2IV2X

Reinterpretation of reduced form of formate dehydrogenase h from e. coli
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
715
structure length
697
Chain Sequence
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Formate-Reduced E. Coli Formate Dehydrogenase H: The Reinterpretation of the Crystal Structure Suggests a New Reaction Mechanism.
pubmed doi rcsb
molecule keywords Formate dehydrogenase H
molecule tags Oxidoreductase
source organism Escherichia coli
total genus 253
structure length 697
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00384 Molybdopterin Molybdopterin oxidoreductase
X PF01568 Molydop_binding Molydopterin dinucleotide binding domain
X PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 2iv2X01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2iv2X04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2iv2X02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 2iv2X03
2R93A 5DYIA 3OUGA 3GTLA 1R9TA 4AOKB 5FTLA 1EU1A 1Y1VA 3H0GA 1CR5A 2PJHB 4DMRA 1G8KA 1UHDA 2JIQA 4CRZA 2VUMA 3PLXB 1E61A 2YU9A 4D7ZB 2IVFA 3TIWA 1H0HA 3QWZA 1I50A 1QDNA 1YLEA 1CZ5A 3ML1A 1PQHA 1R7RA 1TWCA 2NAPA 1Y1WA 3QQ8A 1E5VA 2R7ZA 3HKZA 5FTNA 1SFOA 1CZ4A 3IR5A 4GA6A 1Y4ZA 3GTJA 1TWFA 2B63A 1OGYA 2V45A 2WB1A 2DMRA 2JA5A 3GTPA 2NVYA 1I3QA 4CRYG 2IV2X 1Y5IA 1KQGA 1PQEA 1AA6A 1E60A 4QIWA 2EEOB 3DMRA 3GTQA 4RV0A 1AW8B 1SIWA 1WCMA 1PQFA 1WLFA 2NVXA 1Q16A 1TMOA 2JIPA 4AZDA 3HU1A 5FTKA 2VPXA 2WAQA 4KDIA 3TM7B 4AONB 2V3VA 1K83A 2Y0SA 5EPPA 4AYBA 2JIOA 5DYGA 1QCSA 5FTJA 2C45A 1VC3B 1E32A 2R92A 1PYUB 3QQ7A 3IR6A 1KQFA 2VPZA 2VPWA 2JA6A 2JIRA 5B6CA 1FDIA 2E2IA 1FDOA 4CS0A 1PPYA 4KDLA 3QC8A 5T5ID 4GA5A 5GLFA 3HU3A 2VPYA 1DMRA 3GTOA 1G8JA 1PYQA 5FTMA 2E2HA 3CQZA 5T5MD 4KLNA 3HU2A 5C18A 1PT1A 3O5AA 3CF2A 1UHEA 1TWHA 3GTMA 1E18A 2PMZA 2JIMA 2JA7A 4KODA 3FKIA 1TWGA 3GTGA 4AAYA 1PT0A 2NYAA 4C2MA 1DMSA 1S3SA 1R27A 2KI8A 3GTKA 1H5NA 4KO8A 5C1BA 1IW7D 3IR7A 1TWAA 2E7ZA
chains in the Genus database with same CATH superfamily
2A1TS 1ZOIA 3NC4A 5LMCA 1GL7A 3B7PA 3IJEB 4YJ3B 2LWIA 3BQNB 4URVR 5JCOC 4EUHA 1HUQA 4B4DA 1NT4A 2E0IA 1HE3A 1JBQA 2HPZA 4XM2A 4YMSA 5FA8A 4XFDA 1DC5A 5AVXA 4Q9KA 3QBJA 1K08A 4HT3B 2A6PA 4GKAA 4MW6A 1LF0A 1JDUA 1JR2A 2FOIA 4W6ZA 5BNWA 3DJFA 3KKOA 2FWIA 3SK0A 4HUQB 2IPXA 3ZW9A 3AWIA 3NI2A 5DEOA 1ZMOA 4EELA 2WLSA 5F7JA 3KSUA 2ZYIA 4GOLD 1IN5A 4M1YA 5JD5A 1O0CA 4JEUA 1ATZA 2VZ8A 4MS4B 4FBGA 3OMLA 1QU3A 3C16C 1U3VA 3KZKA 1CZRA 3V34A 3U3ZA 2FW7A 2XB8A 4H15A 2FX3A 4MLCA 3PC8C 2OMKA 2V7BA 3E7FA 3G5AA 1JPJA 2P69A 2PKCA 4ABTA 3DPUA 2R4UA 2E5LB 5T64A 4A8PA 4V0LA 3DWIA 4K9MA 2VO1A 3WNVA 2A4MA 1CYDA 3L7IA 5CM8B 4DQVA 1ULBA 2Z98A 1Z45A 3FCCA 1BCSB 1ZNXA 2EZUA 2VA9A 1JDBB 2GAAA 2BL4A 1KMNA 2OBNA 4M98A 4B48A 3I5XA 3MD9A 2X40A 9MHTA 1JFLA 1FTGA 2ALJA 2ZIXB 4Q3AA 1EK5A 3Q5DA 4YK7A 3EXG1 1I5OA 4TTSA 1R6AA 4PPNA 4U6SA 1L7MA 5CH5A 4TWZA 4FW8A 1CPYA 3X2MA 3T54A 2PSDA 5SY6A 1QZTA 1ZGBA 2HXSA 4TV9A 3OKFA 3T5AA 1L9KA 4IV0A 2JLCA 4LZJA 1XA0A 3S2UA 3FKII 1PL0A 3ZU2A 4BJ3A 4D9JA 4ESEA 2C61A 1ADGA 1U2GC 3RYIB 3MOIA 4ZRNA 1CEYA 3LUSA 1RWWA 2IW3A 3EQ6A 1LC0A 1EFCA 3TM7B 1EX1A 3KZNA 5ADUS 2XDQB 3CNOA 3CJQA 3CCSZ 5B5SA 2OCGA 1U98A 2XUOA 4Q47A 4L4UA 4LZOA 2V9CA 4KGVA 4AYBA 4LOJA 4ZPXA 5DKFA 3ASZA 2IYEA 1JXMA 3A7DA 1R4ZA 2HK7A 2GU2A 2OORA 2P6NA 3IP1A 4WUTA 3CC41 3U0VA 2PI8A 2OENG 1N5MA 2QRGA 3CBQA 1EESA 1VLHA 1X7ZA 4V1CB 5C51B 5TMEA 3U31A 4FN5A 3SNKA 1KO1A 5BRNA 1E6CA 4I0WB 1XZMA 3IQZA 4I1IA 2WPDA 1Z6GA 3OEYA 4FT4A 3BZWA 5IDVA 4P7JA 1TCCA 4NBAA 1QM5A 1X9HA 3R3UA 3E84A 2JASA 3U48A 4DXDA 1NN3A 4X95A 1RXUA 4BWFB 3ZYCA 1PLLA 4K03A 2C3PA 2RHJA 3CC2Z 4OBBA 2B35A 3JX9A 3TBKA 4PYMA 4AI6A 4JXKA 5D1HA 1MGPA 2CXQA 3JARA 1R0ZA 5F51A 3SFZA 2WWTA 2O5JD 1GQFA 4FTWA 1TYEB 5CM2M 3A1NA 1E5XA 1YJQA 6LDHA 2DQ4A 1FDRA 1CY8A 2X76A 3K05A 2ORED 2CV1A 1GTL1 2HBZA 3AJDA 3THXB 3QG1A 1Y0BA 4O2AA 4BPBA 1W29A 1TXGA 3OPYB 4XH9B 1QH1B 1SH7A 2AOUA 2I7DA 1W7AA 1GNTA 2FSUA 2YWEA 1PAUA 3OU2A 2FJUA 4YP9A 3U4DA 6AT1A 3TFOA 1QE0A 4P86A 1ESEA 3WRXA 4BMSA 1FTSA 2MDTA 4G9BA 1K1EA 2AG0A 2XNCA 3ESAA 4XWTA 2WWVD 3Q15C 5JVDF 1NX6A 4LJ5A 2ZAIA 3DWEX 4XCXA 3E1SA 2GS9A 1Q6ZA 3SDSA 1D09A 1A1VA 1FYXA 2WF7A 4L08A 4Z4QA 2CL6X 3PC3A 3D3QA 4NBCA 1AZTA 4JB3A 5D8DA 3UHOA 5CB8A 1Q57A 1RXIA 1WAMA 4Z1MD 3DL7A 2F62A 2DY1A 4JWKA 4AZ0A 1GKYA 3L1UA 3HKDA 4QQ8A 4B83A 2ZJAA 4U0JA 3W5HA 3HYNA 5HRAA 4D25A 3O38A 3NFRA 3UAXA 2O2YA 3GRYA 1R0RE 2VDJA 3IJRA 4P4TA 3RD5A 1SC6A 3UMCA 3NWEA 5E2IA 1FFSA 2XLBA 4U7GA 1ZGAA 1ML8A 5HZKA 5DGCA 3TM4A 4NEQA 5CDSA 4DE5A 1A7UA 1WL8A 2WD9A 1JAIA 3IO3A 2OP1A 3N6VA 4QA9A 5JS6A 1NONA 2QVGA 3HJCA 4BU0A 3UICA 4O4JA 7REQB 5IBRA 2H29A 3JQBA 4GXTA 1OGYA 2IZ6A 1H2BA 3RSQA 1U0HC 3KLOA 2GWRA 3UJ7A 4CCAA 3ILSA 5C3MA 3JZFA 3LE8A 5CVUA 2AOXA 5CLLA 2WIAA 1U9IC 4D8YA 1T9CA 3AJEA 2IV2X 2E82A 3FYHA 5K0GA 3DM5A 1N7IA 1I6LA 1YUAA 2VL7A 3ETGA 2Y92A 3GJ4A 3PP8A 1DO8A 3QHPA 4RK7A 3VX4A 3DVAA 3WE7A 2WFLA 3QJYA 4I19A 2FZKA 4ARCA 3LP6A 4Y6GB 5AHKA 4L28A 3MS2A 1QFZA 3KC2A 4ZQCB 4BEJA 4XWYA 1KP2A 3HBAA 2CFCA 2CB9A 3RAJA 3VZQA 1FZQA 2QN3A 3HRKA 3ZU6A 4DCNA 1R5BA 5ITSA 5LM3A 4HUJA 4EHKA 3A6HA 5EHZA 1IAVA 3W5CA 2BSXA 1N8TA 5DRYA 4RTJA 1UDWA 4RV9A 1GG8A 1VI5A 1ISPA 1SVMA 2CFTA 2RG7A 4JLKA 4WXHA 3UENA 4YREA 3ERCA 5FLXA 2VTEA 1X9IA 3LDUA 1WJGA 3G89A 1B1CA 3SDZA 3LT2A 1KFBB 1AKVA 2E4UA 2EP8A 4RVOA 3TDKA 4XRGA 1PYUB 5JZVA 1JSZA 4LQ4A 4BLQA 1GPKA 4BVAA 1CQIB 2YICA 2P9ZA 4PZYA 4IFBA 4IBOA 4CIXA 3ZCXA 1DJOA 5T4FA 3ZJVA 4HDOB 3QMPA 1Z2DA 1VB3A 1E2GA 5TGDA 1T5IA 1XRPA 1XQWA 2FHPA 1RPJA 2VIIA 3EODA 3O2QB 4P3OA 4XM0A 1IOZA 3LUAA 3RJMA 1GRRA 1P9WA 2Q21A 3FVRA 3DKVA 4KV7A 4GMFA 1JDJA 4X41A 3AF1A 1HE8B 2WKWA 1YS4A 1C1XA 3O5AA 1PWHA 1RM4A 4MKZA 4MWDA 5HXAA 1U9ZA 2FDCA 3O31A 4IW3B 1ES9A 4DA4A 2R8ZA 1Z0IA 3HSYA 3G2NA 1XU7A 3GLGE 1SK9A 2FPGB 4DLBA 4LQDA 1Q3HA 1HLFA 5CBKA 1J39A 3I1IA 1YDHA 3T34A 2JA5I 4HFRA 5LN1A 1ZK1A 5KSYA 3JR7A 2R60A 1JJVA 3V7FA 3NPMA 4GGMX 4MQLA 4DREA 2IU6A 2ZSAA 2PHZA 3HR8A 1KIFA 3P9SA 4DQ0A 4DR5B 2WRZA 3HCNA 4H31A 3WAGA 1ECPA 2K5RA 1LRJA 1LFDB 4G5SA 2Q4BA 1FBNA 4HQ6A 2FZVA 2MR6A 3RSSA 3TPZA 4BX0A 3VSCA 3AZOA 3I55Z 3ZQUA 1ZUD1 3PX7A 3TO5A 3Q10A 4XYGA 3HV2A 1CR5A 4MVJP 3C5CA 4MS1A 4Q3BA 3H4IA 3ZHVA 3GDOA 4KLCA 2B37A 4BBSI 1I8TA 2G4VA 3W8DA 3PS9A 4YMHA 4RZHA 2REBA 5ERXA 2RGRA 1X15A 5C7YA 4GDFA 1U1FA 2V7VA 4C3VA 2JH3A 3K0FB 1DCFA 1NBMD 2Q6OA 2QN2A 1Q95A 1P74A 3HJRA 4B0PA 4AT1A 2F48A 1B42A 1MV8A 5CEFA 1AH2A 4H59A 2OHXA 1VG0B 1XVIA 4RVCA 1L8AA 2VNSA 1YHNA 2X2PA 2BH9A 4UHKA 1DIAA 2HRDA 3OOEA 4KQKA 4A27A 4BBZA 1E5DA 3I61A 1KXJA 3GRKA 3SXUB 3ETCA 1EJ0A 1P2SA 2BLNA 2VXCA 3DZ8A 3EVFA 2H0QA 3D2CA 5BYBA 4HSGA 2K4MA 5FLXf 1H2ZA 2O0LA 3G4SZ 1CEXA 2W6CX 4NI5A 4P4LA 4BKPA 2QTZA 4HMQA 4NBWA 2YVLA 1PVDA 3T95A 3VPSA 3HJBA 1LCIA 3CX8A 1RQ7A 3IEVA 4OI0A 3ZG6A 1ENPA 2Z3WA 1Y7PA 2ZSBA 5TSDA 3TAUA 1T6NA 3PEYA 4E21A 2O3JA 2GAJA 4IDDA 1IMOA 3AQIA 2QGFA 4G5YA 2HOQA 2Z8YA 3C5VA 4BBRI 2I2CA 2CMFA 4HYTA 1AXEA 5CDGA 5EEGA 5EPUA 1NDHA 1V45E 1Y4DE 4AX8A 1YA8A 5C5EA 4K0KB 1QANA 3JQPA 2PBZA 3E18A 2W0SA 5M5BA 3O91A 2GZDA 2G6GA 1AZWA 2HIMA 2ZJFA 3MQ4A 4LMPA 3IHKA 3KT6A 3TYXA 4YI3A 3WGVA 4D99A 2BYTA 2W98A 1JG6A 5I7UA 5FOVA 2OECA 3HFSA 1ZAYA 3NPAA 3TOXA 3EPPA 1GTMA 3AF4A 4HBGA 4W82A 2QRLA 4ZRDA 5J63A 3FPKA 2PCJA 1IXSB 5K09A 3LQ4A 2VZEA 1RWKA 1L8LA 2DTEA 1E4YA 1DQSA 1QOZA 1X3LA 4FDLA 4LW8A 4WMLA 1ZCAA 4MONA 2VYVA 2XY4A 3PDUA 4Z4HA 4M0DA 4UVIA 3P2JA 2ZTVA 5CEJA 4O1MA 4H77A 1PFUA 3LX6A 4J03A 5E6RA 4HNQA 2QLBA 4LG1A 5KSPA 1JL3A 3H5NA 3EGWA 4C4TA 4CFSA 5JYBA 3RBZA 5IEBA 2IK8A 2IFTA 3ENVA 3KYDA 3B1FA 2GKSA 1N3BA 4IMJB 4HRYA 3CB4A 2ZRJA 2OCXA 2BSAA 2X2FA 3CEMA 1XDDA 3GTJI 4Q24A 4BEWA 5H02A 4NPHA 4IDOA 1V16A 5AKJA 2DR0A 3ZHCA 4QQRA 2D6FA 3KXIA 3REFA 2HF7A 4S1WA 3T7SA 5C1DA 2B4AA 5ELXA 2DHEA 1WB9A 2PLWA 3WL5A 1MABB 1T9ZA 3PYXA 2GCOB 3L79A 3QU9A 5K05A 1KI2A 2C7QA 5IM4A 5K8JB 3G68A 2IYOA 5TQ2A 4EKIA 2UVPA 1PR9A 4GKJB 7MHTA 2O5RA 2BEWA 1U2PA 3ILHA 5E2AA 4Q3NA 1RWXA 1U1IA 1P9LA 1G0NA 3F1KA 4I8IA 2QBYB 1QC5A 3BCRA 4CLHA 4D44A 1G8PA 2YYYA 1M0WA 5E4JA 2BGWA 4AJPA 4ASUD 3GCWA 4C7XA 1M1UA 2X7JA 1GFIA 3MT0A 4QQKA 3GH3A 3L4KA 1EX6A 1LU9A 1QONA 1PJ8A 4MPJA 3N05A 3ADPA 4X3CA 1H2XA 2P6UA 1P6UA 2FFJA 4I4TB 2C2XA 2WTEA 4PLGA 2OBMA 2ECQA 4YCSA 2JFZA 2C07A 1KJWA 3H3FA 5AI0A 3AIMA 3C2QA 2IZ0A 2Q2WA 4FGJA 5C1IA 1KMHA 4C87A 1EB9A 1EUYA 1RAGA 3S1QI 2BEUA 2WU8A 3QJGA 1H2HA 2R44A 5DGTA 1N6PA 1KIAA 2XBUA 2XKJE 2ZYUX 3N2LA 4XDGA 3F0TA 3IAXA 4XR9A 1CQZA 4RQUA 1RABA 5IAKA 2Z08A 2E2HI 1SUPA 1WU8A 4B6RA 3QTLA 5JZSA 2X14A 4LX0A 2C4NA 5BSWA 4QGAA 1QLJA 3MGBA 1G4HA 4U3JB 4I99A 3CCJZ 3PRHA 5DTJA 1SZJG 3E8XA 3KLMX 5JMTA 1XQ1A 2Y0DA 5IDXA 2JI7A 4FIDA 3W5BA 3A6ZA 2R92I 1EQAA 1KO5A 2A1UB 2RKWA 2PGNA 2PUJA 5YASA 2A69D 5LP6F 3QBEA 4ID9A 1S5PA 1CNMA 1QR6A 5J4KA 2BBSA 3H4MA 4MVYA 3HUEA 3M5DA 1ZM7A 2C9YA 2HREA 3VNSA 3ASYA 4BU1A 4ZIRA 1YVPA 2ZBUA 1WU7A 4OHCA 1ULUA 5LDGA 1ZJ5A 4FB4A 2Y0CA 4N5NA 3UG7A 3T5DA 3TIGA 4CIYA 5CK4A 2OGTA 3KVVA 4RVUA 4E3WA 1FDWA 5CPFA 3V32A 2IYSA 2NUTB 5I8PA 4CKEB 3ZS9A 1E2DA 3MMPA 2XGMA 4INPA 1P0PA 3AOEA 1JJAA 1W2HA 3LHFA 1GTRA 2DTDA 4M0KA 4MWCA 2WJ6A 1WNTA 3LQRA 4LFCB 3SR0A 4PX9A 5IFLA 2DYKA 3I2YX 1YQWA 4FLMA 4QTUB 2GN2A 4B8WA 1RHJA 1BD4A 3GCGA 4MUYA 4XX0B 5JZ9A 2CNWD 2A35A 2M1XA 4LISA 3D2LA 2BKAA 3KZVA 1G5IA 2ZUVA 2NVUA 4ND2A 3T9FA 4OO3A 4EG7A 2I3ZA 5J2UF 2YWGA 1PK8A 3GLVA 2VEOA 1Q0SA 3CTPA 4GOMD 4RQBA 5TPWB 1SEPA 2R66A 4NZYA 4WERA 3FZEA 3GT4A 3OICA 3ZDDA 1II9A 3LS2A 2WF5A 4IUCS 2HA3A 5AKLA 2GN8A 3RG2A 3K16A 2B78A 4W4TA 2ILVA 1K4MA 1K27A 3GZNB 3OFNA 3RVRA 2GD0A 3V33A 4DNPA 1KY5A 2ZRFA 2C77A 5AJUA 1VXOA 3KBOA 4YQEA 1JUDA 1KKLA 2R79A 4M2LA 1WDKA 4D81A 1B7GO 1YDGA 1AMUA 2XB6A 3BXXA 1DIOB 5K3DA 2Q07A 1G64A 2B4RO 2QTWB 7ADHA 5C5CA 1CEEA 4LOIA 2GNAA 5FPPA 4KUHA 5C4XI 2G06A 1K0UA 3RS5A 1VJ5A 2O5VA 2LVBA 3WMFA 1GSHA 4PO8A 2R5NA 4CMCA 3OEED 4PU0A 2PSFA 3QH4A 1WDWB 1VGQA 1J9ZA 1SVLA 1GRCA 4FJ2A 4MV6A 2ZBPA 2XYQA 4KU4A 2QRJA 3TQOA 2ZJOA 3A9TA 2J5RA 3M33A 3TLKA 1E3LA 4IKEA 3PHIA 3W2GA 4D96A 2Q5FA 2GA9A 4MRMB 1Y8AA 2WE8A 3LMKA 4PPYA 2EBFX 4WSOA 3ZE2B 3ZQ4A 4PBSA 5B6JA 3RIEA 2EVWX 5KYYB 3U6BA 1TQ8A 2R7ZA 4L3WA 1F6BA 2GD2A 4EPVA 1JIVA 1R6VA 2QLNA 2X7HA 3S2DI 3GR6A 3I3OA 3UK6A 1V8ZA 2YADA 3KPUA 4QOSA 2V1UA 2X0IA 2O8BA 4QBHA 5KYXB 2B63A 3PJGA 4KDCA 1IQ0A 1NYRA 5AUOB 4FXPA 1H8HA 1M1XB 5IMSA 3THYA 1QP7A 3TF5A 1YIAA 4CI0B 4WACA 2C5FA 3Q7EA 4GI3A 1X1EA 1U28A 1HPLA 1YE8A 5G1PA 1Q92A 2HZ7A 3FSGD 3KCNA 4I5FA 4MV9A 4BO3A 1EFLA 2JH9A 3VYUB 4C5BA 3ELDA 1UKBA 5K51A 2X3FA 5JASA 5DJ5A 3RPEA 4ALMA 1B3RA 3FCEA 1NXTA 1CKEA 4PX3A 3I2FA 3GTQA 2YXLA 2FPKA 1HSZA 2I67A 2QIPA 3PD1A 5HA5A 4F6RA 4O6VA 5K4HA 3I2KA 1QF9A 1L1QA 3UK2A 4G0MA 3UMRA 3GTKI 3TEJA 3WLHA 1MO6A 2Y1FA 4AVRA 2QG6A 1O7JA 1YDWA 3GGPA 4IIBA 1XZQA 4QPCA 5THKA 3NHZA 3T7CA 3E53A 5IXSA 4X1YB 4B2PA 4R1QA 4MRNA 4MWSA 3GTLI 4NBNA 3ONWA 3FQMA 1XPJA 2YMQA 4X20A 3OPQA 4RLHA 5FUXA 4FHZA 3FNIA 3TVYA 4C76A 2CNNA 4PZUA 4C06A 4HWOA 1ZN9A 5D1OA 3NT4A 4ZDJA 5IT9b 4AO8A 1Y5RA 1H05A 2F59A 1V5IA 2ZYTX 3KALA 4LYGA 1TGYA 1O5TA 1KWGA 3BRWA 3WR5A 4FSHA 5K2MA 1K732 2V7QD 2QVLA 3CR3C 3EB9A 3EHEA 3EEYA 2FP4B 3H0EA 3MD0A 3CG4A 3PQFA 4FHDA 1HEYA 2VPYA 1HF3A 2RBLA 1VYTA 2WIFA 3HCWA 1Z4NA 3O8OA 5FT9A 4BCDA 4BQEA 1WUKS 4YRBA 3C4QA 1ID8A 4HKTA 4I4LA 3AF2A 1VYVA 1U4NA 4IJMA 5E8RA 5E4TA 1TWCI 1G4AE 3NRJA 3W3AA 1PN3A 2VSOA 1Z4JA 4WUVA 4B3TB 3NOQA 2WIBA 3DEAA 3S0JA 1HEIA 3KS9A 3DD5A 3I45A 2H7YA 4AJIA 4NBLA 1FS6A 4AP6A 5C81A 1JSXA 2WUFA 2Q7OE 5K99A 2BZGA 1L4MA 4G89A 1C9KA 3DUFA 3PPYA 4Y1RB 4ZOLF 4L48A 2G1KA 3LFTA 1SUWA 1T5TA 2QD4A 2X4GA 2ZJ0A 3GJRA 3TQCA 2HRQA 4FHGA 2OB2A 4K1LA 1WB5A 4E15A 2AIRA 2XCTB 1T6ZA 3TOVA 1DMSA 2BI4A 2QRVB 3AFMA 4LSWA 4KK3A 4TWRA 1YUBA 4XEHA 4DQLA 4Q4CA 2CL7X 4KR6A 3VPDA 1KA9H 1V6CA 3KSZO 3CIOA 2DXIA 1Q7Y1 1OLOA 2QPOA 2AZXA 3TFWA 1A8HA 1QJ4A 3DKRA 2AOTB 3ETNA 5I5EA 2UUBB 2HA5A 1MTOA 4GVPA 2DSNA 1TT5A 1NNSA 4BEVA 1WCMI 1FFGA 1J2YA 3TL2A 3DDWA 2CJWA 3LUKA 1FNBA 3OPXA 2IYAA 4TM7A 5ALSA 4B75A 4ZK6A 1SELA 5GPBA 1L5HA 5KOYA 2YU9A 1HA3A 2EJWA 1N2IA 3DBHA 1J6UA 3P2YA 2KX7A 1U1DA 4FDTA 1P3Y1 3ITKA 4ZVVA 5I7WA 3MCUA 3MQFA 4MROA 3ITNA 3DHNA 6REQB 5HNKA 4X66B 1E2BA 2HH9A 5KVQA 4FFLA 2HHLA 4G6ZA 1J56A 5KNDD 1R0SA 1T5LA 4MH0R 2W4QA 1NF9A 4H7IA 2X5KO 2XCUA 4JFAA 4HFMA 4P35A 4DDHA 4G9GA 2DH5A 2XF8A 2NM0A 3FCYA 1FQKA 4JZKA 3WHIA 2Q45A 1B93A 4U2BA 3V2GA 2JDID 2Q50A 3PWSA 3TDMA 1MX1A 1W36D 2POQX 2V55B 2WIJA 4L4XA 4CF4A 1MAWA 1U0RA 1EXNA 1PZXA 1Y5NA 1BQEA 4JITA 1OUMA 5I3CA 2OO5C 4RXMA 3B5EA 2EEPA 3SNHA 3X1JA 2ZJ6A 1BHQ1 1K8XB 4PO9A 1PNOA 3SLKA 4H4DA 1KI6B 1R16A 2Y27A 3L7AA 4BNYA 4A9AA 3IA7A 2JJ1A 2QTRA 3LDAA 4QTTA 2AN9A 2EG9A 3IIJA 1BFUA 2EERA 3GBVA 2XDWA 1V6SA 2PQ2A 2W2VA 3O0TA 4KKVA 1FLAA 2Q1SA 1O95C 2GK3A 3CEAA 4JOCA 4Y6PA 4PN3A 5D84A 1DLIA 5HVNA 1EGHA 1KRWA 4OMFG 4ZPJA 5DASA 2JGNA 1GUDA 1Z28A 5F1YA 1T9GR 1L5QA 2ZW9A 3SMQA 2FFHA 5FTKA 1TPYA 1QVWA 4L6IA 3R7FA 3IRVA 3C6KA 1YJW1 2J7KA 3NHBA 1AV7A 4LC1A 3X44A 3ZGVA 5C4IA 3HXMA 1FS5A 2E6KA 2ORYA 2XT0A 1TWAI 5HFJA 3I42A 3ZE8A 4EUKA 4F11A 3OZCA 3SWWA 1UT6A 2DP4E 1NXVA 4KYTA 2HCRA 1SUEA 1PJ4A 2I55A 1Y7IA 1GPAA 2FWJA 3M34A 4KPFC 5B3LA 2PX8A 3L4BA 4TKVB 2J3KA 2QZ9A 3FJOA 3LUJA 4XD7D 2R85A 1CYEA 5JJCA 1NVWQ 3L0OA 1GIAA 3BSYA 4F12A 4MQFB 7ABPA 1NQOA 2OCBA 2BHSA 2O2DA 3R7AA 3UFXA 3ECSA 3LPCA 2DT8A 5HKOA 4QG7A 4IILA 4OATA 1JLRA 1XRNA 1S7CA 4QDJA 1OXBB 1T2EA 3VO2A 3WWEA 4EVQA 1PR0A 4P0TA 1XMJA 4O8ZA 2VZLA 2MSLA 5IM5A 1N2CB 1MO3A 2OXRA 3A1FA 2WHQA 3VKVA 4Z7JA 3I83A 3IVCA 3ZHYA 5F7XA 3LWDA 4HGPA 5C3UA 1YQGA 3F5FA 3FAZA 2ENWA 3UH1A 3CFYA 4GP9A 3FMVA 3B6KA 3TQHA 1F51E 1Q812 2Q7DA 1M0EA 2VJDA 2GKOA 2H48A 2R1VB 5BQXA 5JBQA 1XJ5A 1VE7A 2EGTA 2PO5A 5HIIA 2JIZA 1MUUA 2CSUA 4C21A 3AHGA 2R8PA 3ROGA 3R8CA 5DYWA 3VBEA 3DVLA 3UUWA 4ON9A 4WAUA 4GL4A 3VHLB 2YHIB 5LFAA 1JZQA 4L5CA 1PI3A 4YFYA 1ZONA 3G8CA 1HLDA 1JDPA 4LX8A 4X71A 3BAZA 4Y0AA 4AG6A 1FW6A 1A97A 4K88A 1S2DA 2HF1A 4R2XA 3WHKA 2J3JA 1XZJA 2B0JA 3G8BA 4NJMA 4N8DA 5DXAA 1H6AA 2PNJA 3UH0A 2JL1A 5FBQB 1N8KA 1YOVA 2YFKA 1HYQA 1P2TA 1YJCA 2HMTA 1H1TA 2X4LA 1T9GS 1JKIA 2AKAB 3EWNA 1IY2A 3FTCA 3M3PA 1M72A 2WFZA 1SCAA 2P79A 3ESQA 4JP8A 5CFPA 4HB2A 4Q1BA 1EFKA 3UIEA 1CHDA 3A8TA 4PE5B 1NXSA 2VVTA 3L7DA 1JSLA 3PEWA 5LP6B 3OQ1A 1QDNA 1SNYA 3Q98A 2GN6A 1YLEA 4M7RA 5K8VA 1E2KA 3CWCA 4XEUA 1OBCA 1YZYA 4JVOA 1HNWB 2X1HA 3D3JA 2VYNA 2QHXA 2P67A 3OOYA 2FR1A 4JC0A 3S55A 1XZKA 1E9CA 1H93A 1XZHA 3U50C 3HEAA 2ONCA 2YN4A 1QS0B 4MUXA 1HY3A 3U19A 2RK6A 4IICA 1MOZA 2I33A 4GM4A 5A9TA 3W2IA 3AFOA 4BYGA 1ZHHA 1YI2Z 3W4KA 2YXNA 5LUBA 2JD1A 2QN9A 3K0AB 1PQUA 3L3BA 3R3HA 1Q822 4JBGA 1TM4E 3AR7A 3NYRA 3FZGA 3WISA 2ZE8A 4AJ2A 1RRCA 3BFKA 3EISA 4M83A 4DNOA 4IHQA 3NH8A 1J2JA 3SS7X 3H2SA 1YUMA 3FPLA 3U80A 3ABZA 3X2KA 4K05A 3W06A 2ZGVA 3IVRA 2VQFB 1PJRA 2HJWA 1J24A 1IHPA 2FW6A 1BA2A 1U3UA 4AUKA 1ULAA 2IIPA 3VU1A 4BKMA 3FOWA 1OAOA 5J2UB 1OROA 5ALPA 1IAQA 1VQ91 3PIRA 4RK4A 5LQSA 3FW1A 5BWCA 2XGOA 2JCVA 4L15A 4X7PA 3X1KA 1B74A 4TKUA 2FOLA 5GVSA 2C7VA 1ZOSA 4A3SA 1SUSA 1HC7A 2C4VA 5JYEA 1XCBA 1EQUA 2QOEA 4KIUA 4L16A 1G1MA 1BDMA 3K30A 3D7RA 2I3DA 3TTUA 2B7LA 3V4PB 3QA9A 1MIOB 1EP1B 4R1LA 4OSOA 1N2JA 1T29A 1X74A 1KZ4A 1W75A 2C5SA 1LJ8A 3GAZA 4GQAA 2X77A 1UFOA 4GDMA 3WWDA 1TEXA 2ODTX 4S1OA 1XU4A 1XMPA 3FYCA 3MUFA 2KHZA 1U6KA 3UNXA 2WJ3A 3H87A 3KQUA 3FMFA 1TE2A 1RDFA 4JJ4A 5KTTA 2GB4A 4G5XA 1W0CA 5AI6A 2C4HA 2HMWA 1XKQA 2B8NA 2QRZA 4TVOA 4EVRA 5REQB 5GIOE 2PT6A 5K2OA 2AX4A 2XGGA 1X87A 5CAEA 2I54A 2CNDA 4OQEA 4P4SB 2HKIA 4QJBA 4UUNA 1ONBA 4KXYA 1O6GA 3NEJA 3WWPA 2VSYA 1HEUA 5L6MB 1SBYA 2L17A 2PKEA 4D79A 1ZK2A 4JNKA 5GADl 2LBPA 4FDVA 1DCTA 3ESYA 1PJ3A 1WPGA 2ERCA 2HLPA 1XZAA 1HNNA 3SY8A 1AXGA 1CX9B 1ZSNA 5CJPA 3RFVA 3UY4A 3GRCA 1V8BA 2C54A 2P68A 3JALB 4OMDA 3EQ8A 1GITA 2BBWA 5CYFA 3UWMA 5HOQA 1QPBA 5HMMA 2GPYA 2G1UA 3E05A 1OPRA 2Y8EA 5CT6A 3SJCA 1Z0JA 3NW9A 4CEIB 4UTOA 4TYWA 3A4NA 1UP6A 4G4IA 2XVZA 2XE6A 3D1JA 1R6BX 4MB2A 3WDLA 5KTYA 4JDPA 1VQ6Z 1A9RA 1K7EB 2OQIA 2ZULA 1T3GA 4FMDF 3NJ8A 5FUMA 1IEVA 1GTJ1 2R47A 4G2TA 1YU6A 2YC4C 3VPHA 1N1EA 2PICA 1CJSA 4IFIA 2PT7A 4F7DA 2DBZA 1V5EA 1D8TA 1EIZA 2HB6A 1KKUA 1TVCA 2NXJA 4JP5A 1NG1A 1P77A 3ED1A 4ZKEA 3ABOB 1RRFA 1L0BA 3AUKA 1N36B 2OV6A 3T5MA 2IXTA 4C0XA 1FFXA 3EDYA 2ZBDA 4S1VA 3I561 1QIIA 3MIZA 4FQ5A 4KDEA 5CXXA 2GLXA 2GX6A 3A3KA 3HVRA 4LF6B 1KY3A 4LFAB 3RSCA 4RV4A 3NUZA 4BLPA 1X8JA 3MAAC 5KYTA 3QOFA 1Z82A 1OXUA 3BH0A 4OTZA 5FBVB 2ZWPA 1KQ3A 1BH2A 1T6BY 4K0RA 1VSUA 3GRFA 3WKAA 3AUXA 4PG8A 1Y48E 2GERA 3AKYA 4UOQA 2D7DA 3RVOA 4Q3KA 1GGKA 2EW1A 1MC8A 1C8BA 1WHTB 3BE4A 3RRZA 2XRYA 5LNK1 3PEEA 4G1EB 3ZGZA 3ZE6A 3CMEZ 1YASA 1U4SA 1COZA 3A3YA 3CLRD 1PKEA 2ZRNA 3TRDA 2XQVA 2IT1A 3W90A 1JQJC 5DGIA 3ZV6A 4MYCA 5CA0F 1BW9A 2CXXA 4NAHA 1DU4A 3AUAA 4UAGA 4I3FA 4OLFA 1KYQA 1DTSA 1UMBA 1TEHA 1HWYA 5A6SB 3RSHA 2C92A 5DYNA 5EERA 1SQ5A 3AHFA 1BVHA 2WA2A 2YTZA 2AVNA 3BULA 3PFGA 3PNLA 4YB8A 4M3NA 2AEEA 1MRZA 1NBOA 3V00A 2QW0X 3VH3A 3WTBA 3RI3A 5K03A 4CMHA 1Z6TA 2QG9A 4TT3D 2NTEA 1U0NA 2DFDA 4NEGA 1BWRA 4IGAA 4IJWA 1K83A 1AT1A 3PJDA 4B8YA 4BB9A 4I36A 5DE3A 3M1LA 2BGMA 2EGGA 3SXPA 3GPBA 5AKKA 2FZLA 4R9RA 2EF1A 3WLFA 2J4CA 4L50A 5LA6F 3ZDFA 1EBUA 3VH4A 1B14A 3HUUA 1H4VB 3V4OA 1KVSA 4HXGA 4WI1A 3MXTA 2O48X 3K9HA 4V0QA 5A7GA 1Z29A 2OQ2A 3QKTA 1R0LA 4ALKA 2GPWA 4JLSA 1E2HA 1SJ9A 3DO8A 4RVNA 4QOGA 4X1KB 2P2NA 3OX1A 3HRIA 4KACA 5CLHA 4ZVSA 1UZNA 3QXCA 1JQEA 2H9YA 5CH3A 3THOA 3ZGLA 4A0SA 1UXHA 3ETJA 3V8RA 2Q3EA 2ZT8A 1I9CA 4JLVA 4JI3B 3T4PA 1LVGA 3T5PA 1YZLA 1B00A 2Q4TA 5CHEA 3RTEA 4JFRA 1YVEI 3E5RA 3E1KA 1X7YB 3O93A 3BGWA 1T3HA 1RI4A 4O0LA 3L1IA 1JVBA 4NQRA 4MYUA 1T0HB 1G9SA 5K3FA 4B0OA 4KFTA 1M5RA 1Q1ZA 3T5GA 2AI2A 2QRHA 4RCZA 1ZH0A 3GZ4A 1FXWA 5KMGA 4PGAA 3RJZA 4D5EA 3CF6R 4MEJA 3EGEA 1F8UA 4G5OA 4OD0A 4RGYA 2IEIA 5D3QA 3OZFA 3D6WA 3LTNC 4YT2A 1Z4QA 3H8SA 1V3VA 1B2LA 4BYMA 4XGQA 3ROMA 2PSJA 3EUAA 2RGNC 5PNTA 1DEXA 1NAHA 2ZI5A 4GZ6A 3ZHRA 4TLCA 2PS1A 3H2JA 3KL4A 5KNLA 3GGDA 1W34A 2W48A 3FJYA 2JGFA 2HQRA 3MGGA 1Z08A 4L5JA 1I0IA 1ZINA 4Y2TA 1C14A 3TD9A 5A7FA 1FYWA 1G8KA 3NZEA 1JF8A 2FFRA 3RRFA 1B26A 3AR9A 4UAUA 4PXYA 1IY1A 3OKPA 3TCKA 1DQYA 3GFGA 3ZCTA 4L76A 3U3OA 2ZJ7A 1BMFD 3B9PA 4J4TA 4BVHA 1VL2A 4DOMA 4V3BA 4EJSA 1P33A 1E3EA 3WLOA 4JT2A 1JWBB 1CV2A 1DL5A 3O74A 4G3XA 2PM9A 3GQVA 5LUAA 3EFHA 2O05A 3LBAA 2GO1A 1UPUA 4LZWA 1R12A 1AXRA 1KI4A 2QAGC 4OYHA 4GYYA 4R7ZA 5C46F 3EC7A 4U7DA 3EWIA 4Q3LA 3GVPA 1BE1A 1X7DA 2JEZA 2ZWAA 3URKA 4DR2B 2H1FA 3IJ5A 1FLVA 2NQ8A 1TK2A 2H3EA 5EMKA 3K70C 1QXFA 3SX0A 4HLNA 2HSGA 3M6AA 3GDFA 3SM9A 4C07A 4EJ6A 2JS4A 5BVHA 2VNAA 4UDXX 4OI1A 3PO3I 4UEOA 1T3SA 5GINE 2CCJA 2XUDA 2NVWA 4HDKB 5H3LA 1JKJB 5D87A 3NTVA 2QTGA 2BKUA 3O83A 3HJNA 4P3XA 4P8RA 4EPXA 3KQTA 4F91B 3B8EA 2RHLA 1NQ5A 2ECFA 4CKWB 3SX2A 1N2FA 1K86A 3LFHA 1N5IA 4M9QA 4EA8A 1Q3KA 1WX1A 3DDOA 3IDQA 3M4YA 1QBGA 3IO5A 5IWAB 5I7AA 3SGLA 4EMTA 5LQCA 4OKIA 2BDEA 4OQZA 3CSUA 1UPCA 5FB3A 2RGXA 2CB0A 1KPIA 1D2EA 5SZJA 1O9HA 2P3YA 1WCXA 3KB6A 4CIDA 3GYGA 4KDIA 3H11B 1KS9A 4HPWA 2IV7A 4CM8A 4UOZA 1X0XA 3F8WA 1E1DA 2PYZA 1C7EA 5KZMB 5DBGA 2WHPB 2A5LA 2QP9X 1Q821 3ROTA 3PFFA 2QX7A 2KPOA 4LGMA 4F04A 1M1NB 4RFSA 3RO7A 4BO7A 4KBGA 1XXHB 4RZIA 1VL1A 1EFPB 2G5CA 2Z57A 3B48A 4IIVA 4RIEA 4JV5B 3GPDG 4DZTA 1E3QA 3LBFA 1OAAA 2EIXA 2GVNA 1TU3A 2NTYC 3O73A 3B8HA 3ONVA 4KEAA 1O2DA 5TJHA 2VZ9A 5DBHX 1WY7A 5A3VA 4BC1A 4WDRA 4AY5A 4ARZA 3LA6A 1E6MA 3CYFA 3DP7A 4ND3A 3CCLZ 4OB7A 4YP5A 2OAP1 4AL4A 4O4HB 4EX6A 2E21A 4F9TA 2C2WA 5BOVA 2O3RA 1A98A 1TKAA 2WZQA 5IJWA 3A2KA 1MCZA 4HJRA 4ZV4A 1WETA 3U2QA 1XF1A 4MKXA 2LXNA 4XB1A 2V4MA 3NTUA 2EL7A 3ET5A 4RKEA 5AM2A 1A71A 1SRQA 2BHRA 2ZS7A 4YJGB 1YL7A 2B25A 1E18A 5LQMA 1Z4MA 2XDAA 4GPEA 3OQIB 3D8TA 3NDRA 3QENA 2ZREA 4QUGA 2RIQA 1T8YA 1FYDA 2GBFA 2H31A 4OK5A 3WK9A 4DXAA 4X1IA 4O3MA 2VJKA 1R2QA 4RACA 4BFXA 3M1YA 4H0NA 5HP4A 2DE6A 2WUWE 4NPCA 4C2BA 4QEZA 2FZ5A 1PHPA 3DTVD 4C0BA 5IVHA 2A84A 4LXXA 2EFDB 3A06A 3D0OA 3SYMA 1XKTA 2KJQA 3X2PA 2EXXA 3QPWA 1ONNA 4ZMRA 2Z95A 2H5IA 2X2EA 3OC0A 3PNVA 4G85A 1Q20A 4JZYA 4QPZA 5HJ5A 2R6R1 1VL8A 3ZW7A 3RH0A 3ZBPA 4EQ6A 1P91A 3QEOA 1L5GB 1CQJA 3B2EA 3R5KA 4V0SA 1YI0A 2J3DA 2JJQA 4ZTUB 3GLFB 1FU4A 4G0ZA 5EXSA 3T1YB 4NU5A 3LYHA 3D4BA 2QSUA 4UEJA 1JEYA 3U7QB 2FX2A 2QEXZ 3BWXA 3QE3A 5DIFA 4Q82A 3WLSA 1PJCA 5F9FA 2OFOA 4YRIA 3V3TA 2JW5A 3N2YA 4P83A 4KWCA 2NZJA 2GK4A 1ZQ9A 3FCXA 3RSZA 2PZGA 1PW7A 3FWZA 1F8XA 2JFUA 1DTWB 4HLCA 3T4NB 2Q62A 3GXOA 2HJHA 1KORA 5CRIA 1AQ6A 2HO5A 1F17A 4ZU1X 1NI3A 1IUKA 4A91A 5FWYB 3EH1A 4JVNA 3BWMA 3C3XA 1QV7A 3KLNA 1RHKA 1ZOPA 1OX5A 4X85A 3R2JA 2TECE 3CVVA 1AB5A 1UK8A 1I3QA 2B30A 4QQNA 3FNBA 3OD1A 4D97A 1U7DA 2Y6VA 4M6WB 1X86B 4RF3A 1JVNA 2GXQA 6YASA 1VQKZ 5C8DA 2VJOA 3HZOA 2CXRA 3AEQA 4ZQEA 3V4VB 1HH4A 1U2DC 3IEIA 4LOHA 2X0FA 5AJVB 4BJ1A 2ZWVA 4EKDA 8OHMA 2VTBA 3ZX5A 1U8AA 4L6AA 2RBKA 3EFOB 4LMBA 5JPDA 3EZ7A 1I7QB 3VA7A 3VPXA 2HTFA 2G0TA 3R0VA 3RTBA 3AB7A 3RC1A 2JJ8A 2QL6A 4HEHA 1NUUA 2YZ7A 4NYJQ 4R2KA 3WGZA 5KNCH 1QQBA 3NORA 4DUPA 3DZDA 1BCRA 1HYBA 3SJUA 3UAYA 2FMHA 1AO3A 2H5JA 3EXHB 1KJQA 2V6BA 5DCWA 2CF5A 2OO3A 4U7WA 1BH6A 3S4YA 2NUPA 3AGPA 2QD2A 4JA0A 4US2R 1SBZA 2YY5A 2FRDA 4LC9A 4YCDA 4YGXB 4E2FA 1UINA 2ZIEA 1LX7A 1ONPA 2HWYA 3LY5A 1DX9A 4TTVA 3RBVA 1AA9A 5I47A 4X7RA 4A8TA 2Q1WA 4OHOA 2ZAEB 1UOEA 4Q3DA 3CUEF 5ES3A 3UJ8A 3L46A 4RZUA 3V9AA 1LD3A 1YQEA 4F38A 4KDLA 4FMDB 1JALA 2QZ4A 2QQFA 3VVMA 1YAHA 4PZZA 2MYPA 4BGDA 1XYGA 1WDLA 4CHGA 3N39C 1GN9A 2PX3A 4V2IA 4LWQA 3AR8A 2VFAA 4QU9A 1IJFA 5G53C 3VO8A 5CB4F 2R7ZI 1CIPA 3VR4A 4AP9A 3D1VA 3R9WA 3IOEA 4FVTA 1I6KA 2D06A 3DLBA 3F3SA 4UOEA 1E3IA 3CZBA 1SUCA 2HBYA 3FCUB 3OJWA 3TRKA 1MFPA 1NHGA 2WSSA 2X19A 3BA1A 2YBEA 3NP9A 4I5EA 2B63I 4J0HA 1PT6A 2IOFK 3HY3A 3IPXA 4U0KA 3T5BA 4DLUA 3Q41A 3GGGA 5CVCA 3R9IA 4A6DA 3FRJA 4HK4A 1Y6FA 2ZT7A 2QE7A 2WP8J 3RVLA 1N2XA 3O8DA 5H82A 3VR5A 1WXGA 2GETA 3NGMA 3R9KA 4N5DA 5B3AA 1JLLB 2OXFA 3PGJA 4WNYA 2PRIA 4Q7EA 4D42A 4F3TA 1PK7A 4YPFA 1OYOA 1H69A 4N8EA 3ZXUB 4B3BA 4ZICA 3GTQI 1C4OA 3IAEA 4NJOA 3C41J 1U3GA 3T6KA 1H9CA 2KS6A 2BKVA 4HYEA 1RLMA 4NZNA 5T41A 5AXAA 3VUEA 1VBMA 5D7BA 2PMEA 5EHQA 2O06A 1FDVA 5B4VA 3DEIA 5IKPA 3QKWA 5B1YA 2ONYA 1YRBA 3KHTA 4BNDA 3E61A 4NZZA 1QZ3A 1M34B 4II3A 4OYRA 3KQQA 3M89A 3QVVA 4GR4A 4YP0A 1CZ5A 421PA 5MF6A 5E3IA 2LD4A 3PHGA 3ESBA 3WQSB 5LL6f 5ES4B 4JXZA 1N6RA 1R3DA 4GZ3A 4CM5A 5BNTA 1RPNA 2PTHA 3C5WP 4G4SP 3OX2A 2H1WA 1NIJA 2GPNA 1QIGA 1MQ8B 3H4VA 3OW2Y 4TLDA 3MS7A 1QVRA 2E4XA 1DAKA 3RNLA 4LY0A 2CBZA 3BDVA 3D7LA 3GJ8A 2GN0A 4DW8A 3OM8A 5CDUA 1NW4A 4QOFA 4KQJA 3HKEA 1ZICA 2J6AA 3ND8A 4RWEA 4CF6A 2J0VA 3NRCA 2Q5CA 4CF3A 1Z2EA 3A6KA 3B38A 4BC0A 3A10A 4QUDA 2H1CA 1VFPA 4EAAA 4PLCA 3G1UA 1RACA 2G5GX 3LPLA 4KIJA 5HM6A 4I6JA 4PBRA 1CS0B 1O89A 5AOCA 4OX9B 3NOXA 1SC9A 3FZQA 3BJZA 1LNQA 3N0VA 2Q1XA 3DV0B 4KH1A 5FORA 5DN6A 5K3OA 4GPZA 1L4EA 5IKXA 1LRKA 3H19A 1GPNA 4XOIA 3RUEA 1JVSA 1B73A 1PIWA 1S2OA 3KJXA 1OFVA 4G0OA 4BZZA 1W36B 1W9MA 4PSKA 3S1RI 1GWNA 4NPAA 4D2IA 1UH5A 2BMJA 4GOJA 3WRWA 4EKGA 2WF8A 2WA1A 2GPBA 3SQXA 2VP2A 4XD2A 2OB1A 3EG9B 5G4KB 3GTOI 1CRLA 4QXPA 5FRDA 4C29A 4YCNA 2BJHA 1PBNA 3NDJA 1MOQA 3LLSA 1WCWA 5IJZA 3CCCA 1QPZA 2IE8A 3Q7TA 2OYRA 2GD1O 2VF1A 4TKMA 2JZCA 1N7HA 3L01A 2NQTA 1E99A 3UMBA 1IZ7A 3AP1A 1XIVA 1M2KA 3E22A 1DWOA 4YI5A 1EWKA 3BGSA 4YDQA 1J0EA 1N0WA 2I7VA 2WWXA 2YU9I 4PVCA 4MJLA 4MWZA 4TXMA 1IWOA 1V43A 4Y2XA 1P9OA 4Q16A 4DQXA 1HT2E 1EHYA 2HSDA 4WKCA 3TH5A 2ISSD 2QD1A 3NJRA 1G42A 3QF7A 1TADA 1TFRA 3FBWA 1P1IA 3K0CA 3JQAD 3I6ZA 5KB3A 5CURA 4P3PA 3MMXA 4GGPA 1RXVA 3NNSA 4DDTA 5JI3E 4X60A 1XTKA 1G5HA 4FD2A 2BM0A 4TUYF 4WZBB 3USZA 3NP7A 4BVEA 4JJKA 2P4QA 4MVJD 4Q37A 4E2WA 1DFIA 2YINC 4AAYA 3GL9A 3PGKA 5JHHB 4RA6A 1JIXA 2QT1A 3EY9A 4AYTA 3U16A 4RTSA 1R74A 3T38A 1XEFA 1TD9A 3DULA 2C95A 3TGWA 3EPKA 3IUJA 3KKNA 4H0FA 4JJ8A 3H13A 2Q27A 4BAGA 3LBYA 3OCWA 3W6NA 2Y1EA 1ADCA 1GCAA 2DY0A 3OZUA 1U80A 3PQ6A 4OI2A 1CD5A 3IKTA 1P4SA 4C43A 1M2OB 4B1FA 1XD2A 2P75A 3EZFA 4PCAA 1FDSA 2DC1A 3RR2A 3QE4A 2NUAB 2Z2IA 4PPGA 3IBSA 4AS1A 3OHMA 2EQBA 1JAYA 4E12A 4XCVA 1TQ2A 2AG5A 4EW1A 4LECA 1L5WA 1Z0SA 5K4AA 1I4LD 5EHIA 5L7TA 3NMUF 3EDQA 2CVPA 1QKIA 3FTEA 4QD3A 3DMFA 4X64B 4GD3Q 1JG3A 4R8VA 4DNFA 5L3SA 4RKRA 1RZRD 3DQZA 1MZVA 2H3HA 2QP3A 3RJ9A 2GHIA 2WABA 4MINA 1OTHA 4ZOQI 1XXLA 3DMDA 3PHLA 3BT7A 2RK4A 4CQNA 1TZMA 1V1MB 1U5BB 3F74A 1UODA 3G2IA 4R81A 3GUHA 1PQWA 1E6WA 1RC0A 4TYQA 3H4TA 4CPDA 1ZPDA 2E87A 2HWUA 3M4XA 2N1BA 1YKGA 1KMCA 4TYNA 2IBMA 4MJXA 3WYDA 4FQ8A 4RETA 3TJZA 3QEAZ 3CPWY 3QPAA 2BFFB 1DT3A 3EZXA 4WADA 3C1AA 3RLIA 4XXHA 2OCDA 3B7GA 5A04A 4PQFA 3FDFA 1GLVA 4JODA 4DEYA 1F0KA 4G0WA 2X0JA 4JCOA 2VYCA 3M6IA 2Z30A 1G60A 1A2BA 3OJLA 1L5KA 4YDRA 1CUEA 2E85A 3BH7A 4WXRA 1IJKA 1UKZA 3CR7A 1SOVA 1P45A 1LK0A 1RKQA 3BK7A 3PTLA 2GH1A 1HYHA 2A8YA 2VDKB 3KKLA 4Q93A 3EK2A 2BFDB 3C4JA 4QDXA 2RKBA 4XYLA 4ZK2A 3PDJA 3AONB 5CDFE 2ZI6A 3DDUA 3FOBA 4WZAA 3KXPA 4WEOA 1GZ3A 1F20A 1CWUA 2I8CA 4ZQFA 2EX0A 1RQPA 1WP4A 2J9RA 1TX4B 1ZC1A 1UBJS 1S9DA 1IOLA 2HRBA 3CONA 4ZCLA 1EM8B 3L93A 5BV1A 2ZJYA 3I01M 5AFSA 1ZOOA 4DYVA 1V3UA 5I9SA 1NBIA 4U39A 3WJ7A 2YJNA 2QUZA 3H84A 4NCKA 4EFKA 4NWIA 1OH7A 1RVDA 1P0IA 4K6HA 4YJHA 5EIAA 5TQJA 4BEBA 2R6MA 1C8KA 1SC3A 2XUKA 3OE4A 4BMCA 1CUSA 2OORC 2QJTA 3KOWA 1DBSA 4P5DA 4DIFA 2MYUA 2DBRA 4C4PA 5KQMA 1FYVA 3TLEA 2O8CA 3TL3A 3H9JA 2HLHA 4BIMA 4FDMA 4UM9B 1XKLA 4ARIA 2WU0A 3OF3A 5FADA 1ISGA 2X4IA 3NKFA 2Q3LA 4I9NA 3CZCA 3N07A 2DRIA 4D98A 3VR6A 4V0OA 1KR5A 3GTMA 3K1AB 2ON6A 4GOOD 1ZVVA 4YBRA 4MUMA 1MB4A 1G19A 2VK1A 3Q6NA 4FC6A 3HR7A 4D82A 1M2VA 3W9BA 2F1IA 4NENA 2GM4A 1Y1LA 4HH1A 4PQEA 4LBWA 4EHFA 3BD6A 2NZUG 3IBFA 4BO8A 4ETIA 4UZSA 1RM3A 1WA5A 1E5QA 4KO8A 1WUYA 2I2WA 4G65A 4YCJA 3WGTA 3U37A 1CP3A 3G6EZ 1Y8CA 3IHWA 4HGZA 4QJ3A 2E7ZA 3EDRA 3ER6A 4R0NA 5H9VA 3GLHB 4A23A 5KJ1A 2ZROA 4Q6WA 4YAFA 5ITZA 3P19A 4HP8A 3B53X 3RADC 3DEZA 3ZDQA 1KFKB 1IHDA 1Q2UA 3NASA 3O1LA 4IIFA 2PT9A 1J9EA 3ZD8A 1V0JA 4G26A 1J5EB 3UJAA 5EZ6B 4QUJA 2CLDX 5J58A 1Y8QB 4TTQA 4WBSA 5BMVF 3EZ6A 2JAHA 3ON5A 3B3QA 1A82A 3V55A 1XYVA 4KWHA 4MAFA 4R9VA 4TPKA 1F7UA 1E4OA 1UM9A 2W8BB 1U0SY 4REQA 3WIDA 5ED0A 5H70A 1OVMA 1MRSA 4L3OA 2VT2A 1QCZA 2LFUA 1IM5A 1POXA 1YIOA 4M86A 3ZXXA 3SYKA 2B6NA 2A92A 3JQCA 2ROQA 4WN9B 3G2HA 4LDPA 4TMXA 2VOJA 2Y99A 3FLMA 2ASVA 3FDIA 3NAMA 2IU0A 1OLXB 4BRWA 2WAMA 1RYYA 4KMSA 3SVTA 4MQMA 3V8MA 5FFNA 3HWWA 1HDXA 2GEFA 4BMXA 1KERA 4OQLA 4MI9A 5E1BA 3UPUA 2N42A 3EBPA 3TB4A 3SYRA 2JFYA 1E4EA 5LZ4A 4YAOA 3WGHA 4YWHA 3AXSA 3CISA 3ZE1B 4YUZA 1UMDA 1R6DA 2VSXA 4HXFB 4AMZA 2IDJA 5BT9A 5JMPA 1E3SA 5TGZA 2IS1A 4O29A 4P98A 1OPXA 1BQ3A 3NIBA 3E1GA 2B7CA 3EIUA 1CNFA 2AWNA 3IQWA 3JQBC 3NO4A 1KAOA 1NF8A 2CLMB 4KQ6A 3K20A 2PUHA 5EN4A 3HWX1 4BFVA 3CW9A 4JI4B 1WM1A 4E3ZA 1LWNA 1U2RA 3IAM1 4Y9UA 2WHEA 2Q2OA 2E48A 5FFMA 1P6XA 1VXRA 1KWKA 3RC3A 5EHNA 1IQPA 1ZJJA 5EIBD 3R9XB 2QJRA 4IIJF 2A1IA 5JXGA 5KYUB 5A4MS 3ZIAA 2JJYA 4QU8A 2FPUA 3HBFA 3QWUA 4KN9S 5MHTA 5DI3B 5AVZA 1G38A 2VSQA 3EEOA 4GZMA 1FMFA 4ZI7A 4ZCQA 3LL7A 4AUNA 2GYYA 3EIWA 4F4DA 4D9FA 3U13A 4UTZA 3S5UA 4ZT3A 2BT4A 3ZKAA 1NMQA 4R3WA 3U4QA 1CJUC 1HBJA 1QZXA 2JARA 5FAXA 1ECGA 4XB6B 2JZOA 2FLWA 1T5OA 2HRRA 4Y0NA 2WQ7A 4QGHA 1JEQB 2XXAA 3LOUA 1NYLA 1DWPA 4CRWB 2P3SA 2DEUA 1L8OA 1Y1VS 1EUDB 2X1VA 3QF4A 1PNRA 4CV0A 2X8WA 5JRZA 1TK3A 4RD3A 1CRZA 3AJ9A 2F43A 2FZGA 3H05A 4P32A 2VQ3A 2AW5A 4GG1A 3K9LA 2MTBA 3PNSA 4NCJA 4QX6A 4EY5A 2PRJA 4R1MA 4HPXB 4DR1B 4UVDA 5CCDA 4AW9A 5BSFA 2PUDA 1VBNA 3OZVA 4IYRA 2H5EA 5EE1A 3SF8B 4E08A 2FG7C 3PD7A 2IZ4A 2IP4A 3DEYX 4PLFA 4J49A 1HTWA 4IVRA 2XRMA 2W2PA 3ZWWA 1X13A 1PWYE 2G83A 4NDZA 3HJTA 1DX4A 3TINA 4R54A 3OJ0A 2ZZNA 1KDVA 1RADA 5C1BA 3ZWMA 3MZLB 4JLMA 1POWA 2DOKA 4MW4A 2FF5A 4FYXA 1AKUA 1SCIA 4A6EA 2I80A 1BFDA 3AL3A 5AW9A 1RCFA 3WGNA 3DE2X 3S44A 2E1RA 4WZ6A 3RT1A 3FX2A 2JJMA 4HZUA 3R7WB 4DCJA 5GP1A 5DDIP 5AW7A 3H9CA 3ZUPA 1CZHA 4RPCA 2F3PA 5BXYA 2AK3A 4HN4B 3GCXA 1K83I 4TS4A 3F6PA 1PD0A 1VLLA 4NJEA 5K7SA 3HBJA 4FFBB 3FI9A 4JBHA 1VC2A 3FYUC 4HVTA 5KU7A 2W2LA 2QDKA 3BFPA 1V4VA 2VYND 1T8RA 4MV3A 5JS1A 2I34A 2O8VA 2YZGA 4JUIA 3CE6A 3IQFA 3QFSA 3JU3A 3M9WA 3NWOA 4B3CA 3QFHA 2D62A 2IXGA 3JWGA 5JMOA 1S96A 3N6XA 4QT0A 2JFQA 4MI1A 3ZOZA 1Y89A 1ZC4A 2KLHA 2XUAA 3BZBA 2H8KA 3OURA 4HATA 5KVSA 1E7QA 5T67A 3UT5A 3CCQZ 1V8FA 4L4YA 4FYPA 1E3MA 4CQMA 1QR2A 5JQGA 4UQOA 4K28A 1CY0A 4RKQA 4XPIB 1A9OA 4AZSA 4N7RA 4F9EA 1VQ4Z 3AKCA 2CFRA 4CEHA 1HDYA 1TYZA 4DC1A 4PTZA 5IU6A 4B4OA 3HP1A 3JWIA 1L3CA 3ILYA 4OJMX 5ALGA 5BYAA 3SZOA 2VRBA 4JUAA 1E8NA 3IAAA 4MVJF 2VH1A 3WLIA 2CXHA 2QTLA 2ETVA 1T25A 2GASA 4CKXA 2XAAA 2WLTA 3E3OA 1VQO1 1SIWA 2B34A 2G3YA 5D3MA 2CD7A 5JQWA 1BN6A 1Q0UA 3OEHA 3BHNA 3JY6A 3HKBB 4GBMA 4QAQA 5HCNA 4G25A 4TUYB 1UKEA 1F8FA 3IQEA 4X9XA 2PMCA 4CTNA 3S5JA 2A0YA 2AXQA 1SUIA 1WNFA 2UDPA 2YQ4A 4TWAA 2PGLA 2Q3JA 4RLFA 3V1NA 2DTXA 4WHMA 2GBLC 2ZJ2A 2LCQA 4BJHB 2WYOA 1JW9B 3LPAA 1Z83A 3TNDA 3N2EA 2JI6A 1AGXA 2DCUA 3CW8X 4KFCA 1Z34A 3INGA 3OCCA 4RD0A 5KOJA 1FNMA 5DXFA 3MZKB 1Y1QA 4BX3A 2JIRA 3BSFA 5E7QA 5FXMA 7GPBA 3VU8A 1JHPA 5EQFA 1BDJA 4H7JA 1WUJS 1RXEA 1Z5PA 3DAYA 5K3CA 1HDGO 3TPCA 3ZGOA 2D4HA 1HV8A 4BLSA 2BFEB 2W11A 3RT7A 1MJNA 2V7UA 1IBLB 4JSTA 1UC8A 5AKGA 1KEPA 4Q18A 1E0SA 1RS0A 2H5LA 1JXAA 2BCEA 2IKSA 2XQFA 5KOHA 3KQKA 1P0QA 3S1LA 4K8OA 3SMVA 1C5KA 2OZLA 4LRUA 3H1FA 2AJLI 5KHAA 2JBAA 1FRFS 3OJCA 3QKRA 4M37A 5K3BA 1JA1A 4JYBA 3ZE7A 3I9FA 4P31A 4HYYA 3RQSA 3QKUA 3K9WA 4IKOA 4TWJA 4UMFA 4E14A 1Q91A 4Z1OA 2E9HA 1YVRA 1OX6A 4RUKA 3AV0B 5CCEA 1SFRA 1YZUA 4NICA 3TTTA 4DA7A 3WDKA 1QRUA 3OT4A 4DS3A 1P4AA 1CXZA 3UAGA 4EHJA 3I07A 2H4XA 2C2MA 1S72Z 5LOVB 1LI5A 4DADA 4F4CA 1K8A2 1Z7YA 2AN5A 3OC6A 2RHRA 5HK8A 3RB8A 1E92A 1Y81A 4JH0A 4WXEA 4KQXA 4GRIA 4F5ZA 4UHBA 4FJ0A 2Y1LA 3T35A 4UBOA 1P81A 2O8DB 4GMHA 3MWKA 2PFSA 4TM8A 4WK0B 4PWZA 5HDQA 4W1PA 3UXHA 3I0MA 3G23A 2WVJA 3U6KA 4WBNF 3TLGA 4MVCA 3FQQA 3UAWA 2P91A 3DTVB 3JASA 1GQRA 4NBTA 3DOJA 3JPYA 3EDOA 3VVBA 3TSYA 4UBNA 4YJFB 4B5KA 1HTTA 1R7RA 5G2OA 5P8WA 1J1UA 3ESDA 3NHSA 3OIDA 2IYTA 1XFAA 3R3JA 2JHGA 2A68D 1UEXC 4HZIA 3ZLBA 3PTAA 4JXJA 4E4RA 3DG9A 5EFOA 4QUEA 1BAPA 2XRZA 3EFEA 3K8ZA 2NPOA 4X6UA 2GXUA 2VQSA 2XOXA 2YDXA 4XSVA 5FOTA 4XWGA 2VNKA 4B5LA 3DQQA 3D3KA 1C1DA 3GMIA 1UKYA 1QIDA 1TJYA 2CLHB 3E82A 1A2KC 4JLWA 4JQSA 4R9SA 3EGOA 3AILA 4FUTA 1VG1A 1ZBDA 3C39A 4QDKA 1EK2A 1XRRA 4YASA 5F2EA 4WIAA 3V1YA 2QL7A 5JD3A 3FNEA 2K2WA 3F67A 3NAQA 2C99A 2R86A 1G5PA 4K8RB 3F5DA 2A5FA 5G0WA 2XGJA 4ZV9A 3CJTA 5BSVA 2C7RA 4BXXI 1C4KA 1R50A 3D4OA 5DK4A 2EJTA 4H08A 3G7UA 4Z2AA 5D3KA 2D7CA 2XD4A 3T0IA 3EXEA 3ZJ4A 1I80A 1L4HA 5L53A 3OCJA 1G6OA 2PBLA 1XN4A 3DHWC 3U17A 3HPRA 3LAWA 4YJ3A 2DPGA 4PNEA 1RMYA 5CA1F 2IS4A 5CFLA 1GOTA 5EMMA 2NV2B 1T3ZA 3R4VA 1TF7A 3NM6B 1GRQA 3MUOA 1O97D 1F2VA 4L02A 5DX0A 5EIEA 5IMBA 4A82A 1AHNA 2HCTA 3HPQA 4RS3A 1E2UA 3QU5A 4FX5A 4URWR 1RXSA 3NYWA 3WYCA 2HY7A 4Y9TA 4LYJA 5JNRA 1JEOA 5GV7A 4MS4A 4F72A 1IUPA 1ZGJA 1K6EA 3VC1A 3TCNA 3DF7A 1NI5A 1ODLA 5LBTA 4ZJUA 1NU8A 2UYOA 2M48A 3NUGA 3SIPA 2MHCA 2FPXA 2XUGA 4JLDA 1ZK0A 3DV9A 1S7GA 1UBTS 2ZI3A 2BHNA 3VYTB 3F8TA 3ZN2A 1DAIA 3LKDA 4UCFA 3AOEC 4H1UA 5IRCD 2C0QA 3CF2A 4W1RA 2O8EB 3BRSA 2REQA 1DAGA 3GLQA 3ND6A 1YD7A 2W9XA 2YRFA 2RJOA 3VNVA 3B9QA 3LNTA 1BCSA 3HDTA 1L4NA 3TIIA 4DSAA 1YBVA 3HCBA 4N0QA 1W4CA 2ZIXA 1PR6A 1US8B 2XVXA 3GRAA 3EMKA 3RUAA 1I3QI 4CT0A 1G3RA 3QE0A 1U63A 3G2PA 2NU9B 1VRWA 1IZYA 4QXAA 4LV8B 4X8HA 3U7EB 4D1YA 5A4FS 5BVGB 2RHOA 1GTSA 1V9CA 4KV9A 1K7SN 3KO8A 4NF2A 3C14C 3R3VA 2P1RA 3TW0A 2XIJA 1P5RA 2GHQA 2ZUWA 2AX3A 1C9DB 2ES4A 1UOQA 3AFNA 4ND6A 5AJZA 3X1WA 4DPMA 4I55B 3RYIA 1VQ81 1TM1E 1CVRA 1SUAA 4I3GA 2Z43A 3CU5A 2JBWA 2PJHB 4DMGA 5JAHA 2Z5LA 1MX3A 3ANYB 3MJCA 5KTMA 1J2EA 3KCQA 4A3CI 1T1RA 2Q3CA 1ODKA 3V6MA 4DCMA 5TC4A 4UCQA 2JEYA 4Q3CA 4A8JC 1HDCA 3OCYA 3TRHA 2XNDA 1I7PA 3BBLA 3IAS6 3NANA 4V1CA 1Y6QA 4EB0A 3I0NA 1N2CE 1SXHA 5DI9A 3GPIA 3HVHA 5LKRA 1JR3E 3NYIA 3OZWA 3FBTA 5FPSA 4I14A 1ZGHA 4D8VA 2YXEA 1QFYA 3I92A 4LTNA 1P7WA 4JLPA 4RD4A 4TTRA 4X97A 5KQLA 3DV2A 2OBBA 2GBCA 3C8HA 5K0LA 4DDKA 4ZJYA 1CUAA 2GQ0A 3X2NA 3O95A 3Q7QA 3TOSA 2IUSA 2R7NA 5AM0A 5ALWA 4GF5A 5C1OA 1HM5A 1VLMA 5L40A 4H9GA 4LK2A 1VKHA 2L69A 4D41A 1Z8HA 1XLTA 2VDRB 4I3HA 3SIRA 1SQ0A 1B8UA 2WUEA 1ZUIA 3CB2A 1OYWA 2YXDA 2Z2JA 2EQAA 1ZN7A 1KC3A 2JFBA 4WCFB 3S68A 4ZGGA 1HQKA 5JECA 5KYKA 4A3MI 4FQ7A 1QH1A 1YHYA 1T24A 4BJ5A 3JZDA 4V0RA 2VDPB 5IJ0B 3U1BA 3GJ5A 1D2CA 4PICA 2PG3A 2VCHA 2LKDA 4OHKA 4DR6B 1EUCB 3WOVA 1LLFA 4HEA1 3ZEIA 1SG0A 3JD3A 4DV7B 5FL7D 4P7FA 1GKLA 2B8TA 2OD9A 1C7RA 3N2KB 4MMXB 4QDZA 4C14A 5CXUA 3J81A 5E7IA 2H0AA 2AXEA 5KTOA 4IXWA 5BWBA 3GQBA 2A9JA 2H2FA 5U1PA 2UZ3A 4P0PB 4RIHA 5COQA 5DWVA 5GIPE 2C2ZA 4NR0A 4OM7A 1KQFA 2A9KA 2VPZA 3D7NA 5ECGC 4D6PA 2JA6A 1DC8A 4Z6KA 5T4BA 4H7KA 4JKYA 3VDQA 3PHBE 4PSDA 4U8GA 1SXJE 2Q2QA 1P7CA 4AUEA 4GA5A 1OWMA 4FWIB 4CNQA 1STOA 3KETA 3T9AA 1CZLA 1Z6XA 2E9SA 2PRZA 5K0SA 3Q0EA 1U0BB 2ID9A 3VKUA 1SBIA 1JV2B 1FXUA 2QD5A 7REQA 3MT7A 4B76A 3D0KA 1QFSA 1S89A 2EGHA 1J21A 3A4LA 4CF5A 3D3WB 3LWZA 4AECA 1NI4B 4MYTA 3FLAA 4H3KB 1UPBA 4IEIA 2IZOA 4PR3A 4US0R 5TXGA 4BLUA 4IMRA 1A1SA 1AGPA 2IY9A 3DOHA 3FR7A 3K2IA 4I1VA 3B3GA 3VR3A 2RH5A 4ND7A 7MDHA 4RE6A 1S8NA 5IYZF 3NH5A 1K3FA 2W83A 4K2HA 4MRAA 5MGNA 1IBCA 4UU8A 2AFVA 1NIPA 2FN8A 2VT3A 2XB4A 3ND7A 4KFUA 4RIFA 5HE9A 3RV4A 5AICA 2IGTA 3ZHUA 3U7GA 1XDGA 1OU4A 2R93A 2QQ0A 3HXTA 2EC5A 4J91A 2P9EA 4BNMA 3ENNA 3QIVA 4HRAA 4KXUA 2ZYWX 4XQ9A 3ZBTA 2B3DA 4M1OA 4ZYYA 3UWPA 4MAMA 3C6QA 1MC4A 5FUQA 4C30A 4R0VA 2NIPA 4CLOB 1YH3A 5IT9f 2IPNA 1AIPA 4HH4A 1MJHA 1ESCA 1JR4A 1U2GA 3CT4A 1RCUA 3KL2A 4AJ4A 2EKLA 2W5UA 3C3EA 4IM7A 4AMGA 1GPYA 4D4MA 3HCFA 1E0JA 2ATEA 5DIZA 2QGNA 3KUKA 2JBHA 4HDQB 1L1FA 3QEBZ 4UD2A 4WW0A 1Z5UA 4RJKA 3CZQA 1GZSA 4C6SA 1P9RA 1CRWG 1JQKA 3O4RA 2H06A 4FG4A 5IJXA 5DM4A 3BC1A 4Y9SA 4N54A 3PPIA 2R1ZA 2R8EA 4N1AA 4OB8A 5CUQA 5GWXA 3OQOA 2FB9A 4HGOA 3GG2A 5AW0A 3J81f 3PKZA 3IDZA 1YR3A 5LB4A 4DYDA 2XUIA 4PIMA 5BMVB 5KPDA 1ND5A 4HDCA 4ZARA 2VDNB 1HG0A 1M1YB 1YL5A 4HAOA 2BBTA 1QHXA 5I8WA 3IUEA 2WAOA 1V25A 3KD2A 2PMFA 4FKZA 3IMEA 4AY3A 4J6FA 5KVVA 2JGEA 4C4RA 1Q15A 5AHXA 2FPGA 1EMDA 1WB6A 2WMYA 4GYKA 1QV6A 2GRJA 1X7WB 2BFMA 4E33A 4OGLA 4WA7A 3V46A 2WPNA 3DMRA 1UWKA 3HHEA 1AS0A 2R8YA 1E7RA 4C20A 1QB8A 4HNUA 3FTNA 4PCLA 3D7KA 1H0SA 2IYRA 3E7WA 2ZBVA 4HQ0A 3ZI4A 1CTQA 1OLUB 2JCGA 3UTCA 1ZNZA 4EGSA 5DNDA 1SZPA 4Y9RA 4ADSG 4I8XA 5FX2A 1NUAA 2B3TA 1OIWA 1KO7A 3CXCY 3LT1A 1GV0A 4FCVA 1QGYA 4LRWA 2PZBA 2GXAA 3FKQA 4KQCA 3LY7A 1JE0A 3B2QA 4RSGA 5J5VA 1KETA 3BS4A 3O8RA 1QPGA 3X2HA 4EJ2A 2ASEA 2XA2A 2UZ0A 1SU8A 3F5SA 1NY6A 3RYFB 4PCUA 3GCFA 5JH7F 2HRZA 1DWQA 2VJBA 2DLDA 3B5IA 1BXRB 3UANA 1CDDA 2QVBA 2VXYA 4UW9A 4LPKA 3F46A 3EW7A 3IDOA 1TCAA 2XSZA 3PFHA 4ZD6A 3T3IA 2NMVA 5JALA 3QEMB 5G4LA 3ANMA 3WYFA 2HQBA 3ICPA 3V6LA 2J67A 2WVHA 3I64A 3PHHA 5I9MA 5BORA 1EPUA 3T52A 1T5HX 5H5JA 3I4MI 2VP4A 2VK2A 1LPNA 3AMVA 3HSSA 4GX2A 4IO0A 3PV0A 5CT9A 5DHQA 3HN6A 3L6RA 4WBNB 3SXUA 4PYNA 5CMLA 1FQWA 4O2BB 4LVNA 3W3AH 5A4JA 3WWYA 1RXYA 5EP4A 3VU9B 4TWBA 1XN1A 2C42A 3TRJA 1E9DA 3V8QA 4L0QA 1NTOA 4I6EA 2J9ZB 2Y2UA 4P93A 1JXQA 2J07A 2WJGA 3ITDA 4LRQA 1SWVA 3F9CA 1PS0A 2YYZA 4ZT2A 3PNBA 4EKYA 3WQBA 5BUQA 2WDPA 1NNLA 1EFHA 5BR1A 4Z7OB 4IXNA 4URHA 3ES9A 5K0NA 3AR3A 2NN3C 1SKAA 4HXEB 5JO0A 1NMXA 4G1BA 1VGVA 2IDZA 2OTJZ 3HLKA 3BGDA 4KAFA 3AU8A 3NDPA 4C1BA 5FJJA 2AFHE 4DSOA 5JZBA 3QW2A 3EDCA 1RLYA 2ZIFA 2VSFA 3RRMA 3W05A 3Q5EA 4IVPA 4QTXA 3CCVZ 1I1OA 2VOEA 1ZL2A 4B82A 2FKAA 1RXWA 3I8XA 1SAYA 3TEFA 4BP1A 2VPTA 2VBGA 3AHEA 3BXOA 3K2EA 2FYTA 5JSHA 1KK3A 1OXXK 1QNFA 4G56A 3ZW8A 4RK0A 2EFHB 3DFUA 2HK9A 5CA1B 5LD2C 3ZVNA 1EIWA 3O2NA 4MV8A 4ID3A 2XUJA 2H4HA 3FD8A 3GJYA 1EEXB 1I32A 3KPWA 1GR0A 2BUAA 1U3FA 1NU6A 4QWMA 3SEFA 2IHBA 1A04A 2ZAOA 4X5OA 5BWLA 1WW9A 1WG8A 3HL0A 1BE0A 4R40A 4YQYA 1W4RA 1GGJA 1VPDA 4JC5A 1KS2A 1SGWA 5HS6A 2XZOA 2LGJA 2OCYC 2QSJA 4H60A 4LWOA 1KQNA 1O8BA 3W2FA 4N7BA 1ZJWA 3F5MA 3GTPA 3S8YA 5IUKC 1RJ9A 2H57A 2Y1OA 4K40A 4XRRA 2WJPA 3QSYA 1OLSB 3DLCA 3OLQA 1T2AA 1A8QA 4FCTA 2IHYA 2EEOB 1P72A 3P7MA 2C96A 1OH8A 2QNIA 3D6MA 5CW1A 3X1XA 2CLIB 3SQLA 1OV4A 2ATIA 3RIHA 2BZ1A 3BF8A 1N8SA 1XSEA 3FIJA 3HFGA 1NR7A 1MABA 5ILQA 3WYEA 5CFRA 3COJA 1ZI8A 3ZU4A 3G9XA 1HMPA 3MQ2A 5L7WA 621PA 4U7PB 3OJXA 3G1WA 1CIJA 3VPGA 4H1HA 3WNQA 4M53A 4NNOA 1WXXA 3R0QA 4M22A 1TTQB 2GKGA 4RU1A 2AE2A 2I1LA 4YECA 3TQQA 5JJBA 2QBYA 1DELA 3K5IA 1OAOC 1DEAA 3ENGA 5FLXb 2OFPA 4NYIQ 2XADA 2IEBA 4MKRA 5I4KA 2DQSA 5D6NA 2RH4A 4FFVA 4IHAA 2GN9A 4BFWA 2FU5C 1GAQA 3LRXA 4NL4H 4C2TA 2AYYA 1H3EA 4I4TA 1B0UA 3C45A 3F49S 3VAZA 1SULA 1Z56C 3BRQA 2RHHA 2HADA 3BSSA 2N75A 1PG2A 2ZOSA 3M9XA 4GT1A 4IZOA 4OI4A 4X84A 1XP5A 5L3QB 1ESNA 2GSDA 2NT4A 3HEBA 3MUNA 1PJTA 3DONA 5K8LA 2YIMA 1KSJA 4B09A 2ZFUA 3Q3CA 4HFNA 4YR9A 3RTAA 1E6EA 4OFBA 3EA0A 4RS4A 3VMIA 1TEVA 1W1WA 3LC1O 3PJEA 1MQAA 2AJBA 3HA2A 4H3HB 4V02A 3MG9A 4BZXA 4S35A 4ZEWA 3PU6A 3UHFA 5KSWB 1XNGA 1DIBA 4RV5A 4DCUA 3B12A 4WKBA 1YB6A 4R8KA 4UBIA 1WV0A 4Z0TA 1G2PA 1UT8A 1FFDA 4Q9JA 4W7SA 2WQ6A 3RRXA 1N6NA 3C6YA 2QU7A 2VHTA 4KQGA 4U3JA 4RGVA 4BFLA 1RBYA 4A0QA 3A0RB 2QMQA 1W581 3L1VA 2YNMA 1V8DA 13PKA 2HQ1A 3G0DA 4GPD1 1U90A 2RC5A 9LDBA 1MO5A 1L8FA 2E49A 5LKAA 3FHJA 4PZPA 1XXHE 1LDBA 3PWKA 1BX0A 1OJ7A 3B3JA 4OP1A 5ALUA 5I4CA 5JADA 4BAUA 1AU9A 1CCWA 1MJGA 5BNZA 1K75A 2YCBA 1NQUA 1YR7A 3V8PA 3AF3A 1QIKA 3C70A 1UHDA 1QGUB 3QVGA 2FWMX 5HJ2A 4MUFA 2ENGA 1TZJA 3TLYA 2POCA 3HHPA 5AKYA 1WCV1 4I46A 3UCEA 3VAAA 4QGSA 2ZAYA 5SZKB 3RF7A 3OE1A 4KL8S 2FW9A 1Z0DA 3BJRA 3FFWA 4Y6LA 3ISVA 3TLMA 4DPLA 5KNBA 4F86A 2BDTA 3CT6A 2RHWA 1IL0A 1PJSA 1JIJA 2FPIB 3WIVA 2P9GA 4KUEA 1VDZA 3TL6A 1PT8A 1Z0KA 3E7DA 3OTIA 4BNUA 4ESOA 2GAFA 1NYTA 1A9ZA 1T6YA 2BM1A 4R7TA 3VSBA 3QWHA 5FWXB 2ZE7A 4GNRA 4IV8A 2PH7A 2ZR8A 3ICEA 4QTUA 5LD2B 4XVUA 1WVIA 4XX0A 4BHTA 3Q12A 3ZWAA 1K6MA 2XCIA 3HCDA 4G8BA 3RS3A 4AURA 3L0BA 2HUPA 1JKFA 1SU7A 2JJ2D 3MJ4A 2AYZA 3D6UA 2DBQA 1LBEA 2DFVA 2ZRHA 2WU1A 3EOBI 2RONA 2Z5FA 1DDOA 4K3UA 4NU6A 3T9BA 3U9LA 4D4LA 4E09A 1WRBA 3LLMA 1T1SA 4DLXA 5D5QA 4RSHA 3MWGA 2IL1A 1M2WA 3H1PA 1N8R1 1Q0QA 2VTKA 3VMHA 2WJAA 1J2TA 4HV4A 4EGFA 4CGZA 2M9MA 5F5LA 1H9AA 2PXAA 4OXXA 2RPRA 3L41A 2O23A 4KUGA 1NVAA 2J31A 2JIPA 1KXZA 2VXOA 2DHDA 2ERYA 3CEPB 5LIPA 1USPB 5EQTA 4Y2VA 1U0TA 3FOZA 3C5EA 3C1UA 4L8GA 5JFGA 3LC2O 3N7AA 4I4NA 5FFFA 4PZ0A 3QSGA 1JJIA 1C8VB 1PG5A 1GU7A 2J6HA 2R25B 2N46A 3BFJA 3QUQA 4LGVA 3CC7Z 4KXVA 3RSFA 4DCSA 3T3NA 5E1OA 3RUCA 2QXTA 1Y80A 3UT6A 2O0KA 3RS4A 4BKRA 1KQSY 5IYZB 3L6UA 4A15A 3HO1A 1VL6A 4IHJF 2BMWA 4EPWA 2AJ8A 3CCUZ 2R96A 4IJKA 3ZLTA 1QTIA 3ONNA 3P9RA 5AW8A 4V0NA 5K0ZA 5LPNA 1C3EA 1K6XA 3KKPA 1BXKA 2VHVA 1B0AA 3FNFA 2XIQA 3ZJYA 2YWJA 3L0PA 2JCXA 4MRMA 3E5HA 4R1SA 4RDCA 3G0GA 2BVNA 4CZ2A 3ED5A 5DYTA 1IUOA 1R8JA 4RH1A 2EHJA 3TX6A 1PYQA 4L95C 3MRVA 1UT5A 1GNRA 4OXNA 4Y1GA 1HDOA 4OHZA 4LJ7A 4UAVA 1YRWA 2ZB7A 2OLJA 1QDLB 1M6WA 3HY6A 5A5VA 1FLDA 3ANXA 2KBEA 4CLXA 2R7AA 4DV4B 2AL7A 2GMWA 5KYXA 1TD1A 3JD0A 1XNRB 3BIJA 2V8OA 3K1JA 5U4QA 1M6VB 1CQWA 2Q6TA 4PIVA 4HWTA 4PRYA 2QTCA 4GPAA 4YJKA 3VGJA 3U56A 4E4TA 3WLAA 3JAMA 2DKFA 3UMMA 4IRMA 1L7VC 2AT1A 2FEOA 3HGTA 3DBOB 3LT4A 4GMKA 4BN4A 3K92A 1DGQA 1XG5A 2OHHA 2PNWA 3I551 1UPFA 2AFIA 2W6ID 3CIFA 3NETA 2EZ9A 1VSBA 3Q9SA 1FJGB 1Q6YA 1RZ3A 4ZAVA 3UUFA 4BQFA 2D1TA 3FHLA 2CMGA 4TSFA 4ER7A 1AF4A 3ZWBA 1CDOA 2COKA 1IXRC 4XIYA 1HZJA 2R8OA 2ZIGA 2VTVA 3RIYA 2P9JA 4BRSA 2WJZB 5DSXA 3STVA 1AQUA 4B2IA 3QVWA 4EL0A 3WGIA 3NWJA 4GWGA 4X1YA 1HDZA 3UA4A 3ICCA 2M1ZA 3TKAA 3OIYA 3CMA1 2PO7A 4M1MA 3CD6Z 1QHIA 3P2KA 5AXCA 4G4JA 1EDBA 3N86A 1X38A 5KDOA 3GLGB 4J4HA 3UVEA 1T91A 1B3BA 1UFVA 3LCJA 2B9VA 4LIPD 4TXHA 3WLMA 2FP4A 4RMHA 3ZVMA 1L5OA 3LYUA 3DQPA 4EJSC 3C43A 4F9GA 5CVDA 4AKHA 3II6X 4OY3A 5JH7B 4KWEA 2I6TA 1JDNA 5DZSA 1QK5A 1B2RA 3RJ5A 4LHYA 5C5DA 5HKKA 4A6XA 4ZANA 4QXRA 3PNYA 4M0MA 5MFZA 2UYHA 3UZUA 3OTOB 3ESZA 4HN9A 4HWKA 2YJGA 4I2VA 4ZC8A 1WQ1R 4AN1A 2BCJQ 4K9QA 4QOHA 4YV7A 4MA0A 4EG0A 4DLRA 1KY4A 1APBA 1WZIA 5IX8A 3VMGA 4KO4S 4OEHA 3DE6X 1I1QB 1RRVA 2BCGY 1FRNA 1VOTA 3MGKA 4A5OA 2JLZA 3SSNA 1JG2A 1G0OA 4MAAA 5CM9C 1FTWA 1CLUA 2V96A 1SHKA 2XUPA 3KKMA 4OFXA 2PKXA 3HM2A 4BFYA 5IG2A 1KBZA 5LBUA 2NYRA 2IA5A 2V0CA 3WXMA 3ZV3A 1XK6A 4LGCA 2C5BA 3RIMA 2FY8A 2P5YA 3AUYA 1M34E 5E9AA 3ZIAD 2AOTA 3WV4A 1I2BA 1SBTA 1H6CA 3TW6A 4OQ4A 1UBUS 1WZUA 5IBQA 3H2GA 3EPRA 5FPQA 4ARSA 1U0GA 5ICMA 4U9UA 2M98A 2PKRA 2QD3A 1VIVA 3KFVA 2QW8A 3OPMA 5FPHA 1L7XA 3EVZA 1FJHA 2VAXA 4EHHA 2I03A 5FI5A 2PBRA 1LPPA 2E2WA 1JHQA 3PXEA 1HRDA 3SE0A 1CNEA 2GEKA 3NBQA 4HDNA 2XKBA 3F6YA 3R44A 5DNCA 5FLMI 4BY7I 2P8SA 3HDYA 4C3ZA 4LJRA 5EWMB 4M0EA 4GUDA 4CLDA 5M2QA 4OJYA 4N6GA 1QYIA 4MWTA 4PPQA 4BXOA 1VE5A 1OOEA 2XE4A 1BHJA 2AG8A 2VBCA 3PSAA 2O2XA 4AKIA 3D6HA 3DL4A 4K6FA 4M9CA 1KZHA 2PMBA 3WSWA 1XZ8A 1A4RA 1ZCBA 3K09A 3ZXSA 5G0TA 1PYGA 1YZKA 4P92A 5C0OE 2I2XB 3RKRA 5CB6A 1FVFA 2G77B 3EWSA 4JB8A 4QJ4A 1MW9X 2W6QA 1T4DA 1XYYA 3FZNA 4KVFA 3QHQA 5LQNA 2A6ED 4JASB 5KBYA 4B87A 2OVFA 2KYRA 1LPSA 1XL1A 2GBPA 4EYEA 3SSOA 5T7BA 5GQSA 2B4YA 5I6DA 4YQZA 3A3OA 3HLYA 2JRLA 1FP2A 1RYHA 1BD3A 4ZO8A 2OWEA 2PMKA 3W3ZB 2PE5A 1ZW1A 2P2ZA 2FZ4A 2D2XA 1R4NB 1EVYA 3K8QA 3SLGA 4RIGA 1OXKB