2IV2X

Reinterpretation of reduced form of formate dehydrogenase h from e. coli
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
715
structure length
697
Chain Sequence
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Formate-Reduced E. Coli Formate Dehydrogenase H: The Reinterpretation of the Crystal Structure Suggests a New Reaction Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Formate dehydrogenase H
total genus 253
structure length 697
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00384 Molybdopterin Molybdopterin oxidoreductase
X PF01568 Molydop_binding Molydopterin dinucleotide binding domain
X PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 2iv2X01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2iv2X04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2iv2X02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 2iv2X03
3GTJA 5FTKA 2JIOA 1E61A 2PMZA 1PQEA 1K83A 3DMRA 1R9TA 1TWGA 2WAQA 3HU1A 4GA5A 1TWHA 1IW7D 2Y0SA 1E18A 2KI8A 1UHDA 2JIQA 1KQFA 3QWZA 2YU9A 3FKIA 1WCMA 5EPPA 1Y1WA 2JIRA 1PQFA 3HU3A 1TWCA 2VPXA 4KDLA 4C2MA 4CRYG 1Y4ZA 4KODA 1AA6A 2B63A 1FDOA 5FTNA 3CF2A 1PT1A 1CZ5A 3CQZA 1KQGA 3TIWA 2C45A 2JA7A 1DMRA 5B6CA 2PJHB 1PQHA 2IVFA 2R93A 2E2HA 3GTMA 1E5VA 5C18A 2NYAA 3O5AA 1EU1A 1PYQA 2EEOB 2NVYA 2E7ZA 2R7ZA 2R92A 3GTQA 1YLEA 5GLFA 1WLFA 3GTKA 1S3SA 3QQ7A 3HU2A 3HKZA 2IV2X 4AYBA 5C1BA 4AOKB 4AZDA 5FTJA 1TWFA 5DYGA 1QDNA 3IR6A 1SFOA 2JA5A 4DMRA 5T5MD 5T5ID 1E32A 1VC3B 4QIWA 1I3QA 2V3VA 5FTMA 2V45A 1QCSA 3TM7B 2JA6A 2VPYA 1G8KA 1Q16A 1PT0A 4GA6A 4AONB 3QQ8A 2E2IA 2NVXA 3H0GA 1TWAA 3GTPA 4KO8A 3QC8A 3GTOA 2VPWA 1Y5IA 1UHEA 4KDIA 3GTGA 1SIWA 3PLXB 1TMOA 4CRZA 2JIPA 1PPYA 2JIMA 3ML1A 1PYUB 2WB1A 3OUGA 4KLNA 1I50A 4RV0A 2NAPA 1AW8B 3GTLA 2VPZA 1FDIA 1CZ4A 2VUMA 1DMSA 5FTLA 1H0HA 1R7RA 4D7ZB 5DYIA 1H5NA 1R27A 3IR7A 1G8JA 4CS0A 3IR5A 1CR5A 1OGYA 2DMRA 4AAYA 1E60A 1Y1VA
chains in the Genus database with same CATH superfamily
2ZYWX 1Y3DE 3PNQA 4F3KA 1OV6A 2DFNA 2JIZD 3O2NA 1GVNB 3K2IA 4J03A 3QVLA 4HS4A 5IXYA 2A5JA 3NPAA 2EIXA 3URMA 3LT4A 2YWRA 2JBAB 3JWJA 2FMXA 3OU2A 3HDHA 5FOTA 2KPOA 4HH4A 2X40A 4K6HA 4C7BA 4DIDA 3WQHA 1MVOA 1YKSA 3S28A 3U3OA 3GJ7A 5L4LA 1OJLA 3D7MA 5F1KA 2O0LA 2WWYA 1A9YA 3PQ6A 1XAGA 3NETA 3V55A 1SD1A 3GFPA 1L9XA 2P4QA 1MB0A 1E5XA 4FKBA 4TQGA 4PONA 1CQZA 2D7JA 1L1FA 3CSUA 3AF2A 2ZBEA 1YE3A 4J43A 4LDQA 2YS6A 2I5PO 5HDBB 3W7BA 2H4WA 4M9RA 3R3VA 1XZNA 4MARA 3FGPA 1JZSA 5YASA 2JI9A 3VKWA 1MH1A 3N0XA 3CRMA 1OYOA 4G3XA 2IPOA 1PIWA 2C7BA 2ZS7A 4GI1A 4L6AA 5ICMA 5JATA 3DV2A 2O2SA 4Q9KA 3L4SO 2O50A 4D57A 2AMFA 3C3XA 4YUAA 3IHLA 3EGWA 5T4FA 3GTOI 4K8RB 4KHPB 3WGZA 4LNUB 5C18A 2HWKA 4KCGA 4ND8A 4A3MI 1WXGA 1CYEA 2YICA 4OJMX 4WGFA 1SULA 4B8YA 1EUQA 3FPHA 3IAS6 4KYIB 1IVYA 1JV2B 3GCZA 1Z73A 4BIIA 5JTTA 1TB4A 3S16I 3ZU6A 2QVZX 4K81B 5IJXA 3PP8A 1K4KA 3WQBA 1KK2A 2R4UA 1IHUA 3NWPA 1QOQB 4XI9A 3GA0A 3LUSA 4ZICA 5K0JA 3RB8A 1T0UA 1V2HE 1L5WA 4NXNB 3NVKI 1BJTA 4IDOA 1BQEA 5CK5A 2M6NA 2JFVA 2UDPA 3EHDA 1D0VA 1XCBA 1ZC3A 2V96A 3NUQA 3OZ7A 4JFRA 1GFSA 3VC3A 1AZWA 3R09A 3MC1A 3HTXA 1KDOA 5KNDH 3P9PA 3CRNA 5JO9A 3NHLA 4C30A 3E8SA 3WBJA 5JECA 3K72B 3X2KA 1RCUA 2O3UA 2VI5A 5AXCA 2RHCA 4NBHA 3QVSA 1QMPA 1EVIA 1PQUA 2N47A 3EY4A 3ZUGA 2HNAA 4GSLA 1U28C 2Q6KA 3ZDFA 1ADBA 3CUKA 3GJ0A 4V3CA 1N2EA 5E4FA 1HNNA 1T8YA 3OP4A 4QDJA 3O4VA 2XGSA 5F5NA 4HLQB 2CNWD 5EHNA 4JELA 4CF6A 4IQ4A 5ALTA 4EA9A 4QULA 4MW6A 4N18A 4RXMA 1O96B 3L0DA 4ZD6A 2LDXA 4G5QA 2RHRA 1LV7A 3GEEA 2RI1A 4YAKA 4WCVA 4CMIB 4HYEA 3IT1A 4LDPA 4X3OA 4KB5A 1ZH4A 5AKGA 1PYGA 3DAOA 5KX5B 1NNEA 1SXJD 4MX8A 4XYLA 2GAFA 3OE1A 3TIVA 3DZIA 3DUFA 2PFSA 2BL4A 4GZ3A 4MUYA 1OTYA 2IHUA 3A9UA 3PIIA 4CM3A 4N0EA 4AZ0B 3PUXA 2EKZA 3FZGA 1Y3IA 1P0IA 2P11A 3L49A 3CIFA 3ISJA 4NH0A 2IIVA 5AI4A 3TQTA 1O5OA 1ORVA 4BNXA 4DY6A 4Q3NA 4ER5A 4ENSA 4GLJA 2XQFA 1V11B 3HB5X 5FPHA 3VKFA 3A4YA 3UK7A 1JR3E 1NBWB 1VLLA 1GQOA 1ZU4A 3I12A 1MRZA 2FSGA 4MLPA 1DXQA 3ZWOA 2QG6A 2VSNA 5AVZA 4L72A 1ORIA 2PZFA 4IGKA 2FF7A 2IDMA 1Q2XA 1JG6A 3E4DA 2VHYA 3VR4H 5HILA 1X1AA 3CCQZ 5AXAA 3GN2A 4G01B 3ZQUA 3H2SA 4KFTA 4OLJA 1E1YA 1E2EA 2K7ZA 1T1RA 4DCGA 4EUKA 2PUTA 2BELA 2J6CA 4EHIA 4DB2A 2ZJ8A 2WZQA 3VYSB 3WL3A 5KJ1A 1XU4A 2WM9B 4RHFA 4UHJA 4YCBA 3SBXA 3CQZI 4Q3AA 1AZLA 1QAMA 2G5GX 1UDRA 1XXHB 3EH1A 3I30X 4N3BA 4EEZA 5BWLA 1WBDA 1W7AA 2IYTA 2VAWA 1Z4NA 2V97A 4M55A 5AM0A 3SAJA 4JI0B 2E4XA 3W5UA 3V4RA 1KJ9A 3QV2A 4RLSA 4XM1A 2FZWA 2VYVA 1SZPA 2Z98A 3HVKA 3LDUA 4MQMA 4C0AC 4HQLA 4KGZA 1BX0A 2XJ4A 4LQCA 2V8BA 1M6VB 1AUPA 3L8CA 5K6RA 3ZHZA 4I1IA 3ZKWB 1ODJA 4KSYA 3P26A 1BRMA 4LBWA 5CB4B 3C70A 4QUHA 3EMKA 1AQJA 3HUEA 3HKBA 4OA5A 4ARAA 4MRIA 1C3LA 3P9IA 1P75A 4MGIR 2PMDA 4L4UA 1R6UA 5D1HA 1PD0A 4WTOA 4ODIA 4TKMA 1HQKA 5KVAA 2NVWA 1IY1A 1MXHA 4X8MA 5JQWA 1DJQA 1QVVA 2K2WA 3Q7PA 3WL5A 5T5ID 1Z56C 1R6DA 3B70A 5IFKA 2FCAA 3M4ZA 2PL1A 3J7A4 5DMHA 1XEXB 3ZJVA 1YZKA 1L7VC 4KDRA 4NBWA 1IUKA 3TIIA 2YMQA 2JEYA 3EAFA 3WWOA 4HEJA 3BAZA 4LSMA 5ERYA 3HKBB 2VF1A 2QJWA 2GCIA 5FX2A 3E3AA 1U0LA 2OZKA 1DJNA 2XWJI 3GO4A 3QXSA 1JA0A 2E5LB 2NZVG 5IJWA 2UZ0A 4CIXA 4IDAA 1JPVA 5CYOA 3FTCA 3JX9A 5E7IA 4O2LA 1FTYA 2HMWA 2N46A 2ATXA 4KG7A 4LXYA 2Q4DA 3UG7A 3N6VA 3BMCA 5KKAA 1WSAA 2YZNA 1JDPA 4HNVA 5FBWB 4PZ9A 5HMMA 4Y2YA 5CR9A 1A2OA 5HFJA 1MN6A 1SCAA 3ES9A 1AN9A 3QEOA 3J80A 4CS0A 5KYUA 4BV8A 3CVYA 2XDYA 3FH0A 3FFTA 3WLEA 4RHXA 1D03A 1Y80A 2YJGA 4FBMA 3EJ6A 4HHEA 3BMQB 4IBOA 5JD3A 4BNDA 4BMZA 3NTVA 1UBTS 3CE9A 3OOHA 4RZUA 3VAYA 4LXXA 3L7IA 1QDEA 3I05A 3F46A 4FSHA 2Q0QA 4HDSA 3UEOA 4G25A 1IY0A 5TPWA 1ZOLA 2CV2A 4N3GA 2TSYB 1U7ZA 4JI3B 1K8RA 3AF6A 1M73E 4BWGA 1ZN2A 1ETHA 3K9QO 2Z2KA 1GTRA 1BHO1 4KVZA 1A97A 1M54A 2ZWVA 3A1VA 4A5OA 4R2XA 3HN6A 4MDFA 3H1FA 4R0NA 3N2IA 1VSBA 3X1YA 1I1QB 2FOIA 3ZE7A 1B8OA 2V7WA 2WHPB 5JRZA 3F7MA 2NO1A 3V00A 2V7GA 3IO5A 2GARA 4DM7A 1OBHA 3ZCPA 1XMIA 2ZI6A 2JZNA 3MCAA 4OQDA 3NYWA 4WX2B 3NG1A 2WV7A 2FEAA 5DX0A 5BYBA 3PXCX 4KQWA 1P60A 5FDFA 2HJGA 2IE8A 1L4BA 2WSSA 1H65A 2NU9A 2ZJ7A 5EIBC 1IEWA 3ETLA 4BNUA 5G4LA 5LUBA 4AJIA 3JRXA 1W46A 4UULA 1NMZA 1T1SA 1KEKA 1QKKA 4Y7NI 2XF8A 3C5HA 4DDKA 5FA6A 3U09A 3M6MD 1DARA 3M5DA 3FDXA 2PSHA 1SM4A 2OGUA 3CG0A 2IQIA 1WMAA 5IC5A 4NFYA 2D1RA 3FDZA 2PJJA 4R16A 4LYGA 2OO5A 5A7GA 5BR1A 4YP5A 2O20A 2J3IA 3ANLA 5I7VA 1CJKC 4XYEA 1PV2A 3ZY4A 3A36A 1FSGA 2Y1CA 3P5BA 4RIFA 1IUNA 4L5CA 3ZHYA 4II2A 4C2TA 1T5BA 2W2VA 4JT9A 4RHCA 4RY8A 1GPLA 3INRA 3BD7A 4D45A 2CYCA 1WXHA 3AYXB 3BD9A 2NSJA 1Y81A 1RLIA 2FMHA 2I0FA 3P19A 3R3XA 4RF4A 3RF6A 4NJEB 5HJ5A 2G77B 3M33A 3L6EA 4HWTA 1PGQA 1EFAA 4QEDA 1R16A 2GH1A 4QRHA 4E22A 5KTPA 4L7QA 1AZSC 3CH6A 4MEJA 4D4MA 4I9FA 3C3BA 1ADFA 3TZCA 5FPTA 1Z0SA 2FKAA 3TOVA 5HQ3B 3EIOA 1G291 7REQB 1YRAA 1CJTC 1YUMA 4HAIA 4BWFB 1RXSA 2PM9A 2BVNA 3AR2A 4RD3A 1I7QB 5BW5A 2PZLA 2HLDD 3DL0A 5D3ZA 5F2NA 4OMDA 3VU1A 5FWYB 3PLXB 3PDHA 1SPXA 3H7IA 1JAYA 4CRZA 2A4MA 2I29A 2NTYC 4X93A 1BH6A 4J0QA 3WRVA 4NENA 4DV3B 1XAJA 1LZKA 1JR4A 3MRSA 1D1PA 3L7JA 1T29A 3CD6Z 2QRDB 1KAQA 4G24A 1T5IA 2P41A 1YKFA 1CFZA 2RBGA 2C98A 4EG8A 3AHCA 4JR2A 2WG1A 1IN5A 4Y8VA 1PQPA 1ATZA 1EM6A 2WM3A 4FK8A 2ZIEA 4TL9A 2X0JA 1SBTA 2YVKA 4GLBA 5IKOA 1XTIA 3QMPA 4TLBA 5E7QA 1E92A 4NAHA 5DN9A 5JAHA 1AKNA 5L53A 4LWQA 5K1ZA 1EDZA 4FKZA 2QRPA 4P81A 3CCR1 1SO8A 4L8GA 3REFA 1N2GA 1VP3A 4QGBA 4IDCA 3IMGA 1OQAA 1O6BA 3E03A 5AKYA 1YC5A 4ND1A 4NYJR 3TZKA 3EA5A 2JIOA 2ENWA 2PRSA 2AN5A 4YP6A 3UJNA 5DN6D 1UXOA 1QZTA 3EXIB 1CJSA 3K1TA 3AIIA 3DO8A 4QRIA 2FF5A 1G20B 1IHYA 2PV0A 5ICGA 3QIAA 4ZREA 1J1IA 7AT1A 3JWPA 1Z0AA 2QZ4A 4BYMA 3QITA 3VR5H 2E2JI 2OLEA 1VYUA 3DMHA 3L7MA 3H11A 3TZLA 1GPYA 1Z02A 3AESB 2DFDA 3GEDA 1SCBA 4CEHB 3EWSA 1IZZA 3T54A 3TG8A 1LI5A 2EZ4A 1KK1A 1D4AA 4GF5A 3KSAC 3G23A 1OIWA 3OQIA 1GKUB 3AU9A 1L4FA 2AI2A 2BP7B 3UVEA 5B7NA 4JKYA 5DIZA 4RQAA 2GRUA 2EBUA 4XH9B 4G4SO 2ODNA 3O84A 1X3LA 4MW5A 1EHYA 3MWDB 4RMIA 4Z0TA 5JD5A 1JIKA 1VXOA 4PXAA 1NUTA 5DT2A 1C3XA 2C1EA 2F9FA 4PRYA 1A5BB 4TZ0A 2NW6A 1YVUA 2NQ2C 1Y5LA 1YCDA 2P9GA 2PJHB 2WAYA 3FCXA 5ALSA 4YAOA 1GLGA 3G6WA 4ITRC 4AXXA 3CPWY 5C81A 4J1NA 1M2EA 2HCBA 1USPB 1J0XO 5IJ9B 1P1RA 3H4VA 4N8EA 3EPPA 4IHJB 4H15A 2FFBA 3JQ6A 2GMWA 4DPMA 2WTUA 1GZ4A 4LJ7A 4LNUA 1Q7EA 1I7LA 2AV6A 4R5HA 1Z06A 4RABA 3I83A 3ET5A 2P75A 1R8QA 1XCGB 2VT6A 3RQSA 3TR6A 1CNMA 3WADA 2VZEA 3TAUA 5K4HA 1T9KA 3DTVD 4IOKA 1KVSA 5FUYA 4DKJA 4AKIA 2VLIA 3UAYA 5C1BA 4R2LA 3OTHA 2PGIA 1U9YA 3AERB 3ITNA 3KHSA 3WYGA 3I2KA 5EE3A 1PZFA 3GZTB 1TW3A 1A9XA 3U4QA 4LK2A 1RC0A 1WZNA 2OSVA 4LHYA 5F7JA 1HORA 1LSOA 5H3CA 5BR4A 5KKCA 1UBMS 2PUBA 5KVQA 3H4TA 1E6CA 5L7YA 3TCNA 2QRLA 3DDSA 3BWEA 4ITVA 3SBOA 2J3MA 3R3YA 5TS3A 1UJ6A 1ZAYA 1NRJB 3A4IA 4J0JA 4X94A 2ZWAA 5CT6A 1ZR2A 2HHHB 1ELOA 1EHIA 3DFZA 3ZNOA 2EVWX 5EPEA 4DCTA 5AVYA 4S1TA 2E2IA 5CH8A 1AUOA 4WOJA 3RIGA 4EFDA 2A1TS 3VH1A 1KXJA 5F21A 5H0IA 1UBFA 5JC8A 4NB9A 2H7VA 5DNWA 3VMIA 4AJHA 3JZIA 2JHCA 2GETA 1TT5B 4BVLA 1GQYA 1D2CA 2WUGA 4X1YA 5TQ0A 3ZDEA 3QTBA 4RA6B 1NVXQ 1VMIA 4JXJA 2DQ4A 2DERA 5GONF 3NW9A 1I01A 3CLKA 1U8CB 1NUIA 4ZKEA 3LQ4A 2ZTHA 4MVJP 4WASA 1TUIA 3R6TA 2XZOA 1GAXA 1NVEA 1IBLB 4BJ3A 4AMUA 3U0VA 1PJZA 5LR6A 2G06A 2UYQA 4FW8A 4IXWA 2X4DA 4M4SA 4QJBA 5H9WA 4PYMA 3WK9A 2FEOA 1G8GA 4R98A 4AM8A 1ZVVA 1DFIA 5TPZD 3S99A 1U7PA 2QV7A 1WNFA 1TXGA 1GYPA 1KS2A 2I34A 2VDQB 3N0RA 4FYXA 4RMJA 3RC2A 3W6ZA 4YMTA 2EQBA 2FJ0A 4ZVVA 4WN3A 4WCFC 1QVFZ 2JHPA 3ZH2A 3SFZA 3OAAD 2ZJ5A 4K2AA 4EB8A 3OIUA 4QFDA 3EVDA 4OXYA 2JA8I 3I4MI 3DC7A 3QX7A 4L3VA 1CRWG 1U8EA 2O3TA 2PA0A 3ACBA 1K7XB 3R4VA 5HUQA 4M38A 1YKGA 1SKUA 4ZYYA 3CCLZ 1P0FA 1X13A 2DF8A 4HEQA 1FFCA 3G71Z 4G5XA 5I9NA 5DNUA 5ADHA 3AR3A 5JZBA 5ECWA 4HGNA 1MD9A 4NDNE 1N2OA 2ALJA 5DGTA 3T1HB 1UR5A 5FLEX 4A3FI 5HFNA 3WL6A 4MQ5A 1TVEA 4ZVUA 1JDNA 4P9NA 1KQPA 4WXEA 3T7EA 1FFWA 2I3AA 5KTKA 3D3WA 1FVFA 4CXMA 4X3PA 2QK4A 3C5VA 4R9RA 2LZ0A 3MLEA 3DJFA 4M36A 5IT5A 2QXUA 1WQ1R 2BGIA 1FYVA 5I9LA 1TAGA 2H1FA 2VHEA 4L7VA 4BV9A 2HYDA 2RG1A 3A3KA 4KO2S 3TIFA 2FPPA 4QG7A 3R7DA 3ND7A 3R5TA 4MMYB 5C1OA 4CV1A 5EJAA 1YB1A 2COKA 1W44A 2XE8A 1M76A 5J5VA 4UDOA 5KSZA 4ZJPA 1P0MA 3EXHC 3IKVA 4QPJC 3WNQA 2HSDA 4KKXB 1V7ZA 5IP7I 1HYEA 1O03A 3HFSA 4TSFD 4OHUA 4YO7A 2QM7A 5JRJA 4QECA 4BRSA 1N2CB 2GKSA 1UAAA 2HU2A 3FYTA 4UOQA 4ZGBA 2YS7A 3K16A 3E58A 2WA1A 2WWVD 4EAAA 1O0CA 1S5PA 4M76B 4GD3Q 4CM9D 4E07A 3CLUC 2JH3A 3VPCA 2CBGA 1AC5A 2P9ZA 1XDWA 2QN7A 4Q82A 4GPZA 4WY2A 4KZKA 3WHKA 4MS1B 3D6JA 5AR1A 5BYKA 3J81b 1BIFA 1DT5A 3BE6A 2R6AA 3DO5A 2ONYA 1K8A2 3FLBA 3QRWA 4QYXA 4X90A 4ZOBA 3I4LA 2WRZA 2ERCA 1HDOA 1GFZA 3FYUA 3MAJA 4JODA 4I8IA 1VHWA 3L7DA 4LXHA 1FF9A 1CUFA 2E55A 2QMQA 5FNVA 1W5TA 4XRRA 1JPJA 4C5AA 2ZSJA 3SX4A 2JA6A 3ZXUB 1U3CA 2O1SA 4UVIA 2JW5A 3OO0A 3U26A 3G7UA 1KI1A 4H0FA 1VRCA 1YI0A 3A4NA 3T4XA 2FFHA 1WM1A 3C8ZA 3N2GA 1KQ3A 2L0XA 5GVSA 1SIWA 1RHQA 4MHSA 2RI0A 3SDSA 1WS6A 3TNDA 4A8JA 5AUQA 3DDWA 3HCCA 4E5MA 1ODCA 1K1EA 2B2CA 3I9NA 3DTYA 4PLPA 1TF2A 4LRWA 4WT7A 3ZS8A 4BGVA 2RCNA 5BN3B 3TF5A 1NKSA 1KA9H 3QFCA 4FE7A 3SMQA 2VDLB 2RH8A 1EG2A 1NN1A 5A4MS 1JTEA 1IL0A 1YITZ 1ZKDA 3BIWA 1C9EA 4RLFA 4Z4EA 2OVFA 3G711 2A7XA 2I2BA 4HZGA 3VNBA 2FW9A 2JKYA 1Q0HA 3SUMA 3LUDA 1U0BB 3ENQA 1FFYA 5C3UA 3FQMA 4HAOA 3HMQA 2QLFA 4IP0A 2YW2A 4BMDA 3GDGA 1YQGA 5DLEA 5FFFA 3WA6A 1F2TB 3H99A 5EFOA 4HRYA 3W4KA 4Y2VA 2D5AA 4CF7A 1SXJE 3DF7A 2OECA 1UKCA 2C0CA 3Q8WA 5A6SA 3MWKA 3NVDA 3UQYS 1CBUA 3VMGA 1V35A 3L4KA 3KZMA 4GT1A 3VR6A 4LWOA 1NIJA 5JSZB 1P1KA 4PX5A 1NUAA 4AN1A 1MB4A 3HLKA 2ZANA 4GI3A 3A31A 3KZ1E 2XDQA 3W0LB 3JZDA 2AKYA 4FIDA 5K8IA 2FDXA 3PHLA 4IS3A 3ZZ1A 4HDMB 1EP3B 1I4DD 2YJ5A 2YXDA 3DE3X 1CNFA 4P7KA 3GY0A 3T52A 3U62A 3S40A 2P2LA 1NG9A 3PQ2A 1MRSA 2C92A 2ID7A 3OIWA 4BAUA 4WXPA 4EY5A 1VHQA 2HJSA 1IHDA 3PRJA 5JG7A 1X1QA 2BDUA 3TSZA 1Z17A 3NIFB 5AM4A 2GF2A 1USGA 3MTBA 4EY6A 4QGSA 1SOAA 1T43A 3OSZA 2QN1A 4EI7A 1KJ8A 4CEHA 2OBLA 1NR5A 1P7YA 2FWPA 3O8NA 2ZI7A 5EPOA 2ZREA 1Z5NA 3S44A 2O3RA 1LWOA 4G56A 1K63A 4XR9A 1FZTA 2A67A 1ML3A 1YMVA 1CZOA 1MIOB 4JGBA 4O25A 5AI6A 3CCV1 5EMKA 4BCDA 1WLSA 4L48A 1UBGA 1Z75A 4W9RA 5KC8A 1EU1A 1C2YA 2JI8A 2WIGA 2OK8A 1I3LA 1K5GA 3COYA 3KUCA 2GHTA 2RGCA 1MDFA 1J5EB 3QX8A 4OQFA 1MOSA 2YX1A 2WAOA 2ZG6A 2OBYA 3OT4A 1JJIA 4GMDA 3NP7A 3I1JA 4NEGA 5CT5A 4F2HA 3K9GA 2OLKA 4BZQA 1TK2A 3AZOA 3O3OB 1NP6A 4DEYA 1ABBA 1W4CA 5CB4F 3VGPA 4E5NA 3PUKA 1Z01A 1TO2E 5D3QA 5LBUA 4C3OB 4PQEA 3AMVA 3WDKA 1RWNA 3MZ0A 1VLQA 2CHFA 3UJPA 4FHZA 3BRSA 2WE8A 3CS3A 1KNXA 2ONKA 2WMOB 3DD5A 5KSPA 1CF9A 4RY9A 5CD1A 4P7GA 1L5GB 5JNTA 2HB6A 3E82A 3FHTA 4JT4A 1DKQA 3AO0B 2DHDA 4KDIA 2FQYA 3L18A 4IKEA 3KFVA 4M9QA 4MXDA 4YAEA 2EDCA 2IXBA 2W71A 3HG7A 1I2CA 2IZ0A 1JEQB 4L4XA 3RKUA 4RTOA 1LV8A 1ZGAA 4G2NA 5EHIA 3LECA 4A3GI 2H2DA 2BFNA 4A3SA 3UBMA 1R74A 1ZD1A 5C4MA 2MTBA 4KSBA 4HGRA 1U3WA 4PIMA 4OIFA 2VWGA 4FM9A 1RWMA 3C3EA 1VB3A 2WABA 2H2HA 5E1BA 4I3GA 1JHAA 1KDTA 3IR7A 2WSSD 3VR2A 2AMLA 3AXSA 2EZ8A 2OB1A 2I7VA 2OAEA 1YTLA 2HA5A 3OT1B 1E77A 1BXKA 3B51X 2FN9A 2ZE5A 2WWTA 3D64A 1LS6A 1SPBS 3K0EA 3MWEB 1BH2A 4ZARA 4BAGA 3LZ6A 5SZKB 1PZGA 2JLZA 5AN9F 2IPLA 4RWEA 1ICIA 1F60A 4XIYA 4FKMA 4YRCA 5U4XA 5IDWA 3ZU2A 3DMTC 4DA8A 3GUUA 4CTNA 1ZONA 4H59A 3OLVA 3RSZA 3FKQA 2PUEA 3GYBA 3PU6A 4ASUA 2PX3A 4O63O 5K09A 5JCXA 1OC2A 1C0PA 2NTEA 1NPDA 4CN8A 3EPLA 2Q4ZA 3I5YA 1ZCAA 3TD2A 2PMKA 1VKHA 4AF7A 1OB5A 3CWQA 5TLSA 4YMIA 1J7KA 1OUMA 1Y4ZA 2ROQA 2O8VA 5JZOA 3UV3A 1FB5A 1Y48E 4KPUA 3ILYA 3MCTA 3JZAA 4OHKA 3A3OA 4TXHA 1DRUA 2D59A 3GR6A 5TT0A 3STYA 3BA6A 3LD9A 3MWGA 5G0VA 1GV0A 3U4DA 3CVWA 4RVOA 1R9GA 3I09A 1M8KA 2AF3C 5EEGA 4IGAA 3CFYA 3IAUA 3SEQA 1XROA 2ZITA 3MSCA 3HJCA 2P68A 4MWTA 5LA6B 5ABPA 1R4MA 4H77A 4PLZA 5C9ZA 4ZANA 1W1WA 4IUDS 2OXTA 4B34A 3RCBA 2HSWA 2Q1YA 3CA8A 3K05A 4LPKA 2XCIA 4RVSA 3RHFA 5B3LA 2GCPA 2QTLA 3IV6A 1RP7A 4XWAA 4D3ZA 2R92A 1G8YA 5ISMA 1ZMBA 2ISQA 5CVDA 1Z3IX 3AETA 5ES3A 1L5HB 5EL0A 3RFVA 1U8FO 2GTHA 1O87A 4IIGA 5B53A 1KI6A 4BBPA 1F4VA 4URWR 1DIRA 3KB2A 1PJQA 5ALLA 3RYIB 4E7PA 2EFYA 4RCVA 1KFBB 1B8VA 2GJ9A 1U6IA 2VHWA 3ZIDA 3CCSZ 3F3KA 1U6KA 2PM8A 4CGYA 3HB9A 5J2TA 1NZJA 2GK6A 3A6KA 3C6ZA 3DLTA 1WUKS 1CP3A 2DPGA 3CZBA 3EXFA 5TGDA 3ZK8A 2FEMA 4DZZA 1XMVA 3PC8C 1EXWA 2EWMA 3F6PA 1JLSA 5IG2A 2C7OA 3W6OA 1DOAA 3M49A 4FFSA 4P3XA 1PR1A 4FCWA 1KWKA 4YEDA 4C4TA 2I9KA 2EIHA 4LOIA 2OENG 1J09A 1JT9A 3HZHA 5KU1A 2ZVJA 3DWEX 3ANMA 5ELXA 4ZAZA 2JFNA 3D0KA 4ESEA 2HT1A 1TMOA 1X7ZB 3LWDA 1I32A 3O2JA 3GT3A 2RFLA 5CTJA 2CXUA 3G02A 2V5VA 3P0RA 4F9FA 2ZTSA 3NANA 4NE2A 2WU4A 5FRDA 1FP6A 1ZIOA 5EMJA 4G37A 3QLUA 3HRKA 2WHQA 4Z4GA 1HTWA 3K71B 3DUFB 4X9XA 1AK9A 3L77A 1SUAA 4L3OA 3ITDA 4RANA 4D8UA 2HU7A 4HTFB 4X84A 2OCDA 4ZQHA 1GPDG 4D8TA 3TPFA 1WW9A 1QZ3A 3K9WA 1J0DA 1SXQA 2XMGA 1O3YA 1EX1A 3RIEA 1W5EA 3WE7A 3RQIA 1FJ2A 4UJ5A 4KXLA 4BMVA 1AM4D 5JANA 4LGYA 3A9VA 4US1R 1DV2A 1KAMA 1UP4A 4RVGA 5DTIA 5GVRA 2IUFA 1U3GA 3KBOA 2PEYA 1XQYA 2CN1A 3GLTA 3PC6A 4K6CA 1R4NA 1RQPA 1EAYA 4FD2A 4IEIA 4GO1A 2DC1A 4QYMA 4WSOA 2PHZA 4C4ZA 3AYZB 4PZZA 5AI9A 4R1MA 5F23A 1XKQA 3UWMA 1OH6A 2QQ0A 3ZW7A 4DQXA 2DHCA 2I7XA 2G9ZA 1U6JA 2VSFA 2FPWA 5EJEA 4EYGA 3BE8A 2QTVA 1JAIA 3I2GA 3N87A 3NM6B 4BMNA 4ERNA 3C7CB 3I9KA 1QQ5A 2P1DA 4YQFA 3BAFA 3GNTA 1AS2A 3AR8A 2J4FA 1FDOA 3TX6A 5GIOE 1NNLA 1NX6A 2WFAA 4OK6A 5BVGA 3H18A 1YCHA 3KUXA 2IYNA 2OHOA 1NNSA 3F4BA 4IIJB 4DJ5X 2PG3A 1K06A 3MONA 1AV6A 3GRKA 4FQ5A 2KBFA 4OOFA 1KYVA 4WA8A 5HPYB 3LHFA 4I9NA 1YJ5A 2O2XA 4JIGA 3IJPA 2SCUA 3QWBA 3BXPA 1DX6A 4MQFB 1VLHA 1OH7A 1E2FA 2QX9A 3R44A 4K9MA 5M2QA 1XJQA 1G38A 3FROA 4HYYA 4EZBA 4RDXA 3OZAA 1IMOA 1SU4A 2GLUA 3PGMA 2R00C 1UUFA 2Y0EA 2YHIA 3RUIA 4BIMA 2P9HA 3GA5A 1WTAA 3GLHB 4G9BA 5EP2A 2LKDA 1VHDA 4FYYA 3H9CA 2WAAA 3FTEA 3I62A 3AFMA 5GZ1A 5JS8A 3TLXA 1WG8A 5C1DA 1TYCA 1UJBA 3GFSA 5DBIA 1HURA 1QRRA 3KC2A 1HDEA 1W94A 5EXDA 4BGDA 1S3SA 2QD2A 2PYDA 4PRKA 3RJZA 1H8HD 1VPLA 5EMLA 3NHPA 3BH7A 5IJ0B 1RXIA 2NO6A 1XTTA 2V9CA 3BHJA 4HCJA 2HAEA 1JQ3A 3TVTA 3EY9A 3B7GA 2UYCA 3QKUA 3WK7A 1N36B 3NFYA 5PGMA 3L46A 3A4VA 1FJGB 5CA0F 4BKMA 2HMYB 1L6IA 1CZLA 4HEA1 4L50A 4NULA 3SNHA 2V3VA 3IDOA 4MUNA 4GE0A 4UFNA 2IPNA 1OKKA 4IVRA 1KP3A 3IBSA 4UKDA 1P39A 2Q27A 4GOLD 4RSHA 3ZK7A 4YMUA 4J6FA 1AGXA 3SIPA 2PLWA 3QELB 4NZNA 2OILA 2P5UA 4D3XA 2RHMA 2WYVA 3VR3D 3ESYA 4UPVA 2BJOA 1W5SA 2X0FA 1FOEB 3H2YA 2I03A 5EZYA 4E94A 1OTXA 3Q8KA 3E9ZA 3OZSA 3EXFB 2VT7A 3GOQA 3CH7A 3C5EA 4KNWA 4NC9A 3V4VB 3CLTC 1GA4A 4Z4FA 4L4RA 3PQ4A 3NDPA 1UC5B 3FA2A 1E9SA 3UANA 1FLAA 4NOMA 1GZSA 4C6TA 1XDDA 3E3OA 8OHMA 4P1ZA 3I561 3OZVA 4WKBA 4L16A 3PJDA 2LIVA 5CURA 3KCQA 1JMYA 1MNAA 1QFSA 1YDEA 4F4CA 4AZTA 2D1SA 4PLHA 3ZXXA 3R3ZA 3GTMS 2O7VA 1MG5A 2RGBA 4REQB 5BSUA 5K8LA 2SKCA 5KTSA 1DE0A 3H3JA 4FIZA 5B1IA 1BKSB 1T0PA 3E2IA 4GMFA 2WF6A 3MT0A 1CC1S 3OQVA 2PWPA 4JZKA 4L8YA 2NQTA 3F8SA 4KODA 3KZNA 2DFLA 4KYUA 4IZIA 4MS4B 1LDEA 1QLHA 3PFNA 2A0WA 3ZEIA 2IUSA 1R9MA 4LHVA 4E33A 2PO5A 3CLSD 3OEEA 4ND8B 4DUYB 3H97A 2WIAA 2ZIVB 3EIXA 5JSHA 5DB4A 3SLKA 2C31A 2YZ2A 4YP7A 3BCRA 1CX9B 1R6VA 1FX0A 1Y3BE 3D43A 2FK7A 1SUIA 2WIJA 3DWIA 4CM6A 3KE8A 4ZEVA 1V1RB 1UBNA 1C50A 3IVRA 4PYLA 2VP0A 3AK4A 3GBPA 1KMQA 5C34B 1K7SN 1RXYA 1HH4A 2YC4C 3GLKA 1GDTA 1JPNA 5DWVA 1KYYA 2J5XA 2HF7A 3P9NA 4KXFB 4C9BA 4EGFA 5AMXA 4BRUA 6REQB 3C7DB 3B3QA 3R0XA 4PSVA 2JLYA 3LFHA 4R7TA 4CUJA 1L8XA 4H7EA 1U0EA 3AILA 3B1FA 2QBYB 4XEUA 3FSRA 3UGTA 3QA9A 3CU5A 4A0HA 1JLKA 4WDRA 3BMNA 3A1SA 4GC9A 4HDOB 4M7WA 2RB4A 3CCJ1 3WYEA 5H4GA 1O54A 4ISCA 2QP9X 5JNVA 2BKXA 2H06A 3RH0A 1DXHA 2PWBA 1WTCA 4CLOA 4K9SA 2NX2A 3VV3A 3KU4A 1Y3AA 5I7UA 3L7AA 3KIFA 1ISFA 3HXLA 3BIFA 1PFTA 3RS8A 2V58A 3B78A 2FZCA 4H60A 2YADA 4I5GA 2VUGA 2XCLA 4DLBA 2JFPA 4E03A 1AS3A 3DMYA 1Q7CA 1POXA 4FU0A 2A0YA 4Z0NA 2LIYA 2P4EA 3DKIA 4KWCA 2NXNA 4BX3A 5IC6A 3KX2A 1EB9A 1I0IA 1PBTA 4LMAA 3QU4A 4JLUA 2CDRA 3UJ8A 2R8RA 1VRWA 4P5PA 1QCYA 1XE3A 2JR6A 4AS3A 5HSGA 1LF5A 2ZCJA 3SJZA 1QP8A 2NU6B 3F5MA 3V8EA 5I5EA 3ZDBA 1R0WA 4DG5A 3DMPA 3L84A 4XX0B 1YRQA 3B82A 1CG6A 3PQ3A 3K09A 4BLPA 5EE0A 1LBTA 1P0PA 2HWXA 2JH9A 2XE6A 3TGPA 2VDUE 2REQB 3IC5A 3L79A 4LVOA 4EELA 2GN6A 3OPYB 5K4GA 4UCWA 1QPBA 3JVIA 3A9CA 3KWLA 2MMCA 3MG9A 4YUVA 3VAAA 2NN3C 4FEYA 4GYKA 1NT4A 1ZLXA 1WX1A 1NOKA 1YB5A 1NSFA 3NATA 3NHUA 3DA8A 4IXMA 4MH0R 3BL8A 3ONEA 1IULA 4TKUB 5AKXA 2GI4A 4B8WA 3L6UA 4OEHA 1V25A 4XYBA 3X2IA 1M6NA 3HY4A 4JJOA 5CH3A 3SS7X 2JIZA 3JQAD 4LJSA 2GYUA 4KO8A 1SK9A 2CUZA 2IODA 1DKPA 3B38A 3G59A 2C29D 3EVTA 3FWKA 1ADJA 3PNOA 1VJ5A 5KYYB 5F9HA 4G1EB 2J45A 2YHBA 2PNWA 3Q9NA 3GGDA 1KI4A 2UUPA 2X86A 1TQHA 4W4TA 1PLJA 5CIWA 3O31A 2ZB7A 1QHHA 4X1IA 3C24A 4CIVA 1E62A 2ZVPX 3X44A 4QPCA 2CB9A 4OFWA 1AG9A 4R8VA 9ABPA 3RANA 5IDXA 2HA0A 5M04A 5ALQA 1H3FA 4JU8A 1M34E 3EPKA 2W4IA 4AG5A 2BGRA 2CJWA 3VNRA 4BVAA 4UTRA 1D6SA 2ZYUX 4E11A 4U2GA 4C2BA 3K0KA 1ORTA 4A5SA 3ED1A 1JYEA 1RYFA 2HUPA 3FNIA 4MOWA 5JQGF 1WZIA 3RZOI 4LJYA 1OHHA 3EXG1 3HJRA 4Z9FA 3Q87B 5ARBA 1P7VA 1EJ2A 3MB8A 5BN3A 1U5BB 3MCUA 3W3AA 4GYWA 4ZVQA 3WGVA 3VR4A 5AW0A 1D0IA 3BFPA 5KIAA 1BG6A 2VCEA 3OZIA 4YB8A 5KWVA 3KB6A 3LOPA 1JJ2Y 2GF9A 1RYHA 3WMRA 4CTOA 1DJOA 2OV8A 1ZUHA 4HGZA 3GFGA 3R3JA 5IARA 3TIXB 4CMKA 4HK4A 4RD1A 1GRNA 2W6MA 4X6YA 3HUFA 1KRHA 2CD9A 4X7BA 3U3MA 1IWPB 1ZQ1A 3LFTA 4D81A 1BYUA 3L4BA 1HE5A 4LHXA 1EVLA 1I13A 1S1MA 2EKBA 3C85A 2A0XA 1J8VA 1I10A 4MVYA 4WZAA 4CMEA 4HDRB 4ARCA 3QZUA 1PVVA 2ZSKA 1P7ZA 2GN2A 5I3CA 3UUWA 4KNVA 3U81A 1HTTA 4OKIA 4FYMA 2OV2A 4LC9A 5CA0B 4WLUA 1QFYA 3G9XA 5CP8A 1J2EA 821PA 1X3ZA 3PO3I 2FPSA 2DXIA 1FTQA 2EX1A 2Y92A 4H3SA 4IDDA 3SYLA 1O57A 2C3MA 4WNIA 3WLFA 1HLDA 5AKKA 3T4PA 3IKJA 3X1JA 2CL6X 1DG3A 3CRVA 2AC4A 3DVAA 1CUJA 4NESA 5E9JA 4OFBA 4C0XA 4I1OA 1FXSA 5A04A 2FMKA 3IUPA 4TRJA 1BDBA 1BVHA 4Z2AA 2QTMA 2IEDA 1N3IA 3AW9A 1CCWA 3EGIA 3QVTA 4I9HA 1FXWA 1HMPA 2P77A 4RDIA 4JB2A 4FTWA 4TUYA 1FUIA 1I33A 2IY8A 1E66A 3NGMA 3F9CA 3OJXA 4N7MA 3H1BA 2YRFA 4MNTA 4UUBA 4BQPA 4HFNA 1JJAA 1OLUA 4P82A 5HKKA 4A36A 4EEKA 1A9OA 3P9KA 4J0HA 4CNQA 5JFGA 1DTWB 4I1SA 1FZQA 1XQXA 5BUSA 1Y1KE 1QGAA 3EEOA 3AGPA 1Y8QB 4ZT7A 4CGZA 1G16A 4JUCA 4CHGA 2JRLA 5IKXA 1J2YA 1QO0D 2VRBA 3ZHTA 2EJBA 2POCA 2YY5A 3SYTA 1G3IA 3OZRA 3ZG6A 5AM2A 1QOPB 2XQIA 2VDJA 3HJNA 3RI3A 1CTQA 2R66A 2WF8A 3FI9A 5D85A 3UUFA 3TM7B 1ILWA 3IEPA 2Y1LA 1TQ4A 4OQPA 5DHSA 1RLUA 1YH3A 4BGEA 4CLDA 4ANFA 4ZYZA 5I9IA 2BMEA 1OXMA 1Y6QA 3N2GB 4MUFA 5TE9A 1H6CA 3RC7A 8MHTA 2P35A 1WPRA 3VBEA 4FGLA 1AB5A 1XN4A 3DQZA 2WEKA 1VI5A 3DR3A 4QBGB 3WX0A 4EKYA 4KRGA 1N6KA 1OGJA 1Z34A 2MR6A 1OZ0A 4Y2HA 3WLMA 4GGPA 5HBGA 3GJTA 4U7PB 2Y0DA 3J81A 4EYQA 4L3WA 2R8YA 2W98A 4HAZA 5B55A 2R1ZA 1ZW1A 2ZOSA 3M70A 4QPZA 2ZT5A 4O5OA 4TV8F 3LUFA 4FEAA 2OYRA 3MTEA 2FSHA 2XNKA 4D3SA 1CDEA 5DLDA 4PRLA 1G4AE 1NRXA 5JJBA 4L1KA 3BBPA 1NN0A 4BVBA 3AEUA 4FB5A 3EXHA 4JS7A 4QTTA 1X0XA 3GDWA 3JD1A 3K35A 3AKEA 3D4PA 1SK8A 4OI2A 4AULA 2ZM5A 1R27A 2VA8A 2HF9A 2B4KA 5JAIA 4GP7A 5BUZA 3CLSC 4DXDA 3HJTA 1KY4A 4IJ5A 2I4IA 4QKQA 3HCRA 4O4JF 1DAEA 1VIYA 3NGXA 2KHZA 1TI7A 2EW2A 1W1IA 2Y68A 3GROA 2RBEA 3LT2A 1OFGA 1WMDA 2Q21A 4NZ9A 3RREA 1KIFA 2VNAA 2IYOA 1MAHA 3I76A 1EGAA 1X1DA 3ZWPA 3UGKA 4NFHA 1GTL1 1YQDA 5LU8A 2F8TA 3D1JA 4RF3A 3C6QA 5AW2A 1ZI8A 3KJFA 2AB0A 1MOPA 1QVAA 1VQ7Z 5FOWA 4R68A 4DQ0A 2HXYA 3E35A 5DM4A 1MABA 3IQDB 3ASZA 1VYHA 1WD7A 4G5OA 4WK2B 5TR9A 1XELA 4Q00A 4EO4A 1K5DA 4RTQA 3UJCA 1WCWA 1WZEA 1ZLYA 4O08A 4U5XA 4X60A 1Z6XA 2H4ZA 3A3YA 1BA3A 4I7EA 1ZJZA 1D2GA 3BGIA 3Q3VA 3DUWA 4JBNA 2H9AA 4KPFC 4M46A 2C4UA 3GV0A 2IHJA 4G8DA 4HJXA 4X1IB 5DXFA 4RTJA 4N48A 3ENWA 1IM2A 4RTSA 1GL3A 3C48A 3AR7A 2JCGA 2ORVA 4RSMA 4ZOCA 3OLYA 4J2HA 1WUIS 4TLAA 3CW8X 2JPDA 1OU4A 4UVDA 3UAOA 3KVRA 3NT4A 3THSA 5EWLA 3IHTA 4NAVA 3KXPA 3VU9A 3DGFC 2F1HA 2Q4TA 3W8DA 5JNWA 1XNJA 2H9IA 1JDJA 1OWPA 3PCRB 1NP3A 1TYAE 2IHZA 4IFIA 4EI8A 5B5SA 3GLGA 4NBFA 5GJBA 1CU1A 1C8LA 5BMVF 1PKXA 4X0EA 3S1LA 1NYLA 1D6MA 1Z4KA 5DTEA 2CKDA 2GM3A 4GZ5A 1NA5A 2OO3A 5KNCD 3O93A 1XMJA 1Z35A 4EI9A 1Q3HA 2REQA 3M9WA 3TR0A 1KQSZ 4IFBA 4RTPA 1YXMA 4EJSA 3BZWA 1IC6A 1WLFA 2ZS9A 2YR0A 3KEOA 4FNAA 3Q7IA 4J07A 4S05A 1EDDA 1XZFA 1BXGB 2BCEA 3DH0A 3IURA 3PTAA 4ETIA 2ZR7A 2YUTA 2FEPA 5D5PA 4Y3UA 1KEZA 1JA1A 5F3DA 1RIIA 1DC7A 2C2OA 4LDZA 3WRYA 4XTCS 1AVTA 1FYXA 3IAFA 1TGVA 4H1UA 4NK4A 3HXOA 5LKAA 1XYVA 4ZO4A 3K31A 2A9FA 2DUUA 3OTQA 5F2KA 3RIMA 4FYVA 1ZW6A 2AEEA 1SQ6A 3AWDA 2Y93A 3O92A 5U1PA 5AVUA 3U5TA 4KMRA 1YIAA 2QR2A 2A9QA 1I8TA 4JBWA 3N2EA 1CERA 1PWYE 3N2LA 2FB9A 3I2IA 2XCOA 4YMWA 3HHPA 1RYEA 4B84A 4FPXA 2GT1A 3IODA 1DELA 1BFDA 3FCOA 4PO1A 1L1QA 1FPMA 2R87A 3IT3A 4OI1A 4DWVA 1M2VA 3C14C 1GKLA 4Q4HB 1U1DA 1QHHB 1YI1A 3W6PA 3CEHA 1QAOA 3MCWA 1PYUB 1YJAA 1CFJA 2LTAA 3UJDA 5IM4F 1N9ZA 4BMYA 3EDRA 4QVIA 3V4ZA 1O2DA 2OV6A 3MM4A 2JAWA 2JZCA 2BMDA 2K6GA 1KAHA 2VKQA 3NTOA 2OBMA 4U7DA 2QPAA 5SZHB 3BH0A 1KYXA 2VCYA 5MGNA 4N47A 1DC8A 1CKEA 1EP2B 3I55Z 1JDVA 1EX7A 2CYBA 1QRDA 2H18A 2FWMX 3DYIA 4H08A 4RW0A 2AEFA 4ZI5A 3SXPA 1LPSA 5HJ2A 5J5AA 1X1SA 2GILA 1KBZA 5CK4A 4NYJQ 1M1NB 3WLNA 1H22A 2GXQA 3ANSA 1QANA 3ELBA 1RXEA 3GRUA 4IDQA 4X63A 4XYMA 4ZODA 3TE5B 1M2OB 4RNCA 3GLHE 1KL7A 3UG6A 1G2PA 5FBZA 1ADGA 2PWAA 3AI3A 3FGZA 4JBGA 2ZJOA 4JP3A 4NZOA 4HDKA 3HFGA 3PIDA 4P80A 4BQEA 1A4RA 2KMLA 4QDKA 4EDFA 5L6LB 2CNLA 5HRAA 5J2TB 1G5RA 3GK3A 2BR5A 5NULA 1FDTA 1VQ61 2EKLA 4WXHA 3H8SA 4LISA 3O8OA 4D4HA 4PHHA 4CEJB 4RD4A 4TTVA 5DHPA 4W5TA 5BWBA 2FR1A 4NV1A 3LVRE 5D7NA 2YU9A 3WB1A 4UPEA 2PT5A 4F71A 4LQ4A 2MSWA 5ADWA 2QUJA 2HZBA 5TRTA 4DCVA 3RIXA 3QFTA 4Q7LA 3ZVLA 3JQPA 3QOXA 1V26A 4Q6WA 4M1ZA 4EK9A 2P65A 1TU3A 2FETA 1X0TA 2ZYDA 5DYTA 2JGIA 3T34A 5GLXA 1M2WA 2WW8A 1CUYA 1PYDA 1Q50A 1GQFA 1A27A 2ZCUA 5AVWA 2OKGA 4WBSA 3EERA 1RI2A 1J2RA 2PKQP 2GYWA 3C8DA 3ONDA 3QYJA 2OXEA 2AKAB 4OHVA 1RYMA 1U2DA 2IEAA 2LXNA 2YV2A 5AHOA 3VDQA 4TS1A 5A0VA 1KHHA 2EP8A 2FE4A 3R9XA 1CVLA 1OXKB 2M9MA 3H2BA 5EUBA 1LCIA 2ZQYA 1DBQA 5A02A 1PL0A 1M8GA 3E3LA 3LVQE 4BN4A 3FOZA 3FRHA 2R84A 3WFZA 1BCSB 1E3EA 4LXUA 4F56A 3G2IA 1F3LA 1EFUA 1NF3A 4G9GA 3PUYA 1G0OA 1TEZA 4BY1I 2X41A 3FKSA 4QSHA 3KKEA 1ZD5A 4JJ6A 4JI1B 2ZXUA 1NNI1 1JEJA 1YU6A 2O6HA 3DHWC 3CO0S 3Q8XB 3RABA 2DPXA 4OJNA 4E1AA 5FTJA 3M1AA 1M1UA 1N8NA 1F12A 1KC81 2IYWA 3MD0A 1KP9A 3JZFA 4JP8A 5BNIA 4UTNA 3RWMB 2KE5A 1IPFA 2A5GA 2YU9I 1ZK2A 4Q7MB 3U50C 1MORA 3VISA 3WA7A 4OI0A 1CEEA 1T8WA 1I30A 4TKZA 1SHUX 1N1GA 2APJA 2CLOB 5DWQA 5BRNA 3MS2A 4L0DA 4ETWA 2WVGA 2RK4A 3U1BA 1V3UA 2X15A 3GXBA 4FFBB 4UATA 4PNHA 4AMVA 5CCEA 3TL2A 2ZDGA 3TLAA 1Q862 8ADHA 2HSZA 4Q5IA 2FFAA 2WKRA 1P77A 2C59A 4GXRA 3KB1A 1NQVA 4I4TF 4RPIA 3PEVA 4K7JA 1QGUA 1JSRA 1ZSNA 4Q34A 4F46A 3GTOA 3PEYA 5E0OA 2ZSUA 1E3WA 2EGTA 3HGQA 3K2QA 5KCZA 4GECA 1PHPA 2CEKA 4UREA 3THYB 1DVRA 1THZA 2EFCB 1MV5A 4MZDA 1XP8A 4XCVA 4OQNA 5A3SA 2HC9A 2XLCA 3WK5A 4BU0A 3DEYX 3WLOA 2OCLA 2ZAMA 3KKPA 3RAGA 4H6XA 3CR8A 1G6Q1 1MPXA 4D7ZB 2YBEA 5CA1A 1BDJA 3TAXA 1FEZA 4YACA 1PJSA 1H2ZA 3QHQA 3R7NA 2ZR8A 2I71A 2FW0A 3TQQA 1C7QA 4GL2A 2PX2A 5IKEA 4B74A 4UFPA 3IR5A 3BXZA 2ZP1A 4MCHA 2FJUA 5ALXA 3S6JA 5A4KA 1CR6A 1NT2A 2EGHA 5IZ4A 3VDXA 3SLRA 1YF3A 2Y2UA 2IEGA 1D4OA 4Q9JA 5KCMA 2SKDA 2PKWA 4CLRB 3P2JA 4FFRA 1NJFA 5IUKC 3Q41A 4MITA 4U2CA 4ABYA 4AL4A 2POQX 4O33A 1JALA 4E08A 2DCUA 3PUZA 3ID6C 3DF9A 1NZDA 4GAEA 1UBJS 3FUTA 4FLMA 2NZJA 3RHSA 3PYMA 1NJ1A 2WE7A 2Y99A 3A6PC 2B83A 1EGHA 1VJTA 2H08A 3ITKA 4LY9A 4RKQA 1V48A 2GAEA 4RMGA 5AKEA 3GAAA 3OFND 2PMEA 4ETNA 3BD8A 5DWDA 3RC9A 3G2MA 3SQMA 3OFSA 4GXTA 4X92A 4N76A 4IIHA 1S2IA 4TX1A 3I5XA 1M1ZA 1KKUA 1V3TA 2XUFA 4TNUA 3S1MI 4DIMA 2UXCB 2QUZA 1VQ8Z 1B8PA 4MRVA 4P4GA 1C2TA 3JQRA 3ZHXA 1PT1A 3NBMA 4CCAA 3CVVA 1MAAA 1MEJA 5F77A 5AW8A 5TMEA 3VZDA 4QUJA 4NCKA 3KJGA 2FR8C 3DT8A 3I64A 3PR1A 5DE3A 4IUCS 2BGUA 1AKUA 1ZCFA 3IEIA 3IAS1 3L1KA 1W1UA 2R7NA 3HUTA 4OU5A 3FAZA 3QXGA 5JMOA 4NH1C 1QHNA 2AX4A 3KR9A 3PFCA 1YBMA 2YV5A 1ADYA 1SCUA 5CJJA 1SVMA 3UJ3X 1JHUA 2B5VA 2FP4B 1GU1A 2FPUA 3MFYA 1JVSA 2CFIA 3MJDA 3R2JA 3ROXA 1VYVA 5LMUB 2VQ6A 4QD3A 1SUDA 1UXJA 3KTAB 4R2HA 1XEWX 1G7CA 3WGMA 3G2OA 3SQDA 4LYEA 3MXTA 4KDCA 4MP6A 4WGGA 1N3BA 4EGAA 5L95A 2Q1XA 4NU0A 4YUWA 1RJGA 2Q3DA 3C3MA 2XMQA 2BLNA 2QPTA 3O7WA 2V0NA 5CBPA 4O2BF 2XTZA 5KDDA 2B20A 1MAUA 4QGAA 2CL0X 1OGIA 3FMGA 1EVQA 1ODIA 1T6BY 3E9DA 4CTKA 4ZJZA 3NBZC 3AVQA 3GRYA 5K0BA 3GLUA 3OIDA 2COUA 2GERA 1LSSA 3NBYC 1P31A 1AE1A 3PUWA 1G59A 5C8ZA 3PDIB 3CVUA 2EZUA 1ZJWA 1EWKA 2QW1A 2HCTA 5ESWA 1B26A 5I8WA 1RO2A 3AV0B 3CX6A 4G1BA 2D1TA 2VAPA 3UAWA 3BGWA 1JEDA 5CX1B 1A8IA 3IPYA 5CLLA 4ZCLA 5FV7A 5JXJA 3F8WA 4ZZIA 4B2LA 1T0BA 2BFEB 1K3TA 4Q3KA 1UJNA 2HIAA 4NCJA 4LE0A 1RM3A 4QTYA 4G5YA 4X7RA 3IP6A 1RKVA 1MJGM 4Q9HA 1NC3A 1Z5WA 3Q88A 3SZLA 4EG4A 3QMMA 4RVHA 4BLSA 3CJTA 1XNQB 1QVGY 5LXTF 5B36A 3T3OA 4B47A 4CPDA 3F3FC 1OC4A 2V7VA 5G0UA 1W9HA 2VR1A 4OOEA 5DM2A 4PU0A 3KKQA 2QLNA 3AVXA 2CLKB 3QUTA 3QVVA 2PMCA 4CG2A 2RDMA 1DAPA 3BA1A 3MQ4A 2HDNB 3M4YA 4K86A 3TJMA 4NNOA 3NEAA 1XYYA 4ZV4A 1OAKA 1GKKA 2YTZA 1ZM7A 1G9TA 2BBWA 4I4NA 4UAUA 1J9ZA 4YRRA 2VH1A 4PS0A 3ZV3A 3J7TA 4C04A 3RYCB 3U56A 1GKYA 4N54A 4UMFA 2Z04A 2JLWA 1JWAB 4BLWA 2F6RA 3WB0A 4AVYA 4ESOA 3M6UA 3RVSA 1B41A 4MQBA 4M1OA 1P61B 1WXXA 5K0TA 1QQAA 4LDJA 1M1K1 1B74A 1RQFA 1J56A 2X2PA 2FLWA 2Y1KA 4P35A 2XT6A 3BF8A 3SJAA 3IQWA 1IBSA 4CL0A 4R0MA 5BR7A 5LQCA 1Q6YA 2GN1A 3VU9B 1U5CA 4NMWA 1Z37A 2QREB 1VJDA 3EUWA 1SD2A 3MTAA 4ZAXA 2UXBB 1AT1A 1SWVA 5KPDA 4W1RA 2GEKA 2VZ0A 1TRKA 1GCIA 2Y76A 3I23A 5JARA 1A9ZA 3VVBA 3PI6A 1ZVJA 1RLJA 2YRXA 5A03A 5LDGA 5C7OO 3LBYA 3VR2D 1CB0A 1E89A 2VQ3A 1Q1NA 1JR2A 1NQAO 1Y89A 1W30A 2CJFA 1V95A 2V9PA 3CYFA 1ZOSA 3UOWA 1ECBA 4XVUA 2G8LA 2G0AA 4XX1A 3JSXA 3I9V6 4P86A 1NASA 3TTVA 2CLIB 4H2DA 2QTNA 5COAA 4B79A 3T06B 3NC4A 1V1JA 1WUJS 2IEYA 1Y7LA 4WZZA 4R69A 3RSCA 2O7SA 2TMGA 2BEUA 1DEAA 4FJ2A 3T94A 1QSGA 4KJXA 2AKLA 3FBWA 3L3BA 5BSMA 3GTMA 3N6XA 3WZMA 4EG1A 1OSNA 4ZAFA 4MJ7A 1AV7A 2XSZA 2J6IA 3DW3X 3SWWA 3RVBA 2J30A 2PK7A 4HQ0A 1KIMA 4UAGA 3GJSA 3BHNA 2WHEA 4YRQA 2XCUA 2BF7A 2J5BA 2P91A 4GVXA 4OB6A 1BTOA 3HV0A 1IPHA 2IEZA 3IX0A 1N2BA 4ME6A 4QL3A 5GQSA 5GZ3A 4NYIQ 4CCSA 1Q7Y2 4X64B 3QQPA 1C1YA 3I8SA 2ZUFA 1VPDA 1E3LA 1Y1VS 2QB5A 3C43A 4BATA 4F3CA 2K5RA 3AHDA 3JD3A 2OYSA 2PGAA 5T67A 2X23A 3G5MA 3AEUB 2GDZA 5CNIA 1P1IA 4Z9YA 2YNMA 3NS7A 5L7WA 5U9CA 4HLCA 2IK8A 4HAUA 2W43A 3QSGA 2RKBA 1Q861 2FMFA 3G79A 3QPUA 4L15A 4LTDA 3TNJA 3BJRA 4NCBA 4ZK6A 1U1EA 2QKYA 4YMSA 1A0OA 1OXTA 1XCJA 1B6RA 4BFYA 2Y27A 4OJYA 2ZDQA 5EWJA 4Z8YA 3UMYA 2VATA 4XM2A 2CNWA 1THGA 4HR7A 5G1OA 3U4QB 2F43B 3CURA 1MLDA 1PDVA 3QMWA 4RZQA 3TZHA 1QF6A 3K1AB 1EVKA 4ECAA 1XPRA 3QPWA 4D9NA 4B3JA 5TVKA 1Q22A 4Z1MA 1HFEL 2FPMA 4BMPB 4DMCA 1G3QA 1YA6A 2HBQA 2DKOA 2IXEA 4MVWA 1JIJA 1AK2A 1SB8A 4XWYA 2R8PA 3QTLA 3S2YA 3JS5A 3LKDA 3HOZI 3HXMA 2EX4A 3ZE0B 1TQDA 3RTEA 4UFOA 4EW6A 4QTZA 1V39A 4RIGA 5FLKA 2ACVA 4TM7A 3RJTA 2DB3A 1FSFA 1DINA 3ZIAA 4B87A 4R3UC 1F8XA 1SXJB 1LPAB 2WPNA 3G9UA 2C2MA 1DIBA 3I0MA 1LQUA 3RFUA 2O06A 1ABFA 2I4OA 2V4ZA 4DWJA 1Q91A 2YJNA 3CB2A 4LFBB 4PGGA 1ZGJA 4M9ZA 2VYQA 1SU7A 2W04A 5GINE 2C07A 3UB4A 3PNPA 2IOFA 4F96A 1G18A 1JXQA 3S2FA 4G81A 3WV4A 2LDBA 3ZW8A 1MRNA 5AM5A 4QPPA 1GPBA 2R2GA 3UCEA 1GITA 3CC71 2PLNA 2JKVA 1GQSA 3P0FA 3QGMA 4M1YA 3ZV4A 1QYDA 2VCHA 4UARA 3R7LA 4CODB 2WTNA 1KGSA 3HL4A 1KC3A 5DP1A 3SIWA 2Z2IA 4CDNA 3CME1 2OWEA 1YIJ1 3UFXB 1AHNA 2JUBA 3KZVA 5IWAB 3MZLB 2ERXA 3EPRA 3PE3A 3ND5A 4OFZA 4YVFA 4C6SA 1F1BA 1CEQA 1M33A 4L9SA 4V0RA 1I6KA 4YDHB 3RUAA 3TGWA 3W8EA 4I5DA 2IZ7A 4Z3DA 3GP8A 3GMSA 1EH5A 1GT91 3ZZNA 4PWYA 4OQLA 2GNAA 3C8HA 1JZTA 3FPAA 1T36B 3AUAA 4L8FA 5D6NA 3KKNA 5A6SB 1UZNA 1RABA 2ZB8A 5HCIA 3T3DA 4AN0A 4DJEC 2JAHA 2NT3A 1IE3A 5DN6A 4EKGA 4QWMA 3GPDG 1BKDR 1KXZA 1H9CA 2JS4A 1GPH1 3RT1A 4EPTA 3W7VA 4RJ2A 2AN4A 3LM8A 3FSGA 1WLYA 2I2CA 3FG9A 3PD1A 3PCTA 1PQHA 4Y2TA 3LCVB 4EHKA 4Y6SA 4DMLA 4G8BA 3JQ7B 5KYWA 3RUCA 2JGDB 3ZK9A 2VNIA 5HEKA 2F9MA 1SCNE 1FP7A 2NU7B 2IYLD 3BJIC 3CM0A 5CPFA 3H6GA 5IUNC 3U4IA 1MAWA 3LDAA 4QUIA 4EGQA 1K731 3AJDA 3ZQJA 1GZ7A 3PTZA 2Z9BA 1M2VB 1BX3A 3NCHA 4Q03A 3AG5A 2AD5A 1Q0UA 1OPRA 1Q0QA 3QQ7A 1G8SA 4GS5A 4RYLA 5LLTA 2Q45A 2BHRA 3P0JA 1KPHA 3PGA1 3G2HA 2O0KA 3A2NA 4I1RA 2ZK7A 1KMHA 4GQAA 1FLNA 1YR2A 3H11B 4U2FA 3G6E1 1BD4A 13PKA 2PZ8A 3QTTA 5FBHA 4GRDA 1W25A 3H1AA 1M6VA 2AQHA 4LE2A 2O3JA 1N2CA 4NG5A 3ZCQA 1YR9A 5CYGA 2NVTI 2ZT8A 5LYYA 3ZTYA 1GNSA 1RBZA 2ZRNA 2W6NA 3EXIA 1XDGA 4D43A 4QIWA 1Q5PA 1EDOA 3ZGVA 4UTOA 5JT1A 4NR0A 1ODFA 4DCUA 1Y8QA 2VN8A 1RM0A 3LTNC 1N5KA 1TK9A 1OXVA 2AG1A 4A3LI 4XSHA 1B0AA 1O0SA 3OBIA 4TSFA 1UMCB 2D2EA 4M0CA 2H16A 4AQYB 3JD4A 2VF7A 3GRAA 1NVTA 1UHEA 2J3JA 2PZEA 3GB9A 3HBMA 4G86A 5CXUA 4RXTA 1JIIA 5E1DA 1SUBA 4EYOA 3GLFE 4DA7A 5HZKA 2XXAB 1AO3A 4F3TA 3FJYA 1FNNA 2ZZKA 4O1MA 4FGKA 3N0VA 3QBTA 4MICA 3KWMA 5D1NA 3U7IA 3UTDA 4B45A 3SOZA 3NDBB 2D0IA 2W22A 2GU2A 1DSSG 2C54A 4NATA 4IVPA 4P0PB 1HQCA 4IG9A 5K51A 3ENZA 5AW5A 1KR2A 1B6SA 1ISRA 1WULS 5G0WA 4A8JC 3RYHB 5JS6A 3F6CA 1JEYA 5TS2A 3D3NA 2ZXEA 2OHVA 3ZV7A 3WYAA 1V4NA 1ULUA 2Z8YM 1ECFA 2PPVA 2V55B 1AB6A 4IXTA 1AF7A 1E60A 4KYVA 4IPTA 3V8BA 1O08A 5EAIA 4D3FA 4MIEA 1D4FA 4HBGA 1DADA 1LBSA 5SICE 1O5TA 2AQIA 4KUGA 2XMRA 3DHYA 3B2EA 4I9GA 3D5QA 4CV3A 1KH3A 2GPYA 1OW3B 5J2TF 3IL2A 2IXFA 2E6KA 3B3GA 5TVGA 1I3KA 3HWSA 1RAIA 2VHJA 1ISHA 3HNRA 4FT2A 4JSRA 2J8ZA 4DIEA 3EIUA 4IR7A 1DB3A 4KK4A 3AUYA 5EP3A 4WOCA 2UUBB 3IESA 4M37A 5IAGA 1UMCA 4I46A 3UGJA 4WLEA 3DFKA 1L4MA 2VDMB 3RRFA 1OI2A 1G4UR 3P0IA 3ZDCA 5JUWA 4X6AI 1GLVA 2QR5A 4YY3B 5J2UF 2DSNA 5I8ZA 1RQ7A 3VHQA 5BN5B 3GF4A 2RT9A 2JJ1A 2KW5A 1DLIA 4I4IA 4M98A 2PUJA 3RUDA 3SE7A 4D98A 5KJFA 1FRQA 4LS3A 3TX2A 1DAKA 1ZJ5A 1P0CA 3SNKA 3B20A 1E5DA 1GZDA 4MDYA 4OL9A 5AVJA 4DWWA 2AFHB 4K28A 1QB7A 3F2IA 1GPAA 1RI5A 2FFJA 5DTMA 1DMRA 3E9RA 4ARZA 2Z83A 1NY6A 2X4IA 3EBLA 4HT3B 4P3NA 3ANYB 4O2AA 1RE0A 1Y7TA 5E3HA 5FLYA 4F85A 4CCYB 1PWHA 4DS3A 2GBCA 2H17A 4JBLA 4NOJA 1LX7A 1E5VA 3DXZA 3K0AB 4MV0A 5BNFA 4E5UA 5LNK1 4JYMA 1KEEA 1TU4A 4RENA 3VTKA 4CLEA 3WIBA 5FD8A 5KYXA 4HB0A 2XTNA 3OX1A 1J9EA 3OT5A 4BZPA 3TEFA 1CXZA 4TN5A 4BV3A 2A59A 1UM8A 2FPLA 3BDIA 3GZ4A 1EWRA 4D2IA 4HDCA 2TS1A 1ZB8A 4LGMA 1LB1B 2GD6A 3I34X 3BQ9A 3PDWA 4ZOQI 5JOQA 1A9PA 4R1OA 4UHEA 1ZXLA 3HOWI 2AI1A 3WYBA 3PHGA 5CFRA 1U81A 3JTMA 1IZ7A 3RVDA 1XNGA 1A5ZA 4J2TA 3KT6A 2GBLC 5IC4A 2G7ZA 1F2TA 2X5OA 1E0SA 2W6JD 4D26A 3MERA 4NH4A 1JLHA 4I9UA 1FP4A 1V96A 3MUOA 3ZIAD 4YX9A 1BMTA 1J7JA 2ZJ4A 3SFTA 4A03A 2IELA 1S2LA 5BXYA 3AH8A 2PLAA 3HCWA 1PK8A 1S4MA 4U4AA 4MAMA 1UODA 2GK3A 1Q1BA 2ZJAA 3D8RA 3FFXA 3OF3A 1CQWA 1NF9A 4KDFA 1ITZA 4NFSA 4MXUA 1K7YA 3QF7A 1GT6A 1T5DX 2XWPA 2X5XA 4ZAGA 1H2WA 3PX3A 1AJEA 3GRRA 2MYPA 1QH8A 1SG0A 5B7QA 5K99A 3VYRB 3D59A 1AHHA 1SNYA 1OOEA 3I9LA 2Q7OE 3O73A 4PR0A 2GR9A 2RB5A 5FR1A 2I78A 5A9RA 2AE2A 4RV0A 1KJNA 4K6MA 3MJHA 3VR6H 2GWRA 3RS9A 3U7QB 3VYVA 1PLLA 3W2GA 3LBHA 5JMTA 2YKGA 4OX9B 4JLNA 3PL1A 5EMMA 3WJ7A 1X7YB 3B3FA 4M0DA 1W5FA 4E6EA 4W5QA 3K1AA 5I7RA 2DBVO 4TYWA 4CQLB 3U5ZB 1XTPA 1KZ1A 4U39A 3NHRA 1K0FA 1K6EA 4G85A 4UE6A 2OTLZ 3K6SA 2C7QA 4ZTBA 2J3QA 2FSIA 3JR3A 6Q21A 4NZPA 4B4DA 3SIRA 2XWQA 3G8DA 1CHNA 2DSTA 1J23A 1KGDA 2OC4A 5D7BA 3FLMA 4BFWA 1PQEA 1RO4A 1POWA 5IEBA 3MMZA 4PINA 4W7HA 4HDRA 5DO9A 1PX0A 3P52A 3X2LA 5K4AA 5BW8A 3NEJA 2BTQB 3EUFA 1J99A 1YV9A 3HDYA 1JAHA 1X7WA 2WR8A 4OIMA 4XIJA 5EZYB 2GJ4A 1TD1A 3FYHA 4ZCPA 5AESA 1RXVA 2TMKA 2D74A 2YVLA 4Q9NA 4EB0A 2XTMA 5DOVA 5C3EI 3G9TA 1OILA 1X38A 4MB0A 3ZDAA 1TGYA 5T3YA 1NV8A 5C4XI 1RR6A 1X14A 2BKAA 1ML4A 2VRNA 4KFSA 5FP0A 1XRPA 3CRRA 4IHAA 3WKAA 3CCMZ 1XG5A 4F11A 4JJ7A 1PS9A 2IXGA 4B7ZA 3OZDA 4IMRA 1TL7C 3AP2A 1IN6A 4MPDA 2W83A 3V2UA 3GLGE 3RLFA 2O4CA 3ONFA 3OM1A 4U9IS 5JSFA 1QFJA 2PTGA 4MSUA 5PNTA 1S2MA 2HA2A 2R92I 4WESB 3TG2A 4AUNA 2BKLA 3NT5A 4AD8A 4F9GA 2D2FA 5G1NA 5CB0A 4BNWA 3D6WA 1C81A 1H0KA 3HGMA 1HT1E 3LQFA 2ATEA 3WAKA 3DAPA 2VUUA 3KRTA 4N5IX 2O48X 1EFTA 1MFZA 2XQJA 2FX2A 2WTBA 3FXAA 2E21A 5BO5A 1M10A 3IVCA 1PG5A 2ILTA 2J67A 3CTPA 3LP6A 3FHOA 3R5XA 4GC5A 4GKAA 1R4NB 5HK9A 4JP6A 4NEQA 5HCUA 2L17A 3SLGA 3AL0C 4AC9A 4IICA 3VMHA 1AMUA 1AZTA 2HU5A 3LGAA 4Y2SA 3M6XA 1K9M2 4B3BA 1R0XA 4S2EA 3PFKA 2BFFB 2WJ3A 5M29A 2C9CA 3PYXA 4LG1A 5IK2A 3R9IA 1V7QA 2P2DA 3PS9A 3WHLA 2O23A 3R74A 2H5LA 1JP7A 2BHNA 1H3EA 2FZLA 1DQYA 4L22A 2EKDA 1NBME 3NTUA 4CCWA 2BH0A 3HDJA 2ACWA 3GEGA 3RVLA 1YJW1 2BFOA 3NWBA 1AUVA 4QYTA 3TS1A 4AY5A 1T35A 4MP8A 4YFYA 4ZYVA 2Z4SA 4XGQA 1XQWA 3PPYA 2PT9A 4B09A 4O4IF 3C6BA 1ISPA 4HQNA 3EZNA 2O57A 2QAGB 3UT6A 2HNBA 4M7RA 1BQ4A 1I1NA 1TJYA 4IDBA 1WDLA 1BEEA 4X65B 4Z5XA 2WDZA 2HK6A 3M3YI 1YJ8A 1VQ1A 3VMMA 2IBMA 1TJ3A 4F2WA 5MF6A 3O2SB 4PQRA 2JL1A 1T91A 2KSQA 5H83A 2NP6A 1AQUA 1J20A 3P2IA 5L4NA 3H9QA 9MHTA 3CC4Z 1BU8A 5EZ6B 1U8XX 1PPYA 1YS2X 2H0AA 4N12A 2OA0A 4B4UA 3WGLA 3Q87A 3RIHA 4GMGA 1XL0A 3E22A 3GJRA 3WLPA 3CKYA 2G67A 2OBXA 4BCBA 3L7KA 3QUBA 1BNCA 1Y7PA 5LJLA 2DWQA 2OHHA 3IVAA 3NT2A 3A6FA 2NWQA 4MWCA 3WQQA 3DAHA 1CV2A 1MO2A 5DCLA 1SCJA 3TMAA 3Q98A 1Z0ZA 1Z8FA 4NBTA 3OTWA 1M3SA 1HE3A 1W0KD 1CR5A 2XVAA 3SZ3A 4HXEB 4MQLA 4PHCA 2WTEA 2QDKA 1OFVA 3B12A 4PICA 2GZSA 4DR1B 2ZJ2A 3GOHA 2AGVA 2J0EA 3GA7A 2O5EA 4RDCA 4FERA 2PMZA 3VKVA 2ZRFA 4U2DA 1WWKA 2ECFA 3Q0TA 1OH8A 1Q811 1JIXA 1Z7GA 4O0MA 4YRLA 5F9FA 3LUHA 1MGOA 1JTVA 3BZBA 4RH3A 3UK6A 3WWCA 3DCYA 1B2RA 4UEQA 3M8KA 3HK2A 1Z63A 4G0PA 1REQA 1Z0FA 2QLMA 2OHIA 4D9HA 1Q7RA 3CH4B 5CJPA 2WAMA 4TMVA 5CVJA 3VNQA 1NUHA 1L6RA 3F1LA 3K1ZA 4P54A 1N77A 2VTKA 5EHGA 5CAEB 1Q0SA 1QU2A 4QLOA 2BC9A 4K1XA 3DZFA 2Y66A 3FMIA 2WYHA 1KPIA 3NKLA 3OPYA 4JOQA 4KE7A 1KI3A 4QQKA 3VZPA 1MP0A 1SOVA 3HOXI 4NF2A 3WRXC 4PNEA 5MHTA 2ZVQX 1RC8A 5AVTA 2V6GA 1J39A 2AK2A 1FNBA 2DULA 1BMQA 1KEPA 1FDUA 2R6ZA 2ZSBA 3G8CA 4QUAA 4DMGA 4ECEA 1F5NA 4NU8X 4OHWA 5A2GA 2ETVA 5IKPA 4PRZA 4ZXFA 1T2FA 2OG2A 1HFJA 3TI9A 4F3NA 3BIOA 2PRYA 1YDHA 3HDTA 1V9CA 3RDPA 3AOGA 5FKJA 3GQBA 3IEUA 3MBOA 2Z5VA 4BLOA 1L7BA 4UCXA 2BTQA 2I4RA 5EJ4A 5CNKA 3MWEA 2DKNA 2JGLA 1W6UA 3CLRD 1VQLZ 4M0MA 1EVEA 3KLOA 3PR2B 1DKLA 1QG6A 4NY1A 4PC7A 1W6RA 1OI3A 1N7GA 4UHDA 3UKJA 3ZLJA 1EK6A 5DU2A 1YBVA 2ZT7A 2O8FB 4EZIA 3ZWYA 1D8AA 1FTSA 4J1SA 4DSOA 2O0JA 2WF7A 4C0WA 3OKFA 4TXNA 1A95A 2JANA 1NVKA 3T5BA 3WBBA 1US8B 3O0TA 4DRXB 4DA4A 3UWPA 4EKIA 1S4QA 2QYSA 3C41J 4TKVB 3KQHA 4RV9A 5JYDA 1SFOA 4LYDA 3KIPA 4GX2A 4ZZ2A 1XDSA 1TA4A 4B81A 4CKEA 3O47A 1B15A 1B0ZA 2DQZA 2R65A 4WNYA 1JIUA 4DDMA 4GI2A 4AKEA 4BNDB 2PUDA 1G6KA 1HZJA 3I92A 1OBVA 1EK2A 2MOKA 3X2GA 1FFHA 3OCZA 4GPTA 3QKRA 1UDBA 1QRAA 4PFSA 5IK2D 5D84A 5JBQA 2A9VA 4FS8A 4YPOA 2NYVA 3TMYA 1UADA 2DPHA 5JH7F 2VH2A 5C53B 2BE7A 1PNVA 1K88A 2R6GA 2RONA 4KGXA 2IOFK 4KQIA 3SC2B 4EECA 3I32A 4BO9A 2ORIA 5EXTA 5CEJA 4AKHA 1LZLA 1RP1A 4EGCB 3C1AA 3PVZA 4YWJA 1I6WA 3QYFA 4NQRA 5I7EA 2C96A 1RXWA 4MGZR 4YRPA 3S8EA 5K3OA 3KUUA 1IJBA 2AMJA 2NV2B 1FP4B 2Y05A 4R9VA 2BF4A 2B78A 3RC3A 1FDIA 4M8SA 1GM5A 3VKUA 1IM8A 2BM0A 1QGZA 3Q4GA 1QH8B 5TGTA 4GR4A 4QYWA 3Q5DA 2AFIB 4I50F 4EFNA 1Y9DA 2J85A 1XXHA 3QUAA 3R1IA 4HH0A 4CFSA 1Q0TA 3THWB 2YASA 1ZL2A 3FPKA 2ZAOA 1KU0A 1L5HA 1JTFA 4DANA 2CFCA 3IFSA 4B6PA 1NDHA 1SEPA 2HQRA 3G2PA 5HDQA 4Y2PA 5CFNA 5LJIA 1ST3A 2Z2JA 4QHYA 2MSEB 2P2GA 2Q2OA 4IXNA 5D3KA 3SSOA 2QPLA 1ETUA 5DLQC 2GBPA 1SAYA 3DT6A 3TLMA 1SKQA 4N41A 5KSOA 3QOYA 1UBHS 5ALNA 3VOBA 1ZD9A 1FY2A 2X13A 1VTKA 1OIVA 3C74A 4J0EA 4OF4A 2IJGX 4PZEA 3A7EA 4J3NA 3SZUA 3V8QA 1ULAA 4RK7A 1S8OA 4G4SP 2XQKA 4W8HA 4JVMA 3WWEA 3GGOA 2FWJA 1IOWA 4B7AA 5THKA 1E3SA 1U3VA 1GP2A 2A0KA 4WLOA 3L4BC 1L8FA 2QQ5A 4Y98A 4EUSA 3S81A 3RF7A 1FIUA 4WXYB 4TYNA 1C9KA 1HDZA 5C2JB 1PR5A 1Q3TA 1JKXA 1QH0A 3SUJA 3OJEA 3QFHA 5ELMA 2P6NA 2ZQZA 4YREA 5HE8A 1EQ2A 4P4NA 4P3OA 3L04A 5JXWA 1IJKA 2C83A 3OPVA 1R8YA 2H1IA 3M6VA 4IWYA 4Y7CA 3UWDA 4YV2A 3G68A 1TTHA 4WZAB 5DULA 1IXSB 3KOMA 4WKNA 1P9OA 3HP1A 4FOTA 4A6PA 4TV9A 1VQ5Z 2CXOA 4R5MA 3SU8A 5SZJA 3FF4A 4JQYA 5JDCC 4D0LB 3OEHA 2JCYA 3T8YA 1KVQA 5JCJA 4IIFA 3U2QA 5LKRA 3SGLA 3AY6A 4UHBA 4EBFA 1ES9A 4GLLA 2FMTA 4LTMA 3LF2A 2WUWE 1E9VA 4FZJA 4MA0A 1L4EA 4QQNA 3OCUA 2WKSA 4LQLA 2HL6A 4NYIR 4ZMBA 4D4GA 3RVOA 4YYEA 2JA2A 3OQPA 4ZO9A 2RJOA 5A5DA 2OCYC 5ESDA 2R68A 4AYBA 1TLFA 2GEDA 4C6RA 2FXVA 4AOKB 2HREA 1JE0A 1MGPA 2QQFA 2XNDD 4XWWA 1UT8A 2PH1A 2R4QA 4ZT2A 2AJTA 3NC1C 4YMGA 2FU5C 3ZHQA 1C8VB 1ZNWA 3RROA 1UJ2A 2E0IA 1JDUA 4E32A 4Y1GA 1OV4A 5IRCD 2WKWA 3NH6A 4L4ZA 2OAP1 4QNNA 3A2MA 2DT8A 3CB4A 3MTDA 2JJ8A 3PUJA 4NS4A 4EABA 2BEVA 3X2PA 2EP5A 3Q85A 2AG5A 3WC4A 1C0EA 3BJEA 3VZSA 2ZYIA 3IQZA 3FNHA 1RADA 2W2KA 3L05A 5JW6A 1NVBA 4H7PA 2NVYI 1TWGI 1JYFA 5I7OA 5TJHA 4PPNA 1F8YA 3PG5A 3VI4B 4PANA 4ZC1A 4E15A 3UHPA 1QCDA 1JLMA 2ARKA 3BMCB 2JFBA 4WLNA 3K0BA 2HFJA 2DVMA 1Y34E 1L9KA 3MWFA 2EAUA 4Q1VA 1FRVA 1E2JA 3FPEA 2YN2A 1M0SA 2GKOA 3G2QA 1CYDA 3RRNA 1DFHA 1W88A 1VKNA 2CYAA 1FTWA 3FCYA 3OIYA 4PCLA 2GNOA 1OBFO 4BNHA 2QVCA 4X5OA 1E9FA 1O94A 4UEOA 4GH5A 3ONNA 3R5JA 1PG2A 5E6SA 1ACLA 5E1MA 2PFKA 4AJEA 5JDIA 4C76A 2QE7D 5GGXA 1FQOA 4RVFA 4A3CI 1KFJB 2P3OA 3LL7A 4JUAA 4IIUA 1SFOI 4L08A 4DIUA 3NHSA 3EXHB 2HHJA 5DSZA 1RFGE 4MGHA 5EWJB 4ZIRB 2WJVA 5EFZA 2ACKA 5LWHA 2NADA 3F96A 1JG7A 3THYA 1LDMA 2QW8A 2CHQA 3S55A 1DP4A 3OE5A 3WIUA 1GGMA 5KQLA 3ZWQA 4P7FA 3EVFA 2CXNA 3GJYA 3GLIE 3R7SA 2W2TA 4BEJA 4ED9A 1OFIA 1R9NA 1XRSB 1YS7A 3H13A 3MMPA 4QATA 3FBTA 3SF0A 5LMZA 1A72A 5J4YA 2R85A 4F0JA 2PD4A 1R37A 2AI3A 3F4KA 4F5YA 4U3JB 2H2IA 1QDUA 4YV1A 5BT8A 5FI0B 2M98A 1AGPA 1U80A 1SHJA 3A1DA 1DS6A 5BQ5A 4GOMD 2BJWA 3ETDA 1L4UA 5ALUA 1AKEA 1MUUA 4XUCA 4YJ2A 4KZPA 1QXSA 3CF2A 1MNQA 1RZVA 1Z25A 2Y1EA 4F97A 1B14A 1TCAA 3M3HA 3EDOA 5D1OB 3VC1A 4ZT3A 4B3FX 3GUHA 3NEYA 2BFPA 5K0ZA 2R6FA 3I1YA 4DMKA 3WL4A 3QWAA 5B57C 5FWDA 4A27A 2UYHA 3DHVA 3UHJA 3HA5A 3VR4D 2VF8A 1JEYB 3AB3A 2K4MA 4CUZA 3K0CC 3QLTA 3IYLW 1BU5A 1WDKA 2IUTA 2H4HA 3LP5A 2XRMA 3MINA 3M0EA 3FLEA 3OQJA 3L92A 4MQEA 4RGQA 5EQTA 5J4KA 2P67A 4HDKB 2FN8A 2D5CA 3QUCA 1CWUA 3MLBA 3MTJA 4MUJA 5A5VA 4X8LA 4HQOA 3RGWS 3O1IC 3TLYA 1RAHA 2AMVA 2DUNA 1N0HA 5AHKA 5EVJA 4BLVA 1RRPA 2XOXA 3PRYA 5CCXA 4TOIA 2PH7A 3ROKA 1NBIA 3D9QX 1K6MA 4JHXA 1OAOC 1TZJA 1ECCA 3EZ9A 2A8YA 2WD8A 3RVKA 1MQ9A 1H2FA 3R6GA 4IMJB 3H16A 4J3FA 2JA1A 2Z5LA 4KVAA 1USUA 5EUQB 1XEAA 2DJIA 1OWNA 3JAMA 3Q1KA 5JJKA 1RQNA 1ZJ6A 1NJ2A 1T9ZA 2JATA 2QV0A 3I39X 2O2JA 4EVRA 4P0QB 3W8FA 4B2PA 3T6KA 2JI7A 4BP9A 3KOOA 1RFLA 1CD5A 3NTLA 2NUTA 1ISJA 4FWBA 3VV2A 1KMHB 4XQEA 3PD0A 5C7LO 1J1UA 5ECYA 3E1SA 4AP5A 4EWLA 4LF8B 3OTIA 1BAPA 1ZR4A 4RPGA 4CLOB 1I7DA 4B3IA 2QR1B 4ARZB 3M3PA 1EQAA 2WZDA 4R83A 5BWOA 2P9CA 2QVLA 3T1TA 5ECGC 3KETA 4O5AA 3M2TA 1RIFA 1VL1A 4FINA 3CZMA 3F5FA 3JTEA 1OX4A 1T8PA 1TUBB 1ZRNA 2PMWB 4M0FA 4N0PA 4ZCRA 3MRVA 3KV1A 1SR8A 3FN4A 4HGQA 3VOAA 5JBIA 4EAQA 4ABTA 1DNPA 4MUGA 3ZDZB 4BVJA 2VTBB 2QD4A 1Q0RA 2PSDA 4B46A 2XMCA 3VB9A 4O3MA 2WLTA 1C3EA 4W5HA 4DJTA 2XI4A 1NXTA 4BLQA 3IBFA 2B5WA 3ONWA 3CMA1 2RG7A 1FYFA 1F7VA 2PT7A 1IONA 3TTWA 1OLSB 2JGKA 3CZAA 3LCCA 3UJBA 4QXOA 3VPAA 4AAYA 2Q5IA 2JJQA 3EIHA 4B3GA 3BREA 1U0RA 1L3CA 2ZYVX 3H83A 3VYTB 1UFQA 1N2SA 2HJ9A 3MGAA 5JVDB 1P8AA 3OIGA 4IIXA 3M4XA 1PSZA 3AEKA 3RSSA 3DGEC 4ZCQA 4EA8A 3T5GA 2C4HA 1PTKA 2AJLI 1QGYA 5B1YA 3IQGX 3HYNA 3A05A 2FZGA 3LMKA 3PEEA 4BGIA 5CAEA 1M0WA 2OBBA 2CHEA 3BSSA 1NMSA 4GKVA 4KBYA 4C7MA 1F9EA 4XFKA 3KUDA 2A58A 4IFEA 4L0QA 4BKPA 2PCJA 1IXRC 1I5RA 1YK0A 1ZVKA 1WKBA 1KAOA 3RUFA 1Z03A 5T6MA