2IV2X

Reinterpretation of reduced form of formate dehydrogenase h from e. coli
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
715
structure length
697
Chain Sequence
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Formate dehydrogenase H
publication title Formate-Reduced E. Coli Formate Dehydrogenase H: The Reinterpretation of the Crystal Structure Suggests a New Reaction Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 253
structure length 697
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00384 Molybdopterin Molybdopterin oxidoreductase
X PF01568 Molydop_binding Molydopterin dinucleotide binding domain
X PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 2iv2X01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2iv2X04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2iv2X02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 2iv2X03
1TWGA 5FTMA 1R7RA 2E7ZA 3TIWA 1PQHA 4GA5A 4KDLA 5T5ID 1I3QA 2R93A 1QCSA 1Q16A 1KQGA 5C1BA 2C45A 4CS0A 2VPZA 4CRZA 1R27A 3GTJA 1DMRA 1CZ5A 3IR5A 2V45A 1G8KA 1EU1A 3CF2A 2WAQA 4AYBA 1WCMA 1H0HA 2JA7A 1PYQA 4CRYG 3HU3A 1SFOA 3CQZA 1E60A 1Y4ZA 5FTKA 2YU9A 5FTNA 2JIPA 2DMRA 2NYAA 5FTLA 1I50A 2JA5A 1TWHA 3H0GA 2VPWA 3GTOA 1TWCA 1QDNA 4RV0A 3GTPA 4KO8A 5EPPA 1PQFA 4AZDA 5B6CA 4KDIA 3FKIA 2Y0SA 3QQ8A 1TWFA 2R7ZA 1FDOA 4KODA 2JIOA 1CR5A 2NVYA 3HU2A 1E32A 1DMSA 1E61A 3ML1A 5DYGA 5DYIA 4AAYA 1K83A 2R92A 1Y5IA 2IV2X 1TWAA 1AA6A 3QQ7A 1UHDA 1UHEA 1AW8B 5T5MD 2VPYA 4KLNA 5FTJA 3O5AA 1S3SA 3TM7B 4D7ZB 2B63A 3GTMA 1PPYA 1PT0A 2JA6A 1YLEA 3QC8A 2EEOB 1G8JA 1CZ4A 2NVXA 3HKZA 4GA6A 1SIWA 2PMZA 1OGYA 2E2HA 2V3VA 3PLXB 1PT1A 2JIRA 4QIWA 3GTQA 1Y1WA 3IR7A 3GTLA 5GLFA 2IVFA 1TMOA 3DMRA 1FDIA 1IW7D 3GTKA 2JIQA 4C2MA 5C18A 2VPXA 2NAPA 2KI8A 3GTGA 1VC3B 2JIMA 3OUGA 1E18A 1E5VA 1Y1VA 3HU1A 2WB1A 1PYUB 1R9TA 3QWZA 1H5NA 2PJHB 2VUMA 3IR6A 4AONB 4AOKB 2E2IA 1KQFA 1PQEA 1WLFA 4DMRA
chains in the Genus database with same CATH superfamily
1YK0A 4UCQA 1E89A 2HIAA 4UZSA 3GR6A 2DY0A 1TCVA 1V6SA 1AKEA 3FOCA 3C5CA 2OVFA 1W1UA 2R4UA 3OQBA 4ZVUA 3SLRA 1BW9B 3F71A 3OHMA 4D2IA 2RBLA 3EUFA 1IUNA 3DQQA 4BEJA 1AQ6A 3ONVA 2O2CA 2WU4A 1DXQA 5EPUA 1L5YA 1E69A 2HWWA 2Q7OE 3LL7A 1FPMA 2QAIA 1M1K2 3USES 3X2IA 2AXEA 3WLKX 4US1R 4F9GA 3F6PA 4BGEA 4IWYA 4OJQA 1VQ61 5BSRA 3VM6A 2P9JA 4BC0A 1OX6A 3F8SA 1NRXA 2VZ9A 4BGDA 4AUMA 4BFWA 3UFXB 1DOZA 5HKAA 1H4SA 6PFKA 2AE1A 2ONJA 4POAA 2F7SA 2ZQYA 1U3GA 5K8LA 2VQSA 2DQZA 5F9FA 1QVRA 2WOJA 5FTLA 1RT9A 1XZBA 3HN7A 4CM3A 3RQIA 2IXBA 3CKMA 1JEYB 4US2R 3HKDB 3AUYA 3EHDA 2ETXA 1WU7A 4N5MA 2DR0A 1CRZA 1QMPA 2Q5HA 2XMZA 3IP1A 3L8DA 3EVGA 4MS3B 2FZKA 4E30A 4ZT4A 1OFUA 4ZGBA 3EPJA 4V39A 5JSZB 1PGNA 1LNSA 4QG3A 2Q5EA 5DW0A 4RCYA 1EAMA 3A4VA 1VRWA 2Z83A 4XWOA 3RUIA 4O4JA 1H4VB 1AKUA 3CH7A 5JNRA 2LKCA 2WWHA 1TTPB 4MJ7A 3WGIA 3HVIA 1BA2A 4MR9A 2CYBA 5JASA 4W82A 2A9FA 4L9RA 4ZDIA 2YXBA 4GR9A 3WY9A 3ZHCA 4MSUA 4UFNA 1CY4A 1EXDA 4OBWA 3ZI4A 3JYNA 3I76A 4F72A 4L72A 2G76A 3LO8A 3OZBA 2RCYA 2AF3C 4FNOA 4KQFA 4M86A 1T5SA 3GOQA 3PNMA 3NV7A 4OVKA 4OXQA 5BOVA 4BLWA 5A4AA 4C7OB 3ELBA 1QDEA 1TRKA 3CG4A 1U0GA 2VH2A 3L93A 5T41A 5D6NA 4MZDA 2D1SA 4BVKA 4TYYA 1SMKA 4BMCA 4R1QA 3SU8A 1NBEA 3TE5B 1GCAA 3ULKA 5BUQA 1SPBS 5DPMA 1Y5LA 5FB3A 3UZUA 3NWJA 5AW1A 3ER8A 2HRBA 2HY7A 2NQTA 3MRVA 1XC7A 3GT3A 3D6FA 3CKYA 2Z8YA 3OT1A 5L51A 1JJFA 5BSGA 4DR2B 5CVJA 1V4VA 2SICE 2PQ6A 3UJAA 3NBZC 1RHQA 3O7MA 4TSFD 3RU3A 4AURA 2WIAA 2BUBA 2O8EA 4NATA 4DSUA 5JAUA 1NBAA 4BKOA 1E9DA 1HFKA 3CE6A 3COZA 1NBMD 4GU5A 4C0JA 4CM8A 1RLTA 1N33B 3QTTA 3DGEC 3IQDB 3PF8A 2ZE5A 1QOPB 1GTVA 1RZUA 4GC9A 5J5CA 2SKDA 3T1QA 3GKQA 1T9BA 2NUPA 2X5KO 1P6XA 5ER6A 4BFXA 4DCNA 4N76A 3PVSA 1RI5A 1RHJA 4ILKA 5JNWA 4LAFA 2VH1A 1ZH2A 3CRMA 4IIJB 3G0DA 4RSRA 1JLLB 4NS4A 1R9TA 2CEAA 4LYEA 2W2XA 4ALKA 1M66A 3OFVA 5F23A 3BTSA 1UF9A 1RAGA 2ICAA 3F8TA 2V03A 2QUZA 1UJ2A 1Z45A 2DBQA 2ZJ5A 4P31A 1QCCA 3CVYA 3P4XA 2IE0A 3LC7O 3S4YA 2C2KA 1ONOA 2Q4TA 3ZDBA 3SD7A 3PR3A 1N1GA 1C9KA 2X4DA 4WGGA 3VNAA 3WL5A 4JU9A 2VTDA 1BDHA 2H59A 4IMRA 2MCFA 1V39A 4OSOA 3C3AA 4K1LA 3RB8A 3MB8A 4WKCA 3FYDA 3VR2A 1QPGA 1ZB9A 3NWEA 4D3XA 2A68D 1JR6A 2V4MA 4LXQA 4XDZA 2XUQA 3HB0A 1Z5GA 1GRNA 5DHRA 1EFAA 4CQMA 1V3TA 2GBCA 2PKCA 1XJQA 3ELUA 3KZOA 4IILA 3QELA 2R92I 4DCCA 4HRYA 5JNLA 3VR6H 2VDOB 4ETWA 4QQFA 2GEVA 3FD8A 1LLFA 3A9UA 2BGTA 4BQOA 1K86A 2AMVA 1UDRA 4HMQA 1SK8A 2UZ0A 4HNHA 4PPFA 4TL9A 4UXHA 2GTHA 4LCJA 1A27A 2WF5A 1ZK4A 3CWZA 3I72A 3HZHA 1ECPA 3DVLA 3NM6B 3K7EA 4M55A 4XM1A 5IJXA 5MGBA 3SEZA 4GHWA 4AZDA 1JE0A 2JJ8A 3M4JA 2XQIA 3OT4A 1ZRNA 3A3YA 2FWPA 1NC3A 3ZWVA 2IY9A 3GEMA 3DM5A 1KHHA 4O8CA 3KYCA 1XDUA 4C4XA 3L3BA 3NONA 2GZMA 1OW3B 2B7LA 4HQLA 3BXGA 5FDFA 1RWNA 3T7SA 4E31A 4LRUA 1A3CA 3QEOA 1IEWA 1KMNA 2CXPA 5DCUA 3ITNA 3W77A 4BJ1A 16PKA 1KJ9A 2HTFA 2HR1A 4JI7B 4EX7A 3EPHA 3RJTA 4JUBA 3Q9NA 5DNEA 5KTRA 3DW3X 1HNNA 3OVMA 3FJYA 5A4IS 1OWNA 4PBSA 2A3NA 3OW2Y 1C29B 1J20A 5JSQA 1RJDA 3VZBA 1XJWA 3AEKA 5CXUA 2VDKB 2J6HA 2Q2OA 4OK6A 1I3CA 2YFHA 1JR3D 3PJEA 4AJKA 4DAEA 1ORIA 4C4TA 1FUKA 5GM9A 3X1XA 3OFSA 3OPNA 2NSJA 2R0QC 2EV9A 2HWUA 3GIDA 3N2GA 3V1NA 1NVUQ 3NUGA 1WHTB 5KTTA 5ADVA 3EASA 1XEXA 4WA8A 1R3DA 2G5DA 5ALDA 3I2GA 1ZG3A 3EUWA 3QE0A 4HAYA 4ITRC 4PWZA 4WLVA 3ROGA 1OGYA 1ZK0A 4Q3KA 2E2HA 4FFPA 3M6UA 1KYVA 4N6OA 4E13A 2V3WA 1XQXA 4JS7A 4J7UA 4BNXA 5KSZA 4FKMA 4EZIA 2AJTA 2X8WA 1GT6A 2C07A 2R84A 5K0LA 4C1BA 4BFCA 4BNDA 1JV2B 1KDZA 1YDHA 3NRJA 2JGDB 3F1KA 2VNSA 4F6CA 5LP6A 1G1MA 3LUBA 3SE7A 5F52A 1TUEA 3SQOA 1AH2A 1ORVA 2V0GA 3H17A 1K97A 2DPXA 4NE2A 4O0MA 3KWJA 4YR9A 2GZRA 3W5CA 3G6WA 5KTOA 1AGNA 1DJPA 3EQ9A 3FGNA 3PR2B 2XCIA 4X6XA 5L3VA 3A7DA 4JN6B 4UUOA 2XF2A 3IJRA 4OJKA 1JDBC 2FH5B 4CRWB 1V9LA 3L84A 3ZDDA 2WKQA 4UU8A 3RVSA 4GR4A 3ZW8A 4NTZA 1RXVA 2C42A 4EAAA 3D2AA 4ZV9A 5FYDA 1TVKA 1WVIA 4HQNA 4DW8A 1PSDA 4J16C 1QNLA 1GKUB 4QHTA 1XVUA 5GM1A 5TMDA 1Q14A 2HIMA 3QU2A 3THXA 2OWDA 3THYB 3JAWA 3LZDA 5BMOA 3FPGA 4MARA 2ABWA 3GO4A 3OAAD 4YMGA 4YYZA 4TMVA 3VDNB 5KYUB 2NVOA 3HBFA 4UREA 1ORHA 2PH7A 3N53A 3QLEA 3GZNB 4TYNA 3JS5A 3DKPA 3NT5A 1JT2A 4BKQA 3VPCA 3WIVA 4L28A 4PM4A 3V2HA 4QICA 3RWMB 4Y2QA 3STWA 2FX3A 3RBVA 4Z4EA 2PEZA 9LDTA 1WY7A 1Z0ZA 5A4FS 3QF4A 3U3XA 4JLUA 1BSVA 3FFWA 5KS2A 2GNOA 1MTZA 3BMQB 4FGWA 2FUKA 2VJNA 3KBBA 4UUMA 4WH0A 5K01A 1N2BA 3DLBA 4NV3A 4GP9A 4TTRA 5MN6A 3AVTA 2K2QB 4G4IA 3RRFA 3TLGA 3PKIA 1CD5A 2ZJ1A 3UQYS 3ZWKA 2O0KA 2QAJA 5K8UA 5MN5A 1NI4A 4MYUA 2B1IA 1O97C 1FS5A 1N2ZA 1DAMA 5G1PA 2VATA 5TB5A 3HCAA 3Q3GE 621PA 2JIZA 3GTMI 2PPLA 2IZOA 4FQ8A 1NAIA 1T4GA 4RE6A 1U1CA 3N0TA 3OTIA 1OLUA 4IZIA 5FIUA 2OPHA 4F8JA 4GWGA 4NU0A 1MAVA 1PW7A 2OHFA 2LEXA 3AP1A 3MT8A 5C1DA 1JHVA 4GZMA 2PGAA 4K9DA 5CVDA 1I0ZA 4A1OA 3O0DA 1YZHA 3BRCA 4K6FA 1WUHS 5ANRB 1C0PA 1H2XA 3OZVA 4RU1A 1VKJA 4ZOLA 4OI4A 5B55A 1X87A 1YBFA 3RTEA 1ZCAA 2FN4A 3FWZA 4IJWA 4M53A 4MJXA 2G9NA 1OBHA 1EP1B 2J0SA 1K27A 5ENZA 3O4IA 1B0ZA 5ECGC 1G7RA 1IM8A 4LXGA 3RR2A 4MYSA 3ZHYA 3BBPA 3M5PA 2ZJYA 2G08A 5BN4B 3NYQA 4GD3Q 4BQIA 3VA7A 4KPYA 1E3QA 2NW6A 3FETA 4CR8A 5CITA 3PXBA 4DMLA 1ZHFA 1NXTA 5A2QA 3UGJA 8ABPA 3K1TA 3W4IA 2ERXA 3M6VA 2EGUA 3CGWA 3H8WA 5LA6A 3I04A 3FTEA 3IIEA 5LD2B 3B6EA 1OU4A 3CWQA 4Q3DA 1U7WA 4OQYA 4TZ0A 2XRYA 4Q1AA 4JNCA 1VI5A 2ZAMA 4AU1A 1S2MA 2BEWB 1E4EB 1X80A 2H4XA 2Q50A 2VOJA 2XB6A 3F6SA 5D5PA 3TQOA 5G0WA 3Q8MA 2V96A 1G3UA 3AZQA 3BGVA 5I9NA 3O8OB 1P0IA 1LVUA 3M33A 3MWKA 2C1XA 3GD7A 1CUAA 1EWYA 1R0BA 1Z47A 3N6RA 2SKEA 4DCJA 4DV2B 3HFJA 3NWPA 4GH5A 2I4TA 3GFTA 4UCWA 1NGSA 1P81A 3IEUA 2LIPA 1NBIA 4DXAA 3N8HA 4Z4IA 1PCXA 4MRMA 4HWOA 4LE2A 1JWHC 2VHYA 4XYEA 1JVNA 4WESB 1JUDA 4Q7MB 5SY9A 5L6LB 3JQ9C 5T57A 4ZV4A 3FH0A 3IQWA 3ITKA 1M0WA 3R3ZA 4NBTA 1OWPA 3G2LA 3IAXA 3SWWA 5AHXA 4EI7A 1KY5A 1QWSA 3HOWI 1T35A 1TF7A 2XYHA 2E85A 2OYSA 3IELA 4JYPA 4IGAA 2ANBA 3K3PA 4UJ5A 4IL5A 4Y18A 4PSKA 1JSCA 1N2CA 1IXSB 5KYXA 2OILA 3S3TA 2Z9BA 1NULA 3B70A 3BFJA 3ND9A 1GRQA 2JA2A 4NENA 3VSBA 3C6XA 3KQQA 1JXQA 4INPA 1TJ4A 3YASA 4L2IB 2R93A 3G89A 2D0PB 2VRWA 2Y1GA 1K6EA 1KJIA 3WQBA 3IV6A 4K05A 5LXTA 3TRKA 4O25A 2VDJA 2XCTB 2NU6B 5ESXA 1CIJA 2OSBA 5K0BA 3CC8A 3HRHA 3PNKA 1W1WA 4Y67A 1MVLA 1Z4LA 3DMDA 2ZS9A 2C82A 3FLAA 1Z02A 4B83A 2QLJA 4M7RA 3EPLA 3DKRA 4XSHA 3WIUA 2I6TA 2YCLA 3GPBA 2BKVA 4JOSA 1QTIA 1U9ZA 1XLTA 3IBFA 3DD1A 4O4LB 2BFOA 2QRLA 3V6MA 3WO0A 1N0UA 1ADFA 4XQ9A 3ZXXA 4FSXA 1J8QA 3GEIA 3ZE1B 4AQ7A 4QBHA 1X13A 3SX2A 3LKZA 3B51X 4BDTA 1L8LA 2VNIA 3SVZA 1Z38A 4U2EA 1IFXA 3LQ1A 3WGZA 3T1NA 1EBBA 3FZNA 2EF0A 3RFFA 3ZV7A 2JA6I 2VQ3A 3KXLA 5EE1A 5EPPA 4C5AA 2D1TA 1E8DA 2FV8A 4LDRA 3Q7PA 2Q99A 2VUUA 3MD9A 2NTVA 3ICVA 1DARA 3WFZA 4ACAA 4KITB 2IYAA 3IQEA 3T3IA 1XDSA 1MB9A 1WRBA 2QE6A 3L18A 4PLCA 2WSIA 1YFLA 1L5GB 2NU9A 2VLIA 1U2QA 1HT3A 1L1QA 2O54A 3QKSB 1DNPA 2I76A 1HR0B 2D1RA 3WKEA 1VFNA 3KQVA 4I9FA 4B3XA 3BQ9A 1I7NA 1VL8A 2RGGA 3EVBA 4NV0A 1TKRA 4F97A 2QW1A 4MVJD 4G97A 2P3OA 5EXTA 2HF9A 2R7MA 3HXOA 5FYQA 1MNAA 1Q7BA 3EE6A 3ESXA 3T34A 1XPOA 1U5BA 2HXGA 3ROMA 3E8XA 4DPMA 4CG0A 1KA9H 1AB5A 4X8OA 3FVTA 1GEEA 1T29A 4JLMA 2XDWA 1AG9A 4TTJA 2IY8A 1K66A 5D1PA 2JKYA 3WOHA 4Y2JA 5KX5B 2IUUA 2XGGA 4W7HA 4CM1A 2C3OA 3U17A 3FUTA 4FOSA 2O3JA 6ABPA 3C0KA 3FRJA 3R75A 1YQUA 1JAZA 3ZKWB 2YHUA 1WJGA 2FX5A 2Z09A 3GCXA 4Q19A 1D2NA 1MN6A 3N8DA 3NVMB 5F1YA 3VUFA 4LYYA 4B3RB 3QMPA 3TJZA 3RVRA 4BAGA 1JIJA 1YVRA 2CYAA 1VQ81 1EP3B 1PS8A 1MB3A 1Z7EA 1MFPA 2ATXA 2M98A 4TMTA 5DEOA 1ZGJA 3T95A 3K9WA 4A2WA 5KNCA 1XTVA 4B4WA 1V8DA 3PT5A 4I66A 2R86A 1Z6PA 5HFNA 1F0KA 1EKXA 2XA1A 1WDMA 1RBYA 3HY6A 4JP2A 3ZGVA 2Z58A 1XTUA 3M7IA 4Y1EA 3TZCA 2VP2A 4UNQA 3OICA 3NG1A 1PNTA 4DWWA 4EGCB 4MS4A 3EZNA 4O59O 3TECE 4BVBA 1L4YA 2QVLA 3IDZA 4EKEA 1BO6A 3VZSA 3BREA 1E1DA 1Z37A 1SA0A 3DVRX 3CQZI 3P5BA 3ZPXA 2VUMA 1CDEA 4BQPA 2CE7A 4OQZA 4QARA 5UKDA 2JNYA 3RUEA 2X6TA 1V8OA 2E2IA 1W5BA 1WNFA 1CZUA 3NHPA 4N6NA 3WWDA 4EM6A 4YAGA 1ULTA 3L79A 4JJOA 2ENWA 4FVTA 3S2UA 1QGYA 1VPEA 1KH3A 2Y77A 3G2KA 3MJVA 1TWGA 4QDUA 3B6JA 3JARB 3L7AA 2YHSA 2GJ4A 4G8BA 3FZEA 3WK4A 4D57A 4EY5A 3GF4A 3JRWA 3SLGA 4BFVA 4QPZA 1GDDA 2O6HA 1R4NA 3KYDA 1UXOA 1DG1G 1XMJA 1OLXA 1HLPA 3C70A 3GLUA 3IOYA 4Q1FA 7AT1A 1R18A 5KI6A 4E2FA 3K0CC 1IG0A 1KXJA 3CNOA 4BYGA 2WA1A 3RZDI 3KLOA 4JJFA 3JQEA 3PC3A 2XI4A 1E1QA 4LSWA 3L82B 1A98A 2QHXA 2FXVA 3AY3A 5EZYB 1DEKA 1X7WA 4M0PA 3LBNA 1RXYA 2YQZA 4LNUA 2G9QA 1GGHA 1M6NA 1ZI9A 2CMGA 2PRYA 3SSNA 4JK3A 1JU4A 2VWGA 3VOSA 1M7GA 3BJEA 1VIVA 3B1VA 1TMGE 4K28A 2ZYHA 3AUXA 3TOZA 4EATA 1LV7A 1RAFA 4AKSA 4AZSA 2I2FA 1CHDA 3KJIA 3D02A 3P32A 1IZYA 1TF5A 4F84A 5KNBD 3HXQA 2O1SA 4UMFA 1XHEA 1AN9A 3Q7RA 3IODA 1V6AA 2ORED 4IHJF 3VUEA 4Z1MD 1N2JA 5FA6A 2I34A 1BDBA 1LQ2A 4I4IA 4H7JA 5I9BA 4A2PA 1Y4UA 2SNIE 4EUEA 1E0AA 4PIMA 2GEKA 4QTUA 3A26A 3RFXA 2DFVA 4FMDB 1AC5A 1CWUA 2QVBA 1OT3A 2CK3A 1NQOA 4Y6LA 3TCKA 2G63A 3HLKA 1XA0A 1AZTA 1HEIA 2CC2A 2DPHA 3AEUA 2Y1DA 3BRSA 5DWQA 4Q3NA 4DLWA 4LNHA 5IULC 3PD0A 2B36A 3VU9B 2QPLA 3KSUA 2B8TA 3JWPA 1A1VA 1E61A 1BHQ1 3W3ZB 4C14A 5JS1A 1CY6A 2XZPA 5AVVA 1YA8A 2QI9C 2Z2JA 4HLDA 1RKUA 4YLGA 5BN3A 1OJ7A 4IIGA 2XUIA 1N6LA 3MAJA 2PS3A 4J0FA 4OI2A 4WKBA 3UUEA 2CY0A 3ZDCA 4KVGA 1H9CA 2JH3A 4A1FA 3ESAA 1BNCA 1KDRA 3J7TA 4TM8A 5JNVA 1H8ED 1J8MF 4WFIA 4AZ3A 2HF7A 4JLAA 2VJDA 4P3YA 4TLDA 5IXSA 1G9XA 3Q3CA 3QJ5A 3AF5A 2R6AA 4JEUA 4WXEA 5D7NA 3UAGA 4LMAA 2ZSJA 1Z0IA 4I99A 4R3WA 3ROZA 3VX3A 1C3OA 3T7DA 4BZQA 5BWMA 4MRSA 3S16I 1GQSA 1KYWA 2GN4A 2CDCA 3HLTA 1FBNA 3R0IA 4M49A 3SDBA 4AN0A 1OH5A 2HSEA 4Q47A 4OI0A 4QIWA 1M1XB 5I8WA 1QH1A 3FJOA 3RC2A 2ZBEA 5LDGA 4EJSA 1U0NA 2R8YA 2Y1EA 5TJHA 2PJDA 4JLKA 2O8DB 3HDHA 1HE2A 6Q21A 2VDMB 2FLKA 1Y3AA 2QXYA 4FHZA 3IFSA 2JGNA 1NG9A 3COPA 4K6CA 3ZZUA 1U04A 1XTZA 3OCXA 2WKPA 1DEAA 3ASVA 4IICA 4CZ2A 4Z1OA 4B81A 1IJEA 1XZEA 4CMJA 4CIBA 1NW3A 4K9LA 3DBVO 2QT0A 1D0VA 3O4FA 3F4LA 4ZYTA 3MQ4A 2H2DA 3QGMA 2C99A 2LCIA 3TZHA 2ZUTA 4C21A 1V4BA 4ZO4A 3TWOA 1HOXA 1BS2A 2VJCA 2OB2A 3NV9A 1P4SA 3PQEA 1P5JA 2Q2VA 2RARA 1ZH1A 1XVAA 3NGMA 1ISIA 1OXVA 1Z2PX 2PA0A 2B8EA 2VDUE 2O3QA 3FM9A 4FFNA 1NLFA 2PKWA 4N8EA 1ECFA 4RVUA 4HNQA 4UU1A 4RYDA 5FNVF 1T5LA 1U0RA 4RSMA 4A2CA 1ZYRD 1K5HA 4JHLA 3Q6IA 3WGHA 5FRDA 1SKMA 2JBAB 3AONB 3WYAA 5H5JA 1FPQA 4OPMA 4QWMA 4EMBA 1AOXA 1CZ5A 3OWOA 4HVCA 5D3MA 2BGNA 3JATB 2EFGA 3T1VA 5I45A 4FNMA 4G5QA 1E5XA 3KX2A 4MKZA 4O4IB 5SZHB 5ALJA 1K8XB 3T12A 1PS9A 5CCEA 3V4RA 1D07A 1E58A 1N2IA 2HDOA 3GDGA 1B0AA 4NFSA 721PA 2AJBA 2ALJA 3CPHA 2O0LA 2OZPA 4HYYA 1LDYA 5JMPA 4J0GA 1U9CA 3I3OA 2BDEA 2IOHA 2Z43A 3B2EA 5LUBA 3B1ZA 3DZ8A 3KSAC 2XX3A 3BRWD 4HDSA 1C30B 8GPBA 2H16A 4YXWD 2BFFA 1L8XA 4XGKA 4MI1A 1M73E 3PPWA 5B53A 3R9XA 2WUDA 5JVDB 3RSCA 1N6PA 2HA5A 3IVGA 3O8QB 2QZ9A 3OEEA 1HEUA 1ST2A 3SM9A 3I6QA 4B40A 3X2NA 3NFYA 4XW2A 4KDIA 3GQBB 2K7ZA 3TVTA 1L1EA 1MO5A 1INLA 2ODAA 2AQKA 3IA2A 3MUFA 1KOGA 1CY0A 3DC7A 3IALA 2OBLA 3OOJA 5ESDA 4R1NA 3ZJYA 4DQVA 3TDMA 1OFTA 1ZKMA 4Q24A 4ERNA 2Q3LA 4KDRA 2IZ4A 5JI2E 1YO6A 1SHJA 1S6YA 1UPCA 1GL7A 3UV3A 2ECQA 1Y5IA 4QGAA 5E7JA 1WTAA 1WPRA 1AZWA 3RTDA 5CMLA 4ZIRB 2FSUA 1NVAA 2PX6A 2JZCA 1QGDA 3M6FA 3Q9SA 2Y66A 3OTHA 4INJA 4Q3OA 4R1LA 4QHYA 3RYHB 3X2PA 3DULA 2IUEA 3VI4B 3F7OA 3ZWAA 1C0KA 4A3EI 3F49S 2FY8A 3DPUA 4YP9A 4BOYA 2VG8A 4DLAA 1MDBA 3F2VA 3MXOA 2XQGA 3L4BA 4D98A 2VDLB 3LH5A 4NMMA 3U7JA 3G2HA 4ZHQF 2QLBA 2VNJA 3NTOA 3Q11A 4FUQA 4MR8B 1SZDA 1SBZA 3K1AB 4J1TC 4BEBA 3MJHA 3RYTC 3BDAA 1QJ4A 4RHUA 3KQMA 1CUIA 1O96A 4W9NA 3K9NA 1V5WA 1N5LA 1NBWB 5C5DA 1M1YA 3FSJX 3LPAA 1WCYA 3DZCA 3NIGB 3JQDA 4QFCA 4CT5A 3SMQA 1Q50A 4C6SA 2XECA 3IUJA 1O5IA 3H8VA 1Q91A 1ZYUA 1DEXA 4NHEA 5JJCA 1SCBA 1A9OA 1OFVA 4G23A 5TF0A 3UTDA 3VV2A 3EPKA 1CQJB 3OOSA 4FOLA 3WRYA 4HGQA 2LFUA 5BQ3A 1F7UA 1NJ2A 1OFIA 3A2NA 1Z5PA 3DWGA 1BC5A 3K4HA 4U1RA 4XCVA 5A1TA 2VQDA 3CC4Z 1PV2A 3QEAZ 4W63A 3U4DA 4Q7JB 1DSSG 1EUCB 2HQ1A 5AD1A 1FSPA 1WXXA 2QK4A 5IYZF 3FWPA 3SNKA 1NQTA 2VHWA 1G5QA 1VLZA 1W30A 4CM9A 3A2KA 3L4JA 1NMXA 4JLOA 3NOXA 4LI3X 2QEXZ 4XGQA 4B3DA 4EPTA 3EXG2 1ONBA 2IBMA 2R47A 1N4DA 4TQUS 2GU2A 3LOUA 1H0KA 3R5HA 4KREA 1GILA 3M6LA 5EWMB 2HV8A 3GTOI 2F3UA 1ABEA 2Z4RA 3KR9A 3LU1A 3Q88A 1ULHA 3TQTA 3GH1A 3RRNA 3PO3I 1SD2A 3MLBA 3BWDD 2J6AA 3FYHA 3IHKA 2XUJA 2C77A 3JXEA 2V45A 4CJXA 4RE5A 2G83A 4AP9A 4BATA 3CF2A 4CM7A 5F7OA 4TXJA 2CV0A 2AG8A 1NPTO 3AMVA 1PD0A 2C7BA 3PDWA 3PFHA 3L6EA 3OOWA 3PNBA 5CXQA 2AD5A 3UJPA 3MHTA 3PDCA 4H3KB 1CQWA 4B46A 2BKEA 5BVGB 4HUQA 3PXDA 4ZCMA 4Z9BA 2ZSFA 1KXZA 2JKVA 3FWNA 5KTKA 1DCKA 1QU3A 3T9DA 2AFIA 2ZAIA 1ZW6A 3JVDA 1BEEA 1RZ3A 2HCTA 3IEVA 3RHFA 3RSZA 5L3RA 3GPIA 3S8EA 3BHMA 1MD9A 5BV2P 5JDCC 4G1FA 2QRUA 2DM6A 2GWRA 5FF9A 2B1QA 3PFNA 1RXSA 1KK3A 4I4TF 3FNQA 3FNHA 3JWGA 5IXYA 4AMBA 1WUIS 5B36A 4L73A 3ZWCA 5AVSA 5HVNA 1OPXA 3EW9A 1LW6E 5M29A 2V7UA 1QSGA 2FWAA 3G17A 3L8YA 5F35A 1G6Q1 2Z2XA 1Y8CA 2QN3A 3UATA 3O9VA 3ENZA 4JOQA 1T6YA 2JLWA 2PSDA 1PL0A 4GUAA 1AMUA 2CBZA 2CXNA 3GRVA 3N58A 4KW7A 3QQ7A 1G59A 3BK2A 5KCMA 2HEGA 2R79A 3T5AA 1AKRA 2AR7A 1P1IA 1TA9A 5EGSA 4S35A 1ND5A 3PNQA 4KAAA 1AS0A 5JAQA 1QK3A 1TUBB 1VC2A 3B3QA 5FWYA 2ZI9A 4X61A 1U4OA 2DWCA 3IL2A 1JHPA 3VTAA 1USIA 5TPZA 1MDFA 2EKPA 1VQ91 3EEIA 3QYJA 5H7XA 1PHPA 3RWOA 3LNTA 2NUBA 4WOPA 3L0IB 3A36A 5FUXA 3DOCA 3GEEA 3AZPA 3M3YI 3RUDA 4RTMA 1J2RA 4IUBS 1X7HA 3VH3A 1OY1A 1FRFS 4HMPA 4UHKA 5DLPA 1FCJA 1DCMA 4L6CA 3RLFA 2VBFA 3MJTA 4ZCSA 5BN5A 5IVIA 1WCIB 1EJ6A 2C2XA 1FLDA 4Z7OB 3ZEAA 3AR6A 5HF5A 4MMZB 2PH1A 3B3AA 5GLFA 4J1SA 3NOVA 3U1BA 4R84A 1AZLA 1GR0A 1HETA 2P2CA 4NE9A 4MIEA 3VHLB 2X0RA 1T0BA 3B5JA 3PHGA 2ZIAA 5DN6A 3SYLA 3KK0A 1Q15A 1GSOA 4NMXB 1NUUA 1K68A 1Z74A 3E05A 3JTEA 1CS0B 1VMEA 3KEFA 1WE2A 4AO6A 4DJTA 3GELA 2P9QA 3A6GA 3CC71 1JB9A 1RBMA 3NANA 3K6JA 1T5TA 4OYRA 1E8NA 4HI0E 3IQGX 2NMVA 1I6KA 3RZOI 2ZXUA 5LQMA 3FOZA 3B6ZA 3I8XA 1STOA 4QYIA 1LZLA 2QGNA 3F67A 4KFTA 3KXIA 4MICA 5CXXA 5FPHA 3TQSA 5HZGA 1CS4C 2IHYA 1G55A 1YR2A 1XCOA 3I9NA 4C2AA 4PYMA 5CA0F 3A1FA 1YCHA 1VLVA 1YC2A 2AUNA 5B1HA 4YECA 2PWBA 3EWIA 4HWGA 1QFXA 2D13A 2CJXA 2H17A 2AI1A 3G3EA 2R60A 5FTMA 1CRWG 3DMTC 3EAFA 3FLMA 3L6DA 4R1MA 3S28A 4MQ5A 4YT4A 4OXYA 2GYVA 4IJVA 1JYEA 1TKBA 1SCQA 4D0RA 1H9AA 4GX1A 1NWHA 1XAIA 3GLHB 3DAFA 1C3XA 5A02A 4IRXA 2O06A 1YA4A 3NHAA 3RGWS 3LVBA 3U16A 4MMXB 4MUFA 5KQSA 3O82A 4N5LA 4S05A 5LOVF 2A94A 2X15A 3G1UA 4TL6A 4KPUA 4X0EA 4B3JA 1Y6GA 1FP4A 1E9AA 1NP6A 1F0YA 1ZA1A 2G04A 3F5SA 3OPVA 4G4SP 4LZNA 1SZPA 3WKAA 1NVMB 2QRMA 3OEWA 4M3NA 2QYOA 5DGXA 5F1OA 2F4MA 4ND3A 4DR5B 1M5UA 3OLXA 3WFIA 2GERA 5CPFA 3AR2A 2XEXA 2EJTA 3ZE6A 5M5BA 2GYUA 4M1SA 3V48A 2NU8B 4I9NA 4ZRDA 1UMKA 4G0UA 2YWDA 3D8HA 1KFCB 3I5XA 1UMBB 2F43B 4MLPA 4MQUA 3R8XA 2HW8A 1YJQA 4XD7A 4BUJA 5BY2A 3F3FC 2I4OA 4MWDA 1RI1A 3OG9A 4D9NA 1EWRA 2OAGA 1N2HA 2HCFA 2VSXA 3C7KA 4KXFB 3ETLA 2JIOA 3H8SA 2CF5A 3U4CA 4OFXA 2NO9A 5ITZB 3KAQA 1EFUA 1JDNA 3P0HA 4LJSA 1A9YA 2AZMA 5E3IA 4F06A 3AKZA 4JC5A 3H2ZA 1PG2A 4EZEA 1WR8A 5H4GA 2XWBF 4EKYA 4AZ0B 4IIXA 1ESZA 1KY4A 5AVUA 1Z4OA 3K8QA 4U2GA 2W11A 4HGNA 1QFMA 3Q7EA 5KINB 1YMQA 5JEEA 3U3RA 4M7OA 1Z33A 3QVJA 3PUWA 2IEZA 1WZEA 3E81A 2QMEA 3ZHBA 1WF6A 1ZH4A 2CL0X 3CKLA 3G9ZA 2KMLA 3LUCA 4E07A 2X0JA 1WQ1R 1TQ6A 1Y9DA 2DQ4A 4QGBA 5HTOA 2NT3A 1POXA 2BAGA 1ODTC 4H7HA 5DI9A 1DJMA 5BSFA 4TRJA 3BCSA 3TKAA 1IBCA 3TS1A 1DL5A 2FMXA 3BEOA 4N5IX 3K73O 5LDHA 2XUPA 4G56A 3F3PC 3G8DA 1HO3A 2B4AA 1VHWA 1Z0AA 2OM6A 4TL8A 2P4SA 5JAIA 4V0SA 4UOZA 1D2AA 3BCRA 2QX4A 1ADJA 1PFKA 4F2WA 3U31A 2H63A 1C7IA 2AG6A 3PHHA 1V4NA 5CIWA 3X2LA 1U8CB 1USWA 3EDOA 3JALB 3MTGA 3DBHA 1W4ZA 3O3NB 3QBJA 1JQKA 4TTQA 4C2MA 1E7RA 1FYXA 3KYJB 3OOEA 3H05A 4N65A 3GEHA 4TRNA 5TY0A 2HJHA 4YO8A 2EKQA 1Y1QA 3AERB 1R2QA 2PLNA 3OT5A 4IEFB 5J5VA 5JISA 1E6UA 2VYFA 1Y1TA 3DLIA 4RZXA 5C7LO 1QOQB 3J80b 2DHDA 3VDRA 1OAAA 2VRCD 2OL4A 3P26A 2J07A 4QEZA 5LB2A 1A9QA 4K9PA 4OJYA 5LBUA 1G21A 1XWFA 3PXAA 2ZQ5A 4J8PA 5I7WA 2NG1A 4FFMA 4UHHA 5DCYA 1RAEA 1JFFA 3EGEA 5G4KA 3SEAA 4MUAA 4PIPA 2EBFX 2ZSIA 1YZ3A 3OPYA 5TDHA 3W2IA 2W6NA 3WNQA 3OQVA 1OWOA 5GTDA 3B3JA 2E4XA 4UU7A 2RB4A 521PA 2NVUB 3CPWZ 3BH6A 4LN1A 2VCHA 3CS3A 4WXHA 3ZWYA 1UMDB 4MQFA 2A5DA 4CLHA 2HWYA 5KKNB 3IBCA 3ND7A 3QFSA 1UXKA 4UCFA 2J3IA 2E3JA 5FWXA 4IUCS 4YRSA 1NVVQ 1K3TA 1IY0A 3P20A 1E8MA 4OSPA 2WK1A 4ZYXA 4RKQA 5LMNB 4BXOB 2BP7B 4ODIA 3KQYA 3MOIA 5JQWA 1JEQA 3OZTA 4OEHA 1R6UA 5EFZA 2XAAA 4NBEA 3AUSA 2XIQA 3NC0C 4G25A 3UMBA 1DJLA 2DBYA 3M6MD 1UBHS 1ZAKA 2FQ1A 4Q4JA 3JW8A 3QH4A 2HLDD 3G2IA 1E6CA 2ZBPA 1QFYA 3KOOA 3NHFA 5ILOA 3IVRA 2JB9A 1GAEO 2CUNA 2ONZA 1V2HE 2FUG1 1B43A 4CKXA 3HUTA 2FEWB 2I7TA 3GP8A 1A4UA 4B8ZA 1JFLA 1RIFA 4CCAA 4QYMA 4MV6A 1CTQA 2NZ2A 3BVPA 1GPBA 4Y2SA 4I1SA 3P45A 5M3BA 3EGIA 3RBAA 2G5CA 1PDWA 1BVUA 3KJHA 3MWFA 5GP1A 2BMFA 5HGJA 4FG4A 4ES6A 3SGLA 5ADWA 4B0OA 2XGJA 4O02B 1IL0A 1U8UA 3AESA 4I14A 3UUGA 5LKRA 1RWBA 3R3WA 2PQ0A 1RM3A 5F5LA 2EU8A 3JQ8B 4F9TA 4DLRA 4R1SA 2HU8A 3LVQE 1GL9B 1V1RA 2C04A 3BEDA 3U7GA 1UMCB 5KJ6A 1ZNXA 1QRRA 3GJXC 1L4MA 1W96A 3PUKA 3RS5A 2Z8YM 3KB1A 4Q4DA 5JCZA 3UMYA 1UFQA 2GKSA 1BJRE 2IPNA 3D8UA 3E9CA 5DBFA 4JI3B 5IT9f 2PT7A 4G4GA 3K09C 1BRMA 2OYCA 1NE2A 1P0QA 2QQFA 4QDKA 4QSHA 4ZOBA 4EFDA 4DCMA 4EHFA 2OFPA 5A3JA 2O05A 5CRIA 2PUAA 2O14A 3EEDA 4WLFA 3PUHA 1MT0A 3C5HA 3H2YA 3UWOA 1F6BA 5HUHA 2Y2VA 1TYEB 2VYNA 1TM1E 2Q3CA 4NNPA 1YUAA 5ALSA 1H23A 1Z22A 4OK3A 4DR4B 4X3CA 5A4DA 4TMZA 2QRZA 4N0EA 1ZR2A 2PKRA 1N0VC 3LXRA 4XR9A 4DFDA 3FPJA 4INOA 1ZS9A 3IRUA 1PFTA 1Z15A 3KVRA 5E4YA 1YJ9Z 4D8WA 5EHNA 1I14A 5JALA 1N6HA 3WWPA 1ZJ6A 3DCYA 4BLUA 4Z8YA 1KMCA 1W9MA 2H18A 5F2EA 2X0EA 4I4CA 1GLNA 1C3EA 2OHXA 3AYZB 3DNPA 1C9EA 5EHXA 4Z53A 3FLBA 3GJ8A 2R68A 3I28A 5INTA 4FOOA 1QB8A 10MHA 2LDBA 2H7XA 5HF8A 1Y1LA 2HGSA 4ND5A 5HM8A 1IM5A 2V1UA 3EXHA 1XNQB 2FZ5A 1ECBA 1F2TA 1V26A 1LPSA 1NYLA 2WJVA 3L0CA 3QF7A 2JD2A 4L4YA 4PANA 4JVSB 4GBJA 5HJEA 4LF7B 1C4OA 1T0HB 2WE8A 3OC0A 1JLMA 3TW6A 3WLTA 1SU7A 5KQGA 2ATCA 1GV1A 1QHGA 1PJ8A 4OL9A 4QYSA 1VIDA 1KQFA 2P68A 2ZUCA 3P2YA 4A0FA 5HQTA 1CIVA 1PQ4A 1SUEA 3IQXA 2P9GA 4LJLA 4KWTA 5IDVA 2KS6A 1GV0A 3VPSA 4L5YA 4R8MA 4EB0A 5FORA 2R9VA 3B12A 3RYFA 2EG5A 3QA3E 4UOEA 1QGAA 4B2IA 2E21A 2ZIZA 2FB9A 1TWCI 2VZ8A 4MKXA 4Y2HA 3N8NA 3DDWA 3PQ2A 3T7TA 1HDXA 4ZODA 5T7BA 3GDOA 3W3AH 3QVSA 1ZGHA 2AFVA 4CODB 2MSNA 1ZNWA 1R37A 2Q27A 2WTAA 2VK4A 4OBEA 4XX1A 1RCTE 4C0HA 4H7DA 4DNFA 1Y81A 2RH4A 1XZJA 3NJ8A 2LTAA 2B34A 3IEMA 2DJIA 2RIQA 4GE3A 2CV2A 3SVLA 4EUFA 1B74A 2F3PA 1N9ZA 4GSLA 3SC6A 1DCFA 2VP0A 2XB9A 1WIWA 4YRCA 3R76A 4DKXA 5CYGA 3TNDA 1LQTA 2N1BA 1Z6ZA 3GRKA 4N7RA 1ISJA 4HTFA 3EQ7A 1O5OA 3W5HA 5IT0A 1EDOA 3AIOA 4QASA 1E1KA 2Q8QA 3ONNA 2H4HA 3RF6A 1G42A 1A5AB 2TYSB 5I7AA 1HORA 2QL9A 4BO6A 2OO7A 2C7VA 5B6CA 2PFKA 2X5NA 4BE9A 4QLBA 3GH3A 4Q3EA 4E5PA 2VDRB 1THZA 2X4GA 5AW3A 5I47A 2C5FA 2V8KA 4MB6A 3L43A 4DM4A 5KHOC 2CZCA 5M7EA 3DVAB 3T7JA 5CG1A 4HQ0A 3OQ6A 4C0AC 1JHQA 3IT1A 1BX1A 3EQZA 2O52A 3AETB 1ODJA 4C89A 1P31A 4AS1A 3DZIA 4RF3A 3OZFA 5KOJA 2WG1A 2HLPA 4R2IA 1QVGY 3T1HB 4E46A 1AXEA 1NY6A 2CVOA 4FC6A 3X2HA 3WYGA 5HKKD 1AKMA 1AGYA 3AF1A 3NDBB 3ZTTA 1N7IA 5DGTA 4HDMA 4KSYA 1D4AA 2ZZKA 1CFJA 1OZHA 2HRQA 4UJ3A 1MABB 2FPPA 4NZYA 5KSYA 1DHRA 1RKXA 1U0SY 1JS1X 4PPGA 3PNVA 5GM2A 5LR6A 2X7JA 4H0CA 2QPAA 1WW8A 2G82A 3PLXB 1QAQA 1M34A 5LU9A 3PUXA 2VAWA 5CCBA 2AYXA 3ADCA 1JR2A 4HS4A 4I4NA 4NG5A 3ZHSA 4P7BA 5FBZA 5JZBA 3DOOA 3F4KA 5DM4A 3E18A 4LX8A 3SX4A 4EYEA 3MWDA 1JHOA 4M2LA 4BFLA 5LIRA 4BZXA 1OTXA 2DH5A 2GXQA 2H2GA 3KC2A 4V0NA 2OORC 2QLNA 3E61A 3SQDA 2AFRA 1VP3A 2A69D 3IOEA 4LX0A 3FBGA 2VFAA 2X76A 1XWIA 1O0SA 2WWVD 1HH4A 3CCUZ 3LPNA 1MX3A 3QOFA 3RAGA 4Z2AA 1NF2A 3DOFA 3QWUA 1E18A 5EMHA 2CLSA 3ELDA 5C46F 2BM0A 1SCUB 4PFSA 2NQ2C 3OUTA 2C0CA 2B35A 3F3SA 4G67A 5FA5A 4KGXA 1PK7A 3ZDRA 4YRBA 4K9MA 3K70B 2GAAA 4WDRA 2B0CA 3Q7QA 1X1SA 2C03A 1CIPA 2OXRA 2B5WA 3MJEA 3GLQA 4MV3A 1QUFA 1ZCBA 3AC0A 3OW2Z 5T4FA 2P5TB 2P9BA 5DM60 4U2CA 3M8KA 1FQWA 3D4OA 4KN9S 2HM7A 5JS6A 2RMKA 1ZAYA 1U8TA 1U6JA 1PR6A 4MUXA 5CJPA 4KSBA 2QEQA 4D9EA 5IC6A 5MHTA 3W34A 1BWQA 4JR2A 3W5UA 3M6IA 5CGQB 3RE1A 5H4HA 1RQRA 2VUHB 4D5EA 1YUKA 2GYWA 4F12A 1PQYA 1EDBA 5BNIA 1T6NA 4RM2A 4MW5A 1PJZA 2D1FA 3I9JA 2DFDA 5KVAA 4NYJR 1UBGA 1X15A 2FSVA 4GLJA 3SJAA 2WHYA 4DUGD 1KYQA 3S70A 3T1OA 1ZUHA 1EUQA 3DWIA 1XYGA 3TDKA 1IB0A 1UQTA 1YZKA 3A32A 4FIZA 2PG3A 3EW7A 2V6IA 1L8OA 2JCXA 1Z2OX 3GROA 3C97A 5T64A 2OCKA 3HDYA 4HB0A 2VDNB 2WJ6A 1XVVA 4HQRA 1ZJZA 1VQMZ 1DWQA 2QL5A 2Y1FA 1RR6A 3N86A 4JELA 3RK0A 2DB3A 1OGJA 2R3SA 1MQ8B 2UU9B 3K2BA 4EMSA 4HR7A 1O94A 2OLJA 3L0ZA 1GPMA 1KI6B 3TQRA 4P5PA 4US0R 2LCQA 1JDUA 1O95C 1DL6A 1P6UA 1QAMA 3BERA 4A8TA 2FQWA 1Y1VS 2GJ9A 4Y6RA 4HFNA 4OGKA 2Q07A 4JX8A 3T7EA 1MPTA 3AIIA 3FNFA 1YZFA 1NM5C 4AULA 5CD9A 4MH4A 3GVIA 4HH1A 2Z04A 3TLZA 5IP5A 1XEFA 1XL0A 1SVMA 3I04M 4A8JB 1E4VA 3JQ6A 3A6PC 1UKVY 3JQQA 2BJOA 4B3FX 5C5CA 5CDHA 3ROEA 1Q0PA 3UV6A 2R92A 4I1UA 1PG5A 4NCJA 3ZCRA 1Y4DE 1M6HA 3GX1A 1A2BA 3HJUA 3LWDA 4M1MA 4DZRA 4ZI7B 4YCCA 1Y37A 3AJDA 3UC5A 2Q1TA 5IZCA 1EBFA 4GLFA 2HCZX 2ODTX 3PIIA 4L0QA 3ZYZA 2XWSA 2HSZA 4FYHA 4ZFNA 3FWHA 3WWZA 1XD8A 1CVLA 1HUQA 2BFDB 4DK1A 1B6RA 2WU3A 3R7DA 1BRTA 4HLUC 4FDMA 2BSXA 5KKCA 2IPOA 3UW3A 3U4MA 1SOWA 3CUVA 4W6QA 4BC1A 3J7A4 1QH9A 2Q3FA 3RRZA 1E9CA 2A0XA 2D2FA 4A2QA 3Q0IA 1DO2A 2OKGA 1OILA 3WFJA 3NBAA 4L0CA 4FKBA 3DE4X 2BFNA 4YRQA 4ZKDA 3BOSA 1Q7TA 3TNJA 4BNMA 4E3ZA 2OCAA 3K0AB 3W9BA 3RC7A 4AKEA 5A4KA 1U3DA 1YFJA 3MGBA 4WHMA 5KREA 4XVHA 3AJRA 4EFNA 4J0QA 4KP7A 2Q5IA 2QKYA 1J2TA 2AWOA 1B6TA 3LX6A 2ZRQA 2NAPA 2ZLBA 3DOIA 3MG9A 4MI6A 2RKWA 4PN7A 3CVUA 4XIFA 5TS3A 2FF7A 2YWBA 2XE6A 1E5VA 1W4RA 5H70A 1ELOA 1JI3A 4HX5A 3B60A 4N5NA 5FTWA 4ABYA 2OV3A 2PMDA 3AUJB 4EFLA 4AOKB 3VSAA 3WGOA 5F1PA 3A3OA 1JH8A 4DE5A 5EIXA 3MGKA 4Q12A 1E20A 5JADA 3KQHA 1V1MA 4RC9A 1Z2DA 2I78A 4HAWA 1QUEA 1KE2A 3TE7A 5HRCA 2PANA 4U9HS 3H3XA 4RV5A 1GJRA 1XMIA 3NBXX 1Y5MA 5TMBA 3UMJA 1F8UA 2ZRKA 1JPJA 3LDUA 4OXKA 3SF0A 3ZWWA 5FH9A 2ADMA 4IQ4A 4WNYA 4UEKA 3ZDYB 2LVBA 3ZCVA 3X3HA 1G17A 1KPHA 2A3RA 1DMRA 1FSGA 3KQOA 4CEHA 3VZCA 1SCAA 1VKHA 4F3RA 5AHWA 2CLDX 4WVLA 4TV9A 1KD11 1YB6A 2CSUA 2ZRFA 1P17A 4DMFA 2AC7A 1HYEA 2B7CA 3GVPA 2R4TA 1E6EA 1G3MA 2I4MA 3CO0S 4W7IA 1P7CA 5AOVA 2C8LA 5HRAA 5SYAA 2PV0A 3QPAA 5FTKA 5AI0A 3TTUA 5LFAA 3G85A 4L4UA 1F2DA 1JKFA 2JIPA 1L7DA 1SBQA 2SHKA 3D6VA 4B87A 1UZUA 3DE7X 3PT9A 5GOTA 3TBHA 1ZD2P 3D0QA 3RARA 1QIHA 4MQMA 5JJKA 1XNJA 4INAA 1HTTA 1X0TA 1SUIA 3PDIB 1RXCA 2NLOA 4XUCA 3RC3A 1SUDA 4G0QA 4FFLA 2YOGA 3RYIA 5AJXA 1X1RA 3HDQA 5EFOA 1SXJC 4RK1A 4BX0A 1H94A 3I6BA 2BZSA 3CLHA 1U90A 2BHTA 2PUBA 1UBTS 1JMVA 1KPIA 1ZEMA 2NACA 3VHXA 3ET4A 3W1EA 5E1DA 2ACVA 3NRBA 3EXFB 4DA9A 1IN4A 4GPBA 1QYXA 3QEBZ 1XP8A 4YQZA 2AOTB 2P0AA 5I7UA 1JDPA 4MO9A 3Q87B 2Q1SA 2FP3A 4RA6A 3ZQUA 2PKQO 2IZZA 3RSSA 2MSDB 1GTL1 4PZDA 4I3HA 2R6DA 1EE2A 1EVYA 2OO5C 2PGLA 4J29A 5EXXA 3VTFA 3ZK7A 2O1WA 1PBNA 1L1OC 2DHCA 4OFZA 4Z3KA 1EXMA 4W1SA 3S15I 2WR8A 2X2OA 2C61A 2WZBA 3EDMA 3LLSA 4B6JA 4I1OA 4RMJA 1FVHA 1P2DA 1TKCA 3GTMA 2G7ZA 2IU3A 3N87A 3RD5A 3VR4H 3WYBA 1NU8A 2QP9X 2RJOA 4HXYA 1MR3F 1FUEA 1NOJA 2I6XA 2UZ1B 3GA0A 5E95A 3L0DA 3WB9A 3IJ5A 1CJVC 4KYUA 5COQA 2E87A 2LIVA 5IJ9B 3DVQX 3EK2A 1DOHA 1EX6A 3U4AA 3V1TC 5L3SA 2V3CC 2D4HA 4DUPA 2HWKA 1NUQA 4GX0A 4D9HA 2YDYA 3B53X 4UAUA 4QUKA 3HVJA 3WLRA 1YQTA 2CBXA 3O31A 4MYDA 4F1JA 4IVPA 4E1BA 1LS1A 4JP8A 3FMOB 4NZPA 7REQB 1QG6A 3CX4A 1VQPZ 5KOHB 4AY3A 2GB4A 3KFXA 3V2UA 2J7PA 3C3YA 1R0KA 2ZI3A 4C1NA 4MIOA 3GVHA 3FCXA 1CEXA 4LRQA 2PXHA 3NHRA 4J4TA 3EG9A 4YLYA 4ZZ0A 4MTCA 4QIHA 3S1QI 2BL4A 4LFAB 4B6FA 5THQA 1E1MA 3GTJI 3CTPA 2JLYA 4A91A 4QTYA 3C4QA 1MO6A 1RYBA 2ZIEA 5JR3A 5CB4A 2JFHA 4KH1A 1CZHA 1BKDR 1Z7WA 5IS2A 1S5PA 3F4BA 3ZDAA 4RCZA 3AVUA 2C5AA 5BNFA 1TC1A 1Z2AA 4LZWA 2FWIA 2WF9A 3IQZA 2HSWA 1RHKA 1PZGA 2HF2A 2XJ9A 3EGOA 3NBYC 4YJ2B 2WY2D 5KEIA 4KR9A 4RTPA 1RO0A 2P69A 1JE1A 4IH4A 4JSYA 2WSMA 4QXOA 2H4FA 4K1XA 4IKOA 5BRJA 2AXNA 4LJKA 3OJ0A 5FO1A 3ENNA 3UJ7A 1DTWB 1M9NA 3GUUA 2O6LA 4MVJH 1M902 5DIFA 1FRQA 2P3LA 2Z5FA 1I32A 3T3HA 1JR4A 4DMUB 4TQAA 4MV0A 2FDXA 4MWCA 1W19A 5DHTA 2ISSD 4FFDA 3CN7A 1LJLA 1RE0A 1WVGA 1BE6A 2KHZA 1L5HA 1SVLA 2WQZA 1ZLYA 3DCIA 4I50B 3VYRB 1G8KA 3ZD7A 2ZETA 3O1HB 2DPGA 1TL7C 1XE3A 2X77A 2B30A 3IAS6 3VRHA 4CIXA 5K5EA 3EBLA 1SXJE 2I4LA 4HADA 3O9ZA 1K7XB 2JW5A 4RZ2A 2QE7A 2E4WA 2O50A 2GLXA 1GQOA 2GUGA 3I6YA 3R1IA 5GLYA 2PCJA 4UE2A 5CH8A 5C3MA 4RPHA 4GI3A 2QTRA 3LMKA 5F7JA 4NXMB 1M8JA 3V3KA 2Q5QA 4H3HB 2GBFA 3GMDA 4CF3A 4YMUA 5JQGF 3MUOA 2A59A 2LP4Y 3U80A 1P1BA 2X9NA 4FFOA 4UTRA 2NUTB 2YXEA 2ZI5A 3H9QA 1QIDA 2ACKA 3PRKE 5TLSA 1BX0A 2D8AA 2XT6A 4ZN6A 2BGGA 3QXGA 4JP6A 1OV6A 4FFRA 5CG2A 1RCFA 2VZ0A 3OQIA 5HFAA 5DYGA 1MOSA 5B37A 2XTNA 4YCSA 2I3GA 4FFSA 5AQ1A 3G49A 4Z4QA 3NTQA 2YL2A 2QLVB 1G18A 3VHRA 2ZIXB 1XCJA 1KJZA 1W48A 2CF6A 2E5WA 4Q02A 3TFQA 5BW4A 3D6HA 1MMFB 1D0SA 2XGSA 5FI1B 3VVCA 1XYYA 2D2IA 4F56A 1WETA 1T1RA 4UAGA 1V6CA 1BG6A 1NUAA 3E15A 1UIMA 2FWJA 1DJQA 2VF5X 3RHZA 2NO1A 2OCGA 1PT0A 2JA6A 3FMVA 4HN4B 4JIGA 3OBIA 4LSMA 3M0EA 3CLKA 3H0CA 4GW3A 2V9CA 4RD0A 1Q0HA 4XWTA 4C7KA 2F1OA 2VXOA 4ZV7A 4HLQB 2ZWIA 4M8KA 4XEUA 1SC9A 1W59A 3TL6A 4QUJA 5KWJA 2RK3A 3KJNA 5A7FA 4RTJA 3F6BX 4R7GA 3C3WA 1QIFA 4ANFA 5HMMA 1QPZA 2PNWA 2Y0PA 3CRW1 4TS4A 4B3TB 2A57A 3E84A 3V8EA 2E82A 4WFKA 1VI2A 3KTAB 2WKSA 3AILA 1JHXA 3PK0A 1VJRA 3R5TA 3WXMA 3SJ7A 1SAYA 3ISTA 2WYIA 3K5HA 3GA7A 1NJSA 2BFWA 2XMBA 4YRDA 5KNBH 4IJQA 1J07A 4UBOA 1WBBA 4TVOA 4AVYA 4DL9A 5JPIA 2QIPA 2Y71A 1GCIA 3AKEA 3EDRA 4LVNA 1QVZA 1HDCA 4DIFA 1U28C 2REQB 3HI6A 4MXDA 3DONA 4ROSA 1GSIA 3S2FA 4DV0B 3P0EA 2X8JB 1PQUA 3NHJA 1CY7A 3T54A 3USCS 3SYMA 3KPWA 4YCNA 1YD7A 5B7GA 2P27A 4YDQA 2A92A 2CLCX 3RSQA 2FVXA 3OOHA 1X1QA 4JBXA 1QZXA 2HH9A 1YKGA 5IKMA 1HSOA 3KCNA 3EC2A 4LY0A 1GTG1 4JUAA 2R00C 2SKCA 1YRWA 1QHSA 4MWSA 1MOPA 1W5SA 3F9CA 3NW9A 1G16A 1H2AS 2A0UA 4UMVA 4GAEA 5AKHA 3Q5DA 3ER9A 4J6FA 1JIKA 2WKWA 4AWAA 5BVHA 2UYYA 2OCPA 1CUEA 4ZHQB 3LKBA 4J2HA 3NPMA 4MUBA 1HNWB 4RULA 4KQ6A 3UPDA 4XI9A 3SSAA 3NTLA 4EH1A 4AFNA 3PVZA 4BGIA 5DNDA 5LZ8A 3RIMA 3FI9A 3PU6A 3AU8A 1M6EX 5HZHA 3O4JA 1UKYA 1BXRA 3T15A 3L7LA 2VP5A 4NVRA 5A1JA 1CQIB 3CQZA 2FFRA 2O20A 1W6UA 2W2MA 1JA0A 3BSYA 4RQAA 1XTQA 2UVPB 3HQ4O 4OP2A 4Q48A 4RD4A 5H4UA 4ZOEA 3EXAA 3SPXA 2DU8A 5DE3A 4MAAA 1GCGA 1E4YA 4IINA 3GLVA 5ER9A 1KRXA 2I8CA 3NFZA 4I36A 4AJ9A 3U6KA 5ECDA 3JQCA 4J16A 4JLNA 2C7RA 3RUCA 2HCRA 2ASEA 4ESOA 2QT1A 5K03A 4IGFA 2Q49A 4DVGA 1CFZA 3IHTA 5ICSA 3W9SA 1JHUA 4KIUA 5ES4B 4DQKA 2DHRA 4QM6A 2B8WA 1F8XA 3KT6A 5JROA 5IYZB 3BK7A 2FVYA 1LB1B 2PUGA 4Q00A 5HEKA 3OD5A 3WGMA 1HBJA 5B57C 2IC5A 2V4ZA 4OGWA 5H02A 4O08A 4CLEA 3EBPA 3K2EA 3UJNA 1XTPA 1P4RA 3DF7A 3E53A 5F12A 4BMOB 3U7FB 2GARA 3UK0A 5KDOA 3A11A 4BASA 4QOFA 2DJ5A 4UDXX 1VL1A 1SQGA 3UOAB 3HC7A 5DLDA 3T3DA 1M1ZA 4HV4A 5JNSA 1N92A 3HSSA 4G37A 5CBPA 5MDHA 2YC4C 2Z5LA 4IQFA 2PT9A 1Y33E 3HCBA 2XT0A 3EWSA 3K1ZA 5D1NA 4BZWA 1MH9A 1JJBA 1QLHA 2CJFA 2C3MA 4REMA 2MYPA 4RW0A 3M3GA 1IJBA 2V6MA 4V0LA 3VNBA 5HIKA 2PMCA 1TU0A 3M49A 2D0DA 4YCDA 5I4KA 3O26A 1GPNA 3O21A 2QF7A 2IW1A 2ZKIA 3G2MA 3H16A 3WK7A 5CHEA 2DG2A 3MCTA 1H6BA 2B98A 4BIIA 3FYSA 1W52X 4GRAA 1KOJA 1HE1C 4N0PA 2ASVA 5TT1A 1VE9A 1XLUA 1KAGA 1KEPA 1N2EA 1Q44A 2D06A 3G23A 3HS3A 2O9JA 1G5HA 3OLYA 4KUEA 1EE9A 2HSJA 4KK3A 2VUSA 3TQFA 1N5JA 2A9KA 3IAM1 1CUGA 2WMYA 3M9WA 4DBLC 4EG1A 5KWSA 1WXWA 1C1DB 3IUEA 3JSXA 5JTTA 1YS7A 5FD8A 1IYZA 3GU3A 6LDHA 2DE0X 2HV9A 1ZM3A 3C14C 5HCIA 3URKA 5LSAA 3ZI7A 4I4TB 3KJXA 2GESA 1MG5A 2IK8A 2JFNA 3RVBA 1VJ0A 1R64A 4MW6A 4EUHA 3OCVA 4N8DA 4I6JA 4N0DA 4S0ZA 1Y7LA 4ZYZA 5KIAA 2E4VA 5B6JA 3DDUA 1KBOA 4KTTE 1QV6A 1I30A 1TLFA 3UWMA 1CE8A 3ZNNA 3ZY5A 3ED1A 1DTEA 1QRSA 1EJ0A 3GVCA 1N9KA 5J2TF 1EDZA 3DYIA 1EK1A 3JSAA 4LDNA 3UGKA 4R05A 5A6SA 4KN6A 1PT8A 3WMGA 1FFWA 4Y6PA 1T5OA 3LD9A 4L5BA 2ERYA 5ICEA 1UXHA 4JJ4A 2XD4A 5E1BA 3PE3A 4Y9TA 1A8HA 1TECE 1ZBDA 2Y0DA 1WDKA 4JP1A 4H1VA 5K1ZA 3OQOA 1TCBA 3KKEA 2ZJ2A 3D3QA 3D3EA 4ER7A 3PQ3A 1I6LA 4ZTUB 1YU6A 4WZAB 3CZQA 3T5GA 3BXPA 3ZHXA 5C1BA 4IPTA 1GUFA 2W58A 3VSDA 4O3MA 1D1PA 5DHQA 3FSGA 5ICCA 1C0LA 3Q2IA 3PSHA 1DUIA 2QXUA 2AYDA 3CKKA 1E3TA 3C45A 5E9WA 2PGXA 3HCNA 4Y1GA 3E70C 1BE0A 1QQ6A 2XDYA 4QFDA 4G1VA 3WGTA 4H4EA 3HB4X 2QYHA 2JG3A 1ITZA 3BD9A 1YJ91 4QD3A 5DBIA 2C9YA 1VQ4Z 3AUAA 3WZMA 1GFIA 2WJAA 3BMNA 3EAGA 1NDQA 1QCDA 1QVFY 3EIWA 3JQ9A 4QPNA 3QWBA 3KL2A 1AMNA 3PWTA 1SUPA 1U7XA 2GSDA 3OKPA 5K3EA 3DO8A 1NVXQ 2IF0A 3GVXA 5K3DA 1ZVKA 3CMAZ 1FTGA 2Q51A 2RAVA 3MWEA 1KSJA 5BV1A 5C3UA 1GXSB 3HOYI 2QRVB 3M83A 1U98A 3KTFA 3MCUA 4V0RA 3KB8A 2EXXA 2GPYA 3AL3A 3KT3A 1TJ5A 7ADHA 5DNCA 1PFWA 1W36D 4WJKB 3TCXB 4M0EA 3I4LA 1CUZA 2CMHA 2O7SA 2WSSD 3EF1A 2J0UA 5CA0B 4Q5IA 1OH7A 1G8HA 4YRLA 5I4IA 4OQNA 4CL1A 5JD5A 1OI2A 4LJ6A 2CNWD 2D5LA 5I4BA 3CSDA 5A3QA 2I29A 3GN1A 5TPWB 1ZBQA 2VSFA 2OTCA 3LQQA 5CX1B 4KLRA 2WWFA 5KKAA 3BS4A 1OI4A 1XA3A 1U80A 2HGZA 3OMWA 3HCFA 3H4IA 4GR5A 5DW3A 4U0KA 2BTOA 1GL3A 3WJ7A 3C87A 4DLTA 4R8VA 2IYUA 2LW7A 1EAYA 2Q1YA 3H9UA 3K6SA 1LK5A 3QYPA 3Q40A 1LTHR 2YV4A 1EA5A 1RW4A 3CE9A 3HJBA 2MYTA 4DBLE 2BFEA 4L15A 3UHPA 2COUA 3COVA 1YRAA 1CF4A 1N2SA 4GBGA 4OB6A 3FA2A 1HZJA 1I7DA 3IX7A 1EUYA 3DMYA 3O2SB 3O38A 1SHLA 2EP5A 4Q82A 4KNWA 4RKYA 5E1MA 1NV9A 1CV2A 3ZE0B 1RADA 2A4MA 2YU9I 1C80A 5DNVA 3H7AA 5E8RA 4F7WA 1F4PA 1FX0A 2O3UA 3FDZB 2IS2A 1XTRA 1VKOA 2DVMA 2RHOA 3FFBA 4PG7A 2V8JA 3QXJA 2HXSA 3LPCA 4JWKA 3CJTA 2QA4Z 3KKPA 2NYUA 4ZVNA 3SUKA 2QUBA 4OH7A 4EVIA 1AKWA 3HYCA 1BJKA 4O2RA 4PY2A 2I8LA 4DLBA 2A9VA 3BTVA 5FR1A 1DC4A 4XGIA 1J2JA 3HHEA 4HNGA 3LPDA 1XEWY 1DX4A 2GJ8A 2OMKA 2X42A 2Z0MA 3LK7A 4TXHA 2R8EA 3T3GA 3TXXA 2BMEA 3IULA 2PKEA 1LKZA 4YQYA 3TDNA 2F8LA 2GCOB 2CNLA 2WTMA 3B1WA 4L02A 1ZVMA 3I9KA 1I33A 3QTLA 4FFBA 2FMFA 4O4JF 4RQBA 3ZJ4A 3WMEA 1EFVB 1FZTA 3AHIA 4H59A 2XUOA 2GAEA 1PWZA 1KRHA 4YXFA 3DB2A 3MTAA 4KWHA 3WLNA 1QBKC 5E3HA 4IGEA 2DUWA 1A8UA 1AY0A 4OHXA 3S2GA 4NPAA 1F14A 4ZT6A 1RLMA 2J8ZA 2YJ5A 3AXSA 3P94A 4F11A 4CCYA 1NBME 2OHOA 1K2VN 1KYYA 3GHHA 1XRQA 3KPJA 1V8PA 4ESHA 4I3GA 1QDUA 1MO2A 1QH0A 3SQXA 2TSYB 3IIIA 3UUWA 2XXAA 3BSSA 1XELA 4OM8A 2NPFA 2CJWA 4OQPA 1I2CA 1FVXA 3MERA 3A14A 4TV8A 4UHCA 1C4KA 1GPYA 3SC2A 1ZHOA 2VSOA 3DV0B 4GVLA 1UADA 1H2ZA 4KN5A 4MRRA 3MBIA 5IUKC 4NICA 3WAGA 5TE9A 1RM5A 1BD3A 2CWDA 2YMLA 5CVEA 1QGOA 5U9CA 3UHFA 3KOZA 3QX3A 3ICWA 3QHAA 3IEKA 4OLHA 3Q12A 4HH0A 5TC4A 2A33A 3DTVB 5AKZA 4CHGA 4E32A 1J0DA 2D5AA 4AG3A 1QR2A 1ZOIA 5CH5A 4G5RA 2GLTA 3PEYA 3GPLA 2GJAA 2QQGA 4H35A 3GTOA 3CWCA 1U7HA 3D9XA 4OHZA 1KTVA 1OBOA 3MINB 4Y2RA 4KO8A 5DKFA 3CCU1 4ZAVA 5F64A 1CZKA 4NMLA 3A1VA 4NDAA 1FP2A 1DRUA 1IB6A 2NV6A 1SCIA 4IEEA 4AF8A 5CFRA 3P9ZA 4M1YA 1U0TA 5K4GA 1GLVA 1JQBA 4MITA 1ZY2A 5HILA 4BGUA 2Z8XA 3HJCA 2VHUA 3K0CA 3K35A 5JD4A 4OX9B 1EYZA 1ZM7A 3R6LA 2ODNA 3DDCA 1SB9A 3IOCA 1Z25A 1I4TD 1RXIA 2GAFA 4PYKA 5FJJA 4CCSA 4BQRA 4E5YA 2K5RA 3FAZA 4M1TA 1ZW1A 3WNBA 1VLHA 4O0LA 1FTQA 3JVIA 3LWNA 1ZN7A 1HWYA 2GRJA 3OM1A 3L6CA 4KEAA 5B4UA 5LQJA 1CBUA 1JG2A 1M1UA 2FCRA 4GMKA 3VQTA 4B44A 3F7MA 4BCCA 1P60A 5LQNA 1RO2A 3QUTA 1ZJJA 4B9EA 3I1JA 2W00A 4P3XA 4XA8A 3WV4A 3PITA 1XCGB 1V5IA 2CFIA 1ZUNA 4Y2UA 3M2PA 1YACA 1CP2A 1UM9B 4FZVA 1QRTA 1LEHA 5B4TA 1T1EA 1XJ5A 4OXIA 2IYZA 5EGNA 3DMGA 5F2OA 4Z7NB 2EQ5A 1USPB 2KX7A 1ESMA 1SRRA 4NY1A 3E3LA 3G7UA 1H2WA 2WW8A 3U3KA 3HYTA 5D3ZA 2HMAA 4GM4A 3VAAA 4AX8A 1DXYA 1WB4A 1UWKA 3HNRA 3NKLA 3EC1A 1PWXA 4WQMA 4ZRMA 3K5WA 5AJZA 3ZK9A 2O2DA 4MX8A 3B78A 2A86A 1HYGA 4MPRA 4PAQA 5T4EA 3RU2A 4DYVA 5GOZA 1WXIA 3VKVA 4L1KA 5ALYA 4PWYA 5KSOA 1JR3E 2P90A 3OLZA 1PVOA 3GARA 2P1ZA 2QAGB 1DAGA 1LBEA 1KMHA 4XGRA 3ICEA 3SJCA 1XTIA 2PNJA 5JSKA 3RSFA 4MOWA 3KU1A 1M7HA 1JILA 1X1CA 3OIVA 4F4DA 3EZ9A 3UMGA 2A7XA 5CFZA 1PWYE 5AW0A 1BU8A 2UYQA 2QN1A 2ID7A 2H1FA 3CO5A 3DFFA 4GPAA 4B6EA 5FFNA 4NK5A 2C2BA 3JASB 1LBQA 4R6WA 4WPGA 3SQMA 5G41A 4LXHA 2LR0A 1EGAA 1LS6A 1F2UA 3B1KA 2E4AA 1FU4A 1NJI1 5CVCA 3SZUA 3GEGA 1R5BA 3RHSA 2YVLA 1UBRS 1MENA 2FN8A 3OU2A 4EYOA 3HGQA 3CUEF 4TYQA 1FSZA 3M81A 1N5RA 4CMIA 5IF3A 1NW6A 1SVWA 2FSSA 3GC6A 1M2OA 2GN1A 2XMCA 4JLWA 1L4EA 4J0CA 4RFVA 3SOZA 4NBHA 1RFGE 3S5JA 4BLRA 4WK4B 3FVQA 2Q7XA 2VOEA 4KQWA 4KOEC 1GNQA 3TQCA 5ECYA 4D0GA 5D01A 3KQKA 2WJZB 4QU9A 3SXPA 4UQOA 2IV3A 3FCEA 4NBVA 4B48A 4MVWA 1JLLA 3HGMA 3DLTA 2ZS8A 4L16A 1AKTA 2EG9A 2FXIA 3FUXA 5A3VA 5LP6F 4B4KA 4KR6A 3UH0A 3TAHA 4KFSA 3VHQA 4PGFA 2RIRA 4TMYA 5I7FA 2WPNA 1RWXA 1JQ3A 1HNZB 2OE2A 4NH4A 1SC1A 4PC7A 4L3OA 2DE6A 2IP2A 3A1TA 3ESRA 3M70A 4JFRA 4MMYB 3OESA 3W04A 2KQUA 2P2NA 4MHOA 2NP6A 4URZR 1R10A 5I9TA 4KYVA 4H7KA 2JLRA 1I10A 3TFWA 3VFDA 3JZIA 5CT4A 1RPNA 4R1UA 5E8JA 3SHTA 1M0TA 4MPDA 1UHDA 4C7JA 2CZGA 1DWOA 1RQPA 3JPYA 4ER0A 1ML8A 4IHJA 5K8IA 2JS7A 3PX3A 3HO6A 5A2GA 1I3OA 1BDJA 3CH6A 3DFUA 3ZOKA 4E12A 4AC9A 4KIFA 5D1OA 3TSAA 2J9XB 1B8NA 1XA4A 2NSHA 4KQ2A 1YMVA 2Q6TA 2EEOB 2NTJA 1NVFA 2XRMA 5CR9A 4YMIA 3TF5A 5EWLB 4M9XA 4R2JA 1ACLA 4HB4A 4PG6A 3M4OI 2EC5A 2YV1A 4NU8X 5FPPA 1BIFA 3K0FB 5IC5A 3OQMA 1NP7A 3RSOA 1H2EA 2QJWA 1B3BA 2Q5JA 3M5WA 1TOAA 1DP4A 4OHVA 5ALWA 2O5EA 4CGYA 3L4EA 1FOEB 3NCHA 1LXCA 2PX0A 2IW3A 3DZDA 1Y9AA 2OZEA 4PV7A 5IAAA 2ZJOA 4IOMA 3VAZA 1NRIA 3INYA 5JEDA 4NL4H 3HACA 4O2BA 3X1WA 3OTQA 4C4YA 3QVTA 1FLAA 4M99A 2XKBA 1E5LA 1ODKA 3SR4A 3U60B 5A4JA 4ZJYA 1Z35A 3OCCA 4CBVA 5ELXA 5EIEA 4F7DA 4BUCA 1Y8QB 3JYLA 1TW2A 2VSYA 2AUMA 3VX4A 3L7MA 1P0PA 2RIPA 1E1YA 3IYLW 4LE0A 2MDTA 3M1YA 4LOJA 5E7MA 3TL2A 3TO5A 2C29D 4CDRA 4P35A 3K0HA 3VMGA 2E6UX 3ELWA 4QUGA 1KI1A 4TT3A 4WA7A 2TS1A 3B82A 5NLLA 1ZD1A 4ZOLF 3V42A 3BFVA 5A7HA 1GNRA 1AE1A 2GVZC 4KXQA 1TTTA 2ZEJA 5HJ2A 4OF4A 5ESRA 2C59A 3LC0A 4MQEA 1K1EA 4HNVA 3QM1A 4G65A 3T5MA 2EEZA 3QXXA 4REQB 3D4NA 3OLVA 2AV6A 3AQIA 3QP9A 4J1TA 4B09A 4BY1I 1CUVA 1GZ4A 3GFOA 2XH8A 5IPFA 2FOLA 1V16B 1BCSA 4GXNA 3QKTA 4WY5A 2ZJBA 1L4BA 3IAHA 2AIRA 1GM5A 3FMGA 2EHDA 4X44A 2FPIB 1KE1A 5LA6F 2WZCA 1XLVA 2K4MA 2R7ZI 2KLHA 1GRVA 2OCXA 2WPDD 4NBSA 3DM9B 4OUDA 4Q1VA 3TRHA 3A6ZA 3NHBA 2D4AA 4CL3A 2AN4A 1PJTA 3EGXB 3L9XA 3RUAA 3TUJC 2BH9A 2DLNA 4W8HA 4FMCF 3VH1A 5K0CA 1XRLA 1P0CA 1ZGCA 2G25A 2P62A 4RXTA 4G1UC 4XR4A 5AI6A 3VDQA 4XX0A 1P9OA 1Q5PA 1VQP1 3L8EA 3URMA 5ICMA 2HADA 3EVDA 3CN9A 5IJAA 3ODPA 1QAOA 2O8VA 1PV1A 1ONSA 1TCAA 4JGIA 2DUMA 2UXDB 5FNVA 1KIAA 4A0QA 5HCNA 2DF8A 3PPIA 4UDOA 4DRYA 1X1EA 4HFJA 2AOXA 2FRVA 4Z3OA 3D8NA 1H5UA 2CWWA 2WU0A 5F5XA 3T1YB 3D43A 3E35A 1D03A 2Z6VA 3RIEA 1VHTA 4K9RA 1PGOA 3DLCA 4TTSA 5BMVF 3E9YA 3GZNA 4JROA 1DX9A 1A96A 1UOQA 4AX4A 1XEAA 1YITZ 5JYEA 3Q1KA 2IP4A 3TNLA 3UJ6A 1MB4A 3ZU6A 1OA7A 3OIWA 2H57A 5JS7A 3A58B 5TQ2B 2A0FA 4C4ZA 4MDEA 2FR0A 3TKYA 3KSDO 3CCL1 2XYPA 1NJ5A 2ARKA 3VB9A 2C5SA 3BXEA 3W6ZA 4YRMA 1T6BY 1RAAA 4B17A 1LF5A 2W6OA 3AVQA 4KN8A 4MUKA 3DWEX 2I6SA 4BO7A 2GXUA 1MO4A 2O57A 2X7HA 3FGPA 3PTZA 1KJJA 3QX7A 5LXTF 3TX6A 5IN4A 3CUKA 4DV7B 2RK6A 3HVUA 2QTTA 4S04A 3RRXA 3FKSD 1EIWA 2G8NA 1OT5A 4NK4A 1R6DA 3D6TB 2E89A 4YALA 1W0KD 2JL1A 1T26A 1SEPA 2AHRA 3ESQA 3IAUA 2ZWAA 1YGYA 4Y2PA 2Q21A 3BWEA 3EG5A 1JLSA 1NFQA 2XUZA 3CX8A 1O58A 4HRVA 5EG5A 2HO4A 3RAPR 2NZVG 3I4CA 4PHGA 5D86A 4PCAA 3RRYA 4E22A 1MZVA 4D9JA 3DJFA 1PL8A 3W90A 3M3HA 1I6MA 1RPAA 2I6UA 3PQCA 4ZMSA 1RZRD 5KWVA 5ADHA 1ZR4A 1P8JA 2Y76A 2HC9A 2VPTA 4FDUA 1QB7A 4MVJE 4NOZA 4BNFA 1K06A 4YYEA 1RLYA 4RVDA 3MLAA 2ZTUA 2YADA 1E2LA 5F51A 3NXKA 2HN9A 2XE4A 4YWJA 2PBZA 2DH6A 3HG7A 4FSHA 4N7JA 4JXKA 4HAUA 4U7FA 2A78A 3S2HI 3OH8A 2QREB 1VJ1A 2AKLA 2RHRA 4TWAA 4ZO8A 3AF0A 4LCBA 2XT9A 3RV3A 1R6TA 4TNUA 1D1QA 1HG0A 1F2VA 4M98A 3NI2A 5DHFA 1TJNA 2QTLA 1KQNA 1XNRB 3FR7A 3T4EA 1GPLA 2ZB8A 3MUEA 4H6XA 4PRLA 3WMXA 4EJ6A 1UIRA 5BQXA 1MEJA 3IDFA 3GJ5A 1E3DA 2IUYA 9LDBA 4D6YA 5CB0A 3IBYA 2Q3BA 1QVGZ 2Y1CA 4HOYA 1AF4A 1ETUA 2BEWA 1AMOA 2CCKA 3LT2A 1H1TA 2BE9A 3T5PA 2FOIA 4KPGA 4X94A 121PA 1E2JA 1PZXA 4BFZA 3Q0EA 1GN9A 2G28A 2ZJAA 1P9NA 3O8OA 5FOSA 5KYWB 1KBQA 3AF6A 1KEKA 3W8EA 4FR0A 5EPEA 3U3MA 1ACJA 2BEKA 5IZCC 6REQB 1R6VA 4MGEA 2O19A 3EVZA 1I9CA 4R9VA 4K8RB 4GYKA 1RFLA 4IJKA 4J07A 3VYVA 1NFRA 4D97A 2FPLA 2N0SA 3QITA 1JEOA 4KLZA 4PQFA 4YRGA 4N40A 1L5VA 1I9GA 1QANA 2V0CA 1OVGA 3JVVA 5EI5A 1M33A 1X92A 2BHRA 3KXDA 3K4PA 1T0JB 5ITWA 5C31A 3PXCX 1QTQA 1UWLA 2ZDQA 1QF7A 3MT0A 5EINA 5HK9A 5JAZA 3T3OA 4DMHA 1J2EA 1SQ6A 3H2GA 4FEYA 3ANNA 1TWCA 3IC5A 5K3FB 3DMTA 2JFXA 2I4RA 4OQXA 3OJFA 4TVKA 4ERXA 2R6HA 2J4CA 5DMXA 4FCTA 1D0IA 1E6LA 1ARZA 3FZQA 3WISA 3VNUA 3N3BC 2BR5A 1NW9B 5C7IO 4CLRB 3H6GA 3ASYA 5AUNB 5FBQB 2IEYA 3NAMA 4PPNA 3W5AA 2RBEA 3L77A 1U63A 2HHLA 2HQOA 2R1TB 1W73A 2DTDA 3Q1LA 3KKKA 5CAEB 1UEIA 3HKCB 4DC9A 4MS1B 4P53A 5K8VA 1ZX1A 1HQYE 4WINA 3W7VA 2BCGY 3R5XA 4H7EA 4F2GA 3QX8A 4B4DA 5JZOA 1IQ0A 3MTEA 4IXNA 1MJGA 3OMLA 4L50A 4AMGA 4IV0A 3E2IA 1KZ1A 4EW6A 1HF3A 3LL4A 1EEHA 4M60A 4Q16A 1A7AA 1C1XA 1QK4A 3UT5A 5EVCA 3AFHA 5DLQC 4AYTA 4F6LA 3TG2A 4MJLA 4ON9A 4EKNB 4C3UA 5JZSA 3OCZA 1U8EA 1VA4A 3OHPA 2KYRA 1VQ5Z 1IULA 3O94A 4YP0A 5DNYB 3RVKA 4MA0A 1PNVA 3CU5A 4D99A 2QRDB 2F3QA 5K0EA 3U4QA 1HKHA 1YI1A 4EPYA 1SVKA 3L5KA 3ENGA 1WXQA 3SXUA 2ECPA 1J42A 3BHNA 3TZKA 4JCWA 1ZO8A 4UKDA 3NLLA 3OEYA 3IILA 5CB4F 5IKEA 4HWRA 2L2QA 3OF3A 4JB2A 4UCXA 1LRKA 2CD9A 2YMPA 3DE2X 2QJRA 3Q8KA 2NV0A 3ZDQA 3CJQA 4TLCA 1XRRA 4IZHA 2Z3VA 3MRSA 4JCOA 4UUQA 1Q74A 2YZNA 3LKVA 4JVOA 4P83A 5CEJA 5F9HA 5KSWB 1O6ZA 1LPNA 5KX5A 1OFHA 1BXZA 1Y82A 3KB6A 3LS2A 3OKCA 4W6ZA 4BFSA 2XB4A 1MA0A 4MVJI 2EZTA 2Y3IA 2ZRPA 2DT5A 2QMHA 3ISVA 1IEXA 1PHRA 2V7QD 1YR6A 3QKRA 1OAKA 4C5BA 3NIBA 5BRAA 2XMGA 2JBHA 4JP5A 1HT2E 4ZTZB 3F98A 4CPDA 1RJFA 3R9IA 3STTA 2QTBA 4RVSA 2XKKA 2YV5A 5D85A 4B47A 2BONA 1Z0KA 4CWAA 2HMYB 2DP4E 5H81A 5IUNC 3KB2A 4MGIR 3GGSA 3JR3A 3P8ZA 1ZISA 4NEGA 5E4JA 3ZGOA 1JEAA 2VWPA 5IT9b 1XXLA 1P61B 1W34A 3EY9A 5KJFA 4QAJA 4X62B 3VAYA 4F1WA 1N6KA 1PWHA 3GEPA 1FNNA 3L0OA 3OP1A 1ECJA 1N2CE 1I13A 2IE8A 2IXDA 2TMKA 3CY6A 3K9GA 4QUDA 4UUAA 4CKBA 3CUUA 3IVXA 4R81A 1PJBA 2F3RA 3V8NA 1D1SA 3HXMA 3AO0B 5DN6D 1S7CA 1E1CA 2H2HA 3LIIA 4AWXA 1JECA 2JUBA 4WZBE 1O08A 4FW8A 1EFTA 2DQSA 3S7TA 1ORRA 2PGIA 2PQMA 1SCNE 3V9AA 1U1GA 2IRWA 1KZGB 4TROA 1X2EA 3CCMZ 3JARA 5CFLA 4R54A 1DIAA 2M2IA 2C8KA 2YHIA 1C8LA 2C5EA 3TJRA 1TDJA 2AI3A 5J4KA 2UYOA 3NATA 3SOPA 3RS4A 1CR5A 2WICA 3BQNB 3VR6D 1I7SB 3SFZA 3SICE 3A1NA 2RH9B 1N3YA 2X2FA 3TXAA 3H19A 2G0TA 2YOHA 1QONA 3QXCA 2EW2A 1SWVA 3TOSA 3T3PB 4KWIA 3HNPA 3IV9A 3P0IA 5FOVA 3E0QA 2J85A 2E1RA 3K8ZA 1Z5OA 3MJCA 3N1UA 3KD3A 3R20A 3Q7IA 2CXOA 4LBWA 1H4QA 5DGIA 5DWVA 2Y6VA 1E2HA 3B6IA 3GFBA 4C6TA 1FTWA 2AH5A 5F76A 3R44A 5K6TA 4OMUA 1DCTA 1G60A 2I7DA 3VISA 4YAFA 3N2KA 4NU5A 3REFA 3I45A 4IUDS 5ALMA 4NCIA 2FK8A 1VYHA 2ENGA 4MNTA 3HB5X 5EJIA 3A9SA 1QPBA 4ALMA 1NPDA 3HBLA 4L3WA 2P8JA 3LPLA 2YW9A 1H0SA 1XZKA 1UBOS 2ZYWX 1M8KA 4J0HA 3C8DA 1XAJA 3FDFA 4LOIA 2VRBA 2IA5A 4NYMQ 1G1AA 2PTHA 4RL4A 5H82A 4M37A 2IIQA 1ZXXA 3I56Z 2BJHA 2FSGA 1J8FA 1XZNA 3FZGA 4HDQB 5JC8A 3PFBA 1XV5A 2QQEA 5TJ9A 2PMKA 2E4ZA 4JBNA 4ND7A 4RGYA 5GZ1A 4JI2B 2C3UA 3G68A 4WXYB 3R0ZA 4EA6A 4EI2A 3WGUA 3RGGA 2OLEA 3I2FA 4CKEB 3G9XA 4EHAA 2B61A 3JAMb 1NKVA 1KEEA 4PYIA 2HJGA 1ZHHA 3AVYA 3RJ5A 2H1LA 2Z57A 4DLSA 2YWEA 4TLAA 2AC2A 3D3WB 5T4BA 2FPWA 1AKQA 2DC1A 4RJIA 4DA4A 1WXDA 2QN8A 1DRKA 1FYVA 3K09A 3JYQA 4R98A 1THMA 4QDZA 3JQAA 5FNZA 3H9JA 3G2PA 3I34X 4PG4A 3U5TA 1QYWA 1Y6RA 2G8LA 4NCHA 4NIMA 3I6ZA 3NYRA 5FR2A