2IV2X

Reinterpretation of reduced form of formate dehydrogenase h from e. coli
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
715
structure length
697
Chain Sequence
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Formate-Reduced E. Coli Formate Dehydrogenase H: The Reinterpretation of the Crystal Structure Suggests a New Reaction Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Formate dehydrogenase H
total genus 253
structure length 697
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00384 Molybdopterin Molybdopterin oxidoreductase
X PF01568 Molydop_binding Molydopterin dinucleotide binding domain
X PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 2iv2X01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2iv2X04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2iv2X02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 2iv2X03
2B63A 3PLXB 3GTLA 1DMRA 1CZ4A 3HU1A 2VPYA 1E18A 1Q16A 2V45A 1QCSA 2PMZA 1E61A 3CF2A 3CQZA 3FKIA 3TM7B 3GTGA 1H5NA 1OGYA 1PT0A 1UHEA 4AZDA 3HU3A 4CRYG 4KDIA 1TWHA 1Y1VA 1R9TA 1TWCA 2R92A 1QDNA 1PPYA 1H0HA 1FDOA 1E60A 2EEOB 2YU9A 1KQGA 2Y0SA 1IW7D 4AYBA 1G8JA 2PJHB 2IV2X 1TWFA 3QQ7A 1I50A 3HKZA 2WB1A 2VPWA 2E7ZA 2DMRA 2JIMA 3QQ8A 1AW8B 1PT1A 4KLNA 5GLFA 4AOKB 5FTNA 1I3QA 4CRZA 1VC3B 2IVFA 3DMRA 2JA6A 3IR6A 1Y4ZA 5C18A 1AA6A 1EU1A 1PQFA 2E2IA 4KO8A 5FTMA 3QWZA 2VUMA 1KQFA 1G8KA 1Y5IA 4KODA 2E2HA 1SFOA 3GTJA 4QIWA 5FTJA 3GTOA 3OUGA 2NVXA 2JA7A 4GA5A 1WCMA 4AONB 2R93A 2NAPA 1CZ5A 1R7RA 1TWAA 1PQHA 2JIOA 1DMSA 4AAYA 4RV0A 3GTQA 3HU2A 3H0GA 2WAQA 3ML1A 5FTKA 1K83A 2R7ZA 1E5VA 1CR5A 1Y1WA 1TMOA 2V3VA 3QC8A 5EPPA 5FTLA 4KDLA 1R27A 4D7ZB 5B6CA 3IR7A 4GA6A 2JA5A 2JIRA 5C1BA 1S3SA 3GTKA 1FDIA 2KI8A 2JIPA 2NYAA 4CS0A 1YLEA 3TIWA 4C2MA 1PYQA 5T5MD 2VPZA 3O5AA 2NVYA 2C45A 1UHDA 2VPXA 1E32A 1PYUB 5DYIA 3GTPA 3IR5A 2JIQA 3GTMA 1SIWA 1TWGA 4DMRA 1PQEA 5T5ID 5DYGA 1WLFA
chains in the Genus database with same CATH superfamily
4L5CA 3AR3A 5C4GB 1SXHA 2FWMX 4AMVA 4OUKX 4CEHA 1M74A 2ZYTX 1K7XB 1ZNWA 3MB5A 4UTPA 1T4CA 4Z0TA 5LYJA 1QGDA 3BL8A 2FI1A 3AL3A 1G66A 1HPLA 1SXIA 1XZAA 3IEXA 3S7ZA 4BNLA 3IVCA 1R10A 2H31A 1OGYA 4XH9B 1HDGO 2FEOA 2PI8A 1A9XB 2FG6C 1KDZA 3ZTWA 3V2GA 5KX5F 5AW3A 5LXTA 2AG8A 2EJCA 2YMLA 4JV5B 2ZTMA 1KJZA 4XCQA 1WTAA 1YR8A 2YWBA 3RG8A 4Z53A 4OREX 4K0KB 4LYYA 2PSJA 4MWZA 4L5BA 2VH5R 5LBUA 2ZYGA 2Q8QA 5CHEA 3EA4A 4A15A 5I9TA 1E0DA 3U2QA 1LK0A 2Q0SA 4JNKA 3OM0A 5HPYB 2DH6A 3DYIA 3A2NA 2EHJA 1XOIA 4LVOA 4Z3DA 2PGAA 3JQQA 2AXPA 1D7AA 2OOYB 3GIWA 5K99A 5LKAA 4QBFA 4BNGA 2BFBA 2W37A 1AXGA 5AW8A 2CWWA 2VWGA 2CHFA 4S1VA 1SUPA 1N2CE 3ORFA 5AKYA 3T0FA 4MR8B 1AA9A 3FTDA 1W34A 3R7WA 2FEPA 1DE0A 1QHHB 4YRGA 2ZRLA 4B31A 4D44A 5JVDB 2P9QA 4C3ZA 3T95A 3C14C 4CQJA 5KREA 1Z5NA 2CXOA 1IJEA 1XTQA 2DU8A 3JAMf 3JR3A 4G89A 5IAKA 3BWYA 2XCOA 3T1TA 4NEQA 3T3MB 4AXXA 2ZSFA 1NX9A 1JR3D 3PX3A 4NECA 3LPLA 1UC5B 1O97C 3GGSA 2B36A 4QXMA 4RGYA 2FQXA 3UAWA 1T2NA 3ZWOA 5AIBA 1XMOB 4NBTA 1KJ9A 1DO2A 3ELBA 4IKPA 5IJXA 5JSYA 4RVNA 3EUWA 3BCRA 4HEA1 2GU2A 3DWIA 4K8RB 4DCNA 1C1DB 3IDQA 4BMOB 5JQGB 3HPQA 1WC2A 2BTQA 3F71A 3OF2A 2ZJ4A 3KPYA 1ZN2A 4MV6A 4LGCA 5AKHA 1Q22A 4ARBA 3GU3A 5F33A 3V6LA 4XVUA 4EO9A 3DVSX 5B55A 1MIOA 3CKKA 3EAGA 2QSYA 3VMFA 2OXTA 3A1VA 1U9JA 1ZNXA 3KFXA 3A58B 4TQ9A 4ZQBA 3UWDA 1GKKA 4KPFC 2FMTA 1K63A 1QTRA 3TR5A 4JXKA 1N6LA 1Y4AE 2UUAB 1KFJB 1E5VA 4FIZA 3LUHA 3AUUA 4M9XA 3SXJA 4A8JA 4EUNA 3VU8A 5C44I 3Q87B 4EKNB 5CB0A 1TECE 3WGKA 2IYYA 4YR7A 2QG4A 4BZXA 5C37A 3VBEA 3I30X 3SQXA 1AV7A 3I2JA 1NUIA 1Z33A 4KQMA 3G9TA 4TUYA 1HMPA 5FULA 5IT4A 3V1UA 3LMKA 4MITA 4CS0A 2JJYA 1IEQA 2JHFA 3BM5A 2VAXA 4WKOA 2H7VA 3JRXA 3L3BA 4B3JA 1K88A 4TTPA 3VDQA 2GBGA 1UZMA 3L1IA 1NVDA 1V45E 3JQ9C 4RNCA 2C2OA 4BVBA 3CF0A 1JIVA 4FHCA 4QECA 4BBZA 5J4KA 4TM7A 5DKFA 3I12A 4KXVA 4DMMA 2NO1A 2C0PA 2YZKA 2HO5A 3W77A 1PYUB 2YH2A 3L8MA 4PU0A 5H68A 4HDSA 1W96A 1ESCA 2YHUA 2YY6A 3B1KA 1MZPA 3DE1X 3RU7A 1L7QA 1Z5GA 5TDHA 4BP1A 1XZBA 3OFNA 1F48A 3D5EA 3UMRA 3SHQA 2Q1YA 1ZS9A 2P8SA 2XZTA 1KZ9A 2P9CA 3EGVA 5G02A 2G2KA 1A9XA 2RH5A 1RJDA 5CDYA 3WGOA 3M3YI 1JFFB 4CTNA 3E05A 4CCAA 2ZAEB 2GVDC 3ZDEA 2IV7A 4HWTA 2B9EA 3ITKA 3RSOA 2O0LA 3T94A 2AV6A 3UWKA 4NHEA 1DU4A 2JI8A 1CUHA 4G56A 4M0DA 2ODTX 1E3WB 4KSYA 4YB8A 3JS5A 1GZHB 1Z7EA 3GGPA 4BDSA 3UBTA 4AKIA 4IDNA 2RHRA 3AF2A 4MKXA 3F1LA 1C1DA 1FNBA 1L5VA 2OCAA 5H3HA 2QRDB 3GFQA 4DV1B 3MWYW 4CTKA 1NQWA 4BJ5A 3U7HB 1PQUA 3RK0A 2FRDA 2DUUA 1WPRA 1R12A 3BXEA 5JPDA 1GNLA 2H51A 1ZN9A 2YWCA 4IDAA 3PFIA 1QR2A 2J3LA 4FFBA 4UDXX 1F0KA 3NTVA 4MI6A 4ZVQA 1ZKDA 4JLWA 2IV2X 2IGBA 1SKBA 3R3HA 4L0DA 4KZPA 4YP1A 4MYTA 5KYUB 3THYB 4IHAA 5E4YA 3OT1B 1CV2A 5JAIA 3CGWA 4GM1A 1LDYA 3MRXA 3ZV6A 2AWOA 1C7FA 2GCPA 4D57A 4A3CI 2G9RA 2BCJQ 5WRFA 4Q4DA 4RPLA 1E2LA 2WTEA 4I3HA 4N03A 1SFOI 4Y6OA 4YQFA 1KWGA 3GQBA 1H6BA 4CEJB 3SS7X 3HCFA 3HR4A 3TN7A 3VR5H 3AESA 4F4FA 2H5JA 3UJHA 5L7WA 3C3MA 2QTLA 4BMXA 5B1EA 3QVJA 5E7JA 1CJBA 1CE8B 2G7MC 3KUXA 4B6SA 1DTSA 1Y8RA 2C5HA 1ZUIA 2HJHA 4XTRA 1JA1A 5TQJA 2HFKA 2L2QA 5KYXA 3T06B 1HLGA 2Y9MB 3PEVA 3ESWA 1VQMZ 2GFHA 3EAQA 3ENVA 4L5IA 1UFQA 4EY7A 3W9UA 1TX4B 4EVSA 1N2GA 3GTOA 2D06A 2GXUA 1JDVA 1JQ5A 4Z7QB 3NGXA 3EJ6A 5B4VA 1KOGA 5ED0A 4Q66C 1PUXA 2JFYA 4IUYA 1YQDA 1X2EA 3SE0A 3U26A 3ZV4A 2Q0HA 1C7ZA 3W6ZA 1V1MB 3FSGA 4X95A 3RLFA 2NZXA 4LOIA 2I87A 1REQA 4AO8A 5EKXA 4YGYA 2FVYA 3V5NA 2B7LA 2R62A 4F1JA 2DXIA 1DPFA 4P7BA 3UJ8A 2ZSDA 3CH5A 1C2TA 3TEFA 2YNMC 4NV0A 5AYVA 2JGKA 4DSZA 1N2FA 5B6CA 4G0ZA 1PS0A 1ZK3A 4OB7A 4YN3A 1BZYA 1Z6TA 2I3GA 4F46A 4OI0A 3GTKA 2AK2A 4HX2A 4Z1MA 4G1MB 2FR1A 1E2EA 1WIWA 4GWLA 3VRHA 4EEZA 2D5IA 4ZIRB 3C3CA 2YBDA 2H52A 4BY7I 2F59A 2XCIA 1N9GA 2V8BA 2VZEA 4I4LA 4WOPA 3PEWA 2VWHA 4R2JA 3AIIA 5C7YA 5I7UA 1J5EB 5FB3A 2O7NA 4LE1A 2AFIE 7MHTA 3G2HA 1QZUA 1TMYA 2EQ5A 1ZJJA 4UNPA 3MWEB 1JQ3A 4GBMA 3QJYA 2O3SA 2IHJA 1UDCA 4GP6A 1U3DA 1MB4A 3QGMA 1U3FA 3W3AA 5FHRA 2V98A 2IZ3A 2FKNA 2ZB2A 1ZM4A 2IP1A 5K6AA 1X7YA 1RSZA 3KIHA 4O5AA 1DTEA 4HDMB 2VPYA 3X2NA 2MJLA 3JQAA 4G9EA 1B2RA 2JD2A 3HLKA 3PIRA 3FPEA 1JALA 4IIFA 1ILWA 4WERA 3U40A 1B6GA 1FRQA 2Y1XA 2ISQA 5JDIC 1FJXA 2OZVA 4AURA 1XEXB 3KU1A 2GO7A 1C50A 3RS7A 5JH7A 4Q1VA 5TLSA 2BM0A 3Q15C 3HKEB 2ZIGA 4L0CA 3HGMA 1JFLA 3I4MI 2OOKA 4BLVA 3BXGA 1SOVA 1HE1C 4EARA 1IUKA 2WHQA 4JJOA 2YJ4A 1W6RA 4KQIA 4LYHA 2IS1A 2AMVA 2C92A 3RUHA 2FP4B 1U1EA 1SHZA 1RWKA 1AQLA 4MD7A 1BRMA 3GNSA 3GQBB 4CUKA 1UWKA 1GGKA 3CCFA 5DEOA 4JXXA 4N3GA 4KO4S 3R4VA 1UKYA 4HNSA 4EI8A 2HJSA 3NEPX 4OV6B 1SVOA 3ZW8A 1S721 3NDJA 1NP6A 4D3DA 4A82A 4C0SA 3PX7A 1V7PC 4GSYA 4NK4A 3C7CB 1JLMA 2VNKA 5K0JA 5AFSA 1KSGA 4DY4A 3NHZA 1IN5A 1N8SA 2XX3A 2QKYA 4QTZA 1MPXA 3M70A 3OZUA 2IEYA 3I4CA 5DYWA 1FSFA 1VE9A 4BMNA 3U6BA 1EJ2A 3LAWA 5FBLB 3EXHB 3UH0A 1DXYA 1L5YA 1M2WA 5JZ9A 1ATZA 3FJOA 2B9VA 3D8SA 2BGMA 4MPRA 4FE7A 1PZNA 2A78A 2ZB8A 3FGOA 1V1MA 3AUKA 3NHKA 1JGTA 4WKPA 3O9MA 4BLWA 5LU9A 3TGLA 3MRSA 1UMDB 4DJAA 4MWDA 1Q0ZA 2PTHA 2AFHA 1PR4A 1E0KA 1LRJA 4E2YA 3BBPA 2HMWA 3K0HA 5K0LA 3ODPA 3ZBQA 5B5SA 4N39A 2VHCA 2PM8A 2ZBDA 4IV5A 2Z5LA 1F1JA 3AHDA 3BDAA 1EM8A 1KY4A 3MWDA 3RUDA 2WF8A 1W4AA 2VDKB 1ZJ6A 3HWRA 1BDMA 3KQVA 3P0FA 3A0UA 4GEKA 4NSNA 3S2YA 2Z9DA 2B1GA 3U48A 1GG5A 2YBEA 4H9GA 4QOJA 3ER6A 3F3PC 3A6HA 1RQRA 2ZROA 5K7SA 1AB6A 1MXHA 2V6MA 4B2PA 5LZ2A 1N5OX 5IVIA 3CE6A 1GQSA 2UYYA 4HPJB 4IDQA 5BVHB 3JYHA 1O5OA 3ON5A 1FDIA 5SZJA 4D9FA 2NYAA 2V6JA 4R2LA 2XXAB 1MNAA 2IE0A 3S2GA 5AW2A 3B78A 3BWVA 3D0KA 3OFVA 4AI6A 4XJXA 5I9MA 2FP4A 4BO6A 1E3IA 5BPHA 3FOWA 3VC2A 1EI9A 5AVOA 4R7GA 4L75A 3PHHA 2QA41 3K92A 3I8XA 1EAYA 1W19A 3CNQS 4MYDA 3IIMA 1HO3A 3R7BA 1H3NA 2JA6I 3P96A 2SCUA 3OPYA 2R6CA 1SK8A 3SFTA 1YRYE 5JWRA 1LFAA 2PFKA 2AXQA 5GZ6A 1WCMI 4C7MA 3MPUA 2R1VB 3ZD7A 4E70A 1I5RA 5A9SB 3E84A 1KGSA 3T99A 5E3JA 2A92A 3PGA1 4YRDA 2RGAA 2E4AA 2HQRA 4B8YA 3UJ6A 3ZE7A 4KQHA 3LKDA 5HKBA 1GV0A 3A1WA 2PUAA 4EY5A 4PCUA 1C9KA 2XCLA 2QGZA 3CZRA 3PV0A 1COWA 1P0CA 4GPZA 3QLUA 1YVDA 4ED9A 3QVKA 2CE2X 1MB3A 3T15A 4A8TA 4IJMA 2FR0A 3KJIA 2ZIVB 1H6DA 2QL6A 1BCRB 2DE7A 2C4UA 2H4HA 3DTNA 1CUXA 2I7TA 3SF0A 3PXGA 3DAGA 4Y0NA 5KNCA 1P9OA 1T1GA 4ZT3A 5H1YA 4ND5A 1O4WA 3QUSA 2Y05A 3M89A 4FUQA 4MZDA 1MQSA 1WPGA 3GAMA 4DQKA 1LU9A 4OHCA 1A4XA 4RF2A 2CVFA 3QEBZ 4I1SA 3AR5A 2BRUA 2PS3A 2HMUA 5AJVB 1GADO 4X8HA 2P9TA 3EVZA 1SZDA 1XR3A 3CZAA 1Z5ZA 3ETEA 5KYNA 1FW6A 1Y6ZA 4MYCA 4JS0A 4RHUA 4KRYA 3VB9A 1Z2AA 2LCIA 4B71A 3I45A 2ZI6A 3R40A 1HOXA 4W8GA 3PVCA 1T13A 2Y93A 3Q2IA 1H94A 1P80A 2YN2A 3G9ZA 1HT0A 1LB1B 2HSDA 1NIPA 3M1YA 2HRQA 3DDHA 4MZXA 3KQNA 2XWBF 1KI4A 4MP6A 5F64A 4C0QC 5KNBH 1PS9A 3PLRA 1X7ZA 4GNRA 4CLXA 5EE0A 2EATA 2BF4A 1P7WA 3MYYA 1ADYA 2VDRB 3OJCA 3LXRA 3SI7A 1E9BA 3E9MA 4US0R 3ZDCA 1ZCZA 4ZC1A 1C4WA 4KZKA 4TLMB 2DX7A 4MDYA 3GCWA 3IELA 2QNIA 1EWQA 3RB8A 2CFCA 4NATA 3WY9A 4YJ3A 1UBOS 2VYVD 3NFZA 1OILA 3DDWA 3CMMA 1UT6A 1TFIA 4DY6A 2PIDA 1C3XA 3K5IA 1FRNA 4XYMA 2QIOA 3DSRA 1TEZA 4GXNA 3T52A 2FZKA 3D7KA 4YRKA 2WZDA 3DL0A 1M1ZA 4QTYA 3C8HA 4JUIA 4KQCA 4KDLA 1EFPA 2OBFA 3UO8B 1KZ1A 2LNDA 3T7AA 1KVSA 3VDRA 2KPIA 2AN9A 2CDCA 3G8YA 2LKCA 3EZGA 1BCRA 1D03A 5K0FA 1Y80A 3D2AA 1H8ED 1WL8A 2J0UB 3LUJA 4Q16A 4DNOA 4HVCA 1LS6A 2HIHA 2CLEB 1NHGA 2MIIA 2PGJA 2PK3A 1ZSYA 3NHYA 4KO1S 4XOUA 1R74A 3QKTA 1YKGA 2NVYA 1QQ5A 1W36C 1RIFA 2XXBA 4OAOA 1M2OA 4IIVA 3G49A 1SVSA 1PN3A 4BJ3A 2ZIEA 3C5CA 3I4NI 1MLDA 1PYOA 3KDPA 1GT91 1AV6A 1KMMA 5BYAA 3W34A 4R84A 1GTMA 4A92A 2D0IA 3FUTA 3GPIA 1YQXA 3ESBA 2IZ5A 3GLTA 3GTMA 1W59A 3AEUA 4JR1A 4P7GA 4Q1AA 4XFJA 5KAPA 5DDIP 2IUUA 4EDFA 5KNDH 1XVVA 3C3AA 1RYHA 1O0BA 2V7EA 1Q5PA 2P7IA 4DIUA 2Z9BA 3NWBA 1W44A 1UFOA 1JSZA 4BDTA 5LLDA 1DNPA 2G67A 4MLZA 3VQTA 2GAIA 5JC1A 1IG0A 5DHAA 2EP5A 5I8PA 3DL4A 4GR4A 3SZUA 4BLUA 1ICIA 4Q6WA 2REQB 1ORVA 4UOQA 4ZKEA 4NBDA 3DZHA 2NU8B 3HJAA 3B48A 3ZXIA 2CVOA 3FKSA 4M8NE 3DZJA 4OGFA 5E0KB 1X7ZB 5CDSA 1SUSA 2OBBA 5GY7A 3WISA 5KNDA 3EY4A 2B34A 4A8HA 3S1AB 4DR2B 4OO3A 1PYGA 1HTTA 3WNBA 2FDXA 3WYFA 1PQWA 7MDHA 4DEVA 1VQ8Z 4NZPA 4DLPA 4BO7A 3F3YA 1P29A 3UXEA 3U1BA 4I4NA 1KU6A 2QTNA 4LNAA 1NJ2A 1TQDA 2FW8A 2X41A 3ZWYA 1Y9AA 4U3JA 1Q1AA 2Q6IA 3VYWA 3DVRX 4BQFA 5TS2A 5EWMA 4IO1A 2B8TA 2IA5A 2RIRA 1M2VB 4G8BA 4HDSB 5A4AA 1HX7A 3ANMA 4J7UA 3ASUA 2WT8A 2DE6A 3ZDQA 1IEVA 2BFOA 2J08A 3HOXI 2NPIA 3S16I 3Q7IA 1RMTA 2AE1A 5A4FS 1NI4B 4LCBA 2GYVA 2Y4OA 1A88A 3A1EA 1EP3B 4M8SA 4ZOLF 3S5UA 4US2R 5AOCA 2C3UA 1KH3A 2OKGA 1N6PA 4OP2A 2N46A 4KR3A 2PDAA 4M60A 3F5SA 3WYCA 2I7CA 2C82A 2QTCA 1P2BA 3DV0A 3GBSA 3GJ5A 4TOIA 3EQZA 3OQ6A 5HJ2A 3ZVLA 2Y76A 2P2NA 4CG1A 3T0IA 4DJEC 4GKKB 1TM7E 1R37A 2KS6A 4KLAA 2XD4A 3HRKA 4ZZ1A 5FPHA 3R23A 2V0NA 3TXAA 1QVGZ 4UOZA 1G5RA 2WSYB 1HTBA 1R64A 3AY7A 1SQSA 4K3UA 1G3IA 3ET4A 4MKGA 4TUYF 4REQB 4XVRA 5DI9A 4ZDWA 1BVYF 1X6VA 2WVHA 5DOZA 1SOAA 4J0GA 1WCIB 3SJAA 3HOZI 2EVWX 3ESXA 4URZR 1OQAA 1UWCA 1PQHA 3PGLA 3HB4X 4V0SA 4UC0A 4YO7A 2JLZA 1AQNA 2JD0A 1XZQA 1GAJA 5BNIA 3EEDA 3PDJA 1VYVA 2QVLA 1Z0DA 3BULA 3ZGNA 3KPJA 4YRCA 3L4SO 4YALA 3KQPA 3W2FA 5F4ZA 1NOJA 1X13A 1Y9ZA 2DKOA 2DFTA 3VC3A 4AUKA 2WAXA 3H1FA 4JJZA 1Z6PA 2X8JB 3C5EA 1LPPA 5JS1A 2FN4A 4WNAA 1IHOA 1W48A 1KEVA 3KKZA 3QXCA 3PNQA 3AG5A 3FSEA 3HJCA 1BJTA 4CIYA 1SKYB 3UTCA 3OMWA 5AW4A 3C48A 1XXHA 4BYGA 3AEUB 2HGSA 1V3QE 1SBQA 1ESEA 1GJRA 1W0KD 3I6IA 4YAEA 1ZMOA 4ETMA 2C1XA 2LFUA 5KKCA 3CY6A 1VJCA 1W5AA 3ICCA 4ZEMA 3QVWA 4O2RA 4LZZA 5BV2P 3K09A 4K9PA 5B57C 1BX3A 1VQN1 3NQ41 1Y3HA 5JJLA 5CW2A 4DMRA 4XJSA 3TSYA 1A8IA 1UPXA 4K1XA 4IILA 4NYIQ 3T41A 4A3FI 2B63A 1NJ6A 3DMFA 3MBOA 2V8KA 1FXSA 3REQB 2OHGA 3SQNA 4QUJA 3GG2A 3FWHA 1GVNB 5A0FA 2QLNA 3U3JA 3UMBA 4ASUD 1SUIA 4DLNA 1QHYA 3SS9X 2IL1A 4B3HA 2XB2A 2AMLA 3HPRA 1LTKA 3OJOA 1LSOA 4TLBA 1DJQA 1KEEA 3LVFO 5FWYB 5C80A 1E3DA 2YZMA 1TWHA 2ZWOA 1QC5A 1I7NA 3CFYA 1GSAA 3V00A 4I7EA 5C5IA 2GARA 1YZQA 5IWCA 3S8YA 4EJSC 2CXUA 3LX8A 2ZJOA 2OB2A 1NE7A 3SX4A 5CA0F 1DFIA 1BMQA 1B6SA 1D9XA 2JZOA 5LZ7A 4DLWA 5GLXA 3NBKA 3W5JA 3QBVA 5AVZA 2ZSAA 4MAMA 3ZD8A 2RAVA 1E64A 3L0PA 4DNXA 1RNIA 1MDFA 2ST1A 1R5NA 2HX1A 2JR6A 1Y48E 4B4KA 3SYTA 4AFNA 2C4VA 3MJFA 1T2FA 4O0LA 4FT2A 3IE0A 1CR1A 2RH8A 5GINE 2HCZX 1LBEA 1GZ7A 1VHDA 2RHWA 1SG9A 1GPH1 2EZTA 3L5OA 3SSAA 3UXHA 3R5KA 4RTJA 3TMYA 1L2TA 1XNGA 4C2UA 3B1YA 1U7ZA 3SLGA 4C3OB 5GZ3A 4C88A 2P5UA 2GXAA 5K0ZA 1QDEA 1MZVA 5FDFA 4JAVC 5E6RB 5JVDF 5ALDA 1GXSA 2V54A 2P3YA 3QEAZ 4LF9B 5AIAA 5IAGA 4A9AA 2ZPAA 2GEVA 1YS4A 1M6YA 1YE8A 2WC1A 2XKBA 3GNTA 5KSPA 3R8CA 4B8ZA 4MDEA 4E12A 3FNEA 3JWHA 2ZRCA 4LMAA 1IMJA 4KLCA 4FMBB 1G4HA 1L7EA 2NV6A 1YB7A 4EB0A 4IW3B 1P6QA 2P2GA 3MJ4A 4V2UA 1JDJA 2HN9A 3V8PA 1B6TA 3O94A 4BGDA 3CC41 5IN4A 4BO1A 2WLTA 4OXQA 4XARA 2OA0A 1DBVO 3C3JA 1FP4B 4MXDA 5ECDA 3RBAA 3BGSA 2ZRAA 1S9HA 1HFEL 2Q9CA 1FX1A 2WHYA 4MW7A 4PCVA 2XNKA 1T9GR 2AN3A 4FE3A 3SN6A 3ZHSA 1BS9A 3P4UA 4NU0A 5DLEA 1J90A 1XZEA 1Y6JA 1MVNA 2V6GA 4RIGA 2CCJA 3H1TA 1QU3A 4IR7A 3F7OA 2GF0A 3D6FA 5IBCA 4F9GA 3W9SA 1I4WA 4BYMA 2Q6LA 4BBSI 3PNOA 1N10A 1SBYA 1RVDA 2JL1A 2HHAA 4PGAA 4PPFA 5F5NA 5K0CA 4V1CB 1EXNA 4KVGA 5B2EA 1LV7A 1QG0A 4QC2A 2LCFA 1ENPA 5EUBA 2H54A 3LKVA 5G0SA 2X19A 1MEJA 1CJCA 3U60B 2X9GA 3N0TA 2XR1A 4MYUA 3T4NB 2AFHB 3VOAA 2C0QA 3G8DA 2BISA 3L1HA 3WV4A 2Q1WA 1L1OC 2AKAB 4XJTA 3UK0A 1HNXB 2QTVB 2BMJA 3DVAB 5LWQA 2P65A 4LC1A 3RSSA 4F85A 4TZ6A 5F9FA 3FWNA 1YQTA 2I2CA 1JB9A 2O7VA 4P84A 3NEJA 3K0AB 1D1QA 2Y1EA 1SUDA 2A3RA 3KKEA 3VAYA 5CYPA 4NQZA 2JFBA 2R7ZI 1UHEA 1PT0A 4AZDA 1BQ4A 2WYHA 3IBTA 4LTMA 5D01A 1B2LA 2GN8A 3E8SA 3HDYA 2Z2KA 5H82A 4OA8A 3TLMA 4RZSA 3KCNA 2HDHA 2GLTA 4TYPA 4HLUA 2HSEA 4KX3A 3WJ1A 5FFFA 3PIDA 2C7VA 4IVQA 1G60A 3MLBA 1KIFA 2ZOSA 3QUBA 2NTJA 3ZGYA 5B4UA 1Q811 1VSTA 3WIVA 4EKEA 1FP4A 1KI1A 2KLHA 3K1TA 4ZMSA 1L8FA 1EFDN 4PZ9A 3DMDA 1HORA 3PUZA 4DIMA 4UFNA 1RYNA 1J2RA 3UNXA 1EESA 3JV7A 2C7OA 3LPMA 5K0BA 2E7ZA 3DYBA 1P0PA 3FCCA 4WDQA 3IKLA 3KZNA 1JR4A 4UM7A 4Y30A 3CUEF 1E1RD 5KDOA 3MTDA 5EYPA 1E0JA 3TF5A 4ETNA 3B5JA 1GV1A 4DNFA 3UUGA 3OJXA 2JA7I 4M8IA 3DBRB 3VH2A 4FB5A 3G0IA 4HPWA 3UJPA 5KC9A 3ZWMA 5HP4A 3P9KA 3AETB 2P90A 1NXPA 2COEA 4UNQA 4RY9A 2YVKA 1RC1A 2ZRKA 2G28A 4GX1A 1QH8A 5FCDA 4BQOA 4HDRB 2JEZA 3AG6A 4FGJA 4EDHA 1D6JA 4Q12A 2WU4A 2REBA 4X84A 1U1FA 5FA6A 2G8LA 5CU7A 2PQ2A 2QV7A 5AKXA 5L51A 3TQQA 2O3RA 4LDNA 2OZEA 5ALKA 1AQ6A 4C6SA 4GIBA 1Y8CA 5JTTA 1ORIA 1GUZA 2ZUCA 5F3WB 3P2OA 1AKVA 3M4NA 4P2BA 2GNAA 1N5DA 4BASA 3UMGA 4DKXA 2W6NA 1NXSA 5K3EA 3A1CA 4PZCA 4XB1A 1JG2A 2J4CA 4KE6A 3D7LA 4OJYA 3HEAA 4X63A 3UH1A 2PMWB 5KQGA 3THSA 4LC9A 2FE1A 2G9UA 2P1ZA 3MPOA 2A6PA 4G0VA 1L7XA 1EE9A 3L46A 3F90A 5AP9A 4FQ8A 5JNSA 1TIKA 2QM3A 3CH4B 4L3VA 2O8BA 2JIPA 2DHCA 2Q50A 3KKMA 4I1RA 5B1IA 5KQLA 5C5EA 1KZYC 3U4QA 1OUMA 4DBLE 4QRIA 1P4AA 3EQ9A 1R1DA 3OETA 1ZJYA 1KPHA 1DEXA 3RS0A 5BW8A 1VDZA 2OCDA 1LWOA 1O58A 4N7MA 4QXRA 4S0XA 4PYJA 1ZVKA 1NPTO 3LRTA 1U63A 2VA8A 1X9HA 1E99A 1MX1A 2CD9A 1BE6A 1Q0UA 2C57A 1AKQA 1M7GA 1FVHA 3UK6A 4TQGA 2EFDB 1RLOA 1SFRA 2F43A 4WLEA 4HAUA 3UIEA 3QVUA 2AF4C 1UKBA 3E03A 4Y6QA 4CIWA 5ENVA 2OOSA 1P4HA 1ULBA 5GM9A 1KKUA 1AY0A 2E2HI 4JUDX 4M1OA 4LCEA 3W1WA 4E2ZA 3H04A 3CUTA 5ADWA 3H11B 5ELLA 1XJWA 3M33A 3GZNB 3WMFA 4UOEA 3P5JB 4BNUA 1SCIA 2JHCA 4YHHB 3GGOA 3VOBA 2JFZA 4RQTA 1II9A 1AS2A 2ZM5A 1WABA 2C83A 5ALGA 3GJ6A 3TIVA 2DFPA 4DLUA 1JXQA 4JP6A 1LC3A 4J91A 1WBJB 1EUCA 3G2MA 4Q3CA 1TOAA 4ZJZA 1WD5A 3CLVA 2QJRA 3O3OB 2P0YA 3JRNA 4RGQA 5LP6B 5A5EA 2GRJA 2W8BA 1TJ3A 1TRKA 2VATA 5JD6A 4N65A 1B3RA 4NPAA 1SCJA 3B8EA 5TT1A 4YPOA 2WFLB 1Z74A 4RTPA 1OFUA 2D2IA 3OOSA 3E4DA 1E6CA 5CVUA 4EG1A 3UTDA 5A3JA 3VU9B 5AM3A 3CZCA 3IOCA 3CC71 4HEHA 3V4OA 2JIBA 3NAZA 2WQ6A 8ATCA 4RVOA 1N78A 1YZHA 3RW9A 1G2PA 5ABPA 3ROKA 2I65A 1KFCB 1QOPB 2IZOA 4XLTA 4AYTA 3AVTA 3I34X 4KQJA 3QLEA 1EGQA 2NUPA 1AT1A 5GADl 1TC1A 2RSLA 1ULHA 4DMFA 4WK4B 4D4JA 3KQUA 3KLNA 4X60A 1X3LA 2WJYA 1UC8A 4BNNA 3QIVA 1MC5A 3TTYA 1SVNA 5HGJA 5A7HA 3IR6A 2NT4A 3JVEA 1Z4JA 4E2WA 1IULA 1QQ7A 1R0RE 1WUJS 2CLSA 4M0PA 4QASA 5GQSA 2QVCA 4CL1A 4P54A 3VA7A 1PX0A 2PNFA 4FKBA 5JG7A 4NJEA 4TXLA 4YO8A 4IJKA 5E4JA 4Q48A 3QYFA 4O4LF 4ZI2A 2HJGA 2NVXA 1T36B 2QMZA 4KYIB 2OGSA 2EERA 5EIOA 5CD9A 2G5PA 2ZT7A 3C70A 1Q1EA 4DV6B 1VE5A 4CDGA 1ZGBA 1GLGA 4KBYA 4CLRB 3G0GA 1CY6A 2CXNA 2QRPA 4IIJB 3VPFA 5SYMA 1RHMA 1Y5LA 4GR9A 2G7ZA 4UULA 3ZYCA 3KFVA 3COZA 1WEHA 2FEKA 4YRTA 4CM7A 1ODCA 1L4LA 1YBHA 1F8XA 3NUZA 4H4EA 4FYWA 2MDTA 4CLOB 3EDOA 4WEOA 3A9CA 4GI5A 1NZDA 5CYOA 3CUSA 4CHGA 1T4MA 1HDOA 1EGVB 2O2SA 2SKDA 2IYQA 4KKXB 1GQQA 2UVQA 1ORWA 1SCUB 4PO3X 2CEAA 4DZZA 4P98A 2HPHA 2VJDA 3LSYA 4W6ZA 2DT5A 4GRDA 4EFNA 2CNBA 1FUIA 3EB9A 4DXHA 1U5AA 1N92A 1NW9B 1U2DA 1Q74A 3VVMA 5F2NA 3EPJA 3U7QA 1WETA 2EEPA 5JFTA 2A57A 3P19A 4QDXA 4K6OA 4CHTA 2H9YA 3PP8A 3EFOA 3ABSB 4P3YA 4CYMA 4ZDKA 1Y6GA 2HEGA 2O8EB 1I6WA 2R8XA 5DBFA 1NGSA 3GUYA 2SKEA 3KUKA 4HHEA 1N6KA 1YDFA 3GJYA 2FZGA 1VJTA 3WKBA 1I3LA 2TYSB 3VDNB 5BP7A 2GD6A 3G59A 3O9ZA 4D98A 1EIWA 4KN5A 3IUSA 1PWHA 3ZHQA 1WCIA 1JKFA 1OFIA 1ODIA 1UZLA 3GZNA 4UHJA 3GLGE 5T5ID 2JH3A 4BB0A 2FSSA 4YP7A 1HUQA 2OCXA 1J2UA 3IO3A 1RJ9B 1YT5A 1U9ZA 1KP9A 1U5BA 2KBFA 3BD9A 2WAYA 3Q7RA 4AZ3A 1TU3A 2I7XA 2UDPA 1JLKA 4N4AA 2VJMA 2VEOA 3H8JA 1DRJA 2N47A 5IW8A 2G4CA 4D9NA 3V46A 1AG9A 4RANA 4C4ZA 5ELXA 1GA4A 1UBEA 1YRQA 1C9JA 3FUCA 5J2UB 4MCAA 1EX1A 3OM1A 4MIEA 3S7TA 1FNDA 1YBVA 4P5PA 1NVTA 2QYSA 3WWZA 4QEZA 4UAGA 2YL2A 4BZQA 1Z6QA 2DAPA 4AKTA 1N2CB 4MWSA 2TS1A 5KWSA 2C4NA 1JSLA 1Y82A 2CXSA 2IXEA 3SR4A 5AI6A 4Z8YA 1NZJA 2JI9A 3H2YA 1EEHA 2X22A 1YZLA 2OUIA 3ZWNA 1PAUA 2OG1A 5AXBA 4WLVA 1WMSA 1XP5A 4KHZA 3ZDBA 1U98A 1W4LA 2FSVA 2K3RA 2QMEA 2X9QA 5HQJA 4YY3B 3R7SA 3OPVA 1NPDA 1UC4B 4JJ7A 3SUJA 3T9DA 5C8XA 2C88A 1IOWA 3REQA 1HYHA 4XUGB 3TR6A 3WWOA 5CJPA 3GT3A 5EE9A 3TL2A 2DQYA 5CCBA 3EIOA 5AXDA 3FF1A 2VDJA 5AKLA 2D2XA 3JQ9A 4BVFA 4HATA 3D3WA 3GFBA 3OBBA 2DWPA 4TTVA 2DWOA 1UJ2A 2VJOA 3HCDA 3UAYA 4L73A 2IU4A 4FX2A 3ZC3A 2ZYVX 4AO7A 2DFKB 2UVDA 4DWVA 4EJ0A 5CAEA 3WTBA 2IH2A 3NVKI 2UUPA 1KEPA 4MGYR 4G1EB 2AMYA 4L28A 2VJBA 2ZAIA 4WN9A 4ALIA 1GLVA 2B7CA 3IUBA 1XQ6A 1L7DA 2BFDB 4YJ3F 1XHLA 3IQGX 1CP3A 1PFUA 1T5SA 2JFHA 4J0DA 3U4CA 4AK9A 4YV2A 5ARBA 1DARA 1YHQZ 3BWXA 4EPTA 1NURA 1J22A 1B8NA 3FDFA 3ONVA 1U94A 5CXSA 1G3QA 4E09A 2OHXA 2H1VA 3PQDA 1KA9H 1VQLZ 4FOOA 5LIRA 3PR1A 3A9TA 1GPBA 3MSXA 1PJ8A 3NBXX 4OI4A 4QUEA 1GAWA 4J0EA 2HTEA 2QP9X 3K6JA 4OMCA 4U2DA 4YBRA 2RE8A 3RUFA 5A05A 3TZBA 2A9KA 4FFOA 1M1K1 4UREA 4WZBE 3ZCPA 4DIFA 4WPGA 5LOVB 4QVGA 2QTAA 3B52X 1YCDA 4KI0A 5EJ9A 2WUWE 3PWKA 3EGIA 2X5XA 3P94A 1UQRA 3X43A 3EY9A 1MQ8B 3M82A 3UANA 1N6HA 1S7CA 1RJ9A 2PH5A 4BE7B 4X65B 1QF6A 1FZQA 5B2FA 4ETWA 2XAUA 4P80A 3TZEA 5HTOA 1XFAA 4KGXA 3A6ZA 3O4FA 3KHTA 4M99A 1D2MA 4JCWA 1U3VA 2Q49A 3FG9A 1K6IA 1NUHA 1WUYA 1V25A 3DBOB 1NKVA 3WYBA 5IJ9A 2OLKA 3IVGA 1A7KA 2QPTA 2XUIA 2CFRA 2DGDA 1GA6A 1PSZA 2EKLA 4ILEA 5FXMA 2QTGA 2O8CA 4YJHB 4KXLA 1GPAA 2H9IA 2QQGA 4PR3A 4YMTA 1LS1A 1SUAA 2AI1A 4JUAA 3V1MA 4XIFA 2Q6VA 2R1TB 4F84A 1GFZA 4WASA 3MMPA 2VNSA 1DEKA 3TS1A 1N2CA 4PYMA 2PJJA 3AHGA 3H5OA 4Y9UA 2CHEA 2IF2A 2WTMA 3HVKA 1R9TA 3PCXA 2BFNA 4R51A 5T4FA 3RIYA 3UHAA 4AWXA 3N2YA 1VJ5A 2GTIA 3INRA 3QLJA 4MA5A 2Y2UA 5HOQA 3FTPA 1F3OA 4K9MA 1QANA 6Q21A 1MD9A 2JRCA 3BJRA 2BI7A 3SIXA 4IAOA 4EB6A 2NUTA 1IHPA 1WMDA 2GCOB 4Y2SA 2AZXA 4UFOA 4JD5A 1PGOA 5F77A 3TOVA 3KX2A 2ZJ2A 3DFZA 1YE3A 4NOHA 2YZNA 3NAGA 4I66A 4MMZB 4PYRA 2VPWA 5EP3A 1Z83A 4EO4A 5IZCC 2QTVA 3DVAA 2AC2A 3NDIA 3G2NA 3HKDA 3BAZA 2I4IA 2O5VA 4ZOLA 3UA3A 4CF3A 6REQA 1O95C 3F6SA 4PSKA 4LGVA 1EBUA 1SEVA 4UMFA 4DCPA 7REQA 4EHIA 4TYNA 4DG5A 2CUKA 2H4YA 2VP0A 4LK3A 4MUJA 4IWYA 4OJNA 5IT0A 3KSDO 3A3OA 3IP5A 4HMPA 1DIAA 2E49A 2IWRA 1L5FA 2CF5A 1U0RA 1CUWA 3COYA 1ICEA 1QHHA 5LYYA 4BLOA 2BSQA 4KO8A 2ODPA 3T4EA 2WB2A 3DF7A 4CQMA 5L8VA 4YJ2A 2G9ZA 3RARA 1VRWA 3AU8A 2MR5A 1XQVA 3QOYA 3DDCA 2BFDA 4NEHB 5CG1A 2E0IA 1I7SB 1V1RA 3RROA 4BRZA 1GM5A 3WYNA 4P2GA 3NCHA 5EKDA 5L7YA 3LCVB 1H8EA 1HYEA 5AKKA 1Q7BA 5CT6A 3F6YA 1YQQA 2HA4A 1XQWA 2O2EA 4FP9A 3FR8A 3T1OA 2CXPA 3DPUA 1Z56C 3VVBA 3OQIA 4KXMA 3N6XA 4ROTA 2E4XA 2MOKA 4ZO4A 1OX4A 4G5XA 3RRNA 1BW3A 3OPQA 3V8MA 1FMFA 3B7WA 4JBIA 1YIDA 4LXXA 1CWUA 1T0HB 2J09A 2VJNA 3RANA 1WWKA 3FE2A 4MR8A 2Y1CA 4II2A 4OKSA 1PJBA 4KDEA 2Q0QA 4YREA 1BWSA 4FOTA 3EPHA 4IH1A 2QR5A 4CDRA 5DGDA 2G80A 1VKNA 3OE5A 1CUIA 1MH1A 4JFAA 2D4AA 2J32A 3PX2A 4IS3A 1HL3A 3GRCA 2FFHA 3KVRA 2FN7A 4WOJA 5K3OA 5NULA 2FPIA 2FZCA 2MSWA 2YYZA 1TQHA 3IC5A 4I14A 1T5LA 2L0XA 1S96A 2C9CA 2EFJA 4BS9A 4ZJYA 3X2LA 4CKYA 5CFMA 1RNLA 3NWOA 5EUMA 2VF7A 3QBJA 3A7EA 3W90A 821PA 3U4GA 5CLGA 1WCWA 3FHOA 4JC8A 4Q34A 5HGXA 5GPBA 3QI2A 5DASA 2EX1A 1T5DX 3C5VA 4M9RA 1YMVA 2R1VA 1KH2A 4BV8A 5SY9A 5ALVA 3GLFA 4CQLA 3JWPA 2HMAA 4LYGA 3CGGA 3SQLA 2OK7A 2OV3A 1L7MA 1HURA 1NOKA 4X00A 4WXRA 3GH3A 4Y2HA 4B0OA 1ZH1A 1Z5VA 3O83A 3FVTA 4ZQGA 1ID1A 5K8TA 2BP7B 3IIJA 1SG6A 3DB1A 4IV8A 5EWLB 3ZQ4A 4URVR 3THWB 2QOEA 4EMUA 1ULAA 2R6DA 3U19A 4I3GA 3CPWY 5BSRA 5REQB 3C6KA 1WDMA 4DQVA 4Z0HO 4DRXB 4KQWA 4M98A 2RGDA 4LQLA 5F1KA 3HA3A 5LDHA 2X1VA 1EZZA 3INGA 3IOEA 3Q0TA 3OCXA 4OD0A 5H8WA 3RS4A 1FF9A 1SD2A 4D4IA 4TUYB 1OFTA 4H6VA 5IPFA 3VSCA 2ICAA 1L6IA 3LQYA 3EF3A 4GHWA 1JA9A 4PLHA 4Q4AA 1RBMA 2JFOA 3EVEA 3FNIA 4UD6A 2ZQZA 1I13A 1O0SA 3WYAA 3GEGA 2VUGA 1ZGZA 3FCXA 3WXMA 4C20A 5JDIA 5JU6A 3KC2A 1FS4A 4TRNA 5T57A 2PZ8A 1QG6A 4C21A 2BZ1A 4PZEA 3HVIA 3IDOA 3FW1A 2BEWA 3RS3A 5G0WA 4EPWA 5KX5B 5KNLA 1NY6A 2VH2A 3MS4A 4N3CA 2FUCA 5SZKB 5IN5A 1UBUS 1ZD2P 4BQRA 3CRW1 3I6ZA 2HBQA 3HYSA 3IOYA 3WSVA 5EXEA 2YDYA 3A3YA 1T6ZA 3WFZA 4S1WA 1XI2A 1RZRA 2OTJ1 1P7CA 1X2BA 1I1OA 2JH9A 2BGNA 2XUDA 3QU4A 2GVNA 4MH0R 5AOBA 2ZB4A 3VNAA 2CMKA 2OSBA 3ILSA 2C2BA 2L17A 2XGSA 5I7WA 3NVDA 5JAUA 5I7SA 1NP7A 5HKKA 2EARA 5BQ3A 2JA6A 1OE0A 1L5HB 5K8VA 1NT4A 5K3AA 1PQFA 1S8FA 1E2BA 1I3MA 3GNLA 1MENA 2YICA 3M6FA 3SS8A 4B8WA 1FJHA 3R7DA 3BSFA 4ZJPA 1WPXA 3RKUA 3DA8A 5JV5A 3OSZA 5ICGA 1QIIA 4PZDA 3UW3A 1G98A 4JA0A 2PMKA 4A6PA 4AF8A 1GPWB 2YYYA 4RTQA 4ND8A 1NW5A 2WFLA 3GRPA 2ATCA 1SY7A 5CK5A 4ND4A 3LUDA 4FNGA 4YCMA 5B7QA 5A4KA 3C4JA 1XWFA 1PLKA 5IXYA 1DJPA 3O2SB 2F8MA 1Q0TA 3MTAA 2R2AA 1C3LA 3ED1A 5KVAA 4LDQA 1E5TA 1KZ6A 1VECA 4L6CA 2BUAA 4FFWA 1PW7A 1W1IA 2W70A 1PVOA 1L5QA 3ZJYA 4M87A 1RAEA 4XFKA 4HNGA 5EP4A 2QRGA 1S2OA 4V0MA 4PZUA 4C6TB 2R5NA 3CE9A 3COVA 3ROGA 3E82A 2WIKA 5DHUA 5M3BA 2I54A 1K7FB 4AJPA 5BSVA 4O4IF 1ETUA 1M0TA 4RFLA 4DXAA 5JSUA 2FUNB 4H1UA 1JR2A 5AI5A 1XZCA 5BW6B 5HNKA 4C2MA 2VT2A 3LK7A 4D82A 1MFPA 3PO2I 3N2KB 3H6GA 4F5EA 2C3PA 3UMJA 2BEWB 2E2WA 1JQJC 4US1R 1CQJA 5CVTA 1MABB 1CJSA 1ISIA 2A0WA 4P32A 2F00A 2W93A 1VBMA 4KAJA 3RFCA 4BNDB 2WFZA 4DR5B 4LJSA 1LDBA 2BRUC 2YV4A 4TWBA 3U61B 1V39A 1VBFA 5J43A 1R0BA 3LL7A 5KQRA 3D7SA 3PXUA 3TOZA 2E37A 5B7PA 1HG1A 1E7MA 2H5EA 3UY4A 2XA1A 2C4WA 3TJRA 1O96B 1P72A 3U0BA 4CGYA 2O4UX 4MVJI 5H3LA 5HXAA 1SVKA 4YGXB 3JAWA 1WXHA 1XMIA 2XOKA 4CKBA 5LVAA 2W42A 1YH3A 4HLCA 2W48A 2WF9A 4URXR 4MR7B 3TE7A 4N40A 3DNMA 3WKEA 3ZWKA 1H5NA 1J97A 1W5TA 2AOXA 4UHFA 3V8BA 3JZIA 1FSPA 1K97A 1RWOA 1TW3A 1P0QA 2IXAA 1U3CA 3PFKA 4MWCA 2WA1A 5I5GA 1JR3E 2EF1A 2VAWA 4WKCA 5J2TB 3GOHA 4Y1RA 2VWPA 4LISA 1NQUA 2XD9A 5H83A 1TF5A 4GBED 2X1HA 3UJAA 1WCYA 4CIVA 5DM60 3GTPI 1WXIA 2II6A 5FNVB 3UCEA 1JEOA 2AJBA 2GSDA 2HMSA 1H2ZA 3FMOB 4P82A 3IUPA 1RJEA 1DG3A 1YF3A 1M902 4LHEA 4KNYA 3FSGD 1VL5A 3KV3O 3RM3A 3G5MA 4YK7A 3M4OI 1JECA 3HV0A 3VX4A 1UMCB 2XTAA 2CC2A 4EELA 3D4LA 5B3LA 3FCUB 2JA1A 4FCCA 2YWRA 3VPCA 1Z68A 3W04A 5B7GA 3WRYA 4MLDA 5AM5A 3VH1A 1T9AA 3DZBA 1X7YB 4BKMA 1QXSA 3ZJTA 2PRIA 3L06A 3ANYB 4HAYA 2C29D 1RACA 1QHXA 1RPAA 2BHNA 1FRVA 2XTMA 4LJYA 4OMUA 5DMXA 3N2KA 1PFYA 4E46A 1Z18A 4BB9A 4W9NA 3Q72A 3D02A 2ZS9A 4MV9A 3H42B 1Q84A 4LZOA 3DJFA 4EUFA 5L9AA 2ID7A 5FEMA 3RREA 3GTMS 5G53C 2PWYA 3M4XA 1T5OA 4X93A 4E1VA 5BSFA 5JH7B 1WB6A 2VHXA 4OHRA 3P97A 1KMCA 3HVHA 2WWWA 3L43A 3V33A 1QVFY 3A32A 3GW8A 2N75A 3CLTD 2YX1A 4DV7B 3E53A 2QORA 2QGFA 1SHJA 1YFZA 1SULA 2H11A 3OHSX 4PYNA 3ZY5A 4TL6A 4KTVE 4NENB 2NNLD 1CZ5A 4R9NA 5ARDA 4CMHA 2V5VA 3EERA 4LBYA 5LUBA 1RKBA 3NBYC 4G63A 3ZU4A 5TPZD 2R7ZA 3QPDA 3GDHA 3HWSA 4ZQHA 1N8R1 1FFCA 5FLXA 1UBRS 4RH0A 5KKAA 2V9ZA 1TT5A 5JLJA 3TG2A 5SYAA 4F4DA 1W76A 4D7ZB 3GRRA 3HDVA 3FWZA 4D45A 3ILHA 2IY8A 3UB2A 2B4QA 1EP9A 1Y5RA 4WNCA 3BH0A 3MELA 1T9BA 2W2LA 1NJ5A 4IRXA 5I3CA 2HRDA 1V4BA 3AHEA 2PRSA 4W5QA 2NVXI 2OO5C 4AQ7A 1S8AA 3KR0A 2XSZA 3NBQA 3OE7A 1RDFA 4EGSA 4PGFA 3HCRA 2GCEA 4JJIA 4KIFA 1NF9A 1RYEA 1ZH0A 1YNOA 4KPGA 3U3MA 4ENTA 5JAPA 1RHQA 4MQ5A 3H1AA 1FBTA 4NBLA 1DOAA 1GGMA 1VLQA 5IKPA 3GLSA 1XWIA 4KE7A 4YI5A 3NHRA 3RC8A 2NQ8A 4QAQA 2EOAA 5J1TB 1XV5A 3NIBA 1PQEA 2WP0A 3OZFA 1Y6RA 3NPAA 1GG9A 3NHSA 1M1YA 4R2XA 2A5YB 3K9GA 3SEAA 5K0EA 4DV4B 3AVOA 2YJ3A 3ZKWB 3JQBA 1L9XA 3U44A 1NE2A 2BM1A 3DNPA 1PBTA 3JARA 2K2QB 1ENYA 2Q07A 3JSAA 3L8ZA 5B3AA 3AF4A 3UHOA 3GLGB 2IX9A 5JAZA 4E21A 4EGJA 3PO3S 1W36B 1CQIB 1ITZA 2BUCA 2R7AA 3IBSA 2B4KA 3SJ7A 3CNBA 5AHOA 4C05A 1T2UA 5C53B 2JLXA 1E2IA 1PJLA 2ZSUA 2GBPA 4QM6A 4GPD1 2WIAA 3AHIA 2NLOA 4BNMA 3A31A 2O5RA 4BVHA 2R92A 4NE9A 3ETCA 4GICA 2GAEA 1A5TA 5KC8A 1PBNA 2A9VA 1UMCA 2PUTA 2BI4A 2VT7A 4WINA 5BO5A 4MSUA 2BVNA 1MG5A 1PG0A 1KI9A 3BL5A 1FMTA 4J9UE 4PQFA 4RL4A 2K2WA 4NBUA 4TKUA 4IVPA 3S3TA 8GPBA 1UJCA 1IMOA 3MMSA 4G5GA 2FLVA 4RPCA 2F4MA 1F4VA 4XUEA 3S99A 3P0IA 3GFVA 3LFTA 1Y3BE 2OEPA 3DB2A 1H22A 1M3SA 4UUQA 3E1SA 3THOA 2FXVA 4J0QA 3TB4A 5ECWA 2CSXA 1E9SA 1UKVY 2GPAA 5CIWA 4V24A 3R3JA 4PG8A 1W581 2MSEB 3E2MA 2Q27A 1SNYA 1DOZA 3PVSA 1XCLA 3M1AA 5ALYA 2MR6A 3WGMA 4CIDA 2E2JI 4C4OA 4Q4CA 4UTVA 3D1VA 3AHHA 4D2IA 3VXKA 3DS8A 2F3TA 3H9UA 3TL3A 5DN6D 2IEIA 2BGLA 1VCOA 4NBBA 3IVMA 5AWFC 5B64A 5LSAA 1GGEA 4P3NA 2WWGA 4LWOA 4N5DA 4S2UA 1VFNA 1XU7A 2HF8A 2WIDA 3Q12A 2V59A 3DMTA 2XQJA 3MC1A 2PU5A 1U04A 1WW8A 1XAGA 1P7PA 4FWTA 3GJ3A 1X1TA 2HZBA 4B2IA 4CVNA 3EH2A 5AHKA 2RHGB 5T4EA 2ZRJA 4KFUA 5J5VA 2HV8A 1ACJA 1IH8A 1RWWA 3QPBA 4J4HA 4ZK6A 5BOSA 4QOGA 2IEBA 2P41A 4M9ZA 4RABA 2I03A 3L7OA 4AB1A 1U0NA 5KUTA 4DR4B 3KYDB 4LKOA 2KB0A 2C5BA 3DMYA 5ESXA 1JT2A 5ER9A 4Z2YA 2AN5A 2QPLA 1TEXA 3AONB 2VR1A 3PJEA 3QWHA 1M33A 2MMCA 2GTPA 1JG1A 4BFXA 5JNLA 4UAUA 3H2GA 1X1BA 2JDIA 3QUQA 3CCCA 2OYRA 2DPMA 1PR6A 5A9TA 1YZGA 1RQXA 4DCUA 1C9NA 3Q3EA 3EXAA 1IHYA 2FSGA 1V5GA 2D7CA 2FFRA 3FYUA 3Q7TA 4D56A 2AFIA 4DW8A 4URFA 1EP1B 1E3QA 3EE6A 4IV0A 3ZLBA 3T61A 4X1OA 5KU1A 3OLZA 3HJBA 3BH6A 4NZMA 4UTZA 1C7IA 2J31A 3L7MA 4MUEA 3KZOA 3BMCA 4IDBA 1MGPA 1Z0ZA 2HXYA 5AJHA 1PR5A 2Y67A 3IMCA 3WNQA 4CR7A 5A6VA 1YA6A 2IDZA 4IYJA 3COSA 1JMYA 2ZRGA 3A3NA 3DKIA 2KQUA 2Z6QA 4KAAA 1GDHA 4N0MA 3I1YA 1SVWA 1QAQA 4EYEA 1LSUA 4MR9B 1DQRA 1GNPA 4CN9A 1VXRA 1K8XB 3RYTC 3LWBA 2VDPB 3M1LA 3LY8A 4HZUB 2ZJ6A 1QG4A 2O0HA 4KO3S 4O6VA 1EB9A 3TOSA 3K0AA 4F9EA 4ARZB 1WXWA 5CVVA 1Y6FA 5EZYA 4BLPA 5JFGA 1TD9A 4ES6A 1R8QA 2H63A 3TCNA 1Y1VS 5KJFA 1PJZA 4ZA2A 4NZNA 2C4KA 4F60A 1SKMA 3I4LA 3L01A 4PCLA 2HWUA 3CZBA 2HK6A 1BDBA 5DHPA 4UBKA 3MXTA 1VIAA 4NH1C 5G4KB 3WHKA 3WGZA 5ICSA 4B43A 1TPYA 2OVFA 4LRYA 4L8GA 4N54A 5LUAA 1RWNA 1AHPA 1ZLXA 4FHFA 3FCAA 2O3TA 3QU5A 1X1CA 2G25A 2OZKA 3AI3A 1ZZEA 4ZARA 3S2DI 2X3UA 2QL9A 1G3UA 1W5FA 4L8LA 3IQHX 3MZKB 1YJW1 4MDHA 5FL7D 4TZKA 3GO4A 2XADA 4WGGA 4O33A 4B09A 2CNOA 3DEZA 3X2PA 3CZ4A 2RI0A 3WO0A 2F1JA 4B4OA 3CPHA 5EN4A 3WWYA 3W6NA 4BO4A 2B1IA 3D5TA 1F6WA 4RIHA 3GP8A 4OAPA 5CBPB 1NXVA 4XQ9A 2O57A 3PC4A 5KPJA 4K9QA 3ZQKA 1V3TA 2AUTA 2JFWA 1YI21 3DEFA 4GLBA 3WZ2A 5G1NA 4EGFA 1VMEA 2R6JA 1P1KA 2VHZA 1ZU5A 1YVEI 3ZU6A 2PPLA 3CO0S 5EMLA 2E3JA 2WABA 1NMZA 2VXOA 5FV7A 2WF7A 3QFCA 4AY2A 2ACKA 1XBTA 2DH5A 1QFJA 2F9FA 3PHJA 3ZX4A 4A23A 3EIEA 1YK0A 3HS3A 3N8DA 3CO5A 2CKMA 3VR4A 3BGVA 4F4HA 1K9M1 3G2KA 1KO5A 1KO8A 3MIIA 3QVMA 1GCIA 5K5EA 3MOSA 1HOTA 2BIFA 1ZK2A 2REQA 3A4LA 4FVTA 1S3IA 1SC4A 3HN2A 1JLLB 4JC5A 4O29A 4UBNA 3BKWA 4CTOA 1G20A 2YWFA 5KO2A 3CJTA 4GMGA 1TWFI 5FUWA 3TUZC 4FHDA 1FOEB 3D3EA 5E7IA 3JW8A 4YP5A 1A5ZA 3LYAA 2FEAA 3VR3A 2M1XA 4YTEA 2NVUA 2UXDB 1ZJ4A 2DPGA 4B0PA 2OTCA 2AYXA 2H2FA 1E2FA 2BFCB 1YIOA 5CX1A 2YR0A 2AFIB 3KXIA 2IUYA 4ID9A 1G17A 3GBVA 4U8GA 4WOKA 3UC9A 1SA0B 4IF4A 4YMHA 2BZSA 2FF7A 3AERA 1AQUA 3KHUA 4DN6A 1D07A 1FDTA 1U2ZA 2Q3CA 1DEHA 2WD7B 3HUUA 3GRYA 4LV8B 3FNFA 1K4KA 1QZTA 4KN9S 1MHPA 4W5JA 3ZK7A 4GSKA 1I6KA 4B7XA 3E2IA 5LM3A 1J9ZA 2O8BB 1BWPA 5J2UF 4NK5A 5SV2A 4GYWA 1AZLA 2ZJZA 4G5RA 2JJ1A 2J0QA 1J20A 1J2YA 2XGGA 3E9YA 2DPLA 4RZUA 4M1ZA 1GZ4A 2FETA 2HL6A 2LGJA 3CN9A 3F7NA 4MVXA 5FPQA 2ZZNA 4IRUB 5J5CA 3TIIA 4HUQB 2R86A 2W6ID 3LT2A 3GAZA 4PZ0A 3E3AA 4PX2A 5EMHA 1X9IA 4MICA 5MN6A 2A2ZA 2QROA 5JCZA 3VU3A 2BKVA 3WGUA 4F21A 5A1TA 4GGOA 5A5VA 4YVFA 2C9BA 1PFTA 1H0SA 4MQFB 3T7IA 2H0QA 1UBNA 3HCEA 4WZAA 1XP8A 2G72A 4EMBA 3MJCA 1TK2A 4PR0A 4DJJA 1PX2A 2FG5A 4M21A 3IF8A 2Q5HA 2A0YA 5JCXA 1TGYA 3O03A 4OL0A 4PYOA 4P33A 1FDRA 1NUPA 2C96A 4CM8B 3MNFA 5JBIA 2D2VA 4RK4A 2R9VA 4W4TA 2IFTA 3UV7A 2HH9A 5IVHA 2H1OA 3OW2Z 4U2CA 5CLHA 1OI4A 4KXXA 2A9FA 3CYFA 2V45A 2AXEA 5EP1A 4CJXA 4NFYA 4D3YA 3RYIA 2KX7A 2WIGA 4HMOA 4DLYA 4YCLA 2B1QA 2QRNA 3K4HA 4TMZA 2IEDA 4KV7A 2P7HA 3A6JA 2W4IA 3CCMZ 4JOBA 1FNCA 1VLZA 2H16A 2JCXA 2CKDA 4NB9A 5GONA 4ALKA 4B1FA 1GFWA 3O1HB 3QKSB 1JDSA 3CC8A 1X7WB 3BEOA 4QQFA 1JTEA 4XTCS 1AKUA 5JYDA 1MAHA 1VQ9Z 2H6EA 2YVAA 3OZRA 3C24A 1DAFA 3G2JA 4Y1GA 1FMLA 2VS1A 1ZSNA 3H97A 4X3CA 2P27A 3QYAA 3CCUZ 3B3GA 4FGUA 3NBMA 2EQAA 4B85A 2XAAA 2ZSBA 1I4OA 2LEXA 1NN5A 2HLDD 2PLWA 3OJLA 4M53A 5K1ZA 3S40A 3WHIA 4BTLA 3EWIA 2HWXA 1R0SA 1IZ0A 4O1IA 1BVUA 1XMQB 1LBIA 4FM9A 3V4SA 2RGBA 4XSHA 2PT9A 4FYIA 3PG5A 3F6BX 1Z8HA 3JAWB 4ERXA 4HVAA 3H75A 5EXPA 5FADA 3UGQA 4HUQA 4EATA 1R6AA 2X23A 2UZIR 2NVUB 2ZS8A 1S2NA 3T9FA 1WG8A 2DFDA 2ID9A 2XDQB 4KQ6A 1YR1A 3GTGI 1RBYA 4GI3A 5GV8A 4LRXA 4JXZA 1I32A 3NT2A 3BDVA 3DMPA 3HR7A 3PQ2A 1GZSA 1JQAA 5JATA 5LIPA 4N0PA 3WQHA 2OHOA 4Y1RB 3GT4A 2QN9A 2BSAA 3HDHA 3I37X 4JVSB 1M7BA 5BYBA 3SCZA 4CV0A 5ALLA 2WD7A 2X0DA 2H85A 3B3JA 4UDOA 2H5LA 2IXGA 1M0SA 4PQGA 4BJHB 2XMDA 1G42A 2IOYA 4NEGA 1RPZA 3TB6A 2I80A 4C08A 2HBRA 2WEKA 2I1LA 5DWQA 4R9UC 5IU6A 1CZNA 1FDUA 3FMVA 1ABFA 3BIJA 2ZYSA 3HU5A 3IQEA 4GH5A 2LBPA 4H35A 4LXYA 1FYWA 4QEDA 4OIMA 2XZLA 4X6XA 3JYQA 3KUUA 3N3BC 4N0DA 4GL4A 3L0IB 1YJCA 4LOKA 1Y42X 5JOQA 3IESA 3NT5A 4DNPA 2B5VA 4KDRA 3SQOA 3STXA 4BX8A 3ET5A 2Z3ZA 3AVPA 3JAKA 2WTBA 3STHA 1I0IA 5A0VA 2O1SA 4I0WB 4C1BA 4NB8A 4NL4H 4TYMA 3QVVA 3KB8A 1SC6A 5FOWA 1JLHA 1T9GS 1MHTA 1RXEA 2Y2VA 4I9FA 4RY0A 3C6YA 2XRYA 4G0QA 1OT5A 1DWUA 4L95C 1VPTA 3R20A 4S12A 3W2EA 4DB2A 2X1LA 1E5LA 3QVOA 4NP6A 1W5BA 3VJLA 2OOXB 2E6KA 1TUBA 1UR5A 4UUOA 1ECBA 3EARA 4WH0A 5DSTA 1NBAA 1KNXA 2JJ2A 3VH4A 1GRQA 3LBAA 2FSFA 1FVXA 1MP0A 2LIYA 10MHA 1EGHA 1ES9A 4MS1A 1WNTA 5L53A 3SKVA 3OEEA 3N3AC 3M9WA 5T8KC 1JXAA 1BMDA 3M6UA 3PXDA 4IEEA 2VJMB 1TE2A 5D1OA 4OGKA 5A5FA 2HNAA 2VTEA 3T1HB 5J5AA 5GLYA 3NBAA 3HOWI 3N5KA 2HRRA 1PWEA 5C81A 2CLCX 3O7WA 1EHIA 4ZI7B 3C45A 3LLMA 2ETVA 3PE3A 2C2HA 4RA9A 5EQDA 1R88A 5B1SA 2VZ0A 4UHKA 1ESNA 4O63O 5GGYA 3VR5A 2JLWA 1C3OB 5CA1B 1P61B 1OX5A 2X4DA 5IP7I 3GUCA 2ERCA 3ADKA 3G2QA 1YL5A 1W2WB 4D74A 5BWOA 2PV0A 1U4SA 1FQJA 3U16A 4YP6A 3I61A 3R7LA 1MTOA 1QWOA 5F9HA 1PDOA 2APJA 3F98A 4QDTA 2BYTA 2AG5A 3BXXA 2D0PB 4PSDA 3TFQA 3WE7A 5KTMA 1DELA 1JHAA 4I55F 2FTKE 5GJWC 4B7ZA 2XOEA 4EO7A 4OB8A 2BE9A 4MS4B 4R16A 3IIIA 3VV2A 5HZGA 5IC4A 1LI4A 2FH5B 1XRJA 2GRAA 3DAHA 4HEJA 4RWEA 3OMLA 1ID8A 2BMWA 1YOBA 1PJRA 1VYUA 2P4HX 2R60A 1FMJA 3OP1A 4D0LB 3LNTA 1X74A 1DZIA 2P1RA 2NP6A 1PGPA 1OI3A 1L8OA 1NRXA 4FLFA 1NI3A 2ACWA 4IX1A 4ZAYA 1TF7A 4HQOA 4MHOA 1KYXA 4CQLB 3NHUA 4FR2A 2FFQA 4YRRA 4ZFNA 2ONYA 2PUFA 2P9YA 4RVFA 3D1LA 3Q7EA 1FY2A 2FWBA 4L9AA 4E5NA 2GYYA 2RI1A 4HMQA 5AQEA 2RHDA 5HKLA 3KJHA 3K15A 1WW9A 1Z6ZA 1VE6A 1YQWA 4MYHA 4TLCA 1EHYA 1VI5A 3ZD6A 1LW7A 5I9SA 4N12A 1Y3FE 2C8JA 4I6JA 4KVAA 3W5UA 1XTSA 1OY1A 3AT1A 1BTOA 4HNAB 3AVQA 3CM0A 2MTBA 1A9SA 1G8KA 4Z9AA 3Q5GA 2R4TA 3FYHA 4BU0A 1LH0A 4CMGA 3ZIDA 1T2CA 3AM3A 5ES4B 5EJ2A 1DPGA 1ZIDA 1MKYA 2VYNA 4K6KA 3UM9A 1WCXA 2BLNA 1C29B 2IEAA 2FW6A 1KF0A 2QRMA 3QV2A 4QLAA 4Z7JA 2D74A 3SUKA 1HE8B 2I8AA 3OA2A 2C03A 4GU5A 4YJKA 4D79A 3DP9A 4BQEA 4EPRA 2AQIA 4Q9NA 4B32A 5LA6A 4QOEA 4RV0A 3GTQA 3LE8A 1F5SA 2BEVA 1H66A 1OTHA 3IQFA 2WAQA 4IL5A 4L7QA 3B85A 4LZWA 2C31A 3OTIA 2PWPA 3U7IA 4C03A 4EF6A 1JMVA 3GXBA 1GT6A 4H3SA 3ZHXA 4POOA 1QYPA 3KB2A 5DNVA 4EUKA 1U2DC 2UV8A 5G0VA 4ANFA 3L7CA 3MB8A 1FP1D 3OTHA 5KTOA 1K4YA 2NQTA 2ZAGA 3H9EO 2A5DA 3NKLA 5TJ9A 2OCPA 1D2AA 3KSMA 4LYAA 4ZVLA 2LR0A 4OHFA 3RVMA 1RYFA 3QU9A 3UMMA 1RAFA 1XC7A 3PR2B 5IDYA 3PGJA 2J6AA 2IYRA 5FT9A 3T5GA 3ZHRA 3L7JA 3BEDA 3OFSA 2IHBA 4IHKA 1EP2B 4C7KA 4ZTZB 5J40A 5G3YA 1PR9A 3N39C 2XDAA 1TCCA 1TF2A 2JHAA 2ZAYA 2B69A 2JK1A 3BXOA 3U4DA 5A4MS 3V7NA 3DL2A 1ULUA 2NO4A 3GRFA 1RE1A 5JD4A 1OI7A 3T1YB 3KTAA 2CCKA 2C7PA 2NUAA 3PI6A 2IU6A 4A3EI 3DOUA 1G5PA 1K9M2 3VO2A 3K71B 2O7RA 3KVVA 4MD8A 4AJLA 4B9EA 5JRJA 4BKPA 2J3HA 4XOIA 2DLCX 3B51X 3ZW9A 3EEYA 3CQZA 1SQ5A 1TYDE 3TW8B 2R4UA 2XDYA 1DIRA 3M5DA 2O9JA 4FDUA 1Q11A 3ZE2B 1Z26A 4I1OA 4JXJA 4CKZA 2HW8A 3RYFB 2YC2C 1NVVQ 1OV6A 3GAFA 3I2GA 4D80A 4RSHA 1Y8ZA 4WBSA 3EXEB 3FNQA 2GJSA 2V6IA 3E3LA 4FCWA 4L08A 5TRTA 4DSOA 3PPXA 1N7JA 2F8SA 1Y3AA 2KBEA 4E14A 1ZMTA 2VCEA 1P1HA 2GF2A 5EUQB 4F6LA 1NG9A 2JGDA 3PQ8A 2EEZA 3M2TA 1KARA 4YUYA 1P6XA 2VHEA 1K2VN 4EAQA 2P0EA 4IJVA 1J56A 2W6CX 3OBIA 2QJWA 5FORA 4HJRA 4Q0MA 1PJ2A 2HLHA 4LX8A 5CEJA 1KJJA 2I3ZA 3GP3A 1PL7A 1VE1A 3AEQA 5T41A 1VQ51 3G6EZ 3VJKA 1VJ0A 5B30A 1KYQA 1G5FA 4BV9A 1OB5A 3KYCB 3U3RA 1JE0A 4AOKB 2ZIXA 1W0KA 4P4SA 1Y33E 2RCNA 4P35A 2P28A 1Z15A 2DECA 2PS1A 3DVLA 1BKYA 5TT0A 3W2HA 1RWPA 4FC7A 1Z02A 2GM9A 1F6DA 4RFSB 1W2BZ 5C18A 3ROFA 4FYXA 3ZUGA 4LXHA 2H1RA 2MSLA 2NYUA 1DO0A 4EI7A 2V4UA 4DLSA 1SB8A 2WTNA 3V9PA 1FXUA 2Q5EA 1M6EX 4BV2A 5IK2D 4BMZA 3E9ZA 3EA0A 3I6MA 5DO9A 5A3QA 5BURA 3DE2X 3BQNB 1YIT1 2H7CA 2L19A 2VC2B 3T3DA 5JUWA 1JT9A 3EISA 1ZA1A 3FZGA 3QPWA 4M7PA 4H1WA 1L4HA 5CB4F 3JAMb 1A27A 4KDCA 1VYTA 1P2UA 4Q7QA 4YV7A 4M0EA 2JHPA 3K1YA 5CA0B 1YGYA 2HJWA 3DR3A 3GPBA 4YFVA 5JI3E 4HH4A 3L4EA 3KZVA 3HL0A 5JCJA 2C7BA 4NTZA 4J94A 2ATEA 5IAJA 3S81A 4EBBA 1DLIA 2CJWA 3M6VA 2D1RA 1FC0A 3OT1A 1IN4A 1F38A 3LECA 4YMUA 4ABTA 3HA2A 4C0WA 1LD3A 2VQ3A 4GVPA 3VO1A 1Z2PX 3IQZA 5IEJA 4BUZA 4QICA 3WGQA 1N1GA 1U8ZA 1ZVMA 1O54A 2M32A 4LN1A 4DWJA 4CM6A 1MEOA 1G20B 3O47A 4A0HA 3RH0A 3RSHA 1LDMA 5KWVA 2DLDA 4U2KA 3KR9A 1ISRA 3E0QA 3RO7A 4KVZA 4J7CA 5T5MD 3QE3A 2ASVA 4ZVOA 2HCBA 2F62A 2P4UA 1H5QA 3DTVB 1USIA 5E1DA 1AGRA 1U2PA 3LQ4A 4TV9B 1AKTA 3QMWA 2FSIA 3PHIA 2V7PA 3JQ8A 3LT5A 4ZCMA 1WY7A 4BKRA 1U1CA 2XUOA 4KIJA 1E63A 3PTAA 1LC0A 4R2WA 3T38A 4RXUA 5ICFA 1KMIY 5DCWA 2OGWA 2WUGA 4L8FA 3AI7A 1TU0A 1NI5A 1YUBA 1NBEA 2QT0A 1ZG3A 3I6YA 2C2GA 3KBOA 3NYWA 3Q7QA 4M37A 3MWEA 3USCS 3D9XA 3DCYA 4DA4A 1R2QA 4RMNA 3T1NA 1TJPB 4LYFA 1PEYA 2GXQA 1J8MF 2FRXA 2CNDA 4L22A 4RD3A 4CGZA 5JS6A 2WYWA 5K8LA 5AKEA 5AI0A 2YU9I 4UPEA 4X7BA 1LVGA 3Q9UA 2ZRBA 5IARA 1AZSC 1JXMA 1KS2A 1A2KC 1X80B 4MRIA 4DM4A 1B1CA 4MGIR 2R79A 1YR6A 4DCOA 1ZRSA 3JALB 2AGVA 5FBWB 5CCEA 1Z2EA 1PNRA 3AGQA 1RIIA 4UNIA 1RMQA 4UW9A 2X9NA 2H9AA 3HO8A 2ONKA 2EEOB 3HM9A 4YRQA 3I58A 4D3SA 2W71A 1A9ZA 3QKRA 2HA2A 2XVAA 3GA7A 2WWIA 4W9RA 5DV9A 3QBTA 3OE1A 2NVOA 2YMQA 3K32A 2ANCA 3KAJA 4CL3A 1RLYA 3L7BA 1PR0A 2AOTB 4I1PA 3VTFA 1V5WA 4I5GA 4DMCA 2AEFA 4FFLA 5AJTA 3ERCA 3TX2A 1O4VA 4EG7A 1Z0FA 1X7HA 5F3RA 1AKRA 1HZZC 4J1QA 3IUNA 4FGKA 2J7PD 4OXRA 2IS4A 3IAEA 3JYNA 4EI9A 1U7PA 3MK31 5CM2Z 2QE6A 4V0NA 5A4JA 4Y1EA 1BQEA 4H77A 4KQ9A 2JANA 3ICEA 1T3SA 5CLLA 1X92A 4S24A 1Z0JA 3J80A 2JGMA 1E1CA 3HHEA 1OBCA 2B0JA 5ENZA 1GPDG 2EKPA 2FN3A 4B17A 2ASEA 3DTVA 1AZTA 2B5WA 3ZLTA 1VLMA 3KR1A 1P60A 5C1IA 5BQFA 1JHXA 4RK1A 4EKIA 4B3MB 4D96A 1F8UA 2O2HA 3I1JA 3IODA 4URHA 3KJNA 1O87A 1IB0A 4TZTA 5HK8A 4BCCA 5ITZB 1CDOA 1DO8A 1Z6GA 2P3OA 3UMYA 2X7XA 2PL3A 1PEKE 3FFXA 4UUPA 5DVZA 4WUVA 4YT8A 2OHHA 4RMHA 2CCGA 2CHQA 2X9VA 1FDWA 1EJ6A 2P2SA 1A76A 2Y1FA 4FD2A 2QRLA 2XMBA 4MV4A 4QOHA 4KUEA 2GJ8A 4WBXC 4AUEA 3MTIA 5IWAB 4DR7B 2C2KA 1U02A 4DMUB 5D8DA 4L6IA 3DOJA 5GIOE 1AS0A 3KQOA 4MEAA 4QDOA 2AVNA 4X41A 3BWCA 1MT0A 1XTTA 1P7ZA 2V8JA 1OZ0A 2YV2A 3FPAA 1GSIA 1F0YA 1MR3F 1QRSA 1QM5A 2AYYA 1QK4A 5HUJA 4BNJA 4JB8A 2EIXA 3A1TA 2XJ9A 3WL3A 1I3QI 1N1EA 1RXUA 3I53A 5CEFA 3QWFA 4O2LA 4B6JA 1G8PA 1ZOIA 1EDDA 3QKRB 3ZH2A 1NSFA 4RHTA 5H9WA 4D0GA 1FQOA 3PUKA 3GPLA 3FOAA 4WXMA 3RC2A 3HUDA 5D3KA 1DBWA 4RSRA 1E6LA 1A8HA 3AY0A 5COAA 2R0QC 1JPUA 1U8AA 2FJ0A 3EW9A 1S8OA 3GCDA 3OMXA 4ONEA 5DYIA 3GR6A 3W5DA 5D5PA 1KP3A 1L9KA 4ALNA 1K89A 3RNLA 2PA0A 1IRIA 3EZLA 4OHPA 1SCNE 2YYSA 1R50A 2E4YA 2X8WA 1SMYD 4NBVA 1YDMA 1LBHA 3WK4A 4YDQA 4FZ5A 1NUUA 4NG5A 3GJRA 4B81A 5BT8A 4M49A 1A2QA 4JQOA 4K40A 3L0OA 2ZR7A 3ESZA 4QO7A 5IH3A 3RC9A 3L2OB 3OICA 1E1CB 1SG0A 3FN4A 2R44A 5KTTA 2PUCA 2NN3C 1JFTA 2X86A 3UF0A 3EGEA 3H4MA 1NJGA 2CYBA 3HE3A 4NH4A 3E3NA 3ELWA 1T5IA 4BKUA 2WT9A 3BRQA 1ZIYA 5KINB 4RADA 5ALUA 5BY2A 3PC3A 4D0RA 1SQ0A 1NDHA 1Q17A 3FGZA 2UYOA 2VPTA 1EJ0A 2A9OA 1Y1VI 2HCRA 2TMDA 1HLPA 4PF1A 3W8DA 3GA0A 4D4KA 1X0VA 1Y5NA 1J0AA 1PTKA 4S2EA 3DO8A 4P08A 4FW8A 2VVTA 4CFZA 4R8LA 4ISCA 3V4ZA 1V71A 1HWYA 4DDUA 2XUAA 3QSGA 4I36A 3T4PA 1YB4A 3JWJA 2VEDA 5COBA 1V48A 1KXZA 2PL5A 3UWOA 3N8KA 3DFKA 3QXSA 3SZOA 4EHFA 3BJMA 3I28A 4KQEA 2R6FA 3HY6A 4UE3S 4ZT6A 3JVIA 2ZTVA 5A06A 2I9PA 5HM8A 4CRZA 3SNKA 3AINA 3Q8MA 1GGHA 1THMA 2CHGA 2Q4EA 3C3YA 3LWNA 3KIFA 3F4KA 4HG2A 1WMFA 1NNLA 4JWTA 1OFGA 2QD2A 4XX0A 4FN4A 3OLXA 5ARCA 3RS2A 2PT6A 1Q19A 2HGZA 5KMGB 3AFIA 1KTIA 2GO1A 4IH9A 1P74A 2CUZA 3NTRA 4HJXA 4IUBS 4MRNA 3OP4A 1CZOA 1EX9A 5FLKA 4AYWA 2G6GA 1U7UA 2LV8A 4YMGA 3BCSA 1WQ1R 5C4MA 2OWDA 3I05A 1Z63A 2ZUDA 2HJVA 3BFJA 3TQRA 5KEIA 1Z7GA 4X97A 4JLJA 1GTJ1 1RC0A 4OK6A 2Q1UA 3G02A 1N5KA 2ZJ5A 1QFMA 4P7KA 3LLVA 3V2UA 2ACEA 3AFNA 3H9GA 4Q3EA 4CNQA 1G2OA 3WADA 1WSWA 2JLAA 5DHSA 5TMBA 4WXHA 1CVRA 4JYCA 3C3KA 3SBDA 5IK2A 3AY3A 3VI4B 4E5VA 4EB8A 2XKKA 5D51S 2FHPA 3QBDA 5DW3A 4FFDA 4YCCA 2W2KA 4G9BA 4GNKA 3VPHA 4ZVRA 1EFUA 4L3WA 1S2DA 4EL5A 1Z06A 2RFLA 3OQNA 2HT1A 2NG1A 3URKA 5KCZA 3S8EA 3LRPA 7REQB 3MAAC 2RT9A 3I52A 2NZ2A 2Q5LA 2H0RA 3PC8A 5HKAA 2JPDA 2VDMB 5M04A 3AW8A 4INZA 4I5DA 4HN2A 3PJRA 4ZRDA 3ZS8A 1DZ3A 1TAQA 2YWXA 2R66A 4GKBA 2QREB 2EL9A 1DT3A 1X1AA 1DAMA 2NXCA 2ZBRA 1WA5A 1E1QA 2P6MA 3KOXA 4FSHA 3ZZTA 9LDTA 5EL0A 2VRNA 3ZLJA 2GDJA 2O5CA 4OB6A 4KAXA 4ESEA 4A6DA 1MAVA 2FYTA 4KOEC 4RTKA 2F3QA 4F86A 3BF7A 1YJWZ 3JARB 3M6LA 4LKRA 2R1ZA 2E48A 1RWVA 3A27A 1HEUA 3RGWS 3RRBA 3TQIA 4Z49A 2FMHA 5HWSA 3H2KA 4FTWA 1WLFA 1K66A 2VBGA 1JIXA 3LT4A 3OX2A 2C94A 4U1RA 3FB4A 2YINC 4F4UA 2QM7A 4D26A 2FUEA 3SVZA 1RRVA 2QN8A 2H1LA 3GTLA 3FOCA 3WBKA 3O2NA 1X8JA 3LZ6A 2EIHA 1YFKA 2YZGA 3TTUA 2F48A 2CLOB 5IDWA 1JIJA 4DLBA 5LYJF 2YIDA 3C87A 4MUYA 3BHMA 4FFTA 3JQPA 3RUIA 3STYA 1H2BA 4PS0A 1EK2A 3ZIAA 4A10A 3TDHB 4NPHA 5T67A 1TCUA 2B20A 2XOKD 2Z30A 2PLRA 3D6HA 1J21A 4RDIA 4D6XA 3OIGA 4XZ3A 4EW3A 3THYA 3C8UA 3LDFA 1A98A 4UAVA 2JGNA 2XE4A 5A2GA 3HMKA 3VZRA 1DINA 4M1EA 3QEMA 4HYEA 1ZCFA 2WJZB 3JWIA 4ARSA 4DDHA 3B3QA 4L8VA 4E15A 2J0UA 3BH7A 1O8BA 2I1VB 1UZAA 1IVNA 4NOMA 2R85A 3F8SA 3M83A 4R3WA 1U4NA 1WAMA 3M6IA 1D6NA 3LQ1A 2WU3A 2QPAA 3WP0A 4F06A 1NXXA 2WIJA 4JUCA 4MCJA 5I5EA 2FEWB 1QF7A 4K28A 2QXYA 1CE8A 3M34A 4V02A 1AC5A 3RGGA 1KYYA 1M6VB 2PZFA 2FZ4A 3PCRB 4IFTA 2NUAB 1E89A 3ENGA 4U9HS 4PLWA 2OO3A 2D7DA 4TQAA 5EFOA 5A3SA 1BEUB 3TG8A 3X2HA 3NV9A 5EWJA 2DP4E 2H4JA 2P0AA 4QULA 2ZWPA 3VC1A 5FTNA 1PWYE 1UP6A 2WE7A 5CVDA 3ZDXB 3ZI0A 1V9LA 4O8ZA 2NO5A 2C7QA 3M3GA 2FPPA 1K1EA 3HB9A 1ZWLA 3DUFB 1ZVJA 3VPSA 4ON9A 4A5OA 2QRQA 3PUVA 3RHTA 1M6NA 1MOSA 4A0SA 4DEXA 3STVA 3R75A 4MRPA 4C06A 5LXTB 2H8GA 3I01M 1DXOA 1F17A 1SHLA 3ELDA 4OQPA 4OUDA 2WG1A 4JYAB 2CLMB 2DHEA 5CT5A 1V5IA 1PJAA 3TD2A 3WGNA 1V9SA 2CMFA 2WILA 3FTQA 3CD61 3QY9A 4MJ3A 4TGLA 2IOFA 1K92A 2JJ8A 4BN0A 4DE5A 3PJDA 1R4MB 2OZLB 3G1TA 4JLPA 4EFMA 3R9IA 1N5LA 1QJCA 2QDXA 4F11A 2XNCA 1VJGA 1FS6A 2EJBA 3AFGA 2JKZA 2P62A 3NI2A 1NJI2 2KI7B 4YMSA 1XKQA 1QOQB 2PXAA 4AAYA 2XMQA 4U3JB 4ZANA 5HA5A 3BD7A 1L8AA 4G0XA 2OYSA 4YQZA 3FKJA 1XF9A 5AVTA 1GGJA 1RXVA 3AWDA 3LS2A 1CR5A 4UKDA 4IZ6A 4MUGA 4L9RA 4QARA 4TV8F 1Z88A 4R1TA 1IN6A 3HYLA 1AUVA 1IBRA 3KD2A 3GX1A 1O2DA 4FMCF 3NTXA 1GARA 1C7EA 2FOIA 2ZJFA 3MIZA 3HM2A 5I01A 1OZHA 1X1RA 1KO4A 2YTZA 3QG1A 4RVDA 2QD4A 4PVDA 4UUAA 3LP6A 3S4YA 1SPXA 3CLHA 4KRGA 4L8WB 1EMDA 3G7SA 3PNLA 2KWIA 4UXHA 5JAQA 3QF4A 2ECOA 3EAFA 5I9LA 3HZZA 3BKXA 3LUBA 1G1AA 3EFBA 3T12A 2CLLB 3QMPA 5BN4A 3F5DA 4RV9A 4B3FX 3TNDA 1GRVA 3ILVA 3P1JA 1M2GA 1G16A 1WUIS 1AGNA 2Z1DA 1EXWA 4G85A 2BM8A 1HZJA 1O57A 5GM2A 1NAIA 3MMXA 2QRZA 3K0CA 4K2HA 1QVAA 3F4LA 2PS9A 4HBGA 4KFRA 1US8B 1EUDA 4F04A 3ADOA 4W5OA 3G68A 2DCUA 1G63A 2O3UA 4DLTA 1UOPA 1CPYA 1OYYA 1VZ2A 5IANA 3CQZI 3E22A 3EHEA 4GT1A 2NZYA 4TS9A 3CNNA 4A6XA 2OCIA 4HQ6A 3BMQA 4MJXA 1NVXQ 1ISSA 1Z4KA 3UYKA 4BCBA 1E8MA 3AJRA 1BXRA 1A50B 1YHZA 2IEZA 5FTWA 3P52A 4MX8A 1NRWA 5DBOA 5HIMA 5CFZA 4BNHA 4HGYA 3PFCA 5GV7A 2PZKA 1N2ZA 2J5BA 1A71A 1HI9A 3CH7A 3R6LA 4NDAA 3UV3A 1VB5A 1XQ1A 2NVTI 1PHRA 1U0FA 2YV3A 3EQ2A 3QOWA 3TTSA 2IY9A 3MGGA 1L3IA 2RAFA 4EYQA 3FXAA 5KHOC 2LPMA 4NG4A 2ZBPA 4OJQA 5F23A 2DT8A 4L07A 5D1HA 1O7JA 4JCCA 5ALIA 4LTDA