2IV2X

Reinterpretation of reduced form of formate dehydrogenase h from e. coli
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
715
structure length
697
Chain Sequence
b'MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Formate dehydrogenase H
publication title Formate-Reduced E. Coli Formate Dehydrogenase H: The Reinterpretation of the Crystal Structure Suggests a New Reaction Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 253
structure length 697
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00384 Molybdopterin Molybdopterin oxidoreductase
X PF01568 Molydop_binding Molydopterin dinucleotide binding domain
X PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 2iv2X01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2iv2X04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2iv2X02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 2iv2X03
5DYGA 1TWAA 5FTNA 1QDNA 3GTMA 2VPXA 1R27A 4D7ZB 1R7RA 1SFOA 3GTKA 1PQFA 1CZ4A 4KLNA 4KDIA 3CQZA 1E18A 3HU3A 1Y1WA 2B63A 1CZ5A 1TMOA 2VPWA 4GA5A 4RV0A 4C2MA 2V45A 1FDIA 1VC3B 4CRYG 4AZDA 5GLFA 3QQ7A 1SIWA 2NAPA 2R93A 5C1BA 1H5NA 1YLEA 2E2HA 1G8JA 3HU1A 1PPYA 1R9TA 2JIPA 5T5MD 2JA6A 1PT1A 4CS0A 2E7ZA 1PQHA 1PYUB 2DMRA 5DYIA 3GTLA 2EEOB 1Y5IA 3FKIA 3IR6A 3PLXB 1G8KA 3IR5A 4KODA 1DMSA 3GTJA 2E2IA 5EPPA 1Y1VA 4KO8A 2JIRA 2PJHB 4AYBA 2JA5A 3IR7A 1KQFA 3GTGA 3ML1A 2R7ZA 2KI8A 1I3QA 3TIWA 1AA6A 1EU1A 1DMRA 2PMZA 3QQ8A 3OUGA 5C18A 5FTLA 1TWGA 2C45A 3QC8A 4GA6A 2NVXA 1CR5A 1UHDA 4KDLA 1PQEA 1IW7D 1S3SA 3O5AA 1E32A 4QIWA 1E5VA 1FDOA 2NVYA 1Y4ZA 1WCMA 3H0GA 5FTJA 5B6CA 1TWHA 3CF2A 2JIQA 5FTMA 2VPYA 1K83A 2JA7A 2NYAA 1KQGA 1TWCA 4AONB 3GTOA 4CRZA 5T5ID 3GTPA 2R92A 2WB1A 2IV2X 2IVFA 4AOKB 2V3VA 1PYQA 3HU2A 1OGYA 1QCSA 1TWFA 3QWZA 2Y0SA 2WAQA 5FTKA 1E60A 1AW8B 1H0HA 1I50A 3DMRA 4AAYA 2VUMA 1WLFA 2VPZA 1E61A 1Q16A 3HKZA 1PT0A 3TM7B 4DMRA 3GTQA 2JIMA 2YU9A 1UHEA 2JIOA
chains in the Genus database with same CATH superfamily
3LW7A 3B3FA 3OQPA 4TTPA 4JEIA 3RT9A 4EAQA 4E1AA 2PWBA 4R54A 4N6GA 3AFGA 3P2IA 5BOVA 4V3BA 5AO9A 3D6NB 4ZO7A 5HA5A 4Y3UA 2IHUA 3DLIA 4IKOA 2XXBA 3ESXA 1PZHA 1Q0PA 3EZ9A 4L4XA 1QVFY 3VKFA 1FP2A 2GWHA 3CKMA 3A4TA 2J67A 3NU1A 1XZMA 2PVPA 1K27A 3CZ4A 3G0IA 1E1RA 4HYYA 4FFPA 3OQBA 3A25A 3GH1A 5SICE 3W6ZA 4IZOA 2O59A 4NBUA 1Y9EA 4XIJA 5DVZA 3UWPA 4IXTA 4EG7A 4IFTA 3OCWA 1PZGA 4F72A 4X85A 4W6QA 2Y1CA 4I9UA 1G7TA 1O4WA 4NP6A 3EXEA 1XAIA 3E8XA 5KWSA 3R3VA 1NJ8A 1U9IC 4EYQA 1AB5A 3DBLA 5WRFA 4HH3C 2Y71A 4LY3A 1LZLA 2BM8A 3C7KA 4V03A 4H1VA 5FBKA 1US8A 1VGRA 1J1ZA 3DHVA 3LRTA 3PXAA 5BRNA 4EY3A 2OQIA 5T4HA 2QTHA 1M8JA 2LWIA 2Z2ZA 1ZM4A 2ORVA 2ORED 3FWPA 3NXKA 5A4AA 1JIXA 1K9VF 4OA5A 2IYOA 3OU6A 2ZI4A 3RAFC 5BNTA 3IKTA 4KDCA 4PZCA 2HK7A 3COYA 2ZUWA 2RJ3A 3OFND 4CT4B 1DCMA 3T5PA 5H80A 3BZUA 3FNHA 2Y05A 4MAFA 5IN5A 3SFVA 1IULA 3Q6NA 4JAVC 2H31A 4QX6A 4Y8VA 4D45A 2O05A 2F8TA 5A6SA 4CR8A 4OUDA 4CF4A 2QE7D 3DHWC 1SU8A 5JH7B 4GI7A 1MJHA 1TWGA 2H54A 4TL9A 1NURA 4AI6A 2WV9A 3IALA 3KZKA 4R16A 1L7NA 1EESA 2N75A 4JVLA 4P2BA 4S0ZA 7ABPA 4PRKA 4CL3A 3AF0A 4MROA 4Q7LA 2AQHA 1C7FA 4AP9A 4EHKA 1JHRA 2BR5A 1HETA 2JD1A 3ER6A 5DM0A 1E6LA 1QV9A 2P2SA 2Y67A 3EC7A 2WKWA 2WWTA 3PC8C 4UEOA 4ZQCB 1BCSB 1SU7A 5GY7A 3LSTA 1PJZA 2QBYA 2A7XA 2KS6A 3I1JA 3CCQ1 2BT4A 4H35A 2KM1A 2QT9A 2W6CX 3R3JA 2IPLA 2IHVA 2XD9A 3BAZA 4M2LA 3K05A 4F8EA 2C9CA 3I34X 2X5XA 3KSDO 4PF1A 3KJXA 2AD1A 2ECPA 2HV9A 4WZBA 3C8MA 3BWYA 5DB4A 2A69D 1WXWA 2MHCA 3AYXB 4L02A 4P3PA 1SUBA 5EWLB 1X7GA 5FPPA 2IF0A 1IL0A 2IEAA 4HDKB 4UAGA 4CUJA 4DYDA 3WLQA 2AK2A 2GLXA 4CDNA 2VWQA 4DM4A 2NPOA 4ZK6A 1Y7LA 3G0CA 3B53X 4XD2A 2WAQA 1D2CA 4MRNA 1J8YF 4N8DA 1DWPA 2D6FA 1LF0A 4GXNA 4Y9UA 2BH9A 4GSYA 4RMGA 1Z5ZA 2H2FA 4AKEA 1NVGA 2EW1A 2YJZA 4N0MA 5CNIA 4RL4A 5DGDA 1U3UA 4X1KB 2JCBA 1E3TA 1YIJZ 4DMRA 2ZUSA 3C6ZA 5BR1A 4HZUB 3HVIA 3ZKAA 3K9GA 3ULKA 2A4KA 2JIOA 4AN0A 4KR2A 1Q12A 4ECEA 1RHMA 2D3TA 4M0CA 2WIDA 4OHFA 4XX0A 1B8PA 4YJDA 3P4YA 3LXMA 4NMLA 3ZWXA 4F21A 2O8CA 3IHWA 1DQZA 4ZOLA 3C6BA 4KQWA 1G8MA 3G8YA 4CXMA 2UVPB 1A97A 4UM9B 1K8ZB 3FI0A 1V1MB 3BULA 3WLNA 5FWXA 2OXTA 1WUHS 1KC81 3Q5DA 5EKTA 5ECDA 1QCZA 2Q4DA 3HUUA 3VKGA 3LHSA 1UXOA 3BCRA 4I4CA 4ZOLF 2RJOA 3LDGA 1TWHI 5SZIA 1SUIA 4UPDA 2CE7A 2TMKA 4X00A 2XA1A 4LV5B 3I5AA 4MH4A 5K6AC 4E11A 2HEGA 3TB6A 1SA0B 2C3MA 1GITA 4BFYA 3JQAA 1XPJA 4ZVMA 1XL0A 3BWXA 4Q82A 3CZ5A 4ZCSA 4X92A 1S7GA 1RWXA 3LUJA 5CYFA 2P6RA 3BAFA 1N1GA 4B31A 5FWYA 3HL4A 4NE9A 3ITNA 4FEGA 5FBZA 3WLLA 4EPWA 2EBFX 5B3LA 5LP6B 2HA6A 2DTXA 1WPRA 1OXUA 3THWB 4IH4A 5KYYB 4E32A 3B3QA 1Q5PA 4IDDA 4D4IA 2RGDA 1JFRA 1TZKA 2HNAA 3ASUA 3QKUA 1EXDA 1JJAA 1O9HA 3PEUA 4WOPA 2QLMA 2BHRA 5BN5B 2JZOA 4C06A 2XCSB 3JR3A 1H42A 4FEYA 3RT1A 4ER0A 1VB5A 4ND1A 3DCIA 3I2FA 3CUTA 4P4GA 2ZAEB 5A0VA 3QE0A 4QRIA 3RC9A 4QVIA 1DAKA 3RHFA 2DWCA 2V6IA 2P35A 3AILA 3CC21 3I30X 5JYDA 1ZOLA 2KSQA 2J6AA 2RARA 2CLEB 4LPSA 5ELXA 2XVMA 2PZFA 1SK9A 1ADYA 1WHSB 2ATVA 3S29A 5A4KA 7REQB 2C54A 5H1YA 1TYDE 4PSUA 4X1IB 2Y66A 2NVXA 4M0PA 3D02A 8ADHA 2PUDA 2W6ZA 3UYKA 2NSJA 3UBTA 1K1EA 4DUZB 1ADCA 2DOKA 2JJMA 5JY1A 3CU5A 4IAOA 1AA9A 4LRQA 4LSGA 5TMBA 3HBMA 1M7BA 4FBMA 2G1UA 2IPMA 2JAXA 2X8BA 2FETA 2JNWA 2YV2A 3N2YA 5LYJA 1ZYUA 1SXQA 2MSLA 3ONNA 4QBFA 4MRVA 2DFKB 1D6SA 5DBIA 2OFXA 4ZKDA 1VRWA 3H9CA 1Y9AA 2E18A 4LNAA 2OQVA 1OE0A 1WTAA 2H29A 4UAUA 1K97A 1SK8A 2QL5A 1MC5A 3GC6A 5LYJF 2R8XA 4I9GA 4KQXA 1NYRA 2IDJA 3HRKA 3LT5A 4P6VF 1H2BA 2GCOA 3M6AA 2NU8B 4ZMRA 1U02A 3HSSA 1L1RA 3OTGA 5H3CA 4JLUA 1TZ2A 3D8UA 4C7BA 2V74B 4M1SA 4XPIB 2C2XA 1V11B 5E6UA 5J4LA 1U9YA 4IL5A 2DFNA 2HRQA 1USIA 2GJKA 3GEMA 4LOLA 3YASA 1H4QA 1Y7HA 4ZDWA 3T06B 2W6NA 4RXUA 5JJBA 1QB8A 1T91A 4I08A 4S12A 3GLGB 1BX0A 5L3SA 3ST7A 3X2JA 1Q83A 4Q21A 1VYHA 3P9PA 4N03A 3H2ZA 4YCJA 2EWVA 1OLUA 1SKBA 3C1TA 1MJGM 4CKWB 1QH8B 3E5NA 5KCMA 4FZJA 1OT3A 1CE8B 2IXTA 4FBGA 1L7EA 3SQOA 2Y2UA 6PFKA 1TMOA 2CW5A 3BPSA 4NHEA 5JE8A 4H3SA 2HSDA 5JPCA 2J3LA 1M1ZA 3QH4A 2QP3A 3QYAA 5SYNA 4OYHA 2GO1A 4PLPA 3G89A 3N74A 3RLFA 3CBQA 1NHGA 1UDAA 3NJRA 3O8BA 1W49A 4GBED 5TPZA 2FRVA 4DXAA 2AMYA 4MWOA 3M4OI 4ZC1A 3TVYA 2QM7A 2JI8A 5BURA 4D3ZA 4F8YA 4WJLA 1AO3A 2PK3A 3G6WA 1FFDA 2C2KA 1TMKA 1ZIOA 2QXTA 3S27A 1R0RE 1R9TA 5CW2A 2H1CA 4A4DA 1Z38A 2CNBA 1T2NA 1QFYA 3LHFA 5DBFA 4ZGWA 1FX0A 1L1QA 3VR0A 3E4DA 1W36C 4LF5B 4P4LA 3AM1A 2A5GA 2B9VA 1DC6A 1W59A 5H4UA 3I6YA 4KKXB 1NNEA 5GGYA 1QVAA 1JKJA 3VO9A 2P79A 4BO6A 4H4CA 4XUDA 2CNNA 2XV1A 4GG1A 4I2VA 1XO1A 2F43B 1NUUA 2V7WA 3DZBA 3CPEA 3QV2A 4GZMA 1Y9JA 5TX7A 4BU0A 2AJTA 4QQNA 4B3JA 1HG0A 1UP6A 1L5NA 3T0GA 3EISA 2G8LA 1IVNA 1JQKA 3I4NI 3R0VA 3W3AH 3QBVA 2IE0A 2BZ0A 2HJHA 2FEPA 4O4HF 3WWZA 4NBAA 3PFFA 2YHIA 2I87A 4MD9A 3HA5A 4D9HA 3I2JA 1TUGA 1XZKA 2IW3A 3EA4A 3F9IA 4F60A 4P5EA 3QPVA 3JVEA 5CBKA 2VJDA 4XM2A 1CZKA 3I39X 3KVYA 2WW8A 4FR0A 3V8NA 1V4NA 1T4CA 3HE3A 4BTVA 3FFXA 3NUQA 3V1TC 5BT9A 2XGJA 1L7AA 4JENA 4WOJA 5DV9A 3ZOKA 3UOWA 1WO8A 2Z30A 2ZUBA 4HLUA 2BF7A 3HDVA 3HNOA 4HVAA 5A6VA 1ZHFA 2VNSA 1W2HA 4W7IA 3GCXA 3S17I 4MI3A 1JHUA 1H2ZA 2CHGA 1SZDA 1WXFA 3E48A 5TDHA 4YRSA 2CSXA 1VLMA 4ZC8A 1KXJA 1X15A 4KWCA 4LMAA 1GZSA 1ENPA 1EVJA 2FW1A 2V7GA 3LPAA 2QZZA 2VF7A 4P3KA 1I2ZA 3MWFA 4U2EA 4M88A 2WU0A 2QRQA 5LQMA 4Y1RB 5ALLA 4QXMA 1S721 3IUYA 2VJCA 4I1SA 2JGMA 1YIT1 2Y0EA 4P82A 5T67A 1CERA 3ETHA 3P52A 3QU7A 3V48A 2J45A 3H1FA 4HO1X 3ZWYA 5AKLA 1JT2A 1P6XA 1DEAA 5A1TA 4I4LA 4CGZA 4DOMA 1XWFA 4U00A 3WSTA 2SHKA 3Q41A 4I99A 4AZ3A 5IXSA 1DX6A 1XTTA 3V46A 3IOYA 2QA5A 3C5EA 4QULA 3MTAA 2YWRA 3RC1A 5I01A 1M8PA 3R7AA 1E99A 4CM9D 3IP6A 3SBOA 4JXKA 1JR4A 1FTGA 3L0OA 4IH9A 4KH1A 2CBXA 4WPGA 4G0PA 4D4KA 2EARA 3AM4A 3FI9A 3VPFA 3ZN2A 1SHLA 4J76A 3TZQA 4CV3A 1UIMA 2CYBA 3OO0A 4RKWA 3OPYI 2G9UA 2E2JI 1SXJB 4MO9A 4U5QA 1Z7BA 3QFSA 4DR5B 4MVYA 4BV2A 1VSBA 1QCYA 4ITUA 2VBGA 4CW7A 3Q88A 4GNRA 4WCFC 5LWQA 1PTJA 1FK8A 2CMGA 1NMEA 3HCAA 4N8SA 3I2KA 3R5XA 2I3BA 4D9IA 3VTKA 4ESVA 2X8AA 2PYDA 4JJ8A 5EN4A 1Z2PX 4HLNA 1QO7A 4I4NA 4FR2A 5IUNC 3G9XA 5L40A 4GI2A 3GYBA 4G3XA 3L02A 1Y80A 1F0YA 1LLDA 1R00A 3AH8A 4FGUA 4UNPA 1NYLA 4DPMA 3ER9A 1IOVA 3A9TA 4WT7A 4RSRA 3PC2A 4RAOA 3WNBA 3H5OA 3G7UA 1T1EA 4JQSA 4X6XA 1WQ4A 3WKAA 1E66A 4DIOA 2WM8A 3VZDA 3HUFA 3HY6A 2EZUA 2R4QA 4R1SA 5TC4A 3RIYA 2DY1A 3PEFA 1C4OA 1RQGA 2QPOA 3AU8A 4JITA 1Z8FA 2AN9A 1VPVA 4XJSA 5D2CA 3CGGA 3K1JA 5CVCA 2WM9B 3QENA 4BLUA 2Q6TA 3N58A 5M5BA 5AYVA 3ICQB 3GTLA 1XD9A 2VDMB 3O8QB 1E3WB 3VR6D 2KW5A 4E5VA 13PKA 1UF9A 4RULA 3MERA 4BVFA 1PLKA 2Z8YM 3F96A 1YVDA 4ZI7F 2H08A 2Q2WA 4U8GA 5F9HA 1UXJA 3IVGA 3NAGA 3RW9A 4WDRA 2AYYA 1V95A 5AVXA 3V5NA 1SFOI 3AFIA 5DRTA 1KFKB 4YFYA 2VHEA 1UP4A 1NBOA 3QXSA 3JCZA 3ZJUA 1PK7A 3VFDA 1EP3B 4PZLA 2AEJA 4NBBA 1U2TA 4UFOA 2P2ZA 4PCVA 5FHQA 3K7EA 4WBXC 3T7JA 1EGAA 5ICSA 4DQDA 3O0TA 3QJYA 3OU2A 2EHJA 3GWGA 4XGKA 1MX5A 4HNGA 1XI2A 1SXHA 3HY4A 3H2YA 2IOHA 1WZIA 1FYXA 3CNQS 5AOCA 5IJ0B 1V5EA 3UAOA 4AMYA 2GZ3A 3AGQA 3MCAA 4KDRA 3HOYI 4R1UA 2X76A 1YA8A 1OA1A 2AFVA 2XDWA 2JIQA 5LQUA 4QD3A 1KQGA 5MN4A 3M6XA 2WTAA 2A0KA 4QBKA 1J99A 3G23A 4U2DA 1QQ5A 4WA8A 2ZB8A 3OF2A 2R92A 3AY3A 3EXIB 1G8YA 3GIWA 1WWKA 2AW5A 2O8VA 2YXBA 3I3SR 4H77A 5JPDA 2A88A 3H8WA 4MH0R 1F9EA 4F5YA 4FDLA 3PQ5A 3AP3A 3AJ9A 2QOEA 3N3BC 1RHQA 1BXGB 4RW0A 4WNAB 4IGKA 1N57A 4PIMA 3V8RA 3QPDA 5DNWA 3DCYA 4KG7A 1N2FA 1MEJA 4HDQB 2ZDHA 4L0QA 1AGRA 1DDOA 4C03A 2JGDB 1S2OA 1H6DA 1U8EA 5EJ2A 1S8FA 2OZLA 3ZD6A 1ZA2A 3VH1A 1GPWB 4P5DA 4WBNB 1FUKA 1JXOA 1NJ1A 3DNMA 2VPZA 1NGSA 2QW1A 1NE2A 5IZCC 3V4PB 5EHGA 2QRDB 4FSHA 4Z1MA 1TA4A 3M9LA 4W1RA 4CLOA 3WAJA 3TDMA 5JTTA 3BKWA 4Q15A 1W5FA 2C5AA 1G9XA 3L46A 3PT5A 3U40A 3WTBA 3E22A 4D7ZB 3TNLA 2CCGA 3FVTA 4PAQA 3GGOA 2AXNA 5KNBH 4JBLA 2OYCA 3X2SA 1CUCA 1XN4A 1KAQA 1QUFA 4OVKA 3EZ6A 4Q93A 2YS6A 3PICA 1GIAA 4LAFA 2WYIA 2ZT6A 3C3CA 3D7MA 3MRVA 3WRXC 4EI9A 2FUNB 2DJ5A 1QLJA 3L4SO 3PHHA 2I1VB 3VC2A 5BSWA 1FIUA 2L0XA 2NSLA 1NIPA 3LK6A 1IJFA 2RHBA 2V45A 4JUDX 5B30A 1F6DA 1L5RA 3IVMA 3OM9A 2OZVA 3R8XA 3UXEA 4N48A 2WEKA 1I4DD 2MT9A 3W3AA 1ZK4A 8GPBA 2I8LA 4IV0A 1M1YE 2OOSA 3L0YA 4ZCLA 1A8SA 2PZJA 4Z4HA 1RJGA 2B25A 3PTZA 3VJKA 1U1EA 4NXMB 2IS6A 3QW4B 1BYIA 1JHYA 1YVUA 4LV8B 4QAJA 3QG1A 4X7RA 3HN6A 1RC0A 4DLWA 4M46A 5JDIC 3GLFE 1RC1A 3OIUA 3ZDBA 4IILA 4LXYA 1EFRD 5AUPB 1QS0A 2JFGA 5A3VA 1QRUA 3JASB 2VAWA 4GMHA 2VBCA 1IBLB 2REBA 3M6IA 4MYCA 1KZ7B 2CJPA 3E5MA 1Z8HA 4F38A 5F7OA 4RQTA 3MD9A 3MTGA 2C3UA 1PYOA 3MOGA 3FMOB 4JL5A 3OZWA 2AS0A 4KVZA 1JLRA 1I94B 1ONNA 3UC9A 2JIRA 1QF6A 5FLXA 4ZA2A 2F3PA 5E6RB 5F2EA 2W22A 1U0GA 1CXZA 4DTCA 2EZTA 1Y8AA 1ZJ6A 4LJ8A 3AM3A 3D2BA 4ARIA 3ZDCA 3PR1A 1G20E 1FYWA 2PU7A 3PNBA 4G0XA 1BQ4A 1L8XA 4JN6B 4DGSA 2WVAA 5EFOA 5LD2C 3L06A 3ZK9A 1CF2O 2VDRB 1CX9B 4DA4A 1U2EA 1YKGA 5TPWB 2JK0A 2OUKA 3PCXA 2ZAOA 1SN7A 3CC2Z 4QIWA 1T5TA 3EEBA 2A1IA 1Q57A 3F7NA 1C0LA 4ZOAA 3M9XA 2QJWA 3ZDFA 1K7SN 1W30A 5AVTA 1FNNA 3RVPA 4KXWA 1XQVA 3I561 4KP7A 1QAQA 3K5HA 3EDYA 2XXAB 1NM5C 2I2XB 2QTVB 1HDZA 3K2BA 5TE9A 1MU0A 4JP8A 5BSHA 2QLFA 3T1TA 2PPLA 3DF7A 2QYTA 3NBZC 4Q4HA 4CN8A 1CJBA 4YRPA 3WQBA 1KD12 5JCPA 5K3BA 3DL7A 4I46A 2BFCA 3UAXA 5BR4A 3D31A 1V3QE 2PKWA 3LOQA 4ZRDA 1X74A 1TC2A 3AR6A 4KIWA 2OG1A 3AVUA 1NR1A 1P7VA 2G08A 3AY0A 4GMGA 4NIMA 3ZXIA 1BW9A 1FLNA 2VDLB 3C0KA 1JZTA 2R7LA 5K8IA 2WVHA 5HF8A 3HXQA 3T3OA 2RGRA 2QMUA 2GH1A 1QVZA 3A04A 4JP5A 2W2XA 4UJ5A 3MVEA 2R6GA 4DAEA 1DJOA 2D2FA 3GJ4A 5D7BA 4ZZ2A 1NJ6A 5THXA 3TD2A 2M6KA 3LPMA 4P58A 4BQOA 4BP8A 3URKA 4Y2RA 1MABB 3QKRA 4BFVA 4DQXA 5CCEA 3HOZI 4ZT3A 5FV4A 1R3UA 4RQBA 4TWAA 2PV0A 1FDSA 2AK3A 4G5XA 3U1BA 1YK1A 3J7A4 1AQ6A 5SY9A 5DGHA 3RFFA 3S8EA 4AZWA 3L84A 5FIUA 3W8NA 4BNWA 5IWCA 1P80A 2J6IA 3I9LA 2RH9B 2VDJA 1LJLA 1CZHA 2ZP1A 2E4ZA 3LVBA 2C7OA 2YRFA 3LOUA 1SU4A 4LDZA 3T9CA 5CT4A 4CHGA 4CQJA 4CMKA 2E4UA 1JA1A 3FYHA 2WUVA 1ECCA 3PGKA 5I7HA 4H27A 4BQNA 3A4MA 1GD1O 3PPVA 3UXHA 2GAAA 5SV2A 2NTJA 2X4DA 5A9RA 2UXBB 3CIFA 2H4XA 3LQ4A 4QUEA 4LSMA 4DRZA 4LHSA 4DNOA 1NJI1 4OQLA 5DCWA 4HC4A 3PXUA 4UE3S 5C3UA 2NP7A 1QHHA 2ID9A 3AF1A 1M1K2 1QIFA 1Z4IA 3DE3X 3I72A 3QFHA 4MWGA 4QOEA 4RVNA 3V55A 4ZCIA 4W8HA 2YWGA 3S14I 4ZU6X 1U80A 1L7XA 2FPIB 3WMEA 1MH9A 2V9ZA 3BD8A 4RLFA 4LHXA 4REQA 3ZK7A 4A91A 3G2OA 2D2EA 1H0KA 1NKTA 2JGIA 3G9UA 1UFOA 3LG2A 2DBVO 1YB4A 2MINB 1JSXA 1BGWA 4NBWA 3RJ9A 2GNOA 3SJ7A 2WWYA 1Z0UA 4ZV9A 2V8OA 3UWKA 1XYYA 3DMTA 1FJXA 2PLWA 3N5CA 3WQHA 1ENZA 4R81A 5LXTB 5J2UA 3IR5A 1I2BA 4O0LA 2P6OA 1F3LA 2O06A 3DTVD 1W0JD 3RBZA 3VISA 3WB1A 2AA3A 1GNLA 5EUBA 1YR8A 3T7SA 3PQCA 2FUG1 5BSMA 3CH4B 4TSKA 3STTA 4YROA 3DLAA 1R0LA 1VI6A 3JQGA 3PWZA 3BIXA 3LCCA 4IF4A 5J2UF 1L1EA 3IPCA 1Q92A 4DZZA 1GUFA 2PVCA 1XROA 1KH1A 2W6OA 3CRQA 3G1TA 1DT5A 4H7JA 1SBZA 4MR7A 4N0DA 2H06A 3EZYA 1NJGA 4G0YA 5JSQA 1ISPA 1O7JA 3GDWA 3IBFA 2VQSA 3D4OA 3I6BA 1L5SA 3NV9A 4FU0A 4HEA6 1FEZA 1RRFA 2JASA 2PAFA 3WL7A 4P34A 4PE5B 3QNUA 1EWVA 1PL6A 3THSA 4YDHB 1Y1SA 4D5EA 3A6EA 2QUZA 1KRLA 4EHHA 4H6WA 5CA1A 1G5FA 2QX8A 2AR9A 2H7XA 3R0JA 2PTHA 4G2NA 4NF2A 3Q1KA 2Z5VA 1DDIA 4PLZA 5K3FA 4AWXA 5KNBA 2MTBA 4NOKA 2F8LA 2FH5B 2RHDA 3M1LA 5DRYA 1S4QA 3VR5H 5FCDA 2IP1A 3CCSZ 2D0OB 2TMYA 3DGEC 4FFTA 3EIUA 3NT4A 2CUTA 4MIOA 2LUOA 2UYYA 2RB5A 1M34A 1YB5A 3IXMA 3JVDA 5CA1F 3LOPA 4A15A 1O2DA 3GGJA 2BRUA 4N0EA 4UCQA 3WYGA 4UPEA 5KVVA 4HH4A 1GY8A 3RS0A 1S72Z 1ODTC 2QR3A 3BTOA 3I04A 1BWPA 1O97D 3ZXUB 5F9FA 3V8PA 3DMRA 1YITZ 1XLTC 4OIMA 1QP0A 3F7TA 4FINA 4AY4A 4NFRA 5IT9f 3WLJA 1SZJG 2I78A 2P78A 1B2RA 1WCV1 3BBLA 3P2YA 3KUCA 4MW1A 5HK9A 1WOYA 1NLZA 1YI0A 3DGFC 3E2IA 3FN4A 2PD4A 2X2OA 1TWAA 1E2KA 3E7FA 1JJ7A 2EZ4A 4QYTA 3RU2A 3CEMA 4YPFA 4RHEA 1Z63A 3TTYA 3H9GA 5JMTA 3KRTA 1I32A 3P71T 4OSEA 4UDXX 1VMKA 5HGJA 1L9KA 3WWPA 4BX9A 4S24A 5REQB 1JJVA 1F5NA 4JR2A 4QGFA 3VU9A 3VR2D 4A73A 4B43A 2WTXA 1E18A 1HT3A 5HIAA 1Z12A 2AMLA 1TT5A 3A28A 3Q9UA 1KXZA 1GKIA 2PQ6A 2PMWB 4Y2XA 1F0PA 1WP4A 1W2WB 1WUJS 2JAHA 2VK8A 2N42A 3QQ7A 1ZICA 3B38A 4KI7A 4U7FA 1HDEA 4XWKA 3FFWA 4BMDA 4QIHA 1B4DA 3T9BA 4NZMA 5FXMA 1D6MA 1IPFA 4IJ6A 2P3OA 1Z4PX 1D04A 4Q02A 2VAXA 4MV9A 1TC1A 4COKA 3P0FA 4RK5A 4C76A 1NNI1 3CQZI 2BI4A 2AFIA 2II6A 1JQ5A 1K6MA 3M7IA 4O0MA 3A1FA 3I8XA 4YJFB 3THRA 3ZGLA 5CCBA 2DQZA 2WIKA 3QFFA 5BT8A 1LQ2A 2HA2A 1VTKA 1RQNA 3PUXA 3MTDA 5AQEA 3VH2A 4HUTA 2EL9A 3OJOA 4XGQA 2JLZA 1J8FA 4GT1A 3WK9A 3BH6A 2PZGA 5B6JA 4FTWA 5JWHA 1OXKB 3WV4A 4XA8A 3RSCA 2C88A 3EGDB 4K6CA 4IMPA 4RGVA 1E1QD 4FOOA 4BTLA 5HYVA 5HGXA 1P73A 1LDNA 2OV4A 3ESWA 3M3YI 3AUJB 4XYLA 1UPBA 4I3FA 2CLSA 1YDGA 2R48A 2CSUA 4OP3A 4X94A 5AK5A 2JW5A 1T0BA 5E38A 2ZFUA 2P5UA 5E4YA 4F7DA 1I7QB 4YV1A 1JIVA 2WJYA 2O07A 4GKVA 3TIXB 2KI5A 1H5UA 4C9BA 4RNDB 3GL9A 3O74A 4NOMA 4D0GA 1C3LA 2LVBA 4EYGA 1I4LD 3W2HA 4LGVA 3RUFA 5AK6A 2JIZA 2RGNC 3HB7A 3OUGA 2Q41A 5E0OA 3GJXC 2PZ8A 4D9CA 3HADA 2M9MA 4D99A 5HQ3B 2OYSA 3AV0B 1CY1A 1G2OA 2G5PA 3N39C 4JLMA 3EAGA 2E55A 2N3ZA 2B7BA 1QYXA 3L6EA 3Q15C 4TN5A 5H8WA 1PFYA 2X8JA 3LLSA 5ALOA 2DHRA 1AE1A 1B7GO 3ANYB 4EHLA 3HDYA 3JWPA 1LLQA 4WI1A 3M33A 4NBNA 2BM0A 3ZWQA 1H4VB 3H99A 5HBRA 4R8KA 1FZTA 2Z1DA 5L3RA 1Y6FA 1IJKA 3T4UA 4WY8A 4RPGA 5LB4A 4DADA 5J4KA 4JNCA 3WKEA 4BJ5A 4HG2A 1IWPB 2EIXA 4IMIB 4K9MA 3AI3A 5ED0A 1N8TA 5J4HA 1GTMA 5FBWB 2AT1A 3TM4A 4DR7B 3TO5A 1E64A 1TYZA 2GAFA 4IHAA 2NVBA 4QDUA 4BEJA 1YMUA 3CZRA 4WVFA 3WMFA 4AG6A 5KINB 2QJFA 1KHHA 2WWHA 1ECGA 3AF5A 2AN5A 2ZVJA 2PS9A 1M2VA 3O95A 4IEIA 1LKZA 1PWHA 1DC5A 1X7WB 4RUKA 3T0IA 3M3HA 3SMQA 1W85B 3VGPA 1KBQA 3ZDQA 3LF1A 1A71A 3RO7A 1LUAA 2YZGA 2PRYA 2X77A 5LMNB 3QPAA 3WWEA 1PHRA 1JHOA 3NH4A 1VE7A 3NJ8A 3UICA 1PJCA 1R12A 4HB3A 4RXMA 2ZB7A 3QVUA 4BDSA 3TTXA 3ELUA 4O1MA 5KU1A 4QREA 4OLAA 2IELA 4Y2SA 1BN7A 1OTYA 3NTOA 3NRCA 4R2WA 5IF3A 4KXFB 1FUEA 1KDPA 1QVGY 3AHHA 3CRMA 3QU2A 5CPBA 1EE2A 2Z4TA 1NVVR 4EGAA 1VFNA 2NM0A 1VQ61 4UUMA 1NMSA 2P41A 3NBAA 4H3HB 4AUNA 4B6FA 1BRMA 3QOYA 1F12A 3I62A 4U2KA 1KYZA 4U9UA 3SXPA 5BV7A 5ITZB 2PX6A 1L8FA 4KXMA 4LCBA 1KYIA 1X7DA 2F1JA 3CT4A 1BZYA 3TL6A 3X2FA 1W8IA 2RONA 3GRKA 5JMPA 5K2OA 2VDWB 2GZDA 2YWEA 3EE6A 2HCRA 4NLLA 5A4MS 4CNQA 2HLDD 4D97A 4MVCA 4LJ9A 4FS8A 2QDKA 4WUTA 1X1RA 2O2CA 2IBMA 4FMPA 3CPWY 1N6OA 4UD6A 3RAGA 1II8A 5DNDA 4EWCA 4DY4A 4ZI2A 5BPHA 2OWEA 1GDTA 2ZRIA 3EFEA 1XZCA 4CT5A 1OVGA 5I4CA 5CLLA 1G3QA 4JJ4A 3EVAA 1RI2A 1XC7A 1DAMA 1MVLA 4D9NA 1KDVA 4D8YA 2DUNA 3L1JA 3GLIB 3W2GA 3S81A 3U9LA 5KSOA 5JAUA 5BO5A 2R1ZA 2E2IA 4LZPA 2EGGA 4JI7B 1CR2A 3I6MA 3OHPA 3P45A 4ZODA 1Z4OA 1PN3A 4TSFA 1IHOA 4FT4A 5FKJA 1MO6A 3ZPXA 2WSLA 2Q46A 3AERA 2BFBA 4ZXFA 3TIFA 3MJHA 1DKPA 4XCXA 3VR5A 5ALKA 3RAPR 4DSTA 3K1YA 1USPA 3HR4A 4OXNA 3TW8A 1LBHA 1OA9A 2WR8A 1OFIA 2DPXA 3EF1A 3F5SA 4NAVA 5HKBA 3GJ7A 2BE5D 1AZWA 1ZINA 2OY0A 4FUTA 5CX1B 1AK1A 3B6JA 4DCPA 1T8TA 1UK6A 4YRMA 2Q3DA 1IW7D 1GG2A 3WQQA 4JEHA 3HCWA 3B3AA 1K5GA 3EIWA 2NZ8A 4RENA 3B6KA 5I9LA 1JEQB 4IFIA 1ND6A 3W05A 5BMVA 2Y3IA 3RVJA 3V8BA 2CMDA 3BC1A 2Q5FA 2RGEA 3QEJA 5SZJA 5KTPA 4FOLA 3ZIUA 5DCLA 5JYBA 1EUYA 1SJ9A 4H7FA 3AEUB 4IIJB 4IZ6A 2PNJA 1XCJA 1E63A 4M9ZA 1TZJA 2VRWA 2J9YB 2C7GA 3GZ4A 3NH6A 3U37A 1BJRE 2IP4A 4W9NA 3WLPA 4MUHA 4YDRA 2XT9A 5HJ7A 1B15A 5IRCD 4B2YA 2Q6IA 5KNDH 2KLBA 2NX2A 5BMVF 3I56Z 4DL9A 2NUBA 5AJWA 1DE0A 5AVWA 4U4AA 1DBRA 4CUKA 2A58A 5CR9A 1TW3A 4HAOA 3KYIB 5AXAA 5DLQC 1F20A 1JJ2Y 3OPYA 3PKZA 1XKTA 3I1FA 3KV1A 3HFJA 3HYRA 1MZPA 3G711 2ODNA 2AKLA 2HUNA 3GRYA 1NONA 2G6BA 4NFHA 4HAXA 3DTTA 4WSOA 3NHYA 2PIAA 3OLVA 3RYIB 1Y1VI 3BRCA 4MEAA 4TYMA 2C7PA 4DTIA 3U7RA 4WLEA 4B44A 2QL7A 3CLVA 4K3UA 4P0TA 3ELWA 1GZ3A 1J25A 1I3QI 3N2LA 2R84A 4JJ7A 1GQQA 3MHTA 2IYUA 1DRKA 3D4IA 3ILVA 5DCUA 3W2TA 1J39A 2RHWA 3D4PA 4D9FA 4EAAA 5H9VA 1SC4A 3O7MA 4MW4A 2H2HA 2XYVA 2WINI 2GILA 1JG7A 1O58A 1J90A 3MHPA 3W1VA 4B5KA 4BVEA 1I1NA 3CUWA 4TYPA 3F1KA 2Q0XA 2ENWA 3ZVNA 1N7IA 4IOMA 4HWOA 2EBWA 2UZ1A 5HDQA 2ZBVA 3DOOA 4IIGA 4F5ZA 5BRJA 4CR7A 1HKUA 3ECAA 4NH4A 2AZTA 1MR3F 2QI9C 3CMMA 821PA 4JV5B 3DHNA 4YX9A 2GAJA 2P8JA 2W2KB 2H7YA 1QYRA 2BSAA 3BX1A 1NW5A 2ZB3A 5EKXA 2PBRA 5DSXA 3A3PA 1PS0A 5AJYA 1HX7A 1EPUA 2Q3JA 5DP1A 4A7PA 4Y1GA 2C00A 2P9CA 2GVNA 2IH2A 2V8KA 3FOEC 4UTNA 2GZHA 5GM2A 1NAHA 3A2KA 3I9OA 5DXJA 2CFIA 2RKBA 1E69A 1FCJA 4CFSA 1ABEA 4RPLA 5LJIA 3ZZ1A 1RM0A 1CR1A 2P9ZA 3W9UA 4OQFA 2BTQA 2Y0BA 4XAQA 4A8JA 2SKEA 1S02A 1L7RA 4BMNA 3QHAA 4NOLA 1SO8A 2GX6A 3ICPA 1KYXA 4G5GA 2NVTI 3TGLA 1Y5IA 4G67A 1F7UA 4OHUA 1VBFA 3K0KA 3OT1B 2G4CA 4QJ5A 5CIWA 1TO2E 1XRNA 3OW2Z 3O8NA 4NNOA 4UM5A 5BSFA 1GFZA 2O2GA 3AUAA 1N2EA 2BELA 1PFUA 5C8YB 1XEFA 1PWZA 4X20B 1X2EA 1BWSA 1L5WA 3W78A 3H0CA 3AJ8A 4MOWA 3EZXA 2JA5A 1K06A 1ZH1A 1I7NA 4FDAA 4OBXA 3HEAA 3UUWA 3AL0C 1VQ91 4MV6A 4QNMA 5IX8A 3QM1A 4MQFB 4QUDA 3LVFO 1NMQA 2GN2A 2D1RA 4NV0A 3MZ0A 1GSHA 1S6YA 4ZT4A 1F06A 2BV3A 2AW3A 2OLKA 5CFNA 1H8HA 5IAEA 4B0PA 1E2JA 1Q0TA 2IT1A 4AJNA 1OROA 2CY0A 4KWIA 2BFDB 5G4LA 5CAEB 3RFUA 2PSHA 4RHFA 1KJYA 4U5XA 1GGJA 4L5YA 4W1QA 4H7KA 2AJBA 4EL5A 1XEAA 1E2FA 3ZHTA 3AHCA 2PNWA 1TGYA 1W0KA 5KAMA 4F1KA 2ZYRA 1DL5A 5JNLA 3BJEA 5KNDA 4LK2A 1C0EA 2RBEA 5L4NA 1TIBA 1NBMA 2MMCA 4FYYA 5JAIA 3D6UA 2B1JA 3HEMA 1UKAA 2I8CA 1U1IA 2Y1DA 1P29A 5KPJA 3QBEA 3I2HA 2FEOA 4UCFA 4FD3A 2JARA 2D54A 3I9NA 5CT9A 2HZ7A 2Q29A 3EQ2A 2QREB 3Q9SA 5A62A 5JMWA 3BK2A 5AHXA 4JI8B 4IDGA 1V26A 4MVJI 3QWZA 2OESA 3REGA 5C8VA 1PBNA 4L4ZA 5JNUA 2P62A 4FFBB 3JQQA 3AFOA 1OC4A 4TRRA 4XQ0A 2FFRA 3CJRA 4C7JA 3KSBC 1N6KA 3VZSA 2AVDA 4FB5A 3R9WA 4FYXA 2C95A 2HJWA 2J08A 2WT9A 1NC1A 1VLQA 2W2LD 3Q72A 2XADA 3QFRA 1UOQA 4JGBA 5IUJC 3BGSA 3K73O 1D4ZA 4UULA 2H5JA 2PRSA 4S2UA 4DLBA 2NZ2A 2IV7A 3GFFA 3BIFA 5FJJA 2ZTLA 1ECFA 2ZJ3A 3T3MB 4DA6A 2HMVA 3LYHA 4BMXA 3TLAA 4FYWA 3MWDB 5A0FA 5C1IA 3MS7A 3ANXA 5K0EA 4GOXA 1EFTA 2UZIR 5KPDA 3RHSA 1V7CA 4EG1A 1A9XB 1TKBA 2RB4A 1RAEA 2R25B 3OE1A 2CJFA 2ZBEA 3SJCA 2PRKA 1PNOA 2JATA 1EVYA 2QTZA 3D8BA 4GPTA 1E4EB 2KPIA 2PMBA 2WD7B 2WVGA 3LCJA 4IOLA 2XNDA 3VOTA 4PYNA 1CS0B 4BNDB 3U44A 2IS2A 3KCNA 1U7ZA 1VG1A 4FOSA 1PFTA 4LNUB 4RIFA 3PXEA 2JAOA 3TNDA 1NXQA 3W04A 1VPLA 1XTIA 2AEFA 4LCJA 5ARCA 2Q3EA 3FTQA 2JA2A 3D4LA 1NLFA 2CVPA 4L74A 3WL5A 3BDAA 1CUYA 4MWEA 4NJOA 1QRDA 1CZRA 2JA6A 1L4UA 4YBZA 4FG4A 2P5YA 2BZ1A 1O95C 1W5BA 3DFIA 3WLEA 4POOA 4P4UA 5K01A 3UT0A 3G2JA 3BG1B 3ENVA 1JDSA 3MSXA 1KAEA 4I9HA 1C4XA 4RGYA 1KDOA 5LC1A 3MOIA 2HR1A 1GTSA 1MV5A 3U31A 3LY5A 1P45A 1QB7A 1XMXA 3MWKA 1XSEA 2NYRA 3W7VA 2QYSA 4CZ2A 3R4CA 3GJ0A 4EP1A 3HI4A 4BX2A 3KEFA 2Q8NA 1HF3A 1NQAO 1V9SA 3FYUB 3KHKA 4KDFA 3RK1A 5TEWA 4DDVA 2JLVA 2PXXA 4HDSB 3S3TA 3H0KA 4RTRA 2VK4A 1M7HA 2VAPA 4Q16A 4Y2PA 5DBEX 4JLDA 2AI3A 4Z4IA 1W48A 3OBIA 4AJOA 5TQVA 4F3CA 3UV7A 4XDZA 5HPYB 5FUVA 2REQB 1NVMB 5AI4A 3OQMA 3LCUA 2LFUA 3HCEA 3DZKA 3KBOA 4HRAA 3SDSA 1A1VA 1Q7Y2 5CH3A 2H9AA 4NMMA 4OHBA 3DPIA 1S7MA 2YQZA 2F17A 2A4MA 3QWBA 2YRWA 4QU0A 3QOWA 4B8ZA 2R93I 4RY0A 2A3RA 4Q5IA 2HBZA 2PWPA 3V1MA 3AUSA 3GMSA 4FFOA 3ONFA 2H92A 2XUJA 4HXFB 1V16A 4CWAA 4DLZA 2ZR8A 1SCJA 5DN6A 3GFVA 4DV0B 3TJMA 5AJTA 2Z04A 1L2TA 2EC5A 1G5HA 2NXNA 1OPRA 4NFYA 4ZO9A 5BOSA 1X3ZA 4PZ0A 3TZLA 5JLAA 3UCXA 3IAHA 4PLGA 2BH2A 4DG5A 4C4RA 2V8BA 1AH2A 3K8QA 3AHJA 4MUYA 4KWHA 4TSRA 2WSMA 5J2TA 2XA9A 3TTVA 1NNSA 4ZVRA 2L18A 4EG8A 5FL7A 2IVFA 3I01M 3PHIA 4OK3A 5CB4F 2TS1A 1JIKA 3EFBA 2J5BA 3AEQA 3UK0A 4D4JA 1JE1A 1ND5A 2M1ZA 4NEQA 1L8AA 2WB2A 4HP8A 4LQLA 3U4MA 4NU6A 4DK1A 6NULA 5J2TF 4C88A 4XIIA 4O2BF 1BFKA 1LX7A 3O2QB 1EAYA 2Y4OA 4TN1A 1RQFA 1Y9DA 1FQWA 4B4UA 1GFIA 2CWWA 2VSXA 1CVRA 4MMXB 5IKPA 5JXIA 2D1SA 3F6SA 1XNHA 3TI7A 3PXXA 1CY2A 2Q1SA 1VSTA 4E5DA 5D1OA 3RS3A 2WDPA 2PRJA 4BE7B 4KNVA 4GNKA 4B87A 4X65B 3VTNA 1NPTO 5EUMA 1QO0D 1WAMA 4XQGA 4INOA 4HLCA 2H3EA 1LSUA 4BZXA 3GYGA 2ZZMA 3O9MA 1XCLA 4W82A 1GDDA 4BO1A 1PJBA 3DM9B 2AOTA 3EIXA 1GVNB 4IDFA 1F4VA 4K6OA 1E2DA 1JAIA 1FYDA 3ROQA 1G21B 3BMNA 1HT2E 4J6EA 1UDXA 1OLSA 3UAGA 3RB8A 4B6QA 3FJ1A 3K6JA 3RVKA 4FYVA 1U0RA 4RA6B 3SEQA 4F56A 3OQ1A 2QUKA 3O4RA 4BO3A 4EPRA 5HZHA 2JG3A 3PFBA 1H22A 3ROMA 5LPNA 2V7XA 4BNGA 1DLJA 1T9DA 1YJQA 4FP9A 2BM9A 1VQ6Z 1J42A 1R8QA 4U9IS 1WDWB 1HTBA 2O2ZA 1QH9A 1LV8A 5DI3A 1N9GB 2REXB 4PQEA 4ISBA 4IZHA 4PPNA 1L8QA 1DX9A 3WMWA 4EHAA 4EG3A 2ZSUA 3KKOA 2QMOA 5TSDA 4RF3A 1JBQA 1OWLA 2H4YA 1A4RA 4KR0A 5TGZA 2YIMA 1YE5A 4ZVOA 4CMEA 4I6GA 3VZQA 5ALFA 4K9KA 1O54A 3KXDA 1NJSA 1Z56C 1Q0ZA 2QG4A 2WYOA 2ANCA 3DEJA 2O8BB 2HFJA 2X2FA 4ZAZA 3T7TA 3ZWPA 4RANA 3NGXA 5C7IO 4CDRA 3GBPA 3K9CA 1YD7A 3K5WA 4LMBA 2XCIA 2ERYA 2B36A 2V7QA 1DEKA 2O5VA 3PT9A 3E0XA 3S2IA 3GTKI 2C42A 4EGSA 4X95A 3V3TA 4EPVA 5IK2A 3IAFA 2BKUA 4NBCA 4QFCA 2YVUA 2Q1XA 2G17A 3NPMA 3V8MA 1GGHA 1IN6A 4BFLA 4G85A 2F4NA 3GMIA 3SM9A 3P19A 3OTOB 2NV2B 3L4BA 3K2IA 1GPNA 2IDKA 2GA8A 1AVTA 2IW1A 2Q27A 3OJWA 5FOSA 4Z3DA 5K6RA 3ABOB 3Q6IA 1A7AA 5GM9A 1NP3A 4QYIB 4DLPA 2R7KA 3QUQA 4AN1A 1A8PA 3M2PA 5HX7A 3ADDA 1E0AA 1JPJA 4R83A 2W0SA 4HWSA 5CFLA 5A06A 1SMKA 2WPNA 1SQGA 1DTSA 4Q0MA 1UK8A 4F3KA 2JKVA 4MUEA 2JA7A 2NYAA 1EHIA 1DFIA 3QMMA 4WESB 3BZWA 4A26A 1ZM2A 1EFDN 1PWEA 3EVGA 3ZCSA 4YRIA 3K8OE 2BBTA 1YXMA 2FPSA 2XDQA 3PF9A 1XQXA 2QPTA 3W8DA 1K63A 1BS1A 1N1EA 3HCCA 1FY2A 3ND6A 1YIDA 1H93A 5EMMA 2XCQA 1XVUA 3N1UA 1HMYA 3ACDA 2O7QA 4GR4A 2EKZA 4LI3X 4YRGA 2V6GA 1NR5A 1NUTA 4E2FA 5ER9A 4NBTA 4HMOA 1O94C 2WIJA 3D3QA 5G0TA 5I7OA 1E77A 1V4BA 1JAXA 4LF9B 1PP4A 3QSYA 2QGNA 3HH8A 1LBTA 4DRXA 4M8IA 3ZUGA 5AW5A 1DPFA 3G71Z 3JZFA 1E1RD 3V4ZA 3QA3E 5DYGA 1F7VA 5F51A 1Z35A 2JDIA 2NO7A 2JCSA 4RK1A 3SHOA 2CL5A 4ASUA 5L6LB 1QOPB 1K68A 2GTIA 4MX8A 1SUEA 2ZBRA 1RYNA 1NZDA 1BU5A 4A93I 2D7CA 3AG5A 4MYRA 4NV3A 1RZRA 3LCRA 4WY5A 3GJ5A 3EXFB 4N5DA 1P1RA 4ZRMA 3CQZA 4R7GA 2WUDA 4ZIRA 1WKCA 1VE6A 3UMFA 4RTSA 2J46A 3F2VA 2GPTA 4C2MA 1CS4C 3IJ5A 2O8FA 4LDPA 1P3Y1 1FOEB 1KEEB 2ZTMA 2AF3C 4FG2A 3JZMA 4HFMA 4DN6A 2GBLC 4K7JA 2C82A 4NL4H 4NCXA 3ZG6A 3C4JA 3M4XA 1Q22A 4AROA 2I7CA 4TWBA 5FO1A 2O7SA 2YOHA 1GNSA 2ZE5A 4O4JA 2IZ3A 4XFJA 1ZD2P 3T4XA 5KQLA 4MB6A 1EK0A 2H7CA 2P9FA 2QRZA 3BMCB 3CEAA 4UTVA 1W75A 4ACAA 3R6GA 1TKAA 5JJKA 1TVMA 1E89A 1UT5A 3OCCA 4WRRA 2J9ZB 4GGMX 2Y6VA 3MYYA 1CKEA 1GZ6A 2WT8A 4RHYA 3MIZA 2VF1A 3GD5A 4BO0A 1ZM3A 1ZM7A 3I5XA 3ET4A 1DKUA 2H0RA 3H4TA 5LOVA 2FEKA 2H5EA 4O4JF 1AC5A 2SECE 1WCIB 3EXAA 4HDCA 5CDYA 4AJHA 5KTRA 3G2IA 2O7NA 4XDGA 1NU6A 1UCFA 1A9ZA 3NBMA 1XVIA 4ZAXA 1WSWA 5K0JA 3DFZA 4EPYA 3T7AA 2GPJA 4BKUA 2BGRA 4RTJA 5ARBA 1UAGA 2ZIWB 3LP6A 4DCUA 4M60A 4U2GA 3ZNNA 5ER6A 4G9EA 4YONB 2E0IA 3SHTA 5LOVF 4RJLA 3BHJA 4BBZA 1YCFA 1NFQA 1OJ7A 2ONCA 4DLNA 1YRAA 4LHWA 1LVUA 1UMBB 2ACWA 2HSGA 1OPXA 3BEDA 4UHDA 1PR1A 1V37A 1LTKA 2Q1UA 1UC4B 5F76A 3DEAA 3RRZA 1ACJA 3EPLA 1GSIA 2PEYA 3FW1A 3KPWA 2P2GA 4DARA 2ACVA 1DZ3A 3TZEA 2R8ZA 1WHTB 2PMFA 2P6MA 5DMHA 1VJRA 3PEVA 1UBTS 4WXMA 4RL6A 1V45E 3GJ6A 3NEYA 3TJZA 1QIGA 1T43A 4KO2S 1VQ9Z 3GR6A 5G0VA 3GJTA 1D0SA 1NVUQ 4V0MA 1YI21 1I2DA 1L4HA 4C20A 4Q3EA 1IBCA 3OFKA 1FDOA 3OCYA 5IM4A 4D8WA 1AO0A 2QT0A 3BJMA 1BMQA 1JLLB 1UBOS 3ORSA 5BPFA 4C7OA 2W2PA 4AYXA 3A10A 3FGPA 4MDYA 3DYVA 5I4BA 1Q7CA 1QORA 1M74A 3LE8A 5IT9b 5TXGA 1VJ1A 4JUAA 4B9EA 1BYUA 4JB2A 2Q4BA 3ITKA 1SVOA 3TECE 5IM4F 4GKJB 5C53B 3DW1X 2QX4A 5TLSA 2CDBA 1PVVA 2B8WA 4GM4A 1NVTA 3OJFA 1R5NA 4RVDA 3A27A 2VDQB 2R4TA 2XYQA 3EH2A 4QUGA 1Y4SA 5H83A 2QB5A 3LPDA 3LXRA 4FCCA 5FF9A 5EY5B 1FC0A 2DPYA 4OI4A 1F0KA 3HEBA 4PYRA 2EG5A 3QEMB 1I3NA 2XGMA 1XB2A 4IHJB 1EXVA 2P77A 1R4MA 2JFHA 3VC7A 1I50A 3FFTA 2JEYA 5HQTA 4L28A 3ZHBA 1RR6A 2GPWA 1DOZA 4KREA 2J33A 3B9BA 1Q16A 4TKMA 5IAGA 4YDSA 3ADPA 4TV9B 1KHTA 4HNRA 5EZ6B 5F3DA 3EZ2A 3VR1A 1JDVA 2C5FA 3NAQA 4UNNA 1SXIA 2WJAA 1XF1A 2QRGA 3GTMA 1AQYA 2G8NA 4M1QA 1XTUA 2IV3A 2ZUEA 4DG8A 1Q821 1BS9A 2WAXA 1YDMA 1VHTA 1XHLA 2J3HA 2QM0A 3DZ8A 3JQAD 2IWRA 1MOPA 1Y7IA 3ODPA 1M5RA 5FWAA 1RP7A 1X3WA 1JIQA 3RYTC 1VKJA 2CLMB 4CEIB 4E6EA 1XD8A 1JW9B 3IDAA 1ULSA 4HUJA 6REQB 1E9EA 1TEHA 5L4SA 1DT3A 2AG6A 1ZH6A 4M1TA 2O5CA 4NCHA 1JKFA 1GG5A 2GPBA 4CRYG 2ZTHA 2FR0A 2C9BA 5BXQC 1IQRA 2HA0A 2QUHA 2B4TO 2Q9AA 1GU0A 2VF8A 3DQPA 2IYPA 4H4EA 2JHGA 5BRAA 5KOHA 2IHBA 1B14A 2IYNA 2X2PA 3KSMA 5KKNB 5CMLA 5AKKA 4K86A 5FYQA 4RTOA 2I6GA 4DAOA 3EMVA 3F74A 3IQIX 3TIGA 1DBPA 3JRWA 3NKLA 1IZ7A 3AGPA 3NIDB 4H59A 4YAWA 3SYNA 4X6UA 2FE1A 1IVYA 3CBGA 4KOAA 3G7NA 3AR3A 3JARA 2I4NA 2IGBA 5CT5A 2RIRA 2EKPA 2ZJ5A 4NX2A 3I6IA 4MUAA 3OTIA 4NOJA 2AKEA 1QF9A 3NT5A 3EY4A 3HYNA 2IIVA 3T7RA 7GPBA 1XEXB 5T8KC 4X1YA 1E79A 2RGGA 1O1YA 3L7OA 4MP3A 4J1SA 4OXIA 1XTSA 3WJ2A 4Z4GA 2FQXA 1PJSA 4ES6A 1XHEA 2J7PA 3IAM1 3N2KA 4ZPJA 3T41A 1YZFA 2Y77A 3A6LA 1ZBDA 2H4JA 2VDKB 4LWPA 4P33A 3U3JA 2HU5A 2PJHB 1K3UB 4RZHA 3N87A 3UTCA 5HVNA 2DE6A 4NCJA 3U7GA 5B2EA 2BTEA 2AJCA 1BU8A 5K0NA 1YBFA 2O1XA 3DXZA 1MJGA 3N70A 1FLDA 2PCLA 4QQ8A 3UAVA 4QVGA 1EUQA 3NTLA 3RROA 2GBIA 1YH3A 3QVWA 1D07A 3CKYA 1TK3A 4M89A 2O53A 1AMNA 1B8OA 4QJBA 4CDGA 5HBGA 5I7EA 1VE9A 1CZOA 5DGXA 4UCXA 2VHVA 2R66A 3L77A 3SMVA 3NG1A 1IOLA 1KPGA 1O6BA 4KGXA 1EBFA 3UGTA 3FUCA 2AEEA 3DAGA 2J0EA 2ZCVA 4X45A 1TAGA 1A4IA 3HOUI 4LQDA 4D8VA 5LQCA 3ABRB 4DB4A 5BNWA 1LZKA 2QV7A 4BV3A 1N32B 4PEVA 1T15A 3O9ZA 4ZQBA 5DNVA 3RUAA 1XLVA 1Q6YA 3NYQA 2AG1A 1KU6A 1IN4A 3SQXA 4GL2A 4C0AC 4UTXA 1QHIA 3OE7A 3X2NA 3G2KA 1K5PA 4CL8A 2ZJAA 4JGGA 4F4HA 2HBRA 4Z0TA 4NQZA 3JQ7A 4L51A 4TTVA 1ZB8A 2WUFA 1IJEA 3UHJA 1PFQA 2C97A 1P9RA 4WNCA 2YZKA 5THKA 3JD0A 3T52A 5I8WA 1H4TA 1HDYA 2DBQA 2DF8A 4CKYA 5IYZB 4IIFA 4L4YA 4M4SA 4JEUA 1RRMA 2OTJZ 2ZYDA 4LC9A 3PDIA 3AOGA 2YY6A 4L5AA 4MICA 2HF1A 1UXIA 2ZRMA 3OMLA 1E0KA 3CKKA 3DO8A 3C98A 1PT0A 2J7KA 4L4SA 4LZNA 3ZV5A 3R0IA 3C7AA 3RC3A 2H2DA 3ZCXA 1FBTA 2H1VA 2ISQA 3BKXA 3IIJA 4AL4A 2Z5FA 1GA6A 3QY9A 1DL6A 5C2JB 5TPZD 3WNDA 1G3IA 2ZJYA 1A95A 2OGUA 2WT4A 1AIPA 1KY5A 2YY5A 2AXPA 1NF3A 2OM6A 3KR1A 4FYHA 4P81A 4XH9B 5BV8A 3WY9A 2OC9A 4BXXI 2OGSA 3C5WP 4CLRA 1DX4A 4YUXA 1DIHA 2C84A 2FOIA 4QFBA 3BXFA 3PQ2A 4DLRA 5L3ZA 4DM7A 4IQ4A 3OZ7A 1FZQA 1R0ZA 1T8WA 1JEJA 2I55A 3AETB 3F71A 3I73A 4PRYA 2A57A 4V02A 3TB4A 2PFSA 3OKCA 4WACA 3ZJ5A 4D4LA 3QVVA 5GMOA 4HATA 3KTOA 4RABA 3I2IA 1NXVA 3J80b 1U2SA 1T2CA 1WVIA 3D8HA 3OCVA 3OZBA 3OZAA 3P32A 5HS6A 5FUWA 3R6TA 2GO7A 1IUNA 3VKUA 4CKEA 2XUGA 1D1TA 2X7HA 3CY6A 1NATA 1GZ4A 1XYGA 3R24A 1XKQA 1ECBA 1WUIS 4JC8A 3KYJB 2HC9A 2V59A 3ZU5A 4YI5A 4X7MA 3NDIA 3JYOA 2SNIE 4HNAA 3FHOA 3QGMA 4HPXB 5TV2A 3S5JA 4AJ1A 5A9SA 1CFJA 3E5RA 5KC8A 5KHOC 1YS7A 1VQK1 1QUEA 4MLCA 3TEFA 4JUIA 3RI3A 4GKKB 5G1NA 3RTGA 2GB4A 4OQQA 1IATA 4P2GA 1C9KA 1NMXA 1NDUA 1SKQA 2F9LA 2G1JA 3CONA 4IJWA 4KQJA 4XSVA 3F6BX 3VQTA 4PG4A 4AECA 1ODLA 1D2EA 4MKFA 4EGFA 4ZICA 3D4BA 2B8JA 1P44A 3J7TA 5C8XA 1AGXA 1MA3A 3BMOA 1KR2A 2A1UA 1QXFA 1UBSB 1LK7A 1A88A 2BD0A 4YHBA 5FPHA 3PPXA 4A10A 4II3A 3P0RA 2H17A 5EZ5A 4RDXA 5AHRA 1L7VC 1TECE 2MSDB 2GHQA 3K1AB 1Y1VS 2FSSA 2OXRA 2C5LA 1V47A 3DONA 3R5TA 3CLUD 2A5FA 3OT5A 4S1OA 2XKAA 3T94A 3H3XA 2FKNA 4AWAA 2POCA 1J49A 2ZITA 3FYSA 3V7FA 3DXFA 2IZ7A 3WGQA 1K9SA 4GRAA 3WISA 3KYCA 1ZJJA 3N5KA 4GXTA 3EEFA 3FHLA 3Q85A 1D2MA 1KOJA 4RMNA 1CJSA 3SSOA 2YYSA 3KKQA 4EPXA 1I3OA 4MVJA 3B6IA 3H3VJ 2P0YA 3I4MI 3QLEA 4MHSA 2OCXA 4EUFA 4YV7A 5IDQA 3PRHA 1Z6ZA 3UK6A 3ICOA 1WE2A 1ZFNA 2HGSA 4GPD1 1KI6B 1JDPA 3VH4A 4EVQA 3ZLVA 2OXCA 1DKLA 1L6IA 3U7QB 5KYXB 5TF4A 1UMKA 1HYBA 4MVJF 3D5EA 3H11A 5K9ZA 1XZIA 4WN9B 2I67A 1GKKA 4ETWA 3K32A 2PWAA 4BPRA 3WHPA 1SKMA 4O3MA 2OV6A 5EJ5A 1J8DA 3FCEA 4KN8A 4E1VA 4I8IA 2K5UA 3A31A 1IY9A 1RYZA 1DEXA 4MMZB 4O25A 3TR6A 1T9AA 4E5KA 4B3DA 3H86A 4KZKA 2CXQA 4QXQA 3RKSA 3KSAC 1ZQ1A 1U2QA 5E95A 5I7WA 2W6JA 2XRZA 4B4WA 4KW7A 2R6HA 1ZH0A 2H16A 2XEXA 3CR3C 4Q4AB 3BTSA 1V5GA 3R5HA 2BFEA 1YNOA 3FZYA 3DEYX 4U7WA 1SBCA 2F3RA 3CPHA 3W5UA 4Z7QB 2H00A 3K0FA 1Y5RA 1XXLA 2AC7A 2HDWA 3LD9A 3EBOA 1KY2A 2DWPA 2NG1A 2G71A 3GFQA 3CO0S 3OZXA 4LHEA 4LY0A 4NEHB 4OAQA 5CVEA 5E6SA 3SSAA 1FMCA 1QC5B 1LPNA 2O2EA 4TT3A 4RH0A 4YA6A 1EQ2A 1C1XB 1OGJA 1PKEA 1W96A 2FX5A 2X6QA 5EE5B 4MR8B 4A6DA 1E6WA 1Z22A 3NCHA 4US1R 1KI4A 3QVXA 1J0DA 1OXSC 2H6EA 4EA9A 1H0RA 1SG0A 1XKLA 4I19A 3EBLA 2VDOB 3BGWA 1WCXA 3B7PA 4EKGA 3JWJA 4D81A 1L7DA 4YO7A 3W7AA 3ICCA 4ESHA 2ZZKA 1NBAA 1YHNA 4XVUA 4NDZA 5A3JA 4GRIA 4C29A 2OTL1 3WWYA 1SVSA 2F1KA 3DKRA 4LE0A 2FCAA 3DE7X 4HCJA 4DMKA 4ZYZA 2IIQA 3TNFA 5EYPB 1Z7GA 4LDAA 2JFOA 5T41A 1P4GA 4ND8B 3W8RA 1II9A 2FQQA 1BWRA 2BFWA 4HQOA 1FVFA 2J9FA 3COVA 3QBDA 4YXWA 4XB2A 3K0AA 1D7AA 3SKVA 1YJBA 2C5EA 4MPRA 1SQSA 3IR7A 1SHTX 2R1TB 3IT0A 4GSKA 3FR7A 3CXRA 4JC0A 2IS4A 3CXCZ 3KVNA 4P36A 3WP1B 4EMTA 4XEHA 1VMIA 2WOJA 3IPAA 5TVKA 1KKMA 5LLDA 1TX4B 2JFYA 1LK5A 1E7QA 3PLAE 1X8JA 1JPNA 4M1MA 4EF5A 4V1CB 1IZ8A 3A7EA 1UKYA 3HWRA 1NUSA 2HDHA 3CHYA 4ILEA 2HTFA 3RF6A 1MOSA 4O63O 3ACBA 1I8TA 1CY7A 5ALVA 3K20A 1P18A 1TEVA 3UB4A 1NQXA 2Q49A 3MGCA 2F8MA 1UPTA 2OA0A 3E3AA 1CDDA 3GT4A 2BYTA 2QTMA 4P31A 2DWOA 2ZYSA 4PNPA 3LPNA 3VVLA 4PYLA 1E9DA 2EP7A 2XNKA 3UXMA 4FHGA 4QQFA 2DWUA 3DAYA 1YI2Z 1PV4A 4C4SA 4FZ5A 5EP4A 4ZHQA 4Z1MD 3OOEA 2QTGA 2YMMA 3NOXA 1UBHS 2VRNA 3FJOA 3WX0A 5TY0A 3SZ3A 3AJDA 4ZEVA 5JSFA 1P0MA 1P2BA 2OK8A 3MUEA 4QICA 3OIGA 2G72A 3PL5A 5A2Qb 1X9HA 1QCSA 5BN4B 4BKQA 3LCVB 4BDTA 3ZDDA 1Y34E 1LV7A 1UT8A 3EG9B 3S1NI 4PGFA 2FGKA 1RZVA 3SR4A 3Q5GA 2ZYVX 3KVRA 2CB0A 2I80A 3N6RA 5GJVC 1ZXXA 2JEZA 3OJLA 3MF4A 4J43A 2FAXA 1ARZA 1OXBB 2GBCA 1YL5A 4ZN6A 2D8MA 1D1SA 2DTEA 4K9RA 2G9QA 3CZCA 1VHJA 4EA6A 4E94A 4EA8A 3LUGA 2B0JA 2BFFA 4LXHA 3N8KA 3W3AD 3ZZUA 3PQ4A 1E3DA 1K75A 2N46A 3BCHA 1I7LA 3R9XB 2OK7A 4JH0A 3X43A 4QC2A 5A5GA 1V9CA 1RKUA 2AOWA 2XCOA 3IOEA 1QM5A 5HZKA 1ZJWA 2QP9X 2GN9A 4G8DA 5B4UA 2ZAMA 1YV9A 4C0KA 5FWNA 3HKCB 3K16A 3JAWA 4JP7A 3I4LA 4L48A 4TL7A 4AP6A 2OFWA 1O6GA 4D0RA 1BXRB 1YDFA 3L01A 1ZU5A 1CJCA 1GQFA 4YJ2A 1I6KA 5CG2A 4D7AA 4Y7NI 3L1KA 3EC2A 3W8EA 5ISMA 1OOEA 1H1LB 4RZ3A 4JOQA 1MGOA 3WFIA 1RLJA 1EYZA 1PKXA 3PFHA 1X1DA 3WS7A 5K8UA 3STVA 4REMA 1MJFA 4CM4B 2NZXA 4Q3AA 3A4LA 4TMTA 2ONJA 1J2JA 4Z99A 2NUTA 4EHIA 4JP6A 1ETUA 2FLWA 2B3TA 4OK5A 1K8YB 1ZUNA 3ZE6A 1HE4A 5CX4A 3HCFA 4X84A 5JAOA 4QU9A 1VL8A 4I3HA 4XX2A 4XDHA 4P92A 4FVTA 4MZDA 5T8KA 4R5HA 4MR9A 5EVCA 3AVOA 4IHQA 1KE1A 3DV0A 1P1FA 5EZYB 2AMVA 4NNJA 3R76A 4DV6B 3IR6A 3P9ZA 1WSAA 5DHUA 1Z8DA 2O3RA 2XTZA 5IH7A 2G07A 4PYQA 3NBXX 4S3MA 3JAKB 1ESEA 3X1WA 3A05A 1QNFA 2AWNA 4AYBA 4B3XA 4XE5A 3UCFA 2A9RA 2GT1A 2YN2A 2P3SA 4DMHA 1HDGO 4DIDA 4DVGA 1SQ6A 4KSCA 4FFRA 2C0QA 1MXHA 4Q24A 3GGDA 5JZ9A 3FWHA 3CEPB 1QWSA 3AESA 4LVOA 5CPFA 4KO3S 5ULLA 4BYGA 2PICA 1KJQA 4NSNA 2EX4A 3ZKWA 5HP4A 1PO7A 1XYVA 3HABA 4A6PA 4UE2A 1WZCA 3FA2A 1XRLA 4EZEA 1E4YA 2QLTA 4R1MA 5BWLA 2E37A 3C2QA 5ICFA 4HEJA 2EG9A 3ETNA 1HE1C 1Z68A 3WGJA 1ICIA 3PUZA 1C0PA 3TQIA 3ZGNA 5AVUA 4FE4A 1PJ2A 3O1HB 1U1FA 3SYRA 2P3QA 4NBGA 1R4NA 3AZOA 1LLUA 4A0QA 2IDMA 2NO6A 1Q7GA 1K86A 1ZH4A 3H5NA 1JBEA 2AZMA 5FA6A 1JNXX 5HW0A 1J1UA 4Q48A 1RQRA 4XTCS 3WBBA 4CCWA 4L2IA 1AHNA 4FCVA 1QIJA 4HDNA 1DKOA 3R0QA 4KMMA 3GT3A 1J8MF 2GFIA 2PQMA 3CPSA 1Z5PA 3PNLA 5C52B 3RYCB 4GGPA 4OM8A 1DWOA 2B5VA 2PMKA 1V1JA 5JZSA 3RVDA 1FX1A 2RKWA 1NOIA 3F6EX 3GLHA 2C3PA 1XCBA 4RD6A 4WLVA 1IMOA 4YAFA 3KJFA 1S1MA 1DLIA 3ITEA 2YHSA 3M83A 4E4TA 4OH7A 5IVKA 3GTJI 1QYWA 4D74A 5JAPA 1Y5MA 2EATA 1JKXA 2W2OA 1GKLA 4IDCA 1GAQA 3F90A 1G9SA 2Y0PA 4JLNA 2APJA 4J0IA 2QVGA 5EXTA 3F3FC 4CTOA 2ZBGA 4AO7A 1WDTA 2GI4A 1G8GA 3C3WA 1M34E 1KPHA 5FTNA 3RBVA 2A5JA 3OT4A 2W58A 4FNMA 4UVIA 4Y18A 3PJEA 1XRPA 4LZAA 2WYWA 4FFSA 4RZXA 4QOIA 3ZY5A 5JASA 4MB2A 4QGGA 1D3AA 2JPDA 4X7BA 5KNLA 2ERCA 2ZBUA 3SS9X 3SVLA 2HQSA 2R1VA 1XVLA 2OP0A 5IJ9A 1QVRA 1D7OA 2YUTA 2ZBQA 4UOZA 4N5NA 2PTGA 3A26A 1EWYA 4GEGA 2HSJA 1TVEA 2Z57A 4QXRA 4AKSA 1N5LA 2BEUA 4CMJA 1N6NA 3GDGA 2YY7A 3NHUA 4TKLA 4L22A 3ENZA 5EXSA 3U3ZA 1CPYA 3R23A 5AUQA 3O8DA 1DDGA 2IK8A 4BIIA 1DC8A 1TIPA 1TW2A 2EJBA 1QK5A 4B7AA 2I99A 3G1WA 4ND3A 4KXYA 4BFCA 4ARZB 1FMFA 2C7BA 3L82B 5CH8A 2IYQA 3N2GA 4LJLA 5E9JA 1VPWA 5DGTA 4WW0A 2CVZA 5JVDF 4ITVA 3ISVA 1TWFI 1I24A 2CLHB 3F97A 3R41A 2I4OA 4PLWA 4RV4A 5HMMA 5KEIA 4HGQA 4M9CA 3CRW1 3NKVA 3ZVRA 4BN0A 5GADl 1ML4A 2R5NA 1JHMA 4ZEOA 5DHRA 1J0XO 1KO7A 2C1EA 5AN9F 3MK31 3TL3A 2AFIE 4YUWA 2H11A 1VQKZ 1QIKA 2QEXZ 1R18A 1YSCA 1OR8A 1NW8A 3ENGA 2P9HA 4E6PA 1CEXA 2HHAA 4I5IA 3REQB 4LDQA 1PGOA 4UD2A 3H6HA 4RH3A 3LWZA 3TIWA 1H6AA 3BGIA 4R8SA 5JAMA 4TLMB 4ZT6A 1NW6A 2BJOA 3RG2A 5EJ6A 1HXHA 3CGWA 3KOMA 2ZYAA 5KNBD 4MQLA 1TM3E 3NC0C 1QXSA 1SKUA 1W6UA 1TYAE 3OZVA 3R6WA 4DJJA 3GN2A 4IQ8A 5CDUA 3E9NA 4MRSA 2EXXA 2TMDA 1U2PA 1S3FA 1V3UA 4X6LA 3TEJA 2XMGA 5KX5A 2EBHX 3K1ZA 1Q3KA 3T4EA 1E58A 4B32A 1VE5A 4QG7A 3IBYA 2M98A 5FUBA 4IFEA 2OTCA 5LZ4A 4M36A 3GJSA 3FSEA 1CB0A 1P2UA 4L8YA 3KOUA 3BGDA 2Q62A 1KEPA 4RSMA 5FNVB 4F6RA 2GKSA 1I1HA 5KX5F 1FS4A 4DDWA 4NBFA 4Q9LA 2HF8A 3URMA 4YCCA 4N3AA 1ZGGA 2V65A 3FLBA 1T3GA 4LTDA 2M48A 1UOOA 1OGYA 2O5RA 1U98A 4P3YA 3M3DA 3ZDEA 3ILYA 3D3WB 3PVZA 4IP0A 3ZY3A 4CEJA 2YASA 3EUEA 1KK0A 3X2EA 1KL7A 2NNLD 2PT7A 3FNQA 4Q6BA 2QLJA 3JQFA 3EPRA 1OYYA 1AMOA 1WLFA 5FPKA 3C74A 4OJYA 4FW9A 1N36B 2FWAA 1IQPA 4DSAA 1E3QA 2P5TB 5H9WA 5JLJA 3U4GA 3THYA 1CR0A 3Q0TA 3HO8A 3TG2A 1INLA 4IH1A 4DCNA 2SICE 2OBNA 3VZCA 4YIHA 1UOPA 2P2LA 3ZE8A 2Z2XA 1I7PA 4DDHA 2CNKA 1PQFA 2H4HA 5FFFA 2OAQ1 3B6MA 3EHEA 3VOAA 4BLTA 1V48A 5K03A 4HNVA 3CSSA 4MWCA 4D3DA 1QP7A 2WQ6A 3OSUA 4TS1A 1NXPA 3VX4A 4EITA 4I50A 1JG2A 5BN3A 5ELMA 4PX9A 5FOTA 2IYRA 5GLFA 3AJRA 4N41A 1FP7A 1EBUA 4LXXA 2VZLA 1N2CE 3M3GA 1M0TA 3M5WA 1BW4A 2QR2A 3OLCX 4P86A 3RNLA 1VL6A 3KQNA 1T1RA 1CQIB 5LQDA 3T5AA 4IIHA 1EUZA 4I50F 3BHNA 3WGLA 1X1SA 2NO5A 2XQKA 1WEKA 4OXRA 4TKUB 5AKGA 1NQOA 5C44I 1ZCZA 2HK9A 2GWRA 3AL2A 4X24A 1AKNA 1BGXT 4IVNA 5FNZA 2HJGA 3E8MA 4C4TA 2AR0A 3JXEA 3UTDA 1A8QA 3AKYA 2JIZD 4IKPA 3CUYA 3WO1A 3IQWA 2E21A 3HVKA 3N0RA 3ZH2A 1J2YA 5ES4B 1CU1A 1A5ZA 1M2KA 2UZAA 2OTLZ 3W5DA 3L05A 1LBIA 1N3YA 3CT6A 1LPAB 1Q2XA 3TUIC 3AF6A 3ZQ4A 1P6UA 2HKIA 1A1SA 1ODIA 4V0SA 4D98A 3S8MA 3O26A 5L3QA 3NR2A 2C2WA 4E2WA 4C0HA 5FULA 5COQA 5C4XI 2A0WA 1HG1A 2R5WA 3LP5A 5EOVA 3ZV6A 1JR6A 4NYMR 1E20A 4MYTA 1JEOA 3JQRA 2H2IA 4Q9IA 3P9SA 1GVHA 1U28A 3P9KA 4JY7A 3KQUA 4NWIA 5BY2A 1AUPA 4CF6A 3E61A 4MA0A 2LXNA 5IT0A 3DJYA 1OX6A 2JVKA 1QPBA 3IUQA 4Q3DA 4TS4A 5GZ6A 3NWJA 4M0UA 4I4TA 4UASA 4M9QA 4K26A 1WSDA 1S2IA 1WCWA 5IBRA 4FILA 4O8ZA 3I28A 5IDVA 1U4SA 5ITWA 4Z51A 1E3SA 1Z2CA 4E08A 3RC8A 4U8HA 4UTOA 4UU8A 4B4DA 1O5TA 5FTMA 4HEQA 3GEPA 3RJ5A 1VBMA 3LW8A 1XTRA 1KZYC 2EOAA 2ZJ2A 1OFVA 3JYNA 2XHEA 4I4TF 2HRDA 4JI6B 4I81A 1H2YA 1RXCA 2GD1O 3DMDA 1MO4A 2PKYX 2YV3A 3F6CA 3NO4A 2WYVA 4HAYA 2FEXA 1L4GA 1OSNA 3DT6A 3MELA 4HWKA 4QTYA 3FVWA 2AFHB 2XGGA 1XG5A 2LW7A 3THYB 2VJYA 1LBEA 1TVKB 2C2YA 1XELA 1U3TA 2MSNA 4QE3A 1EVEA 2PXAA 1GGKA 3E9MA 3EFOA 3L7KA 5H7XA 2RPRA 3TM7B 1VJGA 3ZV3A 4JZYA 3MXTA 7MHTA 1XZGA 5AHKA 2C2GA 1P81A 2OO5A 4A9AA 4KACA 3RTBA 2E4VA 4QFDA 1E8NA 1ONOA 3B36A 1A9YA 4TXLA 3FOZA 2G1KA 2F4VB 5JEEA 1BE8A 3D8TA 2IOYA 3CH5A 4PV7A 1ZXBA 5FPTA 1OT5A 4PLCA 2WUEA 2IIPA 3KYBA 1R5BA 3ZBTA 2JFNA 1LA2A 3H2SA 4BJHB 3PUYA 3BFJA 1TFIA 1DAHA 3HG7A 1RLUA 4Q9NA 1Z47A 3H0GI 1MPTA 4J07A 3VDMA 3D64A 3VTZA 2L19A 1AN9A 1TFRA 4WXHA 3GZJA 2CJYA 3CSUA 3JVIA 4JKYA 1BWQA 2VSNA 4PGAA 5DX8A 4EO7A 3F3YA 4P54A 5BNZA 4NAHA 3DFKA 3CVUA 1GAWA 3RD5A 1ID8A 3EXHC 2BTOA 4R01A 1P1CA 3FDFA 4M55A 2E2HA 1WB4A 2P9JA 1HH4A 1NC3A 2QI9F 4NK5A 1C7EA 3X2KA 2ZVDA 3QKIA 4GXQA 2D1FA 4OHKA 5IANA 2Q5QA 1ZU4A 1HQKA 3DR5A 2XTJA 3DZIA 5EFZA 5KCZA 2Q50A 3C43A 3MGBA 4TSFD 2OG2A 4OXQA 3HLTA 3ZWCA 5CGQB 4AU1A 1TOAA 2GF2A 3AVWA 3VR5D 1EFKA 3AHFA 3QSGA 5DKFA 3MJVA 3J81k 3RTAA 1JLMA 1CD5A 3USZA 2YZ7A 1BCSA 1IDN1 2ATXA 5JH7F 1QIHA 3DEFA 4L5CA 1F14A 4NG5A 2R11A 3DKIA 3KB2A 3NANA 2AKAB 3UGKA 2FXIA 4NTZA 4QARA 4A23A 4YMWA 3U26A 2P28A 3INGA 2V8IA 4ER6A 4G41A 3H5RA 5D7NA 3VNVA 3U7IA 3PEYA 5MN5A 1RM3A 3M5DA 4D0LB 2FOXA 1NI5A 1NW9B 5IXJA 1YS2X 1M6NA 5EZQA 1QIEA 1Q2UA 1KARA 3T15A 1M72A 4RJ2A 2IPXA 3QUTA 5T5QA 4YGYA 1RXSA 2JI7A 2V9CA 4V2IA 4LF8B 4CFZA 3MBIA 3IQEA 1D1QA 1FXWA 1JT9A 1U7PA 3TLEA 1VL2A 3RVLA 4A2QA 3KETA 2CXOA 4B6PA 2GM3A 2OCYC 1K9M2 2HCBA 1RYYA 4X1KA 2CFTA 4DBLE 2DHEA 4F2DA 4B2LA 1TJ5A 3TE7A 3TAXA 3EVDA 2HZBA 1RTTA 2XR1A 1RWVA 3C1UA 4RVGA 3HA2A 3OPXA 1GUBA 2H2WA 3R77A 2JFUA 5EIWA 4W9RA 1NQVA 2IBSA 2BBWA 1WXDA 2XWSA 5A1JA 2D7JA 4U3JB 1K8QA 4YAEA 4CCYB 1V1MA 1DAFA 2QPLA 1FDVA 2JMOA 3L7DA 2DEUA 4KX5A 4U6QA 3VYSB 3VDNB 4OO3A 2Z6VA 1CC1S 4PHHA 3RRFA 2NIPA 4B6SA 1PEKE 1U2DA 3GFTA 1MAUA 1ZIXA 2A78A 3B7GA 2V4UA 1PGQA 2J59A 4QGBA 3KZCA 1DWQA 1ENOA 1WVGA 1WZ2A 3K0CA 4BZWA 3N2EA 1SA0A 1WU7A 4N3GA 2VP3A 4FN4A 2ZI9A 3UPUA 2WMNB 3PD1A 1BD4A 1BGVA 5FUMA 4RDCA 1DUIA 5LA6B 3TZCA 1ZUWA 3UMMA 2ZCJA 2ADFA 2JS4A 3GA0A 3LKDA 4ERNA 3VKHA 2JZCA 2I03A 2P4EA 3IC5A 1V1RA 4HB2A 5DW0A 2DUJA 3FDXA 1JXQA 1MVOA 1DRVA 2B2CA 2XSZA 2XQGA 3DFFA 2BR4A 4KXVA 4RCVA 5DWVA 4ARBA 2LNDA 2AJLI 1Y8RB 1EG7A 1OLXA 2FW0A 3GVXA 4HN2A 4RDHA 4V0KA 5LP6A 2VQFB 1BQ3A 4WL0A 1Y3DE 5KYUB 3TLJA 3UAWA 2HRRA 1H66A 5KTSA 2ODTX 4E7PA 3QPCA 4JI1B 3G2QA 4TXJA 1LW6E 1VJCA 1BHQ1 2G25A 3FXAA 3AUXA 1Y6ZA 1P5RA 1DXOA 4P1ZA 4M9XA 5DTJA 4C7MA 4GGOA 3T1HB 1CLEA 4IWYA 5LP6F 2YJ6A 2VA8A 3LLCA 4AY2A 2HAEA 1NTOA 2HSEA 3FNIA 4I1YA 4IIDA 4HQLA 2NUPB 3R6LA 5ADVA 2QXUA 3A4VA 2GZ1A 2KWIA 2QJOA 4MKIA 3C85A 3SQLA 3HXPA 4J0HA 1ISRA 2XGOA 3GTOI 1JFVA 2O0LA 1U5CA 3NHWA 3NB0A 4L7VA 1CF9A 2BGMA 1IUKA 4W5WA 4ZALA 2VUIB 3IPYA 4NQRA 1PU2A 5HTOA 3C3KA 1G8JA 2GZMA 2VC2B 3OIWA 3UC5A 3SC2B 1MGPA 3LV8A 3WKCA 4W1PA 4MUKA 3HJTA 4PBSA 5LIPA 1L7PA 7REQA 3O8OB 2CEAA 3RTCA 4X1IA 3V1NA 4CMAA 4Z54A 5AVZA 5K0ZA 4XSHA 1ISFA 5I45A 4AQDA 4NG4A 5EWMB 2VJMA 1K8A1 2V5VA 2A9QA 5JS7A 1DQNA 5C0OE 1R3DA 1GG9A 2ACEA 3NTXA 3PC6A 3T3PB 4A8HA 3EA5A 4N1AA 1JG1A 2HMSA 4B6OA 3I6ZA 1QQAA 3WTCA 5IBCA 4IEFB 1OWPA 1NDHA 2OAP1 3CZPA 3IMFA 2Z6QA 1H8HD 2I34A 2YHBA 3GNQA 4CUZA 2FRDC 4ATNA 4GOKA 4L5JA 2KI7B 3NI2A 3QF7A 4K6KA 2F1OA 3JATB 3S15I 2ZSFA 3V97A 4K9NA 3GK3A 4KO8A 3DKVA 3AXTA 3H04A 1KDZA 3LKVA 4ALKA 3IIMA 3TLGB 2QMZA 4NVRA 1HE5A 2WNIA 4PXAA 2PM9A 1TQ4A 2D5CA 2PA3A 2X9GA 3L7CA 5F73A 4RZUA 2WLTA 2DR2A 1W0KD 4YY3B 1T35A 4OV6B 3L7LA 4PO9A 2NU8A 3F4KA 3ROKA 5TGDA 1ZL0A 2I66A 3TBHA 1EQAA 5HEKA 5KNDD 4PG6A 2FLVA 1LXCA 1KS9A 1NBMD 2J5KA 2R6AA 3AF4A 2FN3A 3P9IA 4ENUA 1GYPA 3R3HA 1CDZA 1V11A 3L07A 4KXUA 1K6IA 1X8XA 1RO2A 3R8CA 5BR7A 4Q9JA 1XIVA 4G26A 1OHHA 2FUCA 2NO9A 3MRSA 1ZZGA 4D02A 2A59A 4DJ5X 3G4S1 6AT1A 2BEWB 3K09C 3G6KA 4QASA 1Q74A 1GGMA 3ETGA 1TFUA 1U8CB 4W5RA 2DBYA 3GLGA 5EJIA 4OP1A 3GJQA 4I1VA 5EUCA 4UEWA 3SLRA 4JT4A 3VYRB 3QWHA 3MMXA 4CKWA 3VNUA 1M8GA 1QH8A 3ZHSA 1U5BB 2C77A 1T2DA 1HNZB 1CE8A 3CCBA 2B69A 4C6TA 2JLQA 1E2BA 3UY4A 1R9JA 3T4NB 3KQYA 1YUNA 3QKTA 3EIHA 3L7NA 3FFBA 2CFCA 1N3BA 2Y92A 4WERA 1TD1A 2V55B 1YNND 1G19A 3LX6A 3UJ8A 2FJ0A 3U7HB 1C8BA 4LYJA 1MO2A 4E3ZA 1NI4B 2WFLB 2W2TA 3GFPA 2ZRKA 3CINA 3AY6A 5BW6B 3PVSA 1N8KA 2HDNB 2HLPA 2OCAA 3PTAA 2LKCA 1DTEA 2O7VA 4Y2HA 4PNHA 1YR7A 3MLAA 4RXTA 3I9V1 1BTOA 4UM8B 1Y8QB 1Y6JA 2XNDD 1U0JA 2CD9A 3CF0A 1RJWA 1VIDA 1L1FA 2ONZA 3NONA 3P5JB 3HYCA 3MGGA 2VYQA 1VRCA 2D62A 2C2OA 2AOUB 2I4RA 1OI7A 1T13A 1ZN7A 1V5WA 2JBWA 2YIDA 4I1UA 4E2ZA 4KDIA 2F43A 2NT4A 1RKXA 2R8EA 3I0NA 1UBKS 3IOBA 5A6SB 5HZGA 3WG9A 1X0TA 3FPHA 1WCMI 2B21A 4U7HA 4F45A 4IF6A 3N2ZB 1GUDA 2GOYA 5JU6A 2PSSA 3G2PA 2C7VA 3KT8A 3L6DA 3EXG2 3SGLA 3QE9Y 5T6BA 1VQ1A 3N76A 1RO0A 1GR1A 2NTEA 2G04A 3FDZB 4P35A 2HOQA 2RG1A 3DOCA 3OJXA 3A1UA 4OKSA 5A9TA 3WGUA 1TQ8A 2C8LA 1IEWA 1Z0IA 1IM5A 3I01A