G5YA 3DEZA 1QYWA 1TVKA 4WTOA 4BFYA 3EDRA 5M04A 1RHQA 4CNQA 3K5WA 4Z3OA 1XYYA 2HKIA 3QSGA 1UBUS 3KPWA 4HTFB 3G9ZA 4K1XA 1A2OA 4YWHA 2Q5EA 5HF8A 5B5SA 3CNHA 4ASUD 4ZCPA 3FMOB 2O3TA 1RWBA 1VMEA 1J06A 2DQSA 4P58A 2HLHA 4OL9A 3WHPA 1FFDA 4EMUA 1KI4A 3BXZA 3M6UA 3HADA 4TT3D 1Q44A 2Y6IA 2GUGA 3G0IA 5CMLA 5F33A 2JJ1D 1E60A 1W5BA 3AEYA 3NHBA 3PUZA 4QASA 4X00A 1CQJA 3A6JA 1EH5A 3RRBA 1CHDA 1C0PA 3EXAA 4ZK2A 2FZWA 2JFVA 5TGDA 5ABPA 4RZHA 1JIIA 2O7QA 1UDBA 5IBCA 1JPJA 3FNIA 1LWNA 5KJFA 1Y34E 3MINB 1VE6A 1YS7A 1U6IA 2ID9A 3FMIA 4RAQA 1LQUA 2XHEA 3B12A 5ICCA 4EENA 2WF6A 3UCFA 1CJSA 1Q11A 3KE9A 2H1OA 1I6KA 4GD3Q 3ZWNA 4CEIA 1CUVA 2LRHA 1GLVA 1E2DA 2CKMA 1RQNA 3KQKA 2QSUA 3GGSA 2XPCA 4MQLA 5FUQA 1CUUA 4MR8B 5DBFA 3OETA 4DQLA 5AT1A 2OVFA 2X4IA 3GRCA 1M0TA 1MLDA 2NZ2A 4RQBA 2ZJFA 4UVDA 1L7PA 2QN9A 2WJZB 2BCGY 3DFZA 3RGWS 2WAAA 3ZVLA 4TQ9A 1SCAA 2XSZD 1EZ4A 3NIFB 2FOIA 1KIAA 2J9RA 2Q5QA 1XPJA 3DOUA 1B0PA 3MAAC 2AOXA 2C8VA 4BJHB 1A98A 5TQJA 2ZWPA 4N4AA 1YWGO 1C9NA 5TQ0A 2VHJA 5I7FA 3K9BA 1RHJA 2LPMA 4IKPA 1VLQA 3M82A 3OT4A 5CA1F 4QPCA 4RGYA 2QY6A 1TPZA 2HT1A 4LPSA 1QGED 3NTUA 4XUGB 2J6IA 1E63A 4NYMR 4I7EA 3HVRA 5AOBA 2HV9A 2BTOA 1HFEL 4N54A 1E2PA 5JXGA 4Q37A 2QF7A 1SXHA 2A9FA 4G5XA 3KVYA 4JLAA 2A6PA 5EG5A 1HT1E 4RFSB 4RGQA 2QD2A 3ZKWB 5LMCA 2P3OA 2BM9A 3AEUB 4GLOA 2F17A 3BH6A 4N18A 4D98A 1TRKA 3CZ9A 2OLJA 4YJ3F 1JLRA 1CEEA 1Q12A 2RJ3A 5D87A 1EBUA 4ZP1A 3A2KA 1XOIA 3IUMA 2ODPA 3PXGA 4QBTA 3DTTA 4MVJH 2J5BA 2PU5A 3U3XA 4QOIA 2VIIA 3RS7A 3C7TA 4GPAA 4MWDA 3FDZB 3CYFA 3E5HA 4URUR 5EPOA 1FFXB 4HO1X 3W4KA 4EUHA 3O3NB 4CWAA 1FZQA 4ZHQF 1J8DA 1U0HC 2BEUA 3IKLA 1Z5OA 1BS1A 3COSA 3H3FA 2FY8A 1EGHA 3C2QA 3F6PA 1W87A 2DBQA 3D8BA 1JEAA 3ONFA 4LC9A 4A6DA 1JDTA 3FGNA 3VH2A 1YIDA 3KFVA 4LJSA 3U0VA 4XM1A 2OLKA 4KJXA 5ADHA 2J5RA 1CS4C 2QD3A 3OTOB 2YUIA 4BQQA 3KTDA 2OQ2A 4YJGA 3AVWA 3Q7SA 1L7EA 2AZTA 3KZKA 2A2ZA 4R1TA 4ZZ2A 3S55A 5BQ3A 1KVUA 3LYLA 4KXNA 3A14A 1UBLS 3ZE8A 1N8SA 5PNTA 1ZOLA 1E4OA 3INYA 4JBNA 2XEXA 1IH8A 3D2LA 2I6SA 4TUYF 3DL4A 1DBVO 4PCAA 1O94C 3VX4A 2NU7A 4R81A 4UBMA 3RLFA 3ICEA 3ZHQA 4IXTA 4D46A 3R3YA 4EGJA 1X1TA 4OHCA 1N77A 4XIJA 2HB6A 1ARZA 4M1SA 3IURA 3DAPA 4X97A 2FZVA 3HJGA 2CVZA 1IJBA 3YASA 4BYGA 1A8HA 4LF9B 2A5GA 2QP4A 5FR2A 1UWLA 2X3FA 3VR2A 2V9ZA 4V3BA 3I01A 2GZMA 2YXBA 2D4HA 2ZB3A 1KL7A 2VOJA 5COBA 2XNDA 2A0WA 1RWPA 3BREA 1J0CA 5FF9A 4OJYA 2GOYA 1JKXA 3LT0A 3ANXA 3THOA 4EG0A 3C3BA 1I94B 3GVCA 5LOVB 4YAIA 3CY6A 3I6MA 3G5MA 4OY3A 4I0WB 4EVIA 4DR7B 1OAOA 4LYFA 4DZRA 1NA5A 3NI2A 4PG5A 5T6BA 2CMHA 4L4UA 4TSFA 1ZUD1 3WLOA 2FQWA 2G36A 1TFUA 2EIHA 2ZRQA 4L78A 3HBLA 3QJGA 5EYPA 4OXYA 4AW9A 5EINA 4DCCA 2XMCA 3LO8A 2FN8A 2A84A 1NW6A 4Q9DA 5DTRA 2HU8A 3MRTA 2CLEB 4BN4A 1JQBA 2GF9A 3A7DA 1VLHA 5K20A 4GSLA 5AI6A 2XTNA 4FP9A 1PG2A 1TZJA 3I6BA 3CNLA 1AA6A 2XVXA 5A9RA 2ZUUA 4DEXA 3O8NA 4D92A 3PTAA 4M0UA 1NZFA 1GZDA 2YIDA 3AFMA 1G20A 4FK8A 4NX2A 4Y1RA 1Q15A 3CVYA 4D6XA 2IU4A 1FYEA 2Q2WA 3L7YA 1B14A 4OHVA 3FROA 3MGBA 4P1ZA 4XWYA 4KXWA 3WLFA 4XX0B 1I14A 1PT8A 2D0DA 2NW6A 3QXHA 1N5LA 4NU5A 1LY1A 1E5LA 4IUYA 2OCXA 4D8YA 2ZRIA 2Q6IA 2ORYA 1GGFA 1IZZA 2GTIA 2M32A 4O2BA 4NYJR 3D3WA 4F5ZA 1TMKA 2ZTVA 4HQLA 3TXAA 1J7KA 3LM8A 3BSFA 2FHPA 1XCPA 2ST1A 3CLSC 4HVTA 4R9SA 4IIJF 2LCQA 5J43A 5E6UA 1A1VA 1BRTA 1JN0A 4K26A 2O6HA 2QENA 2X2OA 3NHZA 3TE7A 1PS9A 4KO4S 3S2FA 1WULS 1TVCA 4G0XA 1LUAA 1RJ9B 2P27A 3IVCA 3KAPA 4Y6SA 5D84A 5JLJA 2E9SA 4OMUA 2ORIA 4PR0A 2OD2A 3N6XA 4N3GA 4PPQA 3UVEA 4NV0A 4HT3B 4B3IA 2HDOA 1I4TD 2RMKA 1D2GA 3EGOA 5B2EA 3DEAA 3NTQA 1CE8B 1E89A 5GMOA 1ZLXA 4J9UE 3ZTWA 1UBOS 5B4TA 5A2GA 3DAOA 4LOLA 1DMSA 2QSJA 2YJTD 4MCIA 2X23A 4WKBA 1E3IA 3ZZTA 3LOQA 2DUMA 4FCVA 4FE4A 5IULC 1WB9A 4RTQA 1EIZA 4RKYA 4OLBA 2H9IA 2FMFA 4WZBB 3FAZA 1JU9A 1AKQA 1E4EA 2Q3FA 3MQ2A 4LQDA 1K98A 4N5HX 4DC9A 4ZGBA 1U0BB 3BQNB 5L51A 1M6VA 3HVKA 1AK1A 1AKWA 2ZRBA 1VM6A 2NZWA 3EBLA 2CYBA 1FDIA 2ZLBA 1IUPA 1MEJA 1TUBA 1WEKA 2HJHA 1GEGA 3CM0A 1A7UA 1WSWA 4FFDA 4IRUB 4PGMA 1RCTE 3AWIA 3VNRA 4XR4A 4EG8A 5FADA 2HDHA 3TE6A 3TL3A 2GCEA 4LRXA 4I08A 1ABFA 2CHQA 1DX6A 5C35A 3VSAA 2FJ0A 1Z5PA 4ZAFA 3AJDA 3HWRA 2WVGA 2C2GA 4RLHA 4ZWNA 1FF9A 2CXHA 4MMZB 1K5HA 3SI7A 1KF0A 5J4HA 5T4HA 1Y80A 4BNGA 1NFRA 5ESDA 2LWIA 4BS9A 3R6GA 4W63A 3WQSB 1KU6A 4ZHSA 4DBZA 1T9AA 1U0NA 4WACA 2ZI4A 1GQFA 4HJXA 4I36A 4ER3A 1UMBA 1ZEMA 2IXDA 4ZAYA 4JFRA 3WOVA 3L40A 1G7SA 1XTRA 4RHTA 1W4LA 1MG5A 1Q7RA 4L5IA 1VCMA 2BW0A 3RVPA 2BAGA 2JHPA 4C29A 4CN9A 3JQBA 1FRQA 4DANA 10MHA 5HTKA 2W43A 2WQ7A 1ZS9A 3QLVC 1KYZA 4Q48A 4BB0A 1QHEA 3MS4A 2Q1WA 3V2GA 1PJRA 3IBYA 5A5GA 3E5MA 4KOAA 4GM1A 3WK6A 2BJVA 4JN6B 1E6KA 2KMLA 3LG2A 1TCBA 3BK7A 1F8FA 1ZQ9A 2D0IA 3EY4A 1U1FA 1Q92A 1X39A 3HLKA 3K6SA 2C1XA 3CGWA 3R5XA 3MILA 1WMEA 2Q46A 2WZDA 1ZJ4A 3OQOA 1L8OA 2D2IA 1XMVA 2GESA 5FBVB 4YGXB 5L8VA 4FN4A 3G2MA 3S6JA 4BFLA 4D4LA 2XV1A 1JECA 2V97A 2O3UA 3OX1A 2HYDA 2Q4RA 1U98A 3Q6IA 1TT7A 4FW9A 5FI1B 1QGUB 1CZUA 1JDVA 2BDTA 2EEPA 2VDPB