2IUSA

E. coli ftsk motor domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
409
structure length
392
Chain Sequence
LPSLDLLTPPTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRDNPSPLTVVLGKDIAGEPVVADLAKMPHLLVAGTTGSGASVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALGVRNLAGYNEKIAEADRMMRPIPDPYWHPVLKKEPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQAGAESLLGMGDMLYSGPNSTLPVRVHGAFVRDQEVHAVVQDWKARGRPQYVDGITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA TRANSLOCASE FTSK
publication title Double-Stranded DNA Translocation: Structure and Mechanism of Hexameric Ftsk
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 116
structure length 392
sequence length 409
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01580 FtsK_SpoIIIE FtsK/SpoIIIE family
A PF09397 FtsK_gamma Ftsk gamma domain
A PF17854 FtsK_alpha FtsK alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.980.40 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-tRNA Synthetase; Chain A, domain 2 2iusA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iusA02
4GRAA 4OI4A 3J81k 1NVXQ 4KSCA 1RVDA 2JJ2D 5CITA 3W6PA 3LD9A 4N1AA 4CEHA 2O8DA 4G5OA 4RSGA 2QTVB 3NEJA 3CRVA 4Q1AA 2GF9A 2OFOA 1B23P 1AIPA 1KAOA 3HU2A 4ZDKA 4FWTA 1JEDA 4BZPA 1FMLA 1FX0B 3PVSA 3IPYA 1NIPA 1YR6A 1UJ2A 1NIJA 1Z6AA 2A5DA 1GKIA 2QE7A 1UKYA 2UKDA 3T35A 2GCNA 3V00A 1MRSA 4KYIB 3L8YA 3RS4A 2ZI3A 4BFYA 3AKEA 2REXB 2ZETA 3FMOB 4CRWB 4CZ2A 1KTVA 3U5ZB 2PL3A 5J4KA 1AGPA 4HZIA 1KGDA 3GEHA 2V54A 1C1YA 4V0MA 4V0OA 3KKMA 4QBIA 4N0EA 4LHWA 3ADCA 1GAJA 2GK6A 4L4UA 5DI9A 4IDPA 3T1TA 3EWSA 4URWR 1ESNA 4Q18A 3OESA 1OHHA 2R44A 4I99A 1AA9A 2OBMA 2EWVA 3RLFA 3K70B 5SZKB 1W36B 4HLUA 3GLIA 3F8TA 3BB1A 1HQYE 2GCOA 1E6CA 2ZU6A 2ZRLA 1II8A 4R98A 4RZ3A 1OH8A 2GXAA 1ZINA 5LB2A 4TMVA 4JVNA 3QVUA 3KJIA 1RKBA 4LYJA 4U7DA 4LSGA 4JYBA 2ZSDA 3NC0C 3F3YA 2YWHA 1U8YA 1Q20A 2H18A 2I1VB 3E1SA 3FHCB 3GJ8A 1D6JA 4FINA 4QNMA 5C1BA 2JJ1A 4KI0A 3TMKA 3P32A 4TMTA 3QKTA 2VP5A 3BFVA 2ZRHA 5GVSA 1XMIA 4EKDA 5CIWA 3L8ZA 1S9DA 3PQCA 3Q7QA 3UXMA 2IWRA 2GA8A 4TYWA 1NL3A 4MITA 4PFSA 5B30A 3A1TA 2MMCA 3GFOA 4AKIA 4L9SA 1DG1G 4S35A 4QHSA 5DN6A 1IBRA 4HDQB 3DM9B 3U4QB 3QNUA 3ECCA 2JLQA 2YNMA 4LC0A 1TF7A 4HAVA 2VSXA 5A0FA 2WBLC 1PVOA 2P65A 4MUAA 3PEVA 2VPPA 1FMJA 4BEJA 3A37A 5FH9A 1Z0KA 2ZVPX 1JXMA 5EZ5A 1ZU4A 1CR1A 5HE8A 3FHTA 1E0JA 4B71A 1US8A 1QG4A 4LJ8A 2QAGA 3AVTA 3IDQA 4LOAA 1G19A 3CR7A 1KDOA 2ZRPA 4OHYA 2MSCB 1W4CA 2ZSFA 3Q5EA 1F2UB 4TLDA 1N0VC 4DBLC 5B57C 3OZXA 1S3SA 5J5CA 1HQCA 3AH8A 3GJXC 1JEEA 4PHFA 1E4YA 1A2BA 3B1VA 2QORA 5KDDA 2RGGA 4LJ9A 3TK1A 4DKXA 2E9SA 2NTYC 4QC2A 3SC3A 5DHFA 2O0KA 3NTUA 4Q03A 1KI6A 3B2EA 4MYTA 2V55B 4RVCA 3SFVA 1IXZA 2E87A 3D3QA 1QZXA 2A78A 1YZNA 3W5JA 4B32A 1M7GA 1E9RA 2D7DA 3LBHA 1WMSA 1I4LD 1E79A 3CH4B 2QQEA 3DL0A 4BLSA 3LX5A 4HLDA 2J41A 3RRYA 1GG2A 2UVQA 4AYTA 1KOFA 3KQHA 1F6BA 4ZIRA 2WIBA 1JBKA 5CB8A 4NTZA 4Q4LA 1T8TA 2PLRA 2WKRA 4JLPA 4ASUD 2PT5A 1P9RA 2C77A 3WXMA 1J90A 5IF9A 1ZW6A 2OAQ1 4ZO4A 4PXAA 5DNYB 1G3IA 2BEKA 4JLAA 4XIGS 1Q57A 1TU3A 2EU8A 4NH0A 2PZFA 2GJ9A 4MYHA 4DSNA 2EWWA 1R8QA 3RWOA 3BD9A 1N6LA 5FBWB 2J87A 2Z43A 3CONA 4K81B 2GF0A 3VQTA 1Q0UA 2JIZD 1O3YA 3MD0A 1U9IA 2P0EA 3N2EA 1N2CE 1W0JA 1E1QD 3ZIAD 1KNQA 2WZQA 2WWWA 4F4JA 1P62B 4EJSA 4PSAA 1P61B 4X8OA 4XOIA 1PZNA 1ZM9A 4LV6A 1VCIA 1CJKC 3HU3A 4US0R 5CIQA 5KSYA 2D62A 4MYCA 4JLVA 1UAAA 5LB4A 2F6RA 2IYRA 4JBYA 4JIMA 1HH4A 1H8ED 3CUEF 4QHYA 4IJMA 2BBWA 1M8PA 1XFAA 2X2EA 3U3MA 3WBJA 2XOKD 4K8OA 4M2LA 1SXJD 3IEUA 3U7HB 4BFUA 2FFQA 2VSFA 3QG5A 3TKLA 2XNSA 1W7AA 2GVDC 3A4NA 2A2ZA 2QGZA 1YJ5A 1G291 1OH5A 2RHDA 1LVGA 4C2TA 4DDWA 1ZM4A 2VIIA 2G77B 2JDIA 2ZJ2A 3ZLJA 5EXSA 4D25A 1DO0A 4OQLA 4W5WA 4M9ZA 3P20A 4IHQA 2BHRA 2ZREA 1QHHA 3KXIA 2GWHA 3G5UA 4PAQA 4FW9A 3AVPA 4EFLA 3FFBA 4M21A 5CB6A 1JJVA 4PAMA 2AK2A 5FTNA 4HB4A 2Q6TA 2H5EA 3IO5A 2GZHA 1II0A 3BFKA 3OEED 1EG7A 4B3CA 4BWYA 3AB3A 2P5TB 1VCOA 1AQUA 2O0HA 1A2KC 2WJYA 2GK7A 2NZ8A 4JSYA 3TNFA 3V9PA 1LF5A 2R9VA 2V7QD 2A3RA 2OAP1 3KXLA 1IJFA 3SZRA 4F92B 3C8UA 2ZE8A 4WAUA 1OXSC 1T3LA 1NN1A 1PLJA 2Q3FA 2ZJ5A 2JA1A 1F48A 4RZUA 1E9SA 2RKOA 4IDNA 1W4RA 3KB2A 5JWHA 4HI0E 4ZDIA 4XWKA 3LDAA 4XH9B 5SZIA 2BMDA 5E7JA 1DELA 3WNBA 2ZSEA 4A8JB 2AKAB 2G83A 4FWIB 1ZNYA 1LF0A 4BZQA 3BE4A 1LS6A 3CPHA 4O2RA 1OJLA 2V8OA 3DHWC 1I2MA 5CYPA 1U0HC 3KKNA 2J7KA 1QG2A 1CR0A 3PEUA 3VR5A 4NE2A 4A2QA 2QNRA 1LV7A 4Q02A 5JSZB 1XD2A 1OXVA 2G1KA 4QJ5A 4C0JA 3NWJA 3T12A 2WMOB 3WY9A 4A0FA 4WA7A 2QMUA 3TW8B 3B1WA 3AQ4A 2FDCA 1NBMD 3FWYA 3KKQA 4U5XA 3W90A 1KO8A 1BYIA 1L7VC 3MWYW 1HYQA 4HLCA 5AK0A 1QHYA 4GZLA 3SJBA 4HB2A 3KQNA 2ATVA 1GOTA 3QSYA 2JASA 1XP8A 1FPMA 2GCPA 4IW3B 4OYHA 1LW7A 2WPDA 2QMOA 4HB3A 4WVFA 3LW7A 1OV4A 2H1LA 3ZS9A 2WTUA 1R5NA 2ZRNA 4JLOA 2I1QA 4MKHA 2OCBA 1T0HB 1E2FA 4LYAA 5CLLA 4ZCLA 3RWMB 2OLKA 1FOEB 2ZS8A 4TL6A 4DCVA 4GDFA 3LW8A 5GADl 5KNBA 2ZI4A 3CKLA 3SNHA 4P32A 5IDVA 4OI2A 2VF7A 2XJ9A 3SOPA 4AKEA 2FPKA 1HT2E 3VU9B 621PA 2H8KA 3CF2A 4RY2A 3G0HA 2ZUBA 3AEZA 4JZKA 1ANKA 4ACBA 1B0UA 2FPLA 2ZSBA 4PC1A 4JS0A 3ADBA 2CEAA 1Z8FA 5EXXA 1J99A 1NJFA 4US1R 4FI3C 3UPUA 3FDIA 3UK6A 1IN4A 3OAAA 4DDTA 4C0QC 5CM9C 4WXPA 3THYA 3F0TA 2C99A 3OIVA 4QNRA 4QOSA 4QBHA 4YC7A 5TXGA 2VL7A 2YC2C 1U0LA 1C9KA 5L3QB 3U3OA 1ZC3A 2YWGA 1Z22A 2FH5B 3CW2A 1GVNB 4UXIA 3EC1A 4B3XA 1E94E 3DMDA 3SJAA 3KQUA 1W48A 2OSBA 3AF1A 2ZAMA 4OJKA 3MJRA 1JPJA 4FCVA 2OCPA 1DAIA 1KMHB 3T5DA 3R8CA 1QF9A 3VFDA 1NRJB 2PMDA 1D2EA 5AUNB 2GTPA 2JLXA 1KY3A 1Q21A 2P2LA 3MMPA 3QG1A 4DLWA 1XEXB 4BLOA 5C18A 3U7FB 3LQQA 3DEFA 4NU0A 1ZUIA 1H65A 2B8TA 1E99A 3GJ0A 3ZYCA 1MT0A 2Z4RA 2WOJA 3QKRA 3U3RA 2XZPA 3VHXA 1OT3A 4EPTA 1G8YA 1DADA 1A4RA 1XJQA 2ONJA 1Z08A 4LI0A 1CKEA 1DAFA 1VPLA 3B13B 4C30A 2X77A 1ZC4A 3UWOA 1ZNWA 4AY2A 3GCGA 721PA 2C9YA 1T8UA 1XPOA 2YJTD 3TH5A 2WWHA 4IOKA 3QBVA 4ZKDA 1P9WA 2CHGA 5JJKA 2ORIA 3FKSA 2GBLA 2V6IA 2CCKA 3IIJA 4LJ7A 2VBCA 1FQJA 2VP6A 4D81A 1KDTA 2A5FA 4OI0A 4KLZA 3ZZUA 4DUGA 3M1IA 2O8BA 4DSTA 2ZIAA 2GXQA 3HWSA 4IEEA 3CBQA 1JR3A 1UBGA 3GP8A 4EAQA 1P73A 2JLUA 4Z1MA 2RAPA 3X1DA 1NN5A 3CLVA 4A8JA 3AUYA 2G6BA 2IS1A 3HP1A 2FWRA 2ZR0A 4Z51A 3IBYA 4NYIR 3E70C 2WAXA 4XWOA 2B7CA 3CRW1 4B2LA 2AK3A 3L2OB 3NIBA 2VF8A 3EARA 2WSMA 3AKYA 2CLCX 3MAAC 1P9NA 3K9HA 2W6JA 2L0XA 1LB1B 3M4YA 1RYFA 3AVQA 1LFDB 1KI2A 1G21E 5BYJA 2F55A 1QHNA 3L0SA 3LVQE 1QBKC 2PZEA 1GKUB 3BGWA 3HU1A 4LJAA 3ZVRA 5K8TA 2GXSA 3HR7A 4TYNA 4B47A 1PV4A 4M53A 4L8GA 2JJ8A 2VHQA 1W5SA 3AP2A 2QZ4A 5JMTA 4P4TA 4YMWA 3K09C 1TUEA 1KK1A 1U8AA 1WA5A 2UZIR 3AF2A 1DOAA 5K8UA 2GILA 3M0EA 4D26A 3GD7A 3BB3A 3AKCA 1VCMA 3P4YA 4B35A 2FZLA 4D80A 5BXQC 3P27A 5J4VA 1P72A 2J7PA 2ZJ8A 1WF3A 2Z5FA 4B76A 4EFMA 2JGNA 4YMVA 2ANBA 3HDTA 3LH5A 1ZIOA 2XAUA 3UATA 5JRZA 3PG5A 2IF0A 2ZJBA 2YINC 1ZM3A 2LCFA 4AK9A 4DLTA 4LGMA 5CDFA 5DGXA 2QRNA 2ZRIA 1XCPA 4M1MA 1AZSC 5ANRB 2C5LA 4BE7B 1KSGA 1N6RA 2OBNA 1TU4A 4LJ5A 1GIAA 4Q4HB 1G4AE 2G9NA 2AR7A 3W5IA 1M6NA 1G3MA 3K0CC 3LX8A 4E07A 2ORVA 5FPKA 2Y8EA 1H8HA 4JSTA 2ZU0C 1KIMA 1Z07A 4URYR 4UQOA 2ODNA 4CYMA 2EFCB 4MRPA 2EW1A 3RDPA 2GNOA 4POAA 5F9FA 1E9FA 4Q4JB 5LPNA 1N0UA 1Z6TA 2CK3D 1AQYA 3TVTA 4W5JA 3AVYA 2WM9B 2KE5A 4Q7MB 5TMPA 1NG9A 3PUYA 3LQRA 5JJIA 1KMHA 1RW4A 1OXXK 1YHNA 1Z2AA 4BFSA 1VMAA 4PAOA 5IT5A 2QBYB 2REBA 2C78A 2HUPA 4LCBA 5EE3A 3U3KA 1XEXA 4RFSA 4DJTA 1KI4A 2QG6A 5KOYA 2DFKB 3SBEA 1U90A 2VHCA 1W4AA 3T1QA 5HKKD 2OT3B 5J4HA 2C04A 5DYIA 2FEOA 3K9GA 2XB4A 4XD7D 2J9RA 5D3MA 4ON9A 3U2QA 2BCJQ 3K53A 1SHZA 2F7SA 1ONBA 1TQ2A 3ND9A 4P3YA 3FYHA 3PUXA 3ETLA 1E3MA 3N70A 4TMWA 3RSOA 1ZRHA 1A82A 1QHXA 5FPHA 4C0LA 5B58C 3GLHB 1Q22A 1M7HA 2D2EA 1ZP6A 1EESA 2D74A 3QXCA 1COWA 1XXHB 4IDHA 3I1FA 3UG7A 2RB4A 1HTWA 3OFNA 1XTKA 2D06A 2F43B 4KITB 3SQXA 3AGQA 6Q21A 2BCGY 3S1AB 1RRFA 1ZU5A 2ZE6A 2ZRGA 4CT4B 4DT1B 3GEIA 3R9IA 5EZ6B 1UF9A 3GLHE 1SQ5A 3JVUA 3Q85A 1MV5A 2CE7A 2PJZA 3B9QA 4HUQB 4DCNA 1TF5A 3CF0A 2GZAA 4UNQA 4C4PA 3QXXA 5JWOA 3SI7A 1ZMXA 4URZR 1G3UA 3SU8A 2PJRA 3FMIA 3PFIA 4HAXA 2OESA 4JLBA 1TX4B 2IHBA 2PLFA 3AF4A 4WZ6A 2IBMA 2XXAB 5FL7A 1XJCA 2RGNC 1AKEA 2BBOA 2BEJA 2ZROA 4AWXA 3BWDD 2QEQA 1DG3A 1NSFA 4LYHA 1OFHA 3BH0A 1FQKA 1FTSA 4EPXA 2QAJA 3IQXA 4V0NA 1RRCA 1XMJA 1I2DA 2GEDA 5AJYA 2GEUA 2W2XA 2JCSA 2BMJA 2IYXA 1GNPA 2FSIA 3QKSA 5H8WA 2Z0MA 2XX3A 4RD6A 1S2MA 3RS3A 4XVUA 1Q12A 1T5IA 4CEJA 1TAGA 2Q9BA 3CRRA 5KNCA 2JLYA 3VKWA 2CBZA 3B7GA 2W2VA 1Z06A 1G6HA 2R62A 3I8XA 3C14C 2QSZA 4L9WA 5CJPA 5TARA 5JECA 1G7RA 3KQKA 1LS1A 2ZUDA 3EAQA 3CO5A 3KFXA 2Q21A 3SJCA 3ZVMA 2P6NA 2UZ3A 5DSZA 2FEMA 1TQ4A 3F5FA 5CJ2A 4PX9A 3L82B 2IYTA 1XPUA 1OLOA 2ZRCA 3BK7A 4BQSA 1N25A 1MO5A 1D2NA 5HR5A 2NGRA 3R9XA 4V02A 1TADA 1X8JA 3CX7A 1UBCA 4FXPA 1VECA 2J59A 3PIRA 4DDUA 1TTTA 1S0UA 4DIDA 2R2AA 2F1JA 4PQRA 5DISB 1NJGA 2NPFA 4EPVA 3B60A 4RFVA 4ZI3A 2V6JA 2YHSA 5J40A 4MGYR 4R2IA 3WHLA 1HA3A 3I92A 2W6IA 3X2SA 2VHJA 2ZVQX 3LV8A 4DDVA 4Y0AA 3MRSA 3VKHA 1E2LA 2J0UB 5FOSA 1KSHA 3K9NA 5EE1A 4GMDA 3AP3A 1NG1A 1PUIA 2PH1A 1L4UA 4M1SA 5L3SA 2IS4A 2ZRBA 3PXGA 1FTNA 3RS2A 3U7EB 1SXJB 1FNNA 1XDBA 1ZD8A 4EQ6B 3CR8A 3W8RA 2OCAA 1S3GA 2GEVA 2YWFA 2NOAA 5AWFC 4L5BA 1G41A 1G5TA 1K5GA 2YC4C 3SYNA 3KUDA 1OXTA 1E0SA 2GESA 1VYVA 5E7MA 2WMNB 4LX0A 1S8FA 5EJEA 1SXJE 2A9KA 1UKZA 1DAEA 1E1RA 4F7WA 3KDSE 2R6FA 2XEXA 4QKQA 4QGHA 1DE0A 2ZI6A 4HAYA 3KKPA 2JJ1D 1E32A 2AHOA 2Q0HA 3GJ6A 3PUWA 1FZQA 4D4JA 2CXXA 1P5ZB 2ZRJA 3SHFA 4MQBA 2HXYA 2IUUA 2PT7A 4EPRA 4A36A 1HUQA 2QY9A 4LZZA 4B3FX 3X1YA 1TUIA 1KJYA 1G5RA 3IHWA 1U99A 3R20A 4ZCIA 1YU9A 5GJCA 1W46A 2RGXA 5DN6D 2OG2A 3N5CA 1L2TA 3R9WA 4MDEA 4ZCMA 1PUJA 1G5PA 4ZDJA 4I4LA 3T61A 4KFRA 4BGDA 5E7IA 1RPZA 2YWEA 1T4GA 1A5TA 1E9DA 1XXHA 3EWAA 3REGA 1G9XA 4AYXA 2JLWA 3HPQA 1Y63A 4PSVA 3FOZA 3A1UA 2ZR9A 4B44A 4A0RA 1TMKA 2CVHA 4DT1A 3IIKA 4A6PA 3RC3A 3UMSA 2JLSA 4NYJR 4Z54A 5EXTA 4QM7A 3GFPA 4YMSA 2F9LA 3SN6A 4XVQA 1KI8A 1NMZA 3C16C 1DAMA 2BC9A 2QGNA 3C5CA 3W3ZB 5A4JA 2PCLA 1SVLA 1IY2A 2ZJOA 3NH9A 3WYFA 5F3WB 4LDJA 4NCJA 3VX3A 2D4HA 2XXAA 3MFYA 3PENA 4Q1BA 1NY5A 2DFTA 5BW8A 3WBKA 1N6KA 3CZPA 4OI1A 2ZYWX 1S96A 4QJ3A 5JWRA 4KFSA 3BB4A 3AGPA 4MKIA 4P31A 4A0HA 1XTRA 4HSEA 4MH0R 1IXRC 2FV8A 2AL7A 1OKKA 3N2IA 3AVVA 2B92A 1AGRA 2MSEB 1IY1A 1E79D 1F2TA 1RJ9B 4LRWA 3EA0A 1NBME 2H92A 2NO7A 4WBSA 1LY1A 3DDCA 1KKMA 3KJEA 5AR1A 5K8IA 2QP4A 1D9ZA 5JS7A 3LY5A 1E2DA 1GKYA 2P67A 2ZXUA 1BO6A 2XITA 4LBZA 4M4SA 4Q4AB 4LBYA 3THWB 2FNAA 1ETUA 1IONA 3MJHA 4UXJA 4HAWA 1FX0A 1UBFA 1CXZA 3TAHA 4LYFA 5JI2E 1GRNA 3TJZA 2OBLA 5FPSA 3PEWA 4Q5IA 2FN4A 1AS3A 1XF9A 4I1OA 3FE2A 1XJ0A 1P2VA 3OEHA 1E2MA 1EX7A 2J3EA 4P4UA 1KI7A 4GPTA 4TSFA 3TE6A 1R0ZA 5FBVB 1VYUA 4PZYA 2G88A 2AN9A 1Z0AA 5FR1A 4ZPXA 1CR2A 1E0KA 2VP2A 1KO1A 3A36A 3TSOA 4TTQA 4Q9HA 3O8CA 1KSJA 2V3CC 1M34E 1OXUA 1KZ7B 1X1RA 1XMSA 3QI2A 5F9HA 1W0JD 1RZ3A 4B43A 1KSFX 3LXXA 4F91B 4P0TA 1RRPA 4MRNA 5DO9A 1EFCA 4DSOA 2GVZC 4JMPA 3U3JA 1E2PA 5P21A 2K5UA 2HV8A 2TMKA 1D5CA 3THOA 4HUTA 4J0QA 1KK0A 1FP7A 4LPSA 2W58A 3K70D 1VKJA 1W36D 2FFHA 3QVVA 3UG6A 3HPRA 1JECA 4IDQA 2WWYA 1E9CA 2WJIA 2FSFA 2GJSA 4JYCA 4C0SA 2DFLA 1JR6A 4LWZA 4QBFA 2FGJA 2QMHA 2W00A 2JDID 3KQLA 2CNWA 1KKLA 1CTQA 1ESMA 1NI3A 3W6OA 3BIFA 3VNUA 1A1VA 3HYTA 2O0JA 1AKYA 1SVOA 2RGAA 3Q72A 2PEZA 4MKGA 1E96A 3OE7A 1GUAA 4DB2A 1EFUA 1Y3AA 4JLDA 4O0MA 5JS8A 3ADDA 5F2EA 3KL4A 1SXJC 4UNSA 2V4ZA 3NDPA 1VCNA 2PX0A 5FTJA 1VG0B 2PMKA 3U4QA 1YRAA 4NYIQ 4BFWA 2IW3A 4JL5A 5FTLA 3NC1C 2O8EB 2WWIA 2VP4A 3WNDA 1SKYE 5KPDA 2GJKA 2V7QA 1DS6A 4YMUA 4PC7A 4KYUA 2ZJAA 4OHXA 4Q7JB 4YDSA 4DIEA 3RAPR 2BKUA 4EFNA 3TVDA 3WNCA 4TWZA 5C46F 3K0AB 5AJZA 1XZQA 1XZPA 2QMEA 4JLNA 2WHXA 3D6TB 5G3YA 4BZXA 4HB0A 4URXR 5JI3E 1G16A 1OIVA 3NEYA 3QPVA 3ZD6A 2OXRA 2RGEA 3LFUA 1F2UA 4LJ4A 4UNNA 4TQUS 1UDXA 3FTQA 1RYHA 2DR3A 4LJYA 2VA8A 4A6XA 4X8LA 3I61A 3ZS8A 5KO2A 5F98A 1XEFA 4V0LA 4TTRA 4B74A 4V0KA 1I4TD 4KHZA 1KMQA 4OBEA 5GJWC 1KJZA 2IT1A 2BWJA 3DZ8A 4M8NE 4MUBA 4ZI2A 2HT6A 2JLZA 1VYTA 4XJXA 3MSXA 2HXSA 1HURA 4HDCA 2ZYUX 1W0KA 4BUJA 1TNDA 2AXPA 2A5YB 1CJVC 2WAYA 421PA 2V1UA 1GNRA 1E98A 5HTKA 3GPLA 3MGCA 2X1VA 4OJQA 3WMEA 2WJHA 2OO7A 1XU4A 2IUTA 3IPXA 3NBXX 4KXFB 4IXNA 4D0NA 3AV0B 2IF2A 2QTFA 3LBIA 3EA5A 3VX4A 1GRRA 3MLEA 3GEEA 5KUTA 1YZQA 2C03A 5JHGB 3U44B 1ZAKA 3E5HA 5BYKA 1W4BA 2ERXA 4M1YA 1W49A 2J0VA 5LD2C 4BLRA 1G7CA 3QIAA 4D2IA 3K0FB 1CS4C 2DCUA 4URUR 2LKCA 2WV9A 5KDLA 1E2JA 1FNMA 3QUSA 3RS0A 1KI1A 4LUCA 1UKVY 1HY3A 3KJGA 4Q4AA 3TLXA 3RANA 3LA6A 4H9GA 2O52A 3THWA 4AG6A 4GOXA 4OQFA 3QOFA 1E2QA 1N6HA 3P26A 1GITA 1WQ1R 3KFVA 2CHQA 4KSBA 2C9OA 4R71A 1UM8A 4TT3A 1Z83A 4IOJA 1N6IA 3JVVA 2OXCA 1QHSA 4CVNA 3VR4A 3OAAD 2RHMA 3FFAA 4B6FA 1CJUC 3H4MA 3U6KA 1QHIA 221PA 1W2GA 4QRHA 1OSNA 2QM7A 2W83A 5FOUA 4TLCA 4O25A 4MGIR 3BORA 2FG5A 2XSZA 4OQNA 1SHKA 1SKQA 4C2UA 4TMXA 3QKUA 2IXFA 1YZGA 4PHTA 3NBZC 2DYKA 5TV2A 5FOXA 3I62A 4S2EA 2Z4SA 1K8RA 2FZ4A 5KPJA 4A82A 1YR7A 3AVOA 2VLIA 4JVMA 5J4LA 4DB4A 1E0AA 1G3QA 4JBXA 2N42A 3CWZA 5ELXA 3G82C 1M1YE 2O8EA 1Z3IX 3HYRA 4UNRA 3WP0A 1V43A 1YR8A 2BVNA 2DBYA 4XVRA 1G1MA 1SZPA 5JJLA 4GSYA 4YONB 2VP0A 3I32A 4E5UA 1EFTA 2EFDB 1K5DA 1FW6A 1R5OA 4AYWA 3QEOA 4F38A 3QF4B 1JALA 3VR6A 5B64A 1HE1C 2H57A 3LLUA 5HCIA 3REFA 5FUYA 5CK5A 2O8FB 3FVQA 1FP6A 4JKYA 4DLSA 1VDZA 5EP3A 1KK3A 3PUVA 3EZ7A 4OK3A 5FUVA 4M9SA 1GZSA 1R6BX 1SVSA 5DIFA 3GLGE 4UXHA 5FTKA 1XTJA 2A5JA 4CIDA 3WYGA 2DB3A 1KO7A 4Q21A 2WIAA 1GSIA 4TZ6A 4V03A 2W2TA 5J47A 3FKSD 4AC9A 1IXSB 2IYWA 2OUKA 4GT1A 4Q7KA 1J70A 4DWJA 4GOJA 1CRQA 2WSSA 4PHGA 3B6EA 3CB4A 5FOVA 4DCTA 4DUGD 4GFDA 1GRQA 4YXWA 3ZQJA 1G6OA 1KAGA 4Q7LA 4DRZA 3K0AA 4HZUB 3B1ZA 1Q44A 4OHZA 4TYYA 2W0MA 5FBRB 2HYIC 2Z6VA 1XEWY 3ZVLA 2XB2A 3K09A 3BRWD 2CL0X 4TN1A 1AS2A 2PZGA 5DH9A 5K8LA 4Z1MD 2H7VA 1EFRA 2BKEA 2XGJA 1IQPA 2OLJA 1MABB 4GMXA 2AFHE 2FX3A 1XWIA 3W9YA 1WDTA 5JSZA 3ZD7A 4PHHA 4C0AC 3EIQA 3L0OA 5BQ5A 2ZRDA 2XNDA 3IKJA 2CLDX 3R7WB 2W6JD 1S4QA 1NMYA 3CNLA 1J2JA 3IHLA 3ZVNA 1XD8A 2X8AA 4JL8A 1KHTA 4B34A 1X6VA 3GLFE 3H2YA 3IBGA 5FFMA 2XTNA 4A15A 1GDDA 2OEPA 3KKOA 1YE8A 8OHMA 1JPNA 2ATXA 4HLQB 3T1OA 3EX7C 5AJWA 2G3YA 3K0CA 2QN6A 1GILA 4MYUA 3UWKA 5BWMA 1AN0A 4ITRC 3QQ5A 1R2QA 3SEAA 2N1BA 4G3XA 3U44A 1P2UA 4IXMA 4HAUA 4BFXA 4ERNA 1AK2A 1N6PA 2VEDA 2QTHA 4Q66C 1OFIA 1NF3A 4CEHB 2A5GA 3VU9A 4MDFA 1YR9A 2ZS9A 5GVRA 1CP2A 2ODBA 4Q48A 4E22A 2J7PD 3QBTA 1IN5A 5IK2A 4FCWA 1W44A 4W7SA 1Z6GA 1ZD9A 4MRRA 3D31A 1E2NA 1XD9A 1YZUA 2VQSA 1N6NA 3C7KA 1GL9B 4FN5A 4RZ2A 4GNKA 3UKDA 2YYZA 3VTKA 2J46A 3X1XA 1Z0JA 5C4MA 1MKYA 5DHAA 4QL3A 1NVVR 2R6CA 4NZYA 3Q7PA 5FL3A 3C4JA 1M2OB 1Z0FA 1P3JA 3WRXC 2Q3MA 3EZ2A 5BN4A 3QY0A 5L3QA 4QJ4A 3E2IA 5SZHB 3DO6A 3GJ7A 1OIWA 3CX6A 4X8HA 5DE3A 1GNQA 2ODWA 3CWQA 1T3HA 3SFZA 1VTKA 1H8HD 4EPWA 3BFXA 3I4LA 2DY1A 3KX2A 4WW0A 4JLMA 3A1WA 1SVKA 1ZJ6A 521PA 2IXGA 1IHUA 5G41A 3RRNA 1ZD1A 2FPMA 3IILA 4R7ZA 1E2EA 4V0ME 2QT0A 3K8YA 2I3BA 1RRGA 3DMNA 3LAWA 2EQBA 1MR3F 3BH7A 5TY0A 1N3BA 4YDHB 1SGWA 2IK8A 4QG7A 4WIAA 4US2R 4A4DA 2GCOB 1P4SA 2QPTA 1OW3B 2ZQ5A 3RVBA 1UBEA 2F1RA 2BM1A 3T5GA 3OIUA 1DAGA 1UFQA 4C0KA 4RKFA 3CIOA 2N46A 3W3AA 2ZTSA 4KBGA 5JEEA 3SE0A 3GLIE 3TAUA 2BJVA 3H1TA 4KVGA 1BMFA 4YQFA 1HEIA 3U6BA 1EGAA 2ECKA 2QP3A 4TQAA 4C3ZA 5HKKA 2P6UA 2HLDA 3MCAA 4ZKEA 4Z8XA 4Q1CA 5D3QA 1J8YF 1HT1E 1QVRA 3UIEA 4D82A 4KU4A 4NYJQ 2KI5A 4Q00A 4DEYA 4BRUA 5GJVC 4DLUA 3L0IB 4IKEA 3AM1A 4XSHA 2QQ0A 2IUSA 2OZEA 2O8FA 1CEEA 3T1VA 5E3HA 3EIEA 4DVGA 4I1VA 3U7GA 2YKGA 4JVSB 5FOWA 1E4VA 2BMFA 2RGNA 2Q3HA 3NKVA 1OYWA 4NHOA 1F3OA 1OPXA 3KJHA 1MOZA 1AZTA 3K0EA 1WP9A 1TQ6A 2ZRFA 4OK5A 1COWD 3ZZ0A 4TL7A 3B78A 3CNOA 3KZ1E 4FCTA 3OFND 2JATA 1US8B 2P3SA 3M6AA 5AUQA 1D8TA 5FI0B 4RD0A 2NO9A 5JHHB 5L3VA 2AKYA 4Q9JA 2AX4A 4DLZA 2ODEA 1JI0A 3QPWA 3RRZA 1OB2A 2NIPA 2R6GA 1X86B 2B21A 4IVQA 3D7MA 3VMFA 1QDEA 1KK2A 1GM5A 1QHGA 1W2HA 3NDBB 2VHUA 3VR3A 4Q9IA 1SVWA 3BOSA 5FL7D 1Z63A 3TBKA 1XPRA 3UMFA 1Q3HA 1Q1ZA 4G5RA 4F93B 3LRPA 5KSOA 2MSDB 4PZZA 3V4RA 1P60A 5DLQC 3U61B 1M7BA 1KI6B 2R6DA 4ESHA 4G0NA 1ZNZA 3SYKA 2CHVA 4HEJA 4B2IA 1E9BA 3IQWA 4RD1A 4B33A 3EZFA 4A2WA 1CBUA 4C0BA 3ONWA 4PC6A 3UMRA 2VYFA 4GL2A 3LVRE 1VHLA 3DZDA 2QPOA 2ZYTX 2KB0A 5KSPA 2JJ2A 4YLGA 2ZRKA 1P75A 4NP6A 3EZ9A 3SQWA 5TVKA 5G3ZA 2OV2A 4P33A 5JRJA 4BFTA 2EYQA 1K6MA 1HV8A 2WJVA 4R9UC 5L8VA 1KNXA 2HYDA 3JZMA 1S9HA 3C5HA 1VG9B 1XEWX 1DBSA 4TZ0A 1G18A 1AJEA 4IFEA 4JBWA 2QE7D 2NPIA 1U98A 1R7RA 2IC5A 1NLZA 3NBYC 2W0SA 4FMCF 2BV3A 4FMDF 4LV5B 2NO0A 4PQYA 1DAKA 3NBFA 1Z6XA 2ZI5A 2RMKA 4NDZA 1G4UR 3PV0A 4Q4HA 1R0YA 4QHTA 3VR2A 2BBTA 2RCNA 2KBFA 2YOGA 4MRSA 1Z29A 4N3NA 1GP2A 4IVRA 2CE2X 3TUJC 1KO4A 4EJSB 2IYQA 1OHHD 2CCGA 4O3MA 2W6ID 3FGNA 1P2SA 4Q4JA 1V5WA 1P6XA 1T3SA 2ZAOA 2DFNA 2D7CA 3C15C 1E69A 3CZQA 3I5XA 3KUCA 3DVLA 1U0JA 4LHYA 2JLRA 2NO6A 1OIXA 2IYUA 1T0JB 3BH6A 3TUIC 1G64A 2GKSA 5C2JB 4B75A 3CPJB 4D0GA 2QBYA 2YZ2A 1FL9A 2F1HA 2CJWB 2MMGA 2OILA 4LK2A 3TQFA 2B8WA 2P5SA 3RS7A 1G8HA 2BIFA 4GP7A 4XTCS 1NNEA 4BPBA 1E1RD 2VP9A 1FFHA 2R65A 3RC8A 1QHHB 1E2IA 4KO8A 4NCKA 3QE0A 2ZR7A 4K46A 1OYYA 2KSQA 2GZDA 2FMXA 1TL7C 4DCUA 3CF6R 3A58B 4PO8A 4PTLA 5DI3B 1F5NA 4HLUC 821PA 4B3BA 1SVIA 4BFVA 3GJ5A 4NYMR 1II9A 5JCPA 1ZNXA 5H68A 3ICEA 2B6HA 1NLFA 3GLHA 3TUZC 3FPAA 4ILEA 1KDPA 3KXKA 1CF4A 1N5KA 4CDGA 4B3GA 1JNYA 3DKPA 4PPFA 2ERYA 4FMCB 3PCRB 2F43A 4FMDB 4C7OB 3S1AA 1UADA 1ZM2A 5A5GA 3ICQB 3Q9LA 1D2MA 4RCZA 3AF3A 3A1VA 5EP4A 4HUQA 1GL7A 4B6EA 4BLPA 3ND8A 1KYIA 3WYAA 4PZLA 5LD2B 1N6OA 3MUFA 4JVLA 2QSYA 2KWIA 3ZJYA 1XCMA 2QENA 1KI9A 1N5JA 2ZS7A 1IAQA 3WP1B 2DPXA 4PANA 4XSGA 3T34A 3OIYA 1G17A 2I4IA 2QP9X 4EDHA 2J1LA 121PA 5CM8B 4ZV4A 4DXAA 4QM6A 2ZE5A 1XD2B 4AIIA 3NXSA 2REOA 2EFHB 2ANCA 1IN7A 2AFIE 2AD5A 4LJ6A 1XB2A 3THXB 4NMMA 2IYVA 3X1ZA 1E2GA 1G7TA 2QAGC 1Q1EA 1PJRA 5HCNA 4UJ5A 4PC3A 2Q9AA 2GXUA 3Q3JB 1FUKA 3I3SR 5KNDA 1OKKD 4KLNA 2RGBA 4CT5A 4EIWA 1VIAA 4I1SA 3L0PA 3NVAA 4PPQA 3EW9A 5DYGA 3O8DA 4CEIA 2ZANA 4TL9A 2AXNA 3O47A 1CLUA 4NBSA 4M9QA 2JLVA 4BEBA 4ASUA 3R8FA 4HDOB 3I8SA 1CIPA 2X2FA 3NG1A 2DWOA 4JL6A 2IA5A 2ZI7A 3PR1A 2AWOA 2IEYA 3SHWA 1W1WA 1XTQA 3DOFA 3FMPB 4GOKA 4B73A 3I73A 1R4AA 3A8TA 2AWNA 3QF7A 1ODFA 1R5BA 3FMFA 4NPHA 4PSKA 4TYPA 3WHKA 3OF5A 1RC8A 1W47A 3BBPA 2A7QA 2J5XA 2H17A 2FFBA 3OEHD 5LBIA 4HAZA 3CM0A 2JIZA 2BJWA 3ASYA 4TSFD 1CULC 3LNCA 2VH5R 4IOLA 4FMBB 4G1UC 2RH5A 4MRVA 4KVAA 4E03A 3DM5A 5E4FA 4RKEA 4LC1A 1E1QA 3ZIAA 1DARA 4GZMA 4DLVA 3KB1A 1J8MF 4P4SB 4QXAA 3THYB 5AUOB 2VTKA 1UEJA 1XCGB 3D8BA 1VG1A 2HF8A 3B85A 3KTAB 4AKGA 2XZLA 2J0UA 3T06B 4Q1FA 4JLJA 1UPTA 5IRCD 1GWNA 2NG1A 2XZOA 1H8EA 3H84A 3B5JA 1NLYA 1NKSA 2ZSAA 5JEDA 5FUXA 5EUQB 1UKEA 3NHAA 2XOKA 5G53C 1XRJA 1SXJA 3MWJA 1CJTC 1IOZA 4EQ6A 1Q1QA 3HJNA 2OFWA 1R0XA 4LPKA 3A4MA 4PC2A 2OE2A 3PITA 1T91A 3TR5A 4H1VA 1AS0A 2J0SA 3SR0A 1U81A 1T5LA 2B7BA 4B2PA 4BASA 1L8QA 2CJWA 4E09A 1NP6A 1U9IC 4KFUA 4A0GA 2NO1A 2BBSA 2YOFA 3LWNA 2WICA 1SULA 1LNZA 1JAIA 1IN8A 3HR8A 1NSTA 1SKYB 2FSHA 1E9AA 1VHTA 4EJSC 1ZUNB 4A2PA 2IHYA 3H86A 3AUXA 2QRZA 2CNWD 3GJ3A 3QKRB 4Q47A 3OEEA 2IYLD 5CYOA 2J0QA 5EE5B 3OHMA 4M1WA 1T6NA 3BS4A 2O5VA 3OE7D 1OE0A 4TLAA 3SJZA 2ZUCA 2PBRA 5J4YA 1OB5A 4MGKR 1DAHA 5DI3A 3K70C 1W36C 2F3TA 5EXPA 4A92A 2KJQA 3W8NA 4DHEA 2QT1A 4DLYA 2D2FA 4TYQA 3ZZTA 1ZYUA 2IXEA 3EZ6A 1SVMA 4BFZA 4C9BA 3EASA 4M1KA 4W9MC 5BN5A 3EIHA 2O8BB 2GDJA 1A7JA 1NVUQ 4WXRA 4D4KA 4C7OA 4TMZA 2WKQA 3DPUA 4FD2A 3CH5A 3TSWA 4B3DA 2RGDA 1E2KA 2EFGA 3NH6A 3SYLA 1KDRA 4CW7A 3AF0A 2HJVA 1M74A 1NKTA 4JT4A 1G3RA 3VNVA 5FBLB 4U00A 1I4DD 5FOTA 3P1JA 1TF2A 1BS1A 1ZCBA 2F9MA 1NN0A 2VSOA 1MO4A 1JXOA 4DLXA 4GP6A 3EG5A 2XJ4A 1Z47A 3TGPA 3MWKA 4NCNA 1JR3E 2GAOA 1NBMA 4Q9LA 3Q8XB 1FUUA 1MO6A 3IIMA 4D6PA 2ZEJA 1EFHA 5CK4A 1ZUHA 3VKGA 2R8RA 1W0KD 2F3RA 2BM0A 3C41J 5FTMA 1NMXA 3THXA 3W34A 5TDHA 4URVR 2WPDD 1NVVQ 3ZDQA 4M22A 4QFMA 1RJ9A 2IYZA 1JQJC 3SBDA 1DPFA 1F60A 2FJUA 4PO9A 5UKDA 1W5TA 1OF1A 2QROA 2ZJYA 2JEOA 4G01B 2WVJA 4G5SA 4MKFA 4JLKA 3EPKA 1GL6A 4LV8B 1NVWQ 4G5QA 1X8LA 5CLQA 4ABYA 4ARZB 4DSUA 4TTPA 4BLQA 2IYYA 2IS2A 1VIYA 3BJIC 1S1CA 3TQCA 1ZVQA 4AD8A 3QXJA 3IEVA 2ZRAA 2IYSA 1TPZA 1IJEA 1JAHA 1L4YA 1N5IA 2GJ8A 2R6AA 4NONA 4LY6A 1PLKA 1DTSA 2GJAA 3A6PC 4PQFA 1KY2A 1Q3TA 2BDTA 3K9LA 3NHBA 1BYUA 2YOHA 3O8BA 4TT3D 4UNPA 5EP2A 2PCJA 3FHOA 5JBQA 1ZIPA 2HJGA 5FPTA 2WOOA 2X19A 3L43A 4BLTA 3IO3A 2FGKA 1X8KA 2C2HA 3V4FA 2P6RA 4P4SA 5CDFE 4IEIA 4Q1EA 2ASEA 1IY0A 3KTAA 4LHXA 4WZAE 2XSZD 3QJYA 4Q19A 4GI7A 4ZDWA 3ZGXA 1PLLA 4AG5A 1WRBA 4RJLA 1EX6A 3TR0A 2J45A 2WWGA 2ZI9A 5FUWA 1BOFA 1ZM7A 5HPYB 3FKQA 2E1RA 5TB5A 3LLMA 4OKSA 4D0LB 3BXZA 2GETA 2ZITA 3B1XA 3MG9A 3T15A 3LO5A 3K1JA 4A9AA 2QI9C 4DZZA 4LHZA 1MRNA 1E9EA 1Z5ZA 3GLGB 4RFSB 1WE2A 2AD1A 1P7CA 4PO1A 2WWXA 1WXQA 5D3MB 1G8FA 3B1YA 1JQLB 4DEXA 2G1JA 4I1UA 3B8HA 3RHFA 2QA5A 4G5GA 3ASZA 3UANA 3WMGA 1U2RA 3IGFA 2QU8A 1DEKA 2OFXA 3WRYC 4M1OA 4HATA 3TIFA 2BMEA 2ZE7A 2EVWX 5JFGA 5KYKA 3K0SA 4AKHA 4M0LA 2ONKA 1N0WA 2QPAA 1ZCAA 3VAAA 4FIDA 2GAAA 1TEXA 2DWPA 4OQMA 4PPNA 4A1FA 1XTSA 1VG8A 5EE9A 5EE0A 3DKVA 2VRWA 2WSSD 1G8GA 4MA4A 4Q9KA 4RD2A 4UKDA 2CCJA 4TLEA 1JR3D 5H1YA 4CF7A 4YXWD 4KCGA 1KJWA 1XBTA 1U8ZA 2DHRA 2HT1A 3RS5A 2ZJZA 4NKRA 5B2ZA 4OHVA 1UDWA 4MGZR 2ZYVX 2C95A 5AUPB 1T9HA 1U94A 2WKPA 1R8SA 3GFTA 4DC9A 5JZVA 1WB9A 3GLFB 1X3SA 5H70A 5GJBA 2QUZA 5FR2A 4HYYA 3VHLB 1EFRD 1O87A 2NZJA 1TQDA 4L16A 4U02A 2OM2A 2VO1A 1UEIA 1Z0DA 3FB4A 5KHOC 5HZHA 2GBLC 4KODA 1RIFA 2FSGA 2IWHA 4XTRA 1BH2A 2OCYC 4RCYA 5EP1A 1BKDR 2XNDD 1IM2A 2CL7X 3Q5DA 4M9XA 4N0DA 2Q9CA 4IRUB 1YZTA 4LBWA 2IS6A 1CJMA 1OFTA 2ZM5A 2XTMA 1CU1A 3QKSB 4ESVA 1DO2A 2O8CB 1CR4A 1WBDA 3AVXA 4JJKA 2WJJA 4DLRA 3A4LA 4CEJB 1OH6A 4RD3A 3PEYA 3W6NA 3K0FA 4A8JC 2NMVA 2O8DB 1BIFA 2WJGA 2VHTA 2Z83A 3CNNA 3JZAA 1XMVA 5HZKA 4GBMA 4F4CA 1Z6YA 1YKSA 4W5HA 2ZRMA 3CRMA 1R0WA 4R2HA 2GRJA 2OHFA 5C4GB 4ARZA 2EFEB 4AURA 4IVPA 3BAFA 5IK2D 3MWLA 3I72A 5SZJA 2PX3A 5EUMA 3RABA 4F4IA 1JB1A 5BN3A 4NCIA 3B82A 1YZLA 3SDZA 1MO3A 4C0HA 4QGAA 2CLSA 2C9CA 4M1TA 1D9XA 3O8RA 5G40A 3H0KA 3PJRA 4KV9A 4CEIB 4WOPA 2WWFA 2FU5C 2G0TA 1ELOA 1DVRA 2QM8A 2A30A 3AVWA 2YV5A 3EPLA 1JJ7A 2V1XA 1RE0A 2D3WA 2FA9A 3ADKA 2HDNB 4UJ3A 3SS8A 4PR0A 3TRFA 4OHWA 1TEVA 2PEYA 3GLIB 2CK3A 5FBQB 2H16A 4KAXA 1II8B 3A1SA 2BOVA 2FE4A 4QGFA 3GMTA 4L15A 5KU1A 4NYMQ 5L3SB 3U60B 1G7SA 1EWRA 2NQ2C 1CRPA 2FOLA 1EWQA 2LKDA 4O2LA 4TMKA 3QEJA 2EYUA 1OFUX 2XTZA 5M04A 1YQTA 4TL8A 4RZXA 4NL4H 1Q1BA 2CMKA 3RNLA 4TQ9A 1GTVA 3VR1A 4Q01A 4IOMA 4IFBA 1Z0IA 1OH7A 5LDDC 3DOEA 1LTQA 2JAQA 3QPUA 4IDOA 3LXRA 4XD7A 4QGGA 3QF4A 2SHKA 3TW4A 3GLGA 1AM4D 2FFAA 1BMFD 1J7KA 1ZBDA 3IUYA 5JCZA 1NY6A 2HLDD 2YVUA 2IL1A 1GFIA 1XTIA 3AKDA 3BERA 3QXSA 1G8PA 2C98A 1G20E 3EPHA 3ZQ6A 1YVDA 2C96A 2ZPTX 2F1IA 2HF9A 4XWAA 3OIWA 1C4OA 1EK0A 1S1MA 5AJXA 2CL6X 2V9PA 3LBNA 3CX8A 4PPGA 3RSLA 4II7A 5KTYA 3WMFA 2RGCA 4ACAA 3EC2A 4KFTA 2CVFA 4EUNA 4Y0VA 2ORWA 4BRWA 4TLBA 2CDNA 2QAGB 4EPYA 3RYTC 3QXHA 4QBGB 2C8VA 4HZUA 5KDOA 2QL6A 4CGZA 1YRBA 2IEZA 1HE8B 4NCHA 5L3RA 3I5YA 3BC1A 2FF7A 1KZGB 3AP1A 3GQBA 2IX3A 4KJZA 1XNJA 2LWIA 5FI1B 4D4MA 4D4LA 1X1SA 3P4XA 4YMTA 4H1UA 1EXMA 5AJVB 5JLJA 4LBVA 1KI3A 4B48A 4OK6A 4OQXA 3EXAA 2G0NA 1QRAA 4WZBE 3CRQA 1MABA 3QENA 3GJ4A 2HCJB 1Z28A 1R10A 1Z2CA 1KO5A 2HEIA 3AVUA 1IN6A 3ZH9B 3TSZA 4I81A 4JKIA 1XXHE 3GLFA 1YZKA 2DWQA 4AI6A 3PUZA 3X1WA 1QVAA 1E2HA 3CPEA 2HCBA 4JJZA 3R7WA 5E95A 4OL0A 3RRMA 1N5LA 4LHVA 5IHPA 5FPYA 2GHIA 4X8MA 2KBEA 4KBFA 5EQTA 3EPJA 5HE9A 4BECA 5KSZA 4DCSA 1P2TA 1RFLA 1NN3A 1WCV1 3B9PA 1MH1A 1WBBA 4JT2A 4ZIRB 4Q1DA 4RD4A 4Z8YA 1XX6A 2O8CA 1F2TB
chains in the Genus database with same CATH superfamily
2R4QA 2Q3CA 3K9BA 4MUXA 1BJKA 5D00A 1NVXQ 5JC8A 1OUMA 1LBSA 1Y8RB 2QMQA 3COYA 4KSCA 3OQJA 2I2WA 3N6RA 5CITA 3W6PA 1YI0A 3HCEA 4JU8A 3DVQX 4N1AA 4ZO6A 2EJWA 4ZANA 2XIQA 3JQ8A 3ITDA 3NHFA 2QTVB 5TQJA 2G07A 1L6IA 1V7ZA 2V5UA 3CRVA 3DBLA 4GPAA 4Q1AA 4PIVA 4FWTA 4J0IA 2CNDA 3KQWA 3PVSA 3P2YA 1PI3A 1AG9A 1NIPA 3IPYA 5EUCA 5F5XA 1VCHA 1A27A 1GKIA 2OXFA 3CMCO 3GROA 1SBTA 2UKDA 4H2DA 2ZBRA 3T35A 1MEOA 4CRWB 2ZI3A 3AKEA 3A9WA 4GKVA 4A5OA 4NXNB 1GZ7A 1KTVA 1AGPA 1C8LA 1MX5A 1ZK1A 2V54A 1C1YA 3GEHA 1UPXA 4NENB 1EUCB 2CXPA 3QHPA 4LYDA 4TQGA 4V0MA 1I36A 1A4IA 3JD1A 4YRGA 4HUJA 2GK6A 3H4TA 4RK0A 4L4UA 2DLNA 3ZWWA 4F1JA 2WZDA 1QYWA 4FN4A 4RVSA 2FR1A 4U3JA 5K5EA 1ESNA 2BD0A 4II2A 3G5MA 1NHGA 1YVRA 2VUTA 2VHZA 4XGIA 2C4WA 2X7XA 3NRJA 2EBWA 4RIFA 1HQYE 3EVGA 3GFSA 2GCOA 3BT7A 1L5FA 1E6CA 2ZU6A 2BFDB 3PI6A 4R98A 5DP2A 2GXAA 2NU7B 1OOEA 4TMVA 4LYJA 5IKMA 3EOZA 4U7DA 5ALJA 5KWIA 3MZ0A 2JAXA 2RFLA 2ZYRA 4UULA 2HDOA 4FHCA 3UJ3X 4OYLA 4TYMA 4L4YA 5DCWA 5CTJA 2PKXA 3DE6X 1J09A 1C3OA 1KMMA 4FJ2A 2VQDA 1Q20A 4HS9A 3SKVA 2H18A 2R8EA 1V8OA 3PFCA 4G5YA 4WMLA 3RT9A 3AERA 3FR8A 2WJ4A 3JPYA 2XDQA 1QFYA 2B83A 4EITA 1NUTA 5C1BA 1PFUA 3TMKA 2KLBA 2W2LA 2QQGA 3KK0A 1GZHB 5KSWB 4HXGA 1YRQA 4D4GA 4LQCA 3CVWA 4R9RA 1XMIA 4EKDA 1XWFA 1Y37A 1S9DA 4LY0A 3UVEA 3UXMA 2IWRA 5KC9A 3MQ4A 5BWBA 2VSQA 1EA5A 2FMKA 5DNVA 2VQFB 1Q0LA 1TTHA 1FBTA 3P0JA 1DG1G 4I50A 1EUZA 2JHGA 3I9JA 1XKXA 1YZFA 2JFQA 5F51A 4C3OB 1MJHA 3DM9B 4CU5A 4FSXA 4RPGA 1LX7A 3ECCA 5J5AA 2CJPA 4G2TA 2JI4A 5CTAA 2YNMA 1TTPB 2JFBA 4LC0A 3VDQA 4OLHA 1UJBA 3L8FA 5ALNA 2WB4A 1PVOA 4KC0A 5IJ0B 2WYUA 1NRIA 3NM4A 3PEVA 3DEKA 1SO8A 2EKDA 3NFRA 4GZ3A 1FMJA 4O02B 4Q05A 4HWSA 4YUAA 3A37A 2ZVPX 1EZ1A 2F00A 3HXPA 5IZ4A 2AEEA 3FHTA 1E0JA 1US8A 4I55F 1QG4A 3H19A 4KACA 1DUSA 4KQGA 1XIVA 2XT6A 4LJ8A 4O4LA 5CH8A 1QB7A 1XLVA 5TVGA 1QORA 1KU0A 1Z37A 1UZAA 3IDQA 5DCUA 3HKBB 4BFLA 1KDOA 2X6QA 3EFEA 2A86A 1QR2A 4OHYA 2MSCB 4AJ4A 4EYOA 3WMRA 1WETA 4YAJA 3VV3A 1F2UB 4HD8A 4O59O 5BR1A 5B57C 2CHUA 1FP2A 2P9EA 3QYPA 3EGDA 1HQCA 1NPYA 4IUCS 2WP0A 4NBLA 4ZOEA 1PQ4A 3GJXC 5G4KB 4CMCA 4PHFA 2JFOA 5LLSA 3C2QA 3HWWA 5DXJA 1BU5A 2WMDA 2JIOA 3WGTA 5BPHA 1KYXA 1V16B 4I1RA 4Z5XA 2RI6A 3KZMA 1I2AA 3SC3A 4XXHA 5K4AA 1EDZA 3L1UA 3LUPA 4BE4A 4YXFA 2VN8A 3FMGA 5KJ6A 4FFWA 5KYNA 1KI6A 3DHNA 1LJUA 2IH4A 3Q7IA 3CC8A 1IXZA 4OG2A 3TZKA 4JENA 3DH0A 3MQ2A 4B32A 4XX1A 3NNSA 1M7GA 3E4CA 2F48A 3LBHA 3U4IA 1OWOA 1GQFA 2Q7DA 2PS9A 4IEFB 3DL0A 4MXDA 1VL1A 3LPAA 1RXIA 1J1UA 3SM9A 2O8NA 4PLTA 3RRYA 3H9QA 3U1BA 4C04A 4Z7QB 1KOFA 2V7BA 3IA7A 2WIBA 1VYHA 2DPLA 3PA8A 2ZWAA 1NC1A 3K96A 3NEPX 5CB8A 4HH0A 1SXHA 1T8TA 4KN6A 2P4QA 3EISA 3TOVA 2J6BA 3DWGA 3NBAA 3DT8A 3QLVC 1QU3A 4HMOA 2EBFX 1ZW6A 3IV9A 2GFHA 2OAQ1 4I3HA 3H7IA 1XZJA 4OKIA 2KS6A 4C43A 3P45A 3H9GA 4H6PA 4JLAA 4XIGS 2A4MA 3C6QA 1TU3A 1QGAA 2FZVA 2GJ9A 3I9OA 4J91A 1E7QA 1E3EA 1EEXB 5L3QA 4ML3A 3MHTA 2ILVA 4WY5A 3DEIA 2J87A 2VT2A 3M6VA 1EINA 4K81B 1GPBA 1VGRA 4MMYB 3VQTA 5CBPB 2IIVA 3PEEA 5HQ3B 1JYFA 1NZDA 5IJZA 1K0FA 4HBGA 1ECFA 1PR2A 4AIRA 3MCVA 1IEQA 1KOJA 2JAPA 3X2EA 2NV6A 1Y3CE 3RJMA 2HN9A 2YR0A 1N2CE 1W0JA 4D43A 1KQFA 2WZQA 3ZGOA 4R3NA 1BEZA 1P62B 4KG7A 1JYEA 1EFDN 3A6ZA 2OUIA 4EJSA 3B9BA 1O94A 3WI7A 2FYTA 2SCUA 1DCTA 5DLPA 2P6OA 4GBED 1VCIA 1L5RA 2O2EA 3EZGA 5CIQA 1UAAA 1DJPA 4MYCA 4JLVA 7ABPA 3ECSA 1COZA 4UDXX 1FC0A 4JIMA 3GGPA 4DMLA 4D9CA 2BBWA 4K87A 2XOKD 1U63A 2HI0A 5HKLA 5HDBB 1SXJD 2ZYIA 1DIGA 1JG2A 1DHRA 1K9SA 2FFQA 4BJ3A 4LXHA 2XNSA 3U5TA 4TLLB 3G02A 3A4NA 2FEPA 3EMVA 1YJ5A 1OH5A 1I94B 1C14A 3NT2A 2DM6A 4EP1A 1GA6A 5JMOA 1N8SA 2JJQA 4MUHA 1RLIA 1RP7A 1ZM4A 4DDWA 5C52B 1X1QA 1OVMA 2ZJ2A 4PVDA 3STWA 4HVLA 3PDIA 4D25A 4HVAA 1DO0A 1VKZA 5LIPA 4REOA 2X0KA 2WLTA 1XL1A 3P20A 1QGYA 2PN1A 2ZREA 4IHQA 5CT5A 1QHHA 1F8GA 2GWHA 3KXIA 3G5UA 3I4FA 2B5MA 3BQNB 3GAFA 4EFLA 2A94A 2Z2YA 3RGGA 1OQAA 1D4AA 2I71A 4PAMA 3W2FA 1TMGE 5CMLA 2X4IA 4I19A 2Y93A 3L7BA 2YW2A 3SY8A 1W25A 1LBTA 4BWYA 1II0A 1QFZA 3DQPA 3M9WA 4F45A 4JXZA 5FORA 2E7ZA 2IOFA 1PN3A 3AB3A 4F3NA 4IDEA 4KHPB 3LDUA 2WJYA 2GK7A 1LH0A 3CE9A 4M8SA 3UHPA 3NHSA 5IYZF 1NR1A 3G8BA 2A58A 2FR8A 3RVKA 4Q3EA 4P2BA 3U39A 3KXLA 4CKWB 1FS6A 4YJDA 1R0CA 2WTMA 2ZJFA 3WGJA 2OSVA 4F92B 2IYOA 3C8UA 3M3PA 4AXBA 4GVPA 1QP0A 2HR1A 4XZ3A 3KD2A 1I7SB 4WAUA 4OMFG 4AY6A 2A0WA 2UYCA 1YQQA 4PONA 1KC1A 1PZFA 3U0VA 4Y98A 4ERXA 1PLJA 2Z9CA 2DEUA 4GVLA 1Z0SA 4BU0A 2GBFA 3H75A 3MJ4A 4KWCA 3I9LA 3LY9A 4WK0B 2JB9A 2YZGA 3TQHA 4CTMA 1VB5A 2H5JA 5I5EA 4A8JB 3MRXA 1UAGA 1RWWA 3AR5A 1D1SA 3DXZA 3GCZA 3O2NA 1YQWA 3O73A 3O9ZA 2OPBA 2IHUA 2X23A 4J1TC 1LF0A 4CIWA 4BZQA 3BE4A 3PHJA 4J90A 3QWBA 3EI4A 1OJLA 3KXPA 4O2RA 4P22A 4M8LA 2Y1XA 5HEKA 5CFMA 4OF4A 1QG2A 3PEUA 4B6RA 1M5TA 3AESB 4NE2A 5AKJA 2FP4B 1PNVA 1T2EA 3HB5X 5JSZB 3JU3A 2A14A 3NWJA 1UWCA 3T12A 2OO5C 1PR5A 1AU9A 1UBOS 3GYGA 3RK1A 1KEVA 3AQ4A 3MTBA 1MB0A 3HBNA 3KPVA 4KKXB 3LHKA 1L7VC 1BYIA 5AK0A 1I0ZA 5C0OE 4F3CA 1QHYA 1W85B 5JU6A 4ETIA 3GUUA 3PQ2A 4DKJA 3QELB 4YBZA 1BRMA 2ATVA 3QSYA 4AZWA 3X1MA 2JASA 4ZEXA 5FWXA 2N1MA 3VDNB 3FX2A 2GCPA 4YIHA 2YXPX 3ET5A 2Q5HA 2WPDA 3NPAA 2QMOA 4HB3A 4C6SA 5E6SB 1WPGA 1Z4QA 4WH0A 3ZS9A 2WTUA 4NOLA 4S2UA 4XR9A 5BQ3A 4JLOA 2OCBA 4BIMA 3J80A 1T0HB 5CLLA 1UT6A 2J33A 3VMMA 1R3DA 4BLWA 4TL6A 4GDFA 3G2OA 1CK4A 5G4LA 1M34A 3UHAA 4ZI7A 3HP4A 3GXBA 4OGLA 1PFVA 3AUJB 4P5DA 2QG4A 2VZ9A 4P32A 3RKUA 3SOPA 2C57A 2D1TA 5JG7A 3VU9B 2H8KA 4RY2A 3F3KA 3G0HA 2EGUA 2ZUBA 4LX8A 5DGHA 4UHBA 2CKDA 1A0OA 1A8IA 4YRFA 2ZSBA 2HC9A 3FCCA 4HWKA 2C4KA 2RGRA 2CEAA 1ZGBA 1MIOB 1J99A 2WKSA 3QX9A 1NJFA 4K26A 3U49A 3HB7A 4L7QA 4JUCA 1CYEA 2BEWB 3O38A 3AONB 3UK6A 1IN4A 3OAAA 2IYNA 3Q3VA 4ZHQF 3H6KA 5IULC 4BQNA 3L6EA 5B3LA 5CM9C 4BCDA 1NM5C 5LYJA 3NTVA 4PTZA 3UW1A 4I5DA 3TNYA 3ZHTA 1O5OA 4WESA 4EW6A 4P54A 1U0LA 1OXKB 1SC1A 2HSZA 3PC7A 3O6VA 3U3OA 4H3SA 1GSHA 1R6TA 3FUCA 4HGRA 3D1LA 2FH5B 5LNK6 4KQEA 4RHEA 1A8UA 4UCQA 3ZWMA 3OBBA 1GVNB 2ZBEA 3EC1A 4G8DA 4UNIA 1LVHA 1QFJA 3K5IA 5EJFA 4MWCA 5MDHA 4DPKA 1SWVA 2OCPA 5EGNA 4AY4A 2Q8PA 2QLFA 4KE8A 3F7MA 3ITEA 3G23A 5AKYA 3VFDA 1SUAA 2JI9A 5K3BA 2ZBVA 1TUGA 4E54A 2Q9UA 4KE6A 2HPVA 5IXYA 1Q21A 4BLOA 2PZMA 1CUVA 1I2ZA 3U7FB 4TM8A 3ASVA 1EUYA 1RXSA 3DEFA 3AEUB 4D9GA 3F2VA 2P68A 5A02A 1EFAA 1OXBB 3N07A 3KOZA 3G6WA 3RYIB 3NHWA 4LXXA 4NOKA 5ECGC 3TLZA 1V7OA 1FSZA 5B58C 2XZPA 1JQDA 4QXRA 1PWHA 1XCLA 3WGNA 4EPTA 3SWWA 1DADA 1PR4A 2O2ZA 5F2NA 3HCAA 5I9BA 3TPZA 2ONJA 4MQMA 1CKEA 1DAFA 1Y1SA 2CFIA 2X77A 1ZC4A 3PRHA 2DT8A 4W7HA 5JSFA 3KQVA 1ZNWA 2C9YA 4OD0A 3SOZA 4TM7A 2YJTD 1V8ZA 2IELA 2C5AA 3HN7A 4L27A 1V9SA 2VG8A 3TH5A 2WWHA 1USKA 3DYVA 3RGWS 3EUFA 4CKEB 2IIPA 2GBLA 2GYWA 3ASUA 5BMVB 3NMUF 1RAIA 5IC4A 1ESEA 1YBFA 2WNIA 2VBCA 4OQPA 5H59A 4KLZA 1T1EA 3ZZUA 4IPTA 1FZTA 6LDHA 2P2YA 3G2KA 2O8BA 1IL0A 3CR3C 3AMVA 1TYDE 4M86A 1JEOA 1KWKA 1PQYA 4RE5A 1LSOA 1QH1B 3WSWA 5HHTA 1ZIXA 3TRHA 3K6SA 3VBCA 1R5JA 4LSZA 1J07A 1FFBA 1I6LA 3CBQA 4HNRA 3BRWA 4L6IA 4KPEC 3F6PA 2NZYA 2FPGB 5HF9A 1RIIA 4B79A 2AOUB 4L78A 4RNDB 4F4UA 5IC6A 4QASA 1JZQA 4Q4CA 3C97A 4ADSG 3ZE0B 3HDYA 1JHZA 3KQPA 3PICA 3P2KA 1UEXC 1GPMA 2Z2KA 4NYIR 3WFJA 1GGFA 3GRZA 1G4HA 4XWOA 1ATIA 1RCUA 2AK3A 3CZ9A 3L6DA 4XEUA 1JQBA 1ZD4A 3L2OB 1Q6YA 3CY6A 3NIBA 4OBWA 2VBIA 2ZIXB 3AKYA 3MAAC 4WT7A 1G0NA 3M4XA 2FQXA 1D1TA 3IAHA 3ISTA 2ZULA 2INGX 1AQ6A 3ORFA 3AVQA 1GGEA 1ZRSA 4R1TA 2CXSA 1A9QA 3JCZA 2OPHA 2VYNA 1ISHA 1ZD3A 3GPCA 4FKBA 5AVYA 1A9XB 1WSWA 1HRKA 4FDTA 1ZUWA 4TYNA 1ACLA 3OPYB 1V4PA 1QIIA 4ID9A 3HCCA 3W2TA 3E58A 2OWDA 3BIJA 3SF8A 2VHQA 1Q77A 4L8WB 5H81A 1JUDA 2QZ4A 3Q3CA 1O6GA 1ILWA 2QD1A 4E2WA 1TUEA 3AF2A 1KR5A 2FMHA 1PHPA 4EUEA 1JKJA 1TM5E 2NU9A 5AKHA 5TPZD 3KDPA 2C7GA 1VCMA 3AKCA 3C85A 3P4YA 3RU2A 1YQEA 4B35A 2EBUA 3MVEA 4DJTA 5G0TA 4BO7A 1SCDA 3F6YA 3EH2A 2F1OA 3A7EA 1GV1A 1RMQA 2ZJ8A 3CG0A 2Z5FA 4MVXA 5EA2A 4EM6A 2X0DA 4WFQA 1KEPA 1BGVA 2XAUA 3GBPA 5DHSA 3ZDFA 1U65A 5LKAA 3NTLA 2IF0A 3O2JA 3G5LA 1J5EB 2YINC 1XAHA 1SG9A 2ZWPA 3TL2A 1B6TA 1ZM3A 3S2SA 4DLTA 2Z04A 1DB3A 2QRNA 1PVVA 2ZRIA 3OJEA 3UC5A 1AZSC 2Z09A 3MUEA 2C5LA 1EWKA 2Y76A 3E8XA 1ORHA 2B8JA 3GNTA 1U02A 2OBNA 1TU4A 4LJ5A 1GIAA 5E6UA 4LZWA 1KSGA 3DYBA 1RHKA 3KT8A 4DAEA 3I28A 2IPOA 2ORVA 5DYYA 2F9FA 2Y8EA 4NPCA 1C3VA 3VYWA 2IZ7A 1BX1A 1TAHA 3GDWA 2SKCA 4DYDA 4EO4A 2DF8A 4CYMA 3WA6A 1BE8A 2EFCB 2BRUC 2P90A 4MRPA 2EW1A 3RDPA 2FZ5A 4D3ZA 3GRRA 5F9FA 4NU6A 5AQ1A 3S1SA 1B8UA 1N0UA 3BSSA 4ONEA 3AETA 4LRTB 3WMXA 3KYDB 1PK8A 5CFOA 3X2FA 4D7AA 1FFAA 4Q7MB 4EG3A 3PUYA 4B5KA 5JJIA 1KMHA 2UYOA 4Q9AA 1ZJWA 3IEIA 2G36A 2X9QA 1FYXA 3Q3EA 3IP7A 1WDMA 2WQ7A 1LEHA 1SXIA 3EXFB 4RHXA 5GINE 4BEVA 3A0RB 1H66A 5AVTA 4YPFA 5HJ2A 1KA9H 1I5OA 1EMDA 1SEPA 1ZVJA 3Q3HA 4JP5A 4RFSA 3V8BA 1FFXB 2HCRA 3EEFA 1RWMA 2K7ZA 4BVBA 1WLSA 2C04A 1L4GA 4J0DA 3JRWA 3F6BX 5PGMA 2KM1A 5D3MA 4CQMB 1L7XA 4ON9A 2BCJQ 3K31A 2QW0X 3CFYA 4N6GA 4HQNA 3PE3A 2GPYA 5D6OA 3C3EA 5JDIC 3ZGYA 2Y66A 3LOUA 4MPJA 4N39A 3ZDXB 4TWBA 3AY6A 3HXMA 2V45A 1I4EB 2Q5FA 5CA0F 1YVEI 4PR3A 1SU7A 3FYHA 1UBUS 4XFKA 4TTSA 5HWSA 4ODIA 2H9AA 1RWPA 2O3JA 3DBHA 4YAEA 1CJSA 3UJ9A 5J2UF 3WRVA 3MYYA 4Q39A 3IRUA 2JAOA 5CLGA 5AI6A 1WAMA 1YBMA 2C92A 4L51A 1TZBA 5GV7A 3FDJA 2A7XA 4HEQA 1Z56C 3QITA 3DV2A 2IKSA 2WHEA 1LD3A 3GLHB 1YDWA 4QEDA 2E18A 2BR3A 4BNIA 3HWRA 1ZL0A 1JQAA 3UG7A 5EEHA 1WKBA 2PD3A 4NABA 2D06A 4PGHA 3VR6H 2I91A 1E5VA 1SVUA 1E5DA 2Q4OA 4DANA 4AN4A 3D7LA 1PJCA 3KZOA 2ZRGA 4DT1B 2IVFA 2DRIA 4TV8A 1NUSA 1DIOB 1C0PA 1EWVA 1KC3A 2E5FA 2PH3A 1RWNA 5EZ6B 5LBTA 4AICA 3M9XA 3OO0A 2CE7A 4I9GA 1KBOA 3T9EA 4UNQA 4C4PA 2GZAA 2IZ1A 4I1PA 1V2GA 4KUHA 3GGJA 3SI7A 4EY5A 1N9KA 4PRZA 4PYMA 1IM5A 1MVNA 4HK4A 3ZXIA 3CU5A 2RHLA 3PFIA 3EMBA 3ZWXA 4Y6QA 2NSJA 4ZRMA 4MV0A 4PN7A 1DWQA 1DBRA 1P31A 2PLFA 4WZ6A 3GOHA 7YASA 3WR5A 5EHQA 1AKEA 1QFSA 1KYTA 2G9QA 2PS0A 3PJEA 4AWXA 2VJYA 2I4NA 2JGEA 5E7QA 2XLBA 4LYHA 3Q6NA 5BNZA 3ZLUA 1OFHA 2OQVA 1FQKA 3MD9A 5BQFA 4V0NA 4I2NA 1J25A 1XMJA 1I2DA 3WKCA 3U1VA 5F7XA 2GEUA 3N28A 5HGJA 4FS8A 2IYXA 4M49A 3PWKA 2JFUA 4DR3B 3CNHA 4CKYA 2SECE 3QUBA 1R9JA 2XX3A 1KYWA 3VKVA 1THGA 1TW2A 2A1IA 2J3HA 3CWCA 2VAPA 4YJHA 2H7CA 4MHTA 2IITA 2CLEB 5IFLA 4BO1A 1O7JA 3EUEA 3CRRA 1C30B 1OLUA 4E7PA 5CRIA 1YGYA 1KVQA 2JLYA 3ESQA 1E9VA 1T9KA 1BG6A 1UIRA 2NVUA 3IYLW 4RJTA 5J2TB 4CEIB 1BEUB 1LS1A 3OFKA 3PUHA 3D6AA 3NASA 3GDHA 4MPRA 5I3ZA 3AI2A 3KFXA 3UV6A 3B3FA 3SJCA 1YH3A 4GXRA 4EZBA 3ZVMA 1X42A 3S5JA 3F5FA 3L82B 1U7TA 1NI4B 3OKCA 1ENZA 5FAXA 1XZKA 1HDEA 1ZH0A 1PHRA 1SKBA 3BK7A 4BQSA 4CHGA 1D2NA 4YAGA 4ZEMA 3R9XA 1N2IA 4V02A 4RVDA 2ZR8A 1RPNA 3TF5A 4FB5A 5DHUA 5JT1A 4XQEA 5K2MA 3UOWA 3ZXUB 3LWBA 3OQIB 2XOEA 2W43A 2XVAA 3KOYA 1RTKA 4LQ4A 4NULA 5DISB 5ECWA 5C3UA 2NPFA 2WAOA 4EPVA 3TLMA 2KQUA 2JI7A 4CIXA 2OGZA 1IQUA 1HA3A 4PG7A 1V6SA 1N2GA 2O6LA 1GQOA 4RZQA 3SIWA 2YXEA 2P91A 2GAIA 2VHJA 2ZVQX 3DNFA 1D8AA 4DDVA 3I6ZA 1LA2A 5EIBC 5A06A 1ZGHA 5E4TA 4S1VA 3D7RA 4FYKA 1KSHA 2VZEA 1HZZC 1XQYA 3AP3A 5L3SA 4M1SA 2ZW9A 5H4HA 1MHPA 4EI2A 3WLNA 2ZRBA 1Z4LA 1C1DB 5AOVA 1VMIA 1XDBA 1ZD8A 4HYQA 4EQ6B 1NBHA 1BSVA 3PJFA 2ZTUA 1P5JA 1IULA 4DR1B 1SKAA 1JE0A 2NOAA 3CISA 3X43A 1G41A 3WWCA 3FSRA 1EXNA 1GLNA 1F2DA 4G4GA 4RA9B 4XCXA 3DBVO 2WU8A 3DULA 2WMNB 4LX0A 4HYTA 2FQQA 3G1TA 3K1YA 1UKZA 1E1RA 3ZU5A 2X1LA 4GX5A 4BHTA 2V7EA 2R6FA 1AXEA 1TM7E 2NV0A 4QKQA 5IT9A 3O4VA 1FK8A 1UXHA 3IDFA 3KKPA 3FYTA 2PSHA 2Q0HA 2W2LD 3PUWA 4WKNA 3VJKA 5IUNC 2PKRA 1VC2A 5DVZA 5K8CA 2VBFA 3CXRA 3ZEIA 4AP6A 2IX9A 4C7VA 2IUUA 4A36A 4NBVA 1HUQA 2QY9A 4AKTA 1T8WA 3R3SA 3TRDA 2OV6A 2ZT7A 3GJYA 3OG9A 1TUIA 4DXHA 4KMSA 2PRJA 2WPNA 2CXHA 2OB2A 4N8EA 1SMKA 3ZY3A 1U99A 5LL6P 5KYUA 4ZCIA 2VXOA 1AUQA 3RB8A 3CEJA 2VQ3A 3B2QA 2IHZA 2YNMD 3R9WA 2HPAA 2GBPA 1GYPA 5CBKA 4BGEA 3WA7A 3B6MA 1MZPA 1UOEA 2BH9A 4WZBA 1C1XB 1CZUA 1LSSA 3FCYA 1LGYA 2JCGA 3GZTB 3LP8A 3ZWAA 1E5LA 5E4YA 3S68A 2OP0A 4ECEA 1YWGO 1OI3A 3OWHA 4P4NA 3REGA 3N0WA 4AYXA 4ZICA 2JLWA 5KX5F 4RPIA 1LDMA 2I4LA 2VJBA 3FWHA 3N3AC 4YEDA 3TTSA 2IEGA 2YW9A 4L28A 2NUPB 4RGQA 3W6UA 4A0RA 4O63O 1DDIA 3EEBA 1QC5B 3ZU3A 2BLLA 3VPSA 3IIKA 3MGKA 4MUIA 2P9TA 2JLSA 4NYJR 3ZWOA 1K89A 1YIAA 1L7NA 5L7YA 1KY4A 1LDBA 1Z5VA 1XO1A 4LY3A 1VFNA 1GV0A 1DAMA 1N7JA 3RHTA 1E1CB 2QR2A 2VDNB 3QOYA 1TK9A 3KU4A 1EP3B 1ZA1A 3F97A 3IAM6 4R6WA 3EDQA 3V1UA 2GPAA 2PCLA 3W3ZB 4PS0A 1MEJA 3BEOA 2ZJOA 5EEGA 3VSAA 1OLSA 4NCJA 3ZJ5A 1ML4A 2PS3A 3LZCA 4EEZA 2R6ZA 2OLEA 1CQJB 4EYSA 4Q1BA 4XASA 4CM4B 2VZLA 4MI9A 1NY5A 4NECA 2DFTA 1P19A 3WBKA 1UOPA 1A9PA 4QPCA 3FTEA 1OU0A 5EESA 1S96A 4HEHA 3OIGA 2OD7A 4P31A 1XTRA 5B2FA 4MH0R 1HQDA 1MCZA 1S5PA 2AL7A 4IJ5A 5HK9A 1OKKA 1UPAA 3AVVA 3LLVA 1A2QA 3W1VA 2B92A 1IY1A 3AOGA 3W3AH 3YASA 4MO2A 2QMZA 3JVDA 4XIFA 2ILTA 2D5LA 2AFVA 1GT6A 1UBSB 3KJEA 1JSCA 4CLRA 2R48A 1JWBB 2C94A 2QP4A 3DTNA 3ETJA 4L3OA 2HSDA 4Y2HA 3NO4A 1T0BA 1GKYA 3R3WA 2YV3A 3MOGA 4NG5A 2YVQA 3T7JA 5BQOA 4LFAB 4M4SA 5DEOA 3KEOA 5ELLA 3MB5A 2FNAA 5E1BA 1U9JA 4R2JA 3LNTA 1ZCJA 4YK7A 1Q74A 1RWXA 4G0QA 1LQ2A 2ZB3A 2OBLA 3N2NA 5FPSA 3ZI7A 2ZVJA 3H2JA 4WLEA 3IUMA 3U62A 1I7DA 2AJ8A 1FNDA 1AS3A 2FN4A 3DOOA 4MEAA 1XJ0A 4II3A 1QWOA 4CI1A 3NIWA 1I0LA 2ZZMA 3FJOA 1EX7A 3D6HA 5CHYA 1TC2A 1KI7A 1UKBA 4PZYA 3NDIA 4NZMA 3C8HA 1QRSA 1PJBA 3RC1A 4E5SA 1MA0A 4NENA 2A0YA 4IIGA 1MU0A 4ZPXA 1KO1A 1QYIA 4B8YA 4TTQA 2RSLA 1H0RA 1T9DA 4FFLA 5IAOA 2RD2A 3MGBA 5A05A 3I9FA 5FUBA 3WQRA 3EF1A 1Q2UA 3FB1A 1SQ0A 1X1RA 1XMSA 4XQ0A 5AIBA 5EMNA 2LD4A 1W0JD 2GK3A 3EAGA 1RZ3A 4F1WA 3NNDA 4FFMA 1H5UA 1WX1A 1JFFA 3VNSA 1O94D 1EFCA 2GVZC 4JMPA 2WM2A 3PGVA 1THZA 1IIBA 1JNXX 2DJIA 5P21A 1EWYA 2ESRA 2TMKA 4PLWA 2VK4A 5EJIA 4MPPA 4WBNF 5D5HA 3R44A 5FO0A 3RTAA 4H35A 1KK0A 2BFDA 3W0LB 3Q2KA 4U6QA 1POXA 2NU7A 5LUBA 3VPBA 3ZIDA 3UGJA 5SYNA 2I6FA 5T64A 3RT7A 4F0JA 4K2HA 4Y2VA 3K70D 1VKJA 1W36D 1ZJZA 5IKEA 2HIGA 4IDQA 3KQOA 4XCVA 4DNQA 2AG1A 2J5KA 3T38A 5B12A 4G9GA 1GSAA 1C50A 2FSFA 1M2GA 4RACA 3S2FA 1PT6A 5AKIA 1PGJA 4C0SA 2C1ZA 3TL6A 4EDFA 3MBIA 1JR6A 3KDAA 4KW7A 3JZFA 1V47A 1KFJB 2IPXA 3MWEB 3AV3A 4LISA 2CNWA 1Y1LA 3ER6A 3JASB 4DGSA 4IVNA 4PX5A 5LLTA 1AQNA 4X62B 5FBKA 1TJ4A 1TQHA 3E9CA 4RC9A 3VNUA 3HVUA 5IH3A 3KALA 1UBTS 4GOMD 4MIKA 1E96A 1QS0A 4MV4A 4R2KA 1O1YA 1H05A 5I5GA 4AZ3B 3L18A 3OUZA 4G23A 5FTJA 2PX0A 5IHXA 2C9ZA 2PMKA 1IVNA 2ZIFA 1E6EA 1YRAA 4R8LA 1PZHA 3KKLA 3NC4A 4YJ3B 3OPYI 3WNDA 5IJ0A 1P81A 2GJKA 2V7QA 4YMUA 2POCA 2VJMA 1EVEA 5K0FA 2BONA 2ZJAA 4GC5A 5LR6A 2VDLB 1QPGA 1WUIS 5CXXA 4DIEA 4Y1GA 2E4XA 3WNCA 4TWZA 4YLYA 1HDCA 3I7KA 1CY8A 4C5BA 2HA0A 2WNHA 4RPHA 4C4ZA 3MN1A 4JLNA 2C4MA 4BNFA 2HQOA 3USES 3M1AA 5DBOA 5G3YA 2IOYA 4BZXA 4HB0A 1G16A 3U80A 2P79A 3QPVA 4GYWA 2HPZA 3M4ZA 2RGEA 3T7IA 5KTPA 1F2UA 4GU5A 1QF7A 3DFKA 3EXEA 4RIIA 2PQ0A 3A6DA 4LJYA 1VJDA 2JRCA 2VA8A 2W93A 2X7JA 1W5EA 2J5BA 5G4KA 4X8LA 3BMCB 3AUSA 4WK2B 2VPIA 1DHTA 3I5UA 3ZS8A 1HYGA 1N0IA 1QK3A 4NAUA 1XEFA 3G2PA 4B74A 4V0KA 3HKDB 1JSLA 3OF3A 1KMQA 1QHEA 4MUYA 3FY4A 4JYMA 4OBEA 3WNZA 4MUBA 4UUOA 5I8PA 2JLZA 2HT6A 2WM8A 4GGOA 4HAOA 4XJXA 1ZMBA 2P9BA 2IH5A 4L5IA 4HDCA 1SCJA 3A9VA 1NDHA 5BXYA 3DV0B 1RHUA 3ZE2B 4BUJA 2A5YB 4FYJA 3OE5A 4P98A 3IODA 5HTKA 3GPLA 1GAQA 2DPYA 3WMEA 1U9CA 3FTCA 4UU0A 3T5MA 1CS0B 2P9YA 3W5CA 4D0NA 2BE7A 3NBXX 4KXFB 2P4HX 4JAVC 4MVCA 4LMBA 4X91A 1UL1X 1Y9AA 3MHPA 3GEEA 3G8DA 3L7DA 1YZQA 4JOBA 5ALZA 2XCIA 1ZAKA 3OQ6A 5BYKA 3U44B 3BHJA 4N5MA 1PNOA 1KFBB 4M1YA 1W29A 4PCLA 4EQZA 2L69A 4BLRA 1G7CA 1CEYA 1I3OA 2IOQA 2WUGA 3VVCA 2BGWA 4URUR 5HF5A 4C4SA 2UUOA 2VTEA 4IXWA 4CTJA 1E2JA 4BTLA 4UPEA 1FNMA 2RHTA 3CVOA 4FFNA 4LUCA 1PSDA 3QYAA 4LNHA 4Y2PA 1BVUA 3KJGA 2W2KA 3CV3A 1HO3A 3NLLA 5CB4F 2CJFA 4J6FA 3TLXA 2Q1XA 2JLBA 2YY5A 2IU0A 4UUAA 3ZUGA 3EVCA 4Q0MA 4U9HS 2WZCA 5I9IA 1SCKA 4Q3AA 5F52A 2BR5A 5EMKA 1L1QA 2HF7A 5KYVA 3RC9A 2EIXA 3P26A 1LBEA 3WS7A 4KE7A 4RLQA 2H3EA 4YRBA 3UK7A 5HQ3A 3CKYA 1XKQA 1LSJA 1V1JA 2D59A 1Z83A 2ZDHA 3ENVA 1N6IA 1XA4A 1RLTA 4ZGGA 1XLUA 3JYOA 2OXCA 4MS1B 1J0EA 3R7NA 4ALMA 3OAAD 4CVNA 1FTQA 2CUZA 1ZVKA 4OGWA 1CJUC 5HRAA 3H4MA 4ZQCB 2O4UX 1QHIA 3V4LA 3BAZA 3ORSA 1NOIA 5BW5A 3T8YA 1NGSA 3NVDA 1H94A 2GPNA 4X20B 2QM7A 3LUAA 3R6GA 1XELA 2CVPA 3F5DA 3HJCA 3HQ4O 3KSMA 1EM6A 4TLCA 4H60A 4QG3A 2FMTA 2JCBA 4D9NA 3K1TA 3QKUA 1YZGA 1UXOA 4BKPA 3P9YA 3NBZC 4PHTA 4JEIA 2MR6A 2JBAA 5DBFA 5TV2A 5E9AA 3SBXA 4OB8A 2FVXA 4R3UC 2HJWA 2HSJA 5KHLB 4X41A 3ANTA 3NHYA 4LVNA 1RZUA 3LL7A 1GR0A 2FZ4A 3DB1A 1H42A 4ENQA 1YR7A 2GK4A 1DG9A 4JVMA 3CVXA 2R47A 4JBXA 2O2HA 2N42A 4RPCA 4OHMA 1M1YE 4IR7A 4UNRA 1XDSA 2M6LA 5EJ6A 2BVNA 3R4VA 4XVRA 1SZPA 2RKWA 5C37A 5EHIA 3C6ZA 4IIEA 4ZGWA 1AK1A 2WD8A 1N2XA 3VR6A 1HE1C 2H57A 1H9BA 4FNAA 5KTMA 1O95C 2E1PA 1H85A 5IG2A 4EHAA 2JIMA 5C1IA 2DWCA 4GP9A 4AVYA 5JMWA 3FVQA 4DLSA 5LJIA 2XWJI 3LWDA 5EP3A 1CETA 3RK0A 1CC1S 1CQIB 1C7EA 1IQ0A 4CKBB 5FUVA 2E48A 4IIBA 4LECA 3RFXA 1Y5LA 3KB6A 2C5SA 4UXHA 3GLGE 1XTJA 2A5JA 1BH6A 1JQ3A 3CQ9A 1KJ9A 4ZVNA 4CIDA 2I65A 4Q21A 1SXQA 4ZHQB 2I9PA 4MUKA 5HIIA 2W2TA 2O8EA 3E3NA 1BKSB 1GA4A 1XL0A 4DWJA 3JYQA 4MMZB 4BU1A 2WSSA 4F9GA 3L0DA 2H2GA 3JR3A 4GQAA 1IXYA 3B6EA 5FOVA 2OG1A 1YT5A 4YXWA 4DRZA 2PMFA 4K9OA 1JR2A 4AJLA 1VIDA 4RFLA 3ENNA 1KVTA 1QTQA 4OHZA 1H3FA 3OCJA 1P9OA 4KIWA 2ZPAA 4CI9A 2EP8A 1BWPA 3GQBB 1RYBA 4FYYA 4GVXA 1XEWY 1CUJA 2XECA 5GV8A 3TDMA 3NXKA 4HN2A 1OX4B 3BRWD 1NQTA 5F7ZA 2IIBA 3AIMA 4F9TA 2AH5A 4RK6A 1EHCA 2XGJA 1BN7A 1TAUA 4MYSA 3WJ7A 4GMXA 2AFHE 2NNWB 3AESA 3EIFA 3LCMA 3SZLA 3WL8A 2FW6A 5LXTA 2FP4A 2FX3A 3E8MA 4OP1A 2C7QA 5H9VA 1WDTA 5JSZA 4KREA 1DRKA 1B3BA 3EIQA 3L0OA 4KN8A 3H5IA 1P4RA 3D3NA 3DG9A 2I67A 1ZA2A 3IV6A 4WOBA 3OCZA 4B7AA 5A5DA 1A04A 3R7WB 4E94A 2PT9A 4CR8A 2D2IA 1S4QA 3CF4A 3IOMA 1NMYA 3CNLA 1J2JA 3DBIA 3N7UA 2VK2A 4DYVA 2VYND 1X6VA 1T3TA 5FEMA 1EJ0A 4X1IA 2FN9A 5FFMA 3B38A 5TRTA 1E3TA 4AZSA 3CVJA 2HNKA 5E6SA 2ATXA 3IKTA 1QOQB 4L73A 4P36A 3T1OA 1EJ6A 1EK1A 3CJQA 3H1AA 3GWZA 3HNRA 5EWMA 1H4QA 4MYUA 1YI1A 3S99A 1IK4A 3T0GA 3CH7A