2IVFC

Ethylbenzene dehydrogenase from aromatoleum aromaticum
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
MKAKRVPGGKELLLDLDAPIWAGAESTTFEMFPTPLVMVKEVSPFLALSEGHGVIKRLDVAALHNGSMIALRLKWASEKHDKIVDLNSFVDGVGAMFPVARGAQAVTMGATGRPVNAWYWKANANEPMEIVAEGFSAVRRMKDKAGSDLKAVAQHRNGEWNVILCRSMATGDGLAKLQAGGSSKIAFAVWSGGNAERSGRKSYSGEFVDFEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ETHYLBENZENE DEHYDROGENASE ALPHA-SUBUNIT
publication title Crystal Structure of Ethylbenzene Dehydrogenase from Aromatoleum Aromaticum
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 214
sequence length 214
ec nomenclature ec 1.17.99.2: Ethylbenzene hydroxylase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09459 EB_dh Ethylbenzene dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ivfC00
1ULVA 1I82A 1I8UA 1UG9A 2IVFC 1I8AA 4JPQA
chains in the Genus database with same CATH superfamily
3NSYA 4FTDA 1BAWA 3QR1A 3U25A 4F57L 3QO0A 1F2QA 4ELMA 2OMWB 4H8WL 4XWGL 1Q9WA 2CUHA 4LSTH 4OZHF 3BCDA 3M7FB 1FZJA 3HMWH 3Q48A 4ES9A 5D2NE 1BEYL 3LMJL 4G8FA 4NIKB 2GTZA 3KH3A 4OCYL 4PCKA 2YRLA 5FOBA 2EC8A 2FIKA 1T5WB 3TH2T 4D7BA 4RGNB 5MENE 4JQXC 2V7HA 1MIML 3O9WC 4RCAA 4TTDD 5JPNB 1CFTB 2HTLD 5I8CB 2LOEA 1BLNB 3ZUCA 4U2YA 1N2RB 4WK4B 4LRNH 2YUWA 1BMZA 1BHGA 4H1LB 3QA3A 2VMCA 5E5LA 3KYMA 3SD5A 5JIMA 1QBMH 1T66C 3N6YA 2FLBT 2ZUQB 2PCPB 4K23H 4LDEB 4XTRC 1U41A 2XKUA 3QG7H 3RWEA 2ZX8A 2HN7B 1T04B 2NY1D 1DJHA 1CR9H 3ULAB 3CZKA 2VLJE 2WQUA 3PL6B 3CFJA 1YN6B 2VJ0A 3L08A 3S35X 5CSBA 3L3DB 4ZDHB 1OZTG 5EUKA 5I9QB 3RVVD 4N8VA 1OP5K 4NKIL 5E8NA 4WFGD 1I85A 1YUKB 1Y18B 1W15A 3UBXG 3DYOA 4HG4K 2ED8A 2NRDA 3AS2A 1J9SA 4NBZB 4HJEA 4LLDB 2YEZA 4FXTA 4FLQA 1UATA 1N5AA 3T0EB 1NCAH 1XD0A 3OXRA 2VLJD 3TFBA 3BH8B 5TH2A 4PJ6A 4PWKA 3HNTH 3SBWC 4UUJA 3C5JA 3CSTA 1V55B 3EOBB 3IPBA 4NZTH 1N6QH 1WWBX 4IBQA 2Q6WB 4D9RE 3D39D 4X5WB 3CG8A 4JB9H 4NC2B 2J8OA 4P2RB 4GJTB 3NESA 4R5TA 1NGYA 1Y6KR 1IBGH 1NGPL 4YHOL 3P4NB 4OZGB 1OTTD 3OBAA 4M29A 2EDJA 2YMXH 4YK4B 5DWUH 1MRCL 1VEPA 2VC2H 3D51A 4QUOA 4EZJA 3VQ1C 3IGKA 3MCKA 4YSTA 2FHCA 1TDQA 3SHSA 3LPOA 3KPSE 1KXQE 1U8QB 4NWUH 1LJMA 4B9FA 2R69L 5I18H 2ENJA 3MHZA 4ONGH 2NY3D 1FVDA 3N9GL 4TOYH 2DZEA 3O2VH 3CMOH 4OT1L 4YHPA 2NSQA 1OAYH 4QPEA 4L3ED 2BSTB 4I0PC 3UROR 1P2CA 4LL9A 4YHZL 4AMKL 2O6CA 1OW0A 3S96B 3RTLA 3BAKA 4JREC 2KC0A 2AV1B 1BXAA 3HS0C 2ALWA 1ILSA 3IE4A 1NAML 2VUKA 3MV9B 4D8PA 4L3CA 1JJUA 2UUDH 4LIQH 2GUYA 3C5ZD 4N90E 4PYGA 2CO4A 3CIAA 4PJAF 2V5MA 4WU7B 4QJ5B 1AJ7L 2KERA 1DJWA 4FNUA 3S5LG 4XNMB 4Y9CA 2CKBH 3VXTA 4WDIB 1NIAA 5JQIB 1FO0A 2BSRA 2KQNA 4C83A 1FNEA 1DEEA 5CWSB 4IRZL 1JTPA 2K70A 4L5FH 1EXHA 1MFCL 2O5XL 3IAPA 4GBXB 1S7QB 4KJWC 4X4ME 1EJ6A 3NCEB 2XWTB 4JQVA 4EPSA 1FVCA 3DV6A 5GGVY 2PYEB 4FFTA 4JZJB 5TDPA 3LQZA 2ZUSA 2Q86B 3IDIB 1J0ZA 2NYKA 5C6TH 2XYBA 4IQHA 4HX1A 1KFAH 3DK0A 4HS6B 4K0OA 5D55A 5CXPA 3O9WD 1UG9A 4MCNA 5D9SA 1OE2A 4F7PB 1CICA 1IGTA 3ZVVA 2QKIB 4MJJA 5CGMA 2WLNA 1YN7B 1BIHA 2CRZA 4Z18A 4APQB 2XTJC 3OKDA 1Y07A 1I7ZB 3UERA 3KPMA 2YPVH 1T66D 4OF8A 2EYRB 4NRXA 2OK0L 1UADC 4XTRD 1DVXA 5KN5A 2UWEE 4M8RA 3FO0L 2UX6A 3QFJB 4GYBA 3LKNB 3PGFH 4KO7A 1NPNA 2ZD0A 1ACYL 4AYGA 2X0WA 4O2EA 5EC2A 1P4LB 3B9KB 1XH2A 3SJVD 1ZT7A 4C54A 2QDVA 3E8UH 3O2DL 3F12B 1RSFA 3UTPD 1OTSC 2HFEB 5KBMA 2YEQA 3A5VA 4NGHH 1KELL 2N3JA 5EF3A 1HE8A 5L88L 2X4UA 1RLWA 4WTZG 5KW9L 3B34A 2K6ZA 5I1EH 1A7RL 4P5TC 5D5MF 3WY3A 3BUPA 3P9WB 1IGJB 3U0PA 3W82A 3CH8A 5ALCL 1XF2A 1M4KA 4PREA 4N1CA 3R18A 3PWNB 4PIRF 2XVBA 3EG9B 3TBCA 1HFUA 4ODTL 3MOQA 1RPQA 1FN4B 1JK8A 5CJ8A 5FFOA 1V27A 2JTDA 4Y5YC 3TTSA 4MA8H 2SODB 4FCHA 3STLB 2WVUA 1MHEB 4AQ1A 5J1TC 1TT6A 4NUGH 5H94A 4PRHA 3FU3A 4AQ8C 4G9FA 1ZWIB 4HCRH 4I0KA 3G6DL 4LU5H 4M6NL 2R4RH 5T5FH 3VXSD 1BZ9A 3LKQA 4KU1A 4M5ZH 1JNNL 1JDDA 1CE6B 4L8SB 1L9OA 4CMHB 4LSRH 5L8LB 1CL7L 1J0HA 2MIZA 3WENA 4B6ZA 3QO1B 2Q8AH 1ZGLA 1YYCA 2OTWA 4N2LA 3EYFB 1SQMA 3PXLA 4I0PD 4KFZC 5ACZB 2GABA 3EH4B 4BRVA 3SPCA 2PPAA 1S2EA 4JUSA 1IBHA 1RU9L 1ZHBA 2NY4C 5CEZL 2XLLA 2SEBA 4G71B 5TE7H 1F4AA 4RDQG 3LVTA 3NTCH 1DVQA 5AW7B 3X2QB 3CZFB 4AITA 5D2LA 1R3LA 3FUHA 4TTGA 1JFQL 4YPGB 3K6NA 4X7EC 4HQQH 1DUZA 4YXHL 3VM5A 1EANA 1Q0YL 2C7FA 3GDCA 4ZI8A 2XACC 3KYKL 4S1SH 4I1NB 5C0DB 4FKEA 4FTVE 5C0CB 4KJWD 5AW4B 3K1DA 4WVRA 5B39A 1R17A 5L7XH 1NM9A 3OMZA 2ESVD 1YEEH 5DFAA 3CDZA 4HD9A 2GSIB 4PRBB 5F9WB 4WKZA 3LPPA 2WGNB 3TJPA 3I9GL 4D0DA 2WTRA 1ZHKB 1Z9PA 2WVTA 3L16A 3CK0H 1FZOB 1MCKA 3ZZQA 1OCOB 4IRSB 1NBZB 3GUTA 2BC4B 1NMAL 5AKTA 3S97C 1KYOJ 2XTJD 1NGWB 3OHMB 4FTVD 3UTZA 2Y6SC 3FU8A 3OHXA 5CSZB 1MFBH 1C8PA 1WGVA 1NM4A 4GRMA 4PLNC 4QF1B 4JG1L 1LWRA 2EKSB 4R7VA 2XWRA 5ANMB 4H20H 4KI1A 1N18A 5CCKL 3GSRB 4BZ2A 2V3DA 1PLAA 2VQ1A 4HEME 3GRWH 4PJEB 5ESAB 3VB9A 1IV8A 2YIHA 4JG5A 4XMKH 3SCMC 4HP5A 4XP6H 3RBSA 2GFBA 3HI5H 4FHBD 5DQDH 1ZPLA 4XNYL 1F1AA 4XCYA 3ABZA 1L0PA 2VO5A 2DWEB 1BQRA 1OTSD 2HVBA 5TFSH 1M3JA 3TO2B 5HY9B 1TCMA 1P5UC 1VGKA 4YE4L 1FSKC 3OG4B 2XUWA 4P5TD 3S3JA 5I26A 2BNQE 4NO2B 2VUYA 1N5YL 4PJIF 4O2FB 2YAQA 2WHVA 1G94A 4GRWB 4YLQT 3O8XA 4M8UA 4JY6B 1RFDH 4OCSL 4DW2L 2AFNA 1FVEA 2E56A 3IETB 4BXVA 3QRLA 2DTSA 1TVBB 1H6EA 4H5SA 4NHUB 5GGTL 5SV3A 3OB0H 1KLUB 1NC4A 1Q72L 4DO6A 2VABA 3OAUL 1PW3A 1R3JA 5E08L 1RULL 4GMSH 3PDOA 4HUKB 1I9JL 1KV3A 3EOYG 1GOHA 3IKCB 1CE1L 3LZFH 1VSCA 1FZKB 3SQOH 3LV3A 1NANI 3F64A 1JXFA 2BCKB 1CVSC 2DQEH 2NY4D 3B7YA 5EZLB 5SWZE 1Z3GL 5BRZB 2NW2B 3AFLA 3VI3E 4H2CA 4FGMA 1TTFA 4EXKA 4ZPVA 1Q1JH 1A6PA 4PGDA 1H3WM 3CFMA 3GMPB 4MJ6A 4YHLL 2H8PA 1ZVSA 3G7TA 2PABA 1H5BB 4Z3TA 5IT2L 3MV7A 4IK6A 1E6JL 1S8DB 5DRZA 3WTYA 1XD1A 1N67A 4L48A 4QOKE 4ZFFA 5KBLA 4K2UH 1OW0C 4PRNA 1NKOA 1T3FA 2X44D 2A77H 1QHPA 2CALA 3QUKA 4RGMC 3F7VA 4UNIA 5SX5H 3PGDB 3L95B 1T2QH 1AGCB 2PW1B 2XQYA 3QJUB 4L4TE 3VRJA 2ZP9A 4OZIA 5D7IA 3BZEB 3FUIA 1E9PA 3K6FA 2WKGA 2RA1A 1IIKA 4F8QA 4L9DA 1UA7A 4ZOEA 4F7CB 2PYFA 3RWDB 4CDGC 3RKPA 4G8IA 4UAOB 3IB4A 4LIQE 1X7QA 2Q7YB 2Y6SD 1QYGL 1B2WH 5L4IA 1JG9A 4HS3B 3T0AA 3V0VA 5DS1A 2C9UA 1AO7A 2VMJA 1FL5A 4H40A 4NKDA 2A99A 2ZP8A 1QNIA 1T21B 2IDFA 3SY0A 1SLVA 3MREB 1CD8A 2EACA 3D4ZA 2Y7QA 4L5FE 4GSDH 4HH8A 3H2PA 3V0AC 5I2IB 2W9DH 3S34H 4PJGA 2ARJQ 4DP6X 4EMZA 3MLVL 1IO4C 1MNUL 5ITBH 1BLIA 3QEGL 1IGFH 3KPPB 2WWMC 4YQXL 1WA1X 3SCMD 1AZBA 2GUOB 3CFDA 3TO4C 3ZQWA 1J8HD 4HSQA 3BQUA 4AM0B 3SGKA 1RJLB 4H8QA 1JPSL 4ZS7L 4AL8H 1GGIH 2CAKA 4MMZA 3ZE2F 2WUCL 5D71L 2YPKA 1NC2D 4TYUA 2HKHH 1OCRB 3OKMB 4AQEA 4ZD3H 4XO3A 1HN1A 4YFLF 2EYSA 5IROA 1TENA 4ENEC 2G9HB 3Q1EA 2DN7A 3K0YA 1YO4A 3DX9B 2JCCE 4FQQB 1CPUA 4TRPL 4MMYB 2WZPA 1A7PH 4RDBA 4YE0A 4NNPH 5A2LH 3APDA 4MYWB 1TZ8A 4ALAH 3WS6C 5SWQB 1AOZA 1U3JA 3DETC 3KNBA 1ZT1A 2G3NA 4FZEL 1GGUA 1PCSA 1ZANL 2RTTA 4PY7B 4QRTA 1TVDA 1YEJL 2HP4A 3LD8C 2YSSB 3HE7A 3ARFC 1MWAL 1EEZB 4CSTA 3MRHA 4DN3L 2B4CL 3ESMA 4BK5A 5E00B 6PAZA 3QEQA 5AKSA 5GGRA 1WZ1H 2IGTA 4NCC1 4X7TA 4KZEH 5KSBA 3Q13A 2E27L 4LLWA 1X9UA 5DRXB 4JO3L 4PI0A 1QVOB 5HHOA 1YYLH 1Q9KA 4RWHA 1KCBA 3AM8A 2I24N 1OP5H 1IAOB 3CC5A 1J8RA 3V5HB 2WLKA 2YN3A 3CLEL 1HILA 1A47A 2EDBA 3MRQA 4N85A 3WIHH 4EUPA 2EE2A 5IHZA 1P4BH 4CVXA 1XSOA 2R0KH 4JFFE 2N7SA 4AQ1C 3GSNH 4KHTL 2GJ6E 4KZCA 5IB4B 2ZCKL 4YGVB 2AANA 5IJCC 4BUHA 4BWWA 4XBGB 3VRLF 4JFTA 2DQGL 3EFOB 1A4BA 4QT5A 4CBZA 2DQUH 2YEVB 5FS5A 3GHBL 2R56H 2XZAH 2XPGA 2ZXGA 1DBBH 4V33A 4K7FA 3CAFA 2B9AA 2Y07L 4MHHG 2C9SA 1R3HA 1PDKB 2Y3AA 1DBAL 1XZWA 1NOFA 2VL4A 2IGFH 4K5OA 4MKMA 1MVFA 3U6XA 2WKOF 3UGXA 4JFFD 2FBJH 3BEWB 4JCWA 3LY6A 5KS9A 2AK1L 3VH8A 1MWAB 3ZLQC 2EYTA 4N0UB 4MWFA 3QIBC 4KO9A 2LFGA 3EAKA 3GF8A 4DESA 4OV6F 3ETBJ 4OF7A 1BV8A 1NLBL 2WXPA 3D3VA 3RNQB 3TT3L 1UT1A 3MXVL 4UZGA 2R2HA 3A47A 4PJ8B 4RMRA 3UH8A 5T1DL 3HC0A 1M7IB 5FO2A 1YEHL 2Q1EA 3J8F7 3P73A 4M3HA 5LGHH 4D7PA 3Q6FB 3Q3GB 4PU2A 2VZ1A 4WEUD 2PW2A 3DVNA 4UAHA 4CGUB 3U48A 4N6RB 5F1NB 1ZT4B 1UM5L 2BY0A 4XXWA 4BKLA 1KPRA 4NO0B 1L3WA 4PJDE 2X9XA 1S9WB 2KHAA 3B7SA 4DKDC 4JBSA 1LMIA 2H3KA 4M00A 3VD7A 1FYHB 5SWSB 3RWGB 1JRHI 4WGKA 3X14A 3VFPA 2WWMD 3FCUB 2V33A 4K94H 4MLIA 3R0MA 1PNCA 3TO4D 1CFQB 2EVHA 2GSGB 1G9NL 2C3WA 5H35A 3QQ4B 1U9KA 3QULA 2VWEC 4Z3IA 1WTGT 3OHXC 2WQWA 4KTEH 3EOAB 3OGCB 3AGWA 3TA4D 3DJ9A 3KJ4C 2WNXA 4K3JH 4AK2A 1DN2A 4J2QA 4TVUA 4R84A 3ULVH 1GYAA 2VDQH 3ATEA 3VI4F 3EYOB 2AABH 3KYAA 4D8OA 3SY6A 1ZLUK 1G7QB 1A65A 1JPGA 1NGQH 2MQGA 5DJ6B 5LJYH 5HVWA 2MQ3A 4E5XB 4FQLH 2I69A 3U7AA 1XF5A 3DETD 2J12B 4C55A 4Y2LA 2H47C 3QNZB 2P42B 2WQXA 4HWZB 3HI6H 3ARFD 3SOBL 3TEWA 4BFIA 1YJDC 5DD1H 4ZX6A 1S7SB 4KVPA 5I1KL 3PS6A 1QEWB 3MGAA 3QE5A 3TIDB 4AT6B 4OD3H 1IM3A 4P48A 4L23A 4WAFA 1O7SA 3RPBA 1SYVA 4R4BB 3IMRA 1YEDA 5FYLD 2D03L 4MQ7A 4L0YA 2IDUA 2FGWL 3WLWC 4DTGL 1WG3A 3FKUS 4DIXA 2KYIA 3I3DA 3NCYP 2AAAA 3BIAX 2QR0B 4OBSA 3ZKXB 4RRPA 5HHPB 4MAYA 1SDDB 1WT5A 4KOCA 2PTTB 3QUYC 3QAZC 3V4VB 3WUWA 3NCFB 4G9FD 3EW3B 3GBNL 3ESOA 2EE3A 3LIUA 3QRGL 3ZU8A 4EF3A 1BQKA 5BO1L 1I8MA 3RWJB 3R7QA 1RJCA 4KRMB 1S5IH 2XC8A 4RGOL 2Y6TE 1QQDB 1TUPA 1QI3A 4WTWA 4YR6A 3KLHC 4TL4A 1CURA 4Q52A 1A2YB 2Y7OA 1X5GA 3ATDA 5DVPA 5MEQB 2AQQA 3DOHA 4ALAC 1PIGA 4Z0BL 4B53A 4DF9A 4ODSH 1RZJL 5LBSL 4ODBD 1U42A 2CBMA 2BNRE 4XRCB 2QKSA 3LNHA 4N8VG 4UOW0 1NCBL 3VG9C 2OR9L 3QIBD 3LRSB 2VT0A 2YFNA 3VVWA 3NPSB 4TSAH 1T5WA 5HD8C 1E43A 5JPNA 1FWXA 2J5LC 4AYEC 1CFTA 1RK1A 4TN9A 5I8CA 1RVFH 4YDMA 2W91A 5C0RL 2PR9A 5DZNA 4BRJA 1N2RA 2EUVA 3UOAB 5IMLB 3TCLB 1X6LA 4EN2A 4HSAC 4H1LA 3T3MB 1ONQA 4LOFA 3UDWA 2PCPA 1B0GA 5EZOH 1FGVH 2AJ3B 2OZ4A 2DMKA 1JPST 3SD2A 2HN7A 1HT6A 3BVVA 1N12A 1T04A 2E8ZA 3NRQA 5F72S 5GS0H 4YSRA 3WV0A 4JO1L 4IRJC 4X9FA 1HESA 3ALWA 4N0CC 1U95A 4BFRA 3PL6A 2K7QA 5AAWA 1YN6A 5ID1A 4B41A 8FABB 5DR5H 2B7DT 3U9WA 4R97B 3LQAC 1AFVH 2P8LA 43C9A 3B1TA 1VRSA 1YUHB 2CO2A 5FECB 1ZLEA 3BIKB 4NRZB 4AYID 1S7XB 1Y18A 2HG5B 3OVUB 2VXTH 1XZ0B 5DXWA 4JPQA 4LLDA 1WGOA 4ANUA 5D93B 5FUCC 4XOBA 2DKMA 2PPFA 3KGSA 1TQTA 5KVEL 3FQYA 1OY3B 3ERXA 1L3NA 3BH8A 4OIBA 5FUZL 3L3HB 3SQRA 3HRZB 5CM1A 2FLRT 4OD1L 4O02B 4H0LC 5FXCH 3V9FA 5ADOH 3SPVB 2Q6WA 1SUJA 4X5WA 3BQUC 1T1WB 4P2RA 5D7KE 3LKOB 2WZ5A 3P4LA 1SHWA 2DS4A 4PS3A 2M83A 4Y9FA 3ZL4H 4MMZC 2K6WA 4UNUA 3VGFA 3P4NA 1AQKL 4OZGA 2VDMB 4F92B 4WFFD 4AV0A 4DFIA 5IF0B 3X3GL 3WNMA 2VL5B 2ZG3A 1GIGH 1ZA3B 1IAII 1CI3M 3GNMH 4MDRA 1SY6A 1YQ2A 3GB7B 2BFVL 1MF2H 4KRNA 1G9MH 3MLZL 4OZHE 4ZAKB 5IW3A 3B9EA 2BSTA 4RMWA 3M7OA 1FFQA 1MJJB 4I4WB 1N6UA 4LASL 4I3GA 3MRRB 4DN4L 4XP1L 1HX0A 3E2HC 1D7BA 3S96A 1CLOH 1I9IH 2AV1A 3PWUA 1XVSA 5JMRA 2DQJL 3QUYD 2YPLD 3HE7C 1GGTA 2OMYA 2Q76B 1NC4D 4UINH 3U4EB 4U1IB 3MV9A 4BK5C 2WBXA 1TYRA 2AQPA 1AD0B 4KVCH 3WEXB 4NOFA 4EAEA 3Q8EA 4JMNA 4JFUA 1C08B 4WU7A 3ULVC 1UYWL 2W5PA 1XXFC 3HC3H 2O1AA 5D1QE 2YA0A 5HXMA 1JNLH 4P8QA 2YKLH 4RFOH 4UQ9A 1PD1A 4X50A 4G8EA 1QLEH 5IB5B 2PUQT 3AM8C 4FQPA 5CWSA 1DFBH 1T6VN 3P3UA 2DPKA 2WLJA 3P9LA 4KXZI 5G5DB 1ADWA 4I87A 3KLHD 1TTUA 3O6LL 3R1GL 4ZMZA 4GG6F 1I3RA 3HC2A 4GBXA 1DL7L 4NLAA 1HHJA 1S7QA 3BDBA 3IAGC 2XWTA 4CVZA 5AENA 2ISDA 4UB0L 4JZJA 1KG0B 4KMTH 3PP4H 2Q86A 3BKJH 3IDIA 3IS1X 1U3NA 4R7DB 1NUGA 2HFGH 4HS6A 3R0NA 5HD8D 5FPIA 3PU7A 4JFDB 3WEMA 5T33L 3CHPA 3MA7B 3QDGE 1ZHNA 1U8JA 3FH7A 4FQXB 1A0QH 4NZRH 2LU7A 4APQA 4WUUB 1DFXA 4WW2A 1PPIA 3U0WL 1N70A 2WLIB 1I7ZA 5DVOA 1BX2B 3N5AA 5TPWL 1FHGA 1NBVL 3AT8A 3QPXL 1B2YA 2OTUB 3MLRL 4R7NB 3SDXF 3T4YB 2XZCH 4V1DB 5ECGA 5B7EA 4J3VA 1HKLL 4FRWA 3D7PA 1KJ2A 3LS5L 3Q5OA 4A2FA 3QFJA 4PSRA 1EJ8A 4IRJD 1G0DA 3X1GA 3FB6A 4N0CD 3NBNA 4ZSOB 3WFCH 3Q8AA 5H2BA 4H44C 1F58L 1HINL 4RNRA 1KBWA 1OAXH 5D72H 5F9OL 5B3SB 2OI9C 5I1IL 3VRIB 3LX9A 1IEAB 3P77B 2LFEA 1UXWB 1MJUH 1ZS2A 4MQSB 2JSFA 3F12A 2Y7LA 1TZGH 4A38A 1MCLA 4M93C 1CFSB 1RIUL 1WJ3A 4P23B 3P3YA 5I6PA 2PWGA 4R4FL 1E4KA 3QS3A 3GIVB 3DVIA 3S37H 1NBCA 2PMZA 5GRVL 3T1FB 1IGJA 2QLVB 3BFOA 3GQFA 4P9HL 5CINL 5I30H 1BOGA 3QQ9C 5BS0B 2IWGA 3PWNA 2DMHA 3OC8A 1RURH 5JHDB 2CZNA 4EOWL 3MNDA 4N4YB 1WRFA 5AKVA 3W0WE 1LLAA 3V5KB 1G9HA 4TLSA 3STLA 4PCYA 1MHEA 4PJAE 4MRBA 4NT6A 5DS8B 4FAAB 4KFMA 1KIQB 4FYRA 2DM7A 5DT1H 3TEXA 3NIDE 3L4CA 4N86A 2IH1B 3MX0B 5I1GH 1CE6A 4L8SA 5B39G 3ZT6A 4HKZB 3AMLA 2P5WB 3QO1A 4J39A 1W8OA 4HGKC 1TOXA 3G6AB 2M1KA 1RIVH 1C5BL 1L6ZA 4ODUB 2N56A 5GZOC 4H8UA 3FUMA 4KGJA 3D30A 4XOAA 2JV6A 3HE7D 2HVJB 3CFNA 3VYOA 4DGIH 2LT9A 5ERWB 4JFEB 2C9RA 2QQLL 4JO2L 2JELH 4PJ5D 2DWXA 1JYWA 3ULVD 4S1RL 2OZNA 5LB1A 5IIEB 2VLKD 2GJJA 3BZDA 4O4YL 5FM8A 1WS7A 5LBGA 4DGWC 4GS7B 3I74A 1IBZA 1XGTB 2B2XL 2DWYA 4CW1B 2VUOA 5C0DA 3ULSB 5C0CA 5FHAH 2VR9A 4HIXH 4J6RH 1EA9C 2CXKA 1FQ9C 5BOZG 2XN9B 1WT5C 2UXFA 3EYSH 2VDRL 2GSIA 4PRBA 4QYAA 3NA9H 1CT8B 1OALA 1OAQL 3FB8A 4UBDC 5J4MA 1ZHKA 3W38A 4WWKB 1FZOA 3L81A 1XMWA 1R47A 4YBLB 4IRSA 1NJ9B 3SDYL 4MDIB 2MOQA 1SJXA 2BVEA 2BC4A 1HAUA 1PF3A 1OPGH 3EJCA 1G9MC 3LEXB 4HFWB 1AI1H 4IKKA 4CRPA 4LMQI 5GGUA 5JW4R 3UTTE 1G7IB 3HS9A 5FYKH 5J13B 1RUQH 1QW9A 1OQOA 1NUDA 4MCMA 4LCCC 4F2FA 5D5ME 3TZVC 1DBJH 4OQ1A 2DL2A 1R34A 4QF1A 2BO0A 1IM9A 4BA0A 4OI8A 1QFWL 2OMVB 4QGTA 5ANMA 2DMCA 3MV8D 3HMWL 4UZSA 4A7QA 4PJEA 3TN0D 4UMGA 2K6YA 1IKFH 4X99B 4F8OA 1UVQB 2VM9A 1S4IA 3Q1SL 4E36A 3SKMB 2WQVA 1ILUA 4WHTB 1I3GH 1WS8A 1RUMH 2NT0A 4DP9X 1ZD6A 1CBVL 2DWEA 3OLIA 3SYPA 2P47B 5I71B 2NNAB 3IEAA 5EZIL 3TO2A 4G9DB 5E8EA 5HYSB 4N2EA 1T4KB 1JSYA 4LRNL 4MJHA 3EHBB 1PAMA 1KPUB 1PLCA 1QPXA 4JHWH 4WI6A 2BOLA 4ODVL 5IWLA 1ASPA 3FFDB 3OGOE 1FF5A 3JWOL 1E9QB 4XH2B 1TXKA 4NO2A 1U8PB 4O2FA 2C9QA 2XI9A 5AAWC 3QQ9D 2XJKA 2ZE0A 3F58L 3UZQB 1N4XL 3MJ9H 3PIQB 1LTXA 3OWRA 5I9QC 4UV7H 4F7KA 3H55A 3CDGB 2DTMH 4NDMB 2N1TE 2ZPKH 3IETA 3VXRD 1YYMH 3FHAA 2DLIA 2O6DA 1TVBA 2E3VA 3NAAH 4NHUA 1X3DA 3MUHL 3N43F 5EU4B 4HBCH 2LAGB 3L5WB 2DW5A 3ARGB 1MJ7L 1CFMA 3QZBA 1XR8B 2E9BA 4QHPA 5IP4A 3A67H 1UWFA 3IKCA 1JV2A 3TV3H 3X13B 5G4NA 2YD8A 3IXTB 4ONFH 4KNUA 3GXUB 3PUUA 2PWFA 4BJLA 2E59A 2L7QA 2XQYG 3FMGL 1YEKH 3IDYB 4HKJA 3HNTL 3PWPB 4LLAA 4LSVL 3JVFC 3VTAA 4OLXL 3S4SB 5GZOD 4U1LA 2ADIB 3ULUL 4MYPA 5F7KC 3C08L 3QNYB 4WUKH 5CHNA 3QPQC 4ZTPH 5EZLA 3EFDL 5BRZA 2NW2A 4FXGB 3QDAA 35C8H 4GKNB 1WFNA 2DWSA 4PIBA 3NCMA 4GW4B 4G43B 4YSQA 1WA0X 3GMPA 5D2LF 1ZLUH 2GJPA 3LKRB 1TJXA 2CJ3A 1LO4H 1UWXH 3ABGA 3HG1A 5D70L 5T3XD 4G7VH 4ZMLA 3BFQG 2DYPD 1F6FB 1JCVA 2ZT9C 1YVLA 1J12A 4XN2A 3WO4B 3BPOC 1ZLVK 3TPUA 4AW7A 4YSDA 4EQ2A 3D09A 2V2XB 3IFNL 4E9VA 5IEKB 1F6LL 4KX9A 1S8DA 2JMRA 2V2TB 3ARBB 3SE6A 3T71A 1CFVH 2FR4A 4YDLC 4OFIA 5I0XA 4IBLT 1JZ2A 4MZ3A 5JXAH 1DVUA 1SEBB 3PGDA 1OP4A 3L95A 3CSGA 2AQ1A 5DRWA 2BWIA 1OLLA 4RIRA 5K59E 1Z32X 4UBDD 4Y19B 2XKNA 4FG0A 4GP8B 3HJ0A 3GDBA 4R7LA 1EO8H 2FECI 4L4VE 4F7CA 2DJSA 4LIQL 5T1LA 2Q7YA 2B1HL 3DMMB 3D50A 4HS3A 2CKBL 3D33A 1QZNA 4KK6C 4ZMVA 1K5NB 3VTMA 5KOMC 3D6GA 3D18B 5MEOB 3FFCE 1CZ8H 5KUMA 3TZVD 2AERT 5AZEH 4LVHC 4TQIA 3MREA 2B9BA 4PJIE 4L5FL 1G1KA 4LQ1A 5BUPA 4IM8A 3EH2A 5I2IA 4HWBL 3HVDA 3PP3H 1TTBA 1VADB 2X2IA 3H4HA 2FJFB 4B60A 3LPWA 3ZHNA 3BAYA 1QUPA 3JXAA 1KCWA 2GUOA 1W72B 4PG9A 3S6CA 2OPCA 3II1A 2AJVH 4AM0A 3P30H 2CE6A 3H9ZA 3HRPA 4WW2C 4G6MH 2YWZA 3WXVL 3AT9A 5DHYA 1UJTA 3WN5B 5CU9A 1AR1C 3OKMA 3UJJL 1AGEB 3UTSD 4XP9L 5DVMA 1KN4L 4UM9B 2ZYIA 1UKSA 3UEZA 3O4LD 1A7QH 4PJ7B 5JIQA 2NY5H 2G9HA 4L8CB 5CUSH 4EUPG 5CLZA 2C9VA 5A40E 1UH4A 3T4AA 4FQQA 4B0MM 5K9QG 4MMYA 4FP8H 2X2JA 4G80B 3PGFL 1GGYA 5D6DA 4F15C 3KG5A 4OIIH 4OFQA 3T0XA 4L18A 5I1AB 1KGUA 2C9AA 5SWQA 3IAQA 2YA2A 1W16A 1WPCA 3AY4C 3NRPA 2WWKT 4QIRA 1F45A 3PQYA 5E1QA 4PY7A 3ZUNC 3TH3T 2YSSA 5CP7B 4A67A 1NDMB 2AJYL 1O5PA 1QNZL 1SOSA 3RUGB 5CD3B 3MLPA 1EEZA 1HWGB 4KJQC 5E00A 3QDMB 1HDMB 3C60B 4MX7B 1E4KC 1KDJA 1MFAL 2Z4QB 5DMKB 2Y3NA 3HG5A 1FDLL 3P11L 3T08A 5E2TH 3VYPA 1NMCC 4LAQL 1P84K 4AM0Q 1RZIB 4M7JL 5DRXA 3VFRB 1QVOA 3VH8G 3BSZL 1IAOA 3ZYJA 1Z2KA 2Z34A 3K2MC 1KYFA 2NUTB 4PWHA 1B9KA 1K3IA 1N7MH 2EH8L 3QPQD 1L4IA 2GBUA 2OMXB 3OX8B 4R3SA 2BP5M 5FC9A 4XCFH 2LAAA 5IB4A 4YGVA 2FWUA 4OGYH 3U83A 3D2TA 4HWUA 2EIJB 1D5RA 5FW8A 5FR3A 2YUZA 2QPFA 3PV6B 4WKXA 4FQ2L 4R90H 5L2KB 5CNHA 1JWSB 3T77B 2FX8L 1HI6A 1KY7A 1NCHA 5KANI 3C6SA 2OBGA 3C2AH 1DE4B 4M5ZL 5GJTH 5A43C 5EO0B 1PDKA 4ES8A 1A3LL 4X8CA 1WZLA 5C08B 5F96H 3TBVB 2DQMA 3F62A 2A6KB 1PX8A 1QFOA 5EZJB 3K2IA 1KLFB 3V4PL 5JR1H 4BV1A 1D5ZB 3AU1A 1UGNA 2PWEA 3KPTA 4PPTA 4OZIF 4ODHL 4XBEH 5D7IF 4PJFA 3DPBB 1UD8A 1V54B 1MHPL 4OLWL 3ZE2E 1R6VA 4L4JA 3RNQA 5CFHA 5D7HA 4J3OF 1WK0A 3NJFA 2ZYRA 4PJ8A 3TCXA 5D96B 3VXUB 4XXCC 1M7IA 2FATL 2AK4E 3FFOA 3EBGA 5L2JB 3RA7L 4Y1AB 5CEYB 3Q6FA 3Q3GA 1OAZH 4GAJH 1DCLA 4KK6D 3OKEB 4HQQL 5IESH 4HUWB 1GSMA 4PP1C 5F1NA 1ZT4A 4I9XA 3K2UH 4PQXA 1J5HA 3CFCL 4M7KL 3BVDB 2EDFA 3HI1B 1S9WA 1JV5A 4GI9A 1QBAA 2A6DB 1T80A 4NC1C 4UMSA 5BW7C 2HFTA 4OLYL 3RVUC 3T2LA 3ABMB 3GLZA 5SWSA 3RWGA 1NICA 1SXAA 4LFHD 2V6HA 3L2LA 3CE1A 5CIPH 4X98B 1T6WA 4GUPB 4BEIA 2GSGA 1GYVA 3ARDC 1CDYA 1GGCH 5DTFA 3QQ4A 5BMFL 3RFZA 1NUFA 3EOAA 3OGCA 3DSNB 5LGKA 1WO2A 5D4IA 3D9AL 1U2YA 1AR1D 2OMUB 3B8SA 3BP7B 3V6OA 2J7LA 4RWYL 3HZVA 3LNFA 2AXHA 3BUBA 5B21A 4ZK8A 5AYQA 2N59A 2GK0B 4PGZA 4RH4A 4M1DH 5FYKE 3V4PB 1BG1A 4ABVA 3EYOA 3PDGA 5BZWB 1WF5A 1EHLL 4RRPG 2Q8BH 5DJ6A 4KUCD 1GKEA 4R8WL 1EBAA 4DEPC 3LS4H 2FQGA 3DI3B 3MBWB 4TNEA 2P49B 5LAXB 3CFKB 3ZRCC 3MRIB 3WUWG 4E5XA 1JGVH 1KCVH 2FYYA 2VDPH 3VRLE 1RERA 1BZ7A 4FERA 4GO9A 4XO9A 5F6HJ 3GSWA 2PCFB 4X4XB 3W81A 4GW5B 4M6OH 4Y4KC 2CK2A 3DXAE 1KCUL 4KJQD 4X8GA 4DKFL 3BKYH 5KBPA 4Z3EA 4CA4A 1X5MA 5TFSL 1QEWA 5IWLC 4AT6A 3K8MA 4TNVF 1CJYA 1JN6B 4G6FB 5MHSE 3MA9L 4OJYA 1QFUL 2DH2A 4QHKI 2VXQA 1K4CA 2BSDA 4ONHB 4QDGA 5C07E 3SO5A 2XWDA 3MLSL 4TNVK 5DD5L 3BDYL 1KTRL 1PYWA 3GTNA 2F68X 2QR0A 4AKPA 5A2BA 3LRHA 5HHPA 3IF1B 4Q7DA 2EZ0C 4NQUA 1MHHB 5HYQB 1X5YA 3O6FB 2NZ9C 1O9WA 3AROA 3V4VA 4B7IA 4MJIB 2WINA 3WYRA 4H1LG 5I1HH 2Q7NA 3V0WH 3MRDB 4OTXL 3N1MC 2WVSA 1I9RH 2XBZA 1PLGH 3DGDA 5CGYC 2CO6B 5D4QA 4JLRB 2CBPA 2NY5C 2CLZB 2WAHA 2XN0A 1AGDB 4HGWB 1QQDA 3AVEA 1REIA 3AUVA 1A2YA 1X5LA 5MEQA 2BS9A 5I73C 2Y7SA 5DD0H 1UT9A 4L2LA 3F84A 4JCLA 1MXGA 3SQOL 4MCZB 3LTVA 4XRCA 1JOIA 4E9RA 1QTYT 4LCWE 3LRSA 3QEHB 4X5XB 2KDGA 2A6JB 5DD6B 1ZGLM 2VAJA 1QACA 1WAEA 4UDUA 1E28B 4I8DA 4XC3H 3UXFA 4EZLA 5B3NA 2XU9A 1KGXA 2OYMA 2WB7A 4GLRI 1D7CA 3MZGB 4X6FB 4X7SH 1MCCA 3S3DB 3JVGA 1BYPA 2NYYC 3TCLA 3U36B 2ZXAA 2Z35B 3AS3A 3HE6B 2GSMB 5ALBL 3VI4E 5JHBA 4PP1D 4CSPA 2XHNA 3F04A 2AJ3A 4FQCH 1IILE 1SRDA 2LLNA 4CL7A 3RVUD 1KJVB 5IK3A 5EBMA 3LOWA 4TLKA 1C1EL 5LBVA 4PS4H 4UT9A 1T2QL 2YLKA 3ARPA 8FABA 1JXGA 5C0BB 5HGHB 3G5VB 1QRND 1Z0MA 2Q2LA 3G6JB 3AQXA 3ARDD 5BOPA 1KYDA 3PUCA 1FO0H 3FPXA 2H6UA 3EJPA 4NRZA 2HG5A 1CL7I 1WA2X 2H2SC 1XZ0A 4E41E 1GGBH 1K8DB 4NN6B 4LF3B 1I31A 1IM9D 2WXHA 3IS0X 1JRHH 4HYTB 5ESVB 4JDVB 4Y2DC 5AZ2H 3DO3A 5GS1B 1CTNA 2YUVA 3L3HA 3HRZA 1YQVL 4O02A 4EN3B 3SPVA 4GSUA 3RTQB 1IGCH 3KCPA 3S34L 3JT0A 5LNDA 1T1WA 2WXMA 1QA9B 3MRKB 4NNXB 4B9JA 1OAJA 3NABH 3BIBX 2IG2H 4MXVF 4XNXH 2YQ3A 4Y4KD 4IBUA 2VL5A 1KOAA 2NCMA 4AL8L 5DYFA 3D2UA 1GGIL 2EDLA 1BMWA 1IGIH 2WXFA 3TYFA 2NCEA 3GB7A 4JRYB 4ZAKA 3QXAA 2BSCA 4TKWA 3T4AC 2YQ2A 4AV5A 4FJZA 3UACA 3JUYA 3BX7C 1INDH 4R0LB 1OCCB 4P46C 5HGBB 2Z64C 1EZVX 4I4WA 3D1MC 3DX1A 4PV9A 4UZUA 3HNSH 1Y7VA 3MRRA 3DX3A 5IMMA 4HIEB 5E9DD 2EZ0D 1URLA 1A7PL 3GM8A 4GT0A 2I60L 2NZ9D 1MAML 3PLYA 3NJMA 3GC3A 3U4EA 3D8MA 3VD5A 4DVRL 3WEXA 1AD0A 5HHMB 4I89A 1C08A 3Q9QA 1MPAH 4OR1A 5CGYD 2ZYSA 2BX5A 1DQML 3MYJA 1XBRA 1MG2C 1KC5L 1UZ6F 1XX9C 1KXHA 2VDKB 2Z31C 2VZVA 3DO4A 2OMTA 2XY1A 3BZ4B 4ACTA 2BVQB 4UQBA 2PF6A 3A3YB 3MLUL 1RZFL 1KG0A 4TL5A 1RZ8B 5JZ7C 3QGVA 4ZYKB 1P69B 1QABA 3KLSA 5FIEA 2DLFH 1DVFB 3ZDZF 4PJ9C 4XNAA 5D1ZI 3WKPA 4XVSH 2WTPA 4JFDA 3QJZA 4X2UA 3HG1D 2F18A 3MA7A 4TQPA 1HEZB 1CK0H 2G60L 4FQXA 2YGNA 5FDWB 2MWCA 2AXFB 2NPLX 2NYYD 4W68A 1O7DE 4NI6A 4WUUA 2F54B 1KN2L 2WLIA 4GSXA 2OTUA 3WIIH 4ZNEE 1ES0B 3IMVA 4R7NA 1FL6B 3T4YA 2J56A 4B9GA 5EOQL 3D25B 5EORH 4P59H 5J3HC 1E4WL 1URZA 5HP5A 5JQHC 2XWZA 2JJSA 1U3HB 4TQHA 5L8JB 3ISYA 4OM0H 2HLFC 4WI0A 4HOWA 3A6CH 1DQQB 2CWRA 2WBJB 3E6FB 5HHVH 3SQBB 4DO4A 1ZLVH 2MPAH 5B1JC 4WEEA 2ICEB 2VLRB 4MNGB 4MXWH 3VRIA 1P1VA 3P77A 5T1LD 1UXWA 1RPUA 3QZWB 4ZZFA 2DV6A 2WK2A 1CFSA 1KJ3H 1J1XL 1RZKC 1MCIA 4XVUC 1K72A 3WL9B 4QTHA 1RV6X 1HH9B 4Y2DD 1XSKA 1RK7A 3VXPB 4JPVH 1KEMH 1NUNB 2VR7A 2ORBH 2P4AB 3H8NA 3DUHA 2IEPA 4NM4H 4S2SB 3T1FA 5DHXB 3SN6N 1O5DT 4KAQL 1NDGB 5BS0A 5EBLA 4G5ZH 1QSEE 4Q6IC 2H3XC 2J1WA 4ZFZB 3RFZC 4JY5H 3V5KA 1CXEA 5JW5B 4APXB 4L9LA 4RA3A 1A7OH 3GMQB 4BGLA 4KZDL 5INDB 2R23B 4ANWA 4TNFA 4ELME 2C3HA 5F7UA 2IH1A 1XB3A 3WIFB 1TITA 4NQXB 4KQ3H 4GG6E 4NZUL 2VDQL 3TH4T 4NNYB 1QSED 2Z65C 2AABL 3B2VH 1OCZB 2Q87A 4P46D 1TJGL 1AH1A 4AXWB 4XPHH 5F7NC 3PQYD 4N5UA 3M1CA 3DIDA 2YZ8A 4XNUH 2YXVA 1H6TA 3NK4A 1S6NA 3V6FA 2NNRA 3VX0A 2FSEA 3ZTEA 5ERWA 2N0KA 3FN9A 4FFWC 4JFEA 1RJYB 2EDRA 2EINB 4EDXB 4XVTL 3ESNA 1TU2A 3HI6L 5K69A 5KYWA 1UHVA 3HAEH 1A4KA 3T8XB 1WHPA 3KPRD 4YEEA 3HB3B 5FB8A 1XGTA 4G7YH 3SDXE 4OD3L 3FUJA 4OLUH 1M42A 2Z31D 1MREL 1T83A 3BD5A 3EGXB 3KJ6H 4IS6B 1CXLA 4U3XA 4XOEA 4Z7UA 3V52H 4FI8A 4ORGB 4O9HH 4RQQB 3SGJA 2HJLB 2XN9A 5KTEH 1CGSH 5DA4A 1D5XA 1U8LA 2IALB 3LRMA 3MKGA 4J3BA 5JZ7D 2QPDB 3FC8A 4BSWB 1LP9B 1FBIH 1CT8A 1GYWA 3I2CH 4PJ9D 4UILH 1E6OH 4NQED 3US9A 2BIQA 1E0OB 1U8NB 1Y1UA 5DRNB 4WWKA 2COVD 1G7HB 1IZJA 1RZQA 5L0QB 1YDPB 1NJ9A 1NGZB 4GQPH 4AIEA 5E70A 2FVNA 3CXHK 3OWEA 1JHLH 3LEXA 2XSKA 4PJBA 1UKTA 3U79A 3WFBL 3A24A 1G7IA 1H15B 4HJIA 4KQ4L 3OKYA 1FH5H 1S5IL 4JM2C 1F86A 2K0RA 4E9WA 3EYUH 1PG7L 2WD0A 4NJAH 3RILA 3SYAA 2YO3A 1KIUB 2CR6A 4TQ8A 2B3RA 4M1GL 2CSPA 5J9PB 5J3HD 4S1QL 2JJUA 4PB9H 4TUKH 2UV3A 3RAJH 3FOMB 1JXDA 2HLFD 3K91A 4X99A 2ERJB 2DBJA 1UVQA 4D9LL 3SKMA 4WQOA 5FF6B 2HRGA 4TSAL 4YUEH 4H25B 4G2AA 2YAOA 1FNFA 5EF2A 2DQDH 5ILTL 4BIKA 5DI8A 2NNAA 3TBTB 4G9DA 2K8MA 5HYSA 1T4KA 1CF8H 1TMQA 4PTUA 2F53E 1DVZA 7CGTA 1KPUA 4XVUD 1XSIA 2GBAA 3M45A 5D7SH 4P5KB 5ENWA 3IU3B 3FFDA 2Z0BA 3JWDH 4U0QB 4XH2A 1U8PA 2OS7A 2P28B 3IPFA 4WGVB 4K3HA 4WK2B 3W1ZA 1B3JA 1D9KB 4BQ6A 4UT6L 2JJTA 5GS0L 3UZQA 1UH2A 3D69B 3PIQA 4NM8H 4Y1TA 3IMTA 3K6OA 3UTOA 2XN1A 5CFAA 5IQMA 1Z6JT 3CDGA 3L1GA 3EBIA 4J3OH 1TYEB 5CLTA 5DR5L 2IO5A 1BVKB 4NDMA 2RB8A 1LGVA 3NDZE 4JFXB 5JHLA 2DBLL 3B37A 5HTSA 1AFVL 4DAGL 5EU4A 4K71B 4U1JA 3ARGA 2MEJB 4XHQA 1L9MA 1XR8A 5F1IB 2APWA 4GQQA 3RNKA 4PB0L 1VGEL 3KM2A 3OKOB 5GRZA 1WIPA 2NXYB 3IXTA 2D73A 5ISZE 1G6VK 1P9MA 4LOUC 4I13B 5DFWH 6PCYA 3CZGA 3PWPA 4LSDA 4RMUA 3S4SA 1AQDB 2YD2A 2B0SL 4CVWA 4ZXBC 2GC7C 1J1PH 4A7SA 3QEUB 4GW4A 3LNEA 4FFWD 4G43A 7PCYA 5B8CB 5HGGS 1BVZA 4GP5B 3LKRA 3U0TB 3W39B 3GLDA 3LDBC 3M8OH 3MRPB 2R4SH 1KCRL 1JI2A 2YQBA 3MI6A 4AG4H 2V2XA 5IEKA 3C6LA 3TC9A 1XCQB 2V2TA 2XZQH 3ARBA 1NIEA 5D7LB 2I7SA 4JFHD 1N6VA 4POYA 4W9IC 2W9EH 2DY2A 4OCWL 5F0LB 1E3ZA 1DJIA 1M05A 4DUXA 5J11C 4KH9A 4WI7A 1WD9A 3KPNB 1SEBA 5LWYH 4J12A 4GRLC 1CLOL 1I9IL 3OD3A 1KY6A 4Y19A 5I0VA 2K3TA 3HLKA 5J89A 4HXBH 4PI2A 5KYYB 5F9AC 4JVUA 4UINL 2ZWZA 5EEZA 1IBDA 3WXWH 4FXKA 1P4UA 1SYSB 4TSCH 4RRPM 3HA0A 2O30A 2CKNA 4HUNB 2YKLL 4JM2D 1K5NA 1LVEA 4OCLC 4EI6B 1EJOH 3D18A 5MEOA 3SKJL 1ODAA 3U7WL 5ECJE 4WCYH 1LWJA 4KVNH 3MUY1 5C0AD 1MCJA 1F4XH 4KTGA 1YEGL 1TIUA 5F7EH 4HT1H 4C47A 1VADA 3DUUA 4OF3A 4KI5F 5EIVA 2FJFA 4JQIA 4PJEF 1HE7A 2AJZA 4KMTL 3PWVB 4NBYB 3CSPA 4NYLB 1XB8A 3BKJL 4C59B 1W72A 5HGDA 2GY7B 2HFGL 3BN3B 5FO7B 2C26A 4UIKH 5EA0H 4PRHE 5EU6B 5HYJE 1Q38A 3W9DB 2YJLA 3X1FA 1MJ8H 3NSCA 3WN5A 3WE1A 2V37A 4ZO8A 4YHKH 1K2DB 4QKTA 1E5ZA 2IAND 2QVFB 4UM9A 2GHWB 2KI6A 5INCB 4XN9A 4PJ7A 5T5NF 3TGXA 4L8CA 4YWGH 3VO0A 5DO2C 3VE0B 2A73B 2ZQKA 4AI7A 2VZTA 2WP3T 4IU3A 1ET8A 1JGLL 1F13A 3BPLB 3S37X 2Z3FA 2EUXA 1I4FB 3QQDB 1X7TA 4G80A 4NUJA 5I1AA 1CQYA 1C5DA 5D72L 2DMGA 5D2LE 3UZEA 5JORB 1AZNA 2HH0H 5CP7A 3TWCH 1NDMA 3RUGA 5CD3A 2OCCB 1B4JH 5HYEA 1UA3A 3QDMA 1HDMA 4FQJH 4MX7A 5DLLA 2AJSL 3WNPA 1BF5A 1O0VA 3KGRA 2Z4QA 5DMKA 2Y72A 4AQAB 5F7DB 3DHUA 4YLCA 2M8XA 3ZMRA 1RZIA 4PRPB 3LZOA 4HHAB 3QRBA 4Q89A 4LOUD 5LCVH 3GBML 1LO3L 3FUFA 3CN4A 3RIAF 3LNGA 4JHAH 5HDQH 5AWNL 2NUTA 1WZAA 2ZXEB 1RURL 5F7LB 2OMXA 3RIAK 4ZXBD 12E8H 1EEYB 1TJMA 4L9LC 2Z93B 3EJUA 4RAUA 4AKQA 2XJLA 1CDGA 3CPLB 2B5IB 5L2KA 3B5HA 1J48A 4JHVA 4WWOA 4Y5VC 4ABWA 1DE4A 2VDNL 3JWDC 3PRZA 5I1GL 1HOEA 5EO0A 4PVBA 2Y5QA 3VA2C 3V9CA 3E1ZA 4WO4C 5CGBA 1FNAA 3VGDA 4AWJC 4B27A 4J3OC 4GRLD 4MNQD 1M6OB 2APXA 1KLFA 3ZDWA 4MSWB 1D5ZA 2DOCA 4MD5B 5I1JL 1XH1A 2Q2EB 2HZHA 1SF3A 4FFZH 3E3QE 3DPBA 4UU9B 1FYTD 1T5XB 3OJ2C 4HJJL 4JG0H 5D2NB 5C0GA 3NACL 2BVYA 4AEIH 1D5BB 2QQKH 5DJXB 2VRKA 3THMH 3VXUA 3WJLC 5BZDB 3U4BL 5L2JA 4Y1AA 1JF1B 5CEYA 4P3CH 3VD1A 1PU0A 2NY1B 5F6IB 3OKEA 4HUWA 3O3EA 4Z7VB 1RCYA 3R7RA 3SGJC 3L3JB 3N85H 3VFGH 1IE4A 3HI1A 4E5XG 2H1PL 1AC0A 3GM0A 2A6DA 4O2CB 3FTZA 3V0DA 1KBBA 4S0TD 4ZO9A 4HJ0C 4XPGH 1JZ4A 3CGTA 4QRFA 1QKZL 5FCUL 5HJ3A 1XH3B 4W6XB 1GYUA 1IBFA 4LLYA 4X98A 1BQHB 2BMKB 2EIEA 4XVOA 4F5CA 1EHAA 3UYPB 5KJRH 5EMYA 3U1QA 2IGLA 1A14L 1Q8MA 2VLJB 3DSNA 3PV7A 4HUXB 4U1NB 4BZ1A 5FOJA 2OMUA 3BP7A 1OPGL 1GA2A 1AI1L 2PTVA 4LSUH 2V5SA 3AG1B 2KT6A 4I3RH 5EDXA 5FYKL 3W9EB 2EIZB 2GK0A 5HYIA 3D39B 1TSRA 2VW7A 4J3TA 3AU0A 4BUQA 5DO2D 2YBGA 5BZWA 1K6QH 4OQTA 1TZHB 4JO5A 5C09A 5TQ0H 1OF2B 3MBWA 3VG0L 3BGFC 5LAXA 1GCFA 2QVIA 3CFKA 4M02A 2P80D 3MRIA 2YXWA 2AP2A 1IKFL 2EDMA 5CD5C 5LQBH 4UM8B 4QHMB 4XN5A 4FMKA 3HKFA 4X4XA 2JE8A 4ZOCA 1SXSA 2NY3B 5E6SB 5CBEB 1IVLA 3QUML 1E90A 5C0IB 1KYAA 1X5FA 2FL5B 4A7TA 1UACL 2BIIA 4L3EB 1FFOB 4L05A 3TXAA 4XC1H 4AOFA 2A9NL 4ZUUB 5IHUH 1ETZA 4EBQH 1DBKH 4BH7A 1JN6A 4YXKH 3BWSA 3QUZA 3F3HA 3UAEA 4QHLA 4Z8FL 3BUQA 4RVBA 1PZBA 1XIWC 3TJHC 5E4EC 5BV7B 2WQSA 3HIZA 4F57H 4NN7C 1AAJA 1HNYA 4H8WH 4XWGH 3C5ZB 3IDMB 5AW5B 3WNJA 3MJ9L 4OZIE 1MHHA 5D7IE 1AIZA 4M5SA 5HYQA 1P7QD 3O6FA 4AMXA 3OF6A 1H9VA 4NUMA 1KXVA 4U1HB 5F3BB 4MJIA 3JTTB 3MNVB 1BEYH 3LMJH 1YYML 3MRDA 3NAAL 4GAFB 1AHKA 4PY8J 1X9QA 4OCYH 2CO6A 3SDDC 1JZFA 3ZHLA 4JLRA 4HBCL 3U1SH 3BRDA 1AO7E 1DQTA 2J6EA 2CLZA 5J6GA 3DARA 1GHFL 3FHQA 1I1RA 1P9MC 4HGWA 1HNGA 4CNIB 3DV4B 1GRWA 1PEWA 3RQ3A 4FA6A 4WO4D 4DGYL 4A66A 4PJGE 3O9WB 3E80A 4J3OD 1DSWA 1YG9A 2ICWI 3EH1A 4ZTPL 3QEHA 3FXIC 1RD6A 4ZJ9A 3SGEI 2X6CA 2A6JA 5DD6A 3T8MA 5C70A 2J1KA 3UYRL 3ZT5A 1EERB 2A4EA 2Q3AA 4Q9QL 3HG0A 2E9GA 4X6FA 1BVLB 1XBDA 2VAAB 1R5VB 3C6LC 1OGAD 4AE0A 2Z35A 3HE6A 4ELKB 1IKNA 3IFLH 1JGDB 5BNXD 4Q9BA 3BMWA 4NKIH 3FN3A 5CILL 3L8QA 3P4OA 1PKQB 2DIJA 3NIFB 2H26B 2XA3A 3Q44A 2ZOOA 3SJVB 4CC4C 2D9QB 4KKBC 1KJVA 1JCKA 3EFFA 3ZK0A 4FFYL 4HJ0D 2JKTM 4LCUB 3AY2A 2HYMA 3EBAA 5FGRA 2QHRL 5JOPE 5M94B 4FXKC 1UOKA 3G6JA 2TRYA 5F0JB 3BEVA 2HJFB 2QGCA 4NUPA 4P07A 2QPUA 1EO8L 3SB3A 1QR1B 5TE6H 1ETA1 3QEQE 2VTFA 4J3SA 4AH2B 2BERA 4QGYA 1K8DA 1YPZA 4NO5B 3TBWB 4LF3A 5CEXB 1NGPH 3U1PA 1DVYA 1WLHA 4G8GE 5HHOE 1C5CL 3IRZA 3N40P 5ESVA 1USZA 1MRCH 3SE4C 1BWWA 5GS1A 3IRCA 3VACA 1A1NB 4A7VA 2F7OA 2QGEA 3S48A 5JOPD 1M53A 1ZTXL 4EN3A 3B2PA 3RTQA 2R69H 2R39A 3BP4B 3BMVA 3M86A 3UX9B 3CVHB 2WVVB 1QA9A 4OT1H 5CD5D 2VOTA 1CGWA 2HG0A 5AL8A 2BRRL 3UJIL 1TNNA 3MKKA 1BIIB 3P0YH 1MRDH 4NNXA 2ZKHL 3VXSB 3VXQB 3KWTA 3GBEA 3PGCB 1RI8A 2AJVL 4O5LL 1FLRL 4YHZH 2AKRA 3P30L 4PSPA 4G8GD 5AOLA 4AMKH 3QXDB 2VW6A 2X4NB 4I0PB 2WWOA 1BD2E 3Q5TA 5FA4A 2IOOA 1NAMH 4JRYA 5A2IH 5E2UL 1W0VB 1T1XB 4JREB 2JB5L 3UJTL 2NTFA 3HS0B 4X7CC 3I6SA 1XIWD 2DQFB 3EUUA 4R0LA 3TJHD 5KS9E 1AJ7H 5CUSL 2NOYA 2P8PB 1F8TL 4PJCB 5KUKA 1T7XA 3DJTA 3UZEC 5DC4B 1WC7B 4IBVA 2XICA 3ARTA 4IRZH 3AQDA 3KH4A 1D3CA 4ETQB 4P4RB 1MFCH 2O5XH 5LO7A 2Q7AA 1FCCA 3FRUB 5I8KL 3TA3A 4H4NA 4ZRGA 4F9PC 2G9KA 3GSOA 3HFML 5AOIA 1GMIA 3RJDA 1EVUA 3VQ2C 3SDDD 3GKWL 1UD4A 1JZ5A 2X9YA 3S5ZA 5IMOA 1CYXA 3II2A 2ESVB 7TAAA 1OWWA 4GQZA 4ZG1A 2XKSA 4HLEA 5A2KH 3V95A 1QZ1A 3G5WA 3DX0A 3GXNA 3FQRB 1GMEA 3DJSA 3U9UB 4LSPL 3VD2A 3BZ4A 3IT8D 2BVQA 3V8CA 4HC1H 1L0XA 2X2UA 3BO8B 4P2CG 3D4YA 4WFED 1HSAB 3N04A 4Z95L 4ZYKA 3Q06A 1DVFA 1XHHA 4GSRA 2XY2A 2OK0H 1DSFL 2XTJB 1WEJL 4FTVB 2M2DA 3FO0H 1Y6NR 4YSUA 1MELA 2IPKB 3IGUA 1MFVA 3B83A 1CIDA 1HEZA 1F97A 2D7NA 2P24B 1D5MB 2AXFA 1ACYH 2EADA 3C6LD 1DQJA 2F54A 4R90L 1BM3H 1KB5L 5ITFA 3O2DH 1ES0A 1FL6A 3SYQA 5GJTL 3N2JA 5A6MA 4MZ2A 5JW3H 1O75A 4H8WC 4KKBD 4B96A 5IREA 1U3HA 5TJWK 3F7QA 3LIZL 5B1CA 3UPAA 3GS0A 1DQQA 2WBJA 3KLLA 2JNZA 3SQBA 5KW9H 4MXVE 1L6XA 2VLRA 4NN5C 5IB1B 3VXMA 3O0LA 3WD5L 3VFNB 5ALCH 3VWJC 3QZWA 2RAMA 3UCQA 4DQOH 4ZQKB 3MTXA 4G3YL 5F9JB 3S9DB 4P5TB 4ZFOB 3LN5B 3PHOA 3OKKB 4PV8B 1UH3A 2Y1VA 4FNLL 2X1WL 4MLSA 5DU7A 3I85A 3PABA 1OAZL 1HH9A 3X12B 3NVQA 1I53A 2XVLA 4NQDA 1DQIA 4Y5YB 1DQLH 1ADQA 1A1OA 3G6DH 3ILPB 4OSUL 1WFMA 3FHEA 5HPOA 1NDGA 1JNNH 5DEZA 1CL7H 1FFNA 2C4FT 4QTFA 5DA0B 1G6RL 3QS2A 5HDBB 3B6SB 4MXQC 2DH3A 2EDKA 3BH9B 4AYBA 5JW5A 2IADB 1KB5B 4APXA 3EDJA 4IMKA 1MZZA 4QRPA 4WNJA 5F7BA 43CAB 2C3XA 1DBML 4G6AC 4ZTEA 4PVMA 4QRRA 1RU9H 5INDA 5IQ7L 2R23A 2V5RA 5CEZH 1MIEL 2CLVA 2OJZL 5C0EB 1UZ6E 3GSVA 4JFYB 3BFWA 2HLAB 4RX4A 4XAWL 3QBTB 4FKHA 3WJJC 1SBSL 3S5YA 3N91A 4W4OA 1XF1A 2NY4B 1G7JA 4NNYA 4M1DL 4JFVA 4V2CB 5DDHB 2EH7H 1JFQH 3IJYB 4N2BA 3V5DB 4AXWA 1INQB 3RX5A 1JI1A 3ZDZE 4YXHH 1T1ZB 3VXOB 1KGJA 1Q0YH 4FA7B 3WBDA 5J1AB 3KYKH 1RLBA 4RGNE 3DHMA 4JZNA 1EIBA 1S7UB 1RJYA 4EDXA 3QWOA 6FABL 5DK2B 3ASOB 1NCOA 4UTAA 4Z7WB 4KKNA 1BZQK 3BE1L 3HUJB 3QUZC 1TMCB 3I9GH 1X4YA 2BZCA 3T8XA 2WXRA 1OL0A 1CQKA 2NY2C 2RFXB 4K9EH 3NP4A 1MFMA 3BGMB 3BT2L 3EGXA 3GO1L 5DHVH 3ZHFA 1BBJA 2X3BA 2VC2B 4ORGA 4KDVA 4RQQA 5EEUA 2HJLA 4Q8BA 3GMLB 1YMMD 1MI5D 2L8AA 1CYGA 2IALA 2ZUYA 4LDLB 2IBBA 4BSWA 1LP9A 1NPJA 3K4DA 3SKNB 1Q9WB 1U8NA 3FBKA 1W0WA 5EOCJ 5DRNA 4JG1H 1V5JA 3KMDA 2Z7WA 3G5XB 3NFSL 1G7HA 5CCKH 1YDPA 5HYSG 1NGZA 4PBDA 3MRMA 4P2QD 1NEUA 3CX5K 1X5AA 4KJYB 2RR3A 1BOYA 3FO1B 1FORL 4V11A 1PLGL 2FO4A 5EEYA 4LPYA 3T0EE 1HHKA 5LXGH 1UXSB 1PSKH 4XNYH 2H0PA 4Z3GA 3EZ8A 2V7HB 4WZ9A 1V7NH 1KIUA 4BINA 3U6RB 3SCMB 3VGBA 3EXLA 5H8DA 1J8HB 5EU3B 4B0MB 3A6BL 3CX2A 4P2RE 3FOMA 4KK9C 3U46A 3QA3B 4YE4H 1NSNL 3C87A 1IL1B 1NC2B 4XAKE 2PCYA 5DEFA 1J87A 1P5UB 3NQKA 5BOJA 4PH8A 5FF6A 4YL9A 2HAZA 3OMIB 1C7SA 4ZMAT 1LE9A 3VWJD 1FSKB 4X8XA 1JTOA 4FXLA 3C8DA 1L9TA 2ILLA 4YLBA 4OCSH 4X7SL 3O11B 1PJWA 3H9SE 4WFHE 4EDWH 5BVPL 5AG8A 3I6GB 5IHLB 4P5KA 4HKBB 2C5DC 4F27A 1BJMA 2WY3B 3S4SG 1Q72H 2BW5A 5E8NB 5IW1B 4UQ3B 4FQCL 2CGRL 4XAKD 1D9KA 4C56A 5F44A 3TFKC 3D69A 3RURA 3VYNA 1GTFA 3JTBA 1T5KA 2YEZB 4LARL 1GY1A 1CE1H 5FKPB 1VAHA 2VE6B 2E7BA 1MH5B 4JW3A 4KGLA 3MV9E 3OXRB 4MXQD 3VCLB 1BVKA 4XE0A 4JFXA 3H9SD 4HJUA 4ZPTB 3WY1A 4UUJB 4KHXL 3S36L 4PRAA 4N0FB 2YMOA 2ZX7A 1FO0L 3H3PH 4H88L 2GITA 1QBLL 1P84J 1U36A 1YNTF 1M1XB 4LLQB 4XMVA 1NGYB 4EI5C 1MDTA 2V9UA 3WDHA 4F9LC 2BFGA 4YHLH 5C09D 3FH8A 4A7GF 3NCJL 2DB8A 1UZ8B 2DL9A 2PYEE 3MCKB 3T2OA 4F58L 2D7QA 3FU9A 2WWKO 1SXCA 1IGCL 3FTYA 4Y7OC 2G5RA 3QWNA 1E6JH 2I7OA 2D0GA 4ZMTA 3QEUA 5C92A 2CJSA 4PLOB 4MTMA 5B8CA 3EDKA 3BSGA 3U0TA 3W39A 3WNKA 2WO2B 1TQSA 2NR6C 4QWWC 3QUZD 5CBAA 4JFFB 1XMEB 3K72B 5AVWB 4ZOBA 2NY2D 4RGMB 1XCQA 4KY1L 5D7LA 5JIIA 5KYUB 3J07A 1S3KL 4PS8A 1F0LA 1SJVA 1BGXL 2R59A 4ZW6A 4K9JA 3QJFA 5A1AA 1ZIBA 5LG1A 1QYGH 1GC1H 3VXTB 3KPNA 2DEXX 4C83B 3PPSA 3MOAL 2OYKA 5JHAA 4XODA 3TA3C 3E9UA 3LN4B 3QFDB 4N3TA 5F7YC 2GBTA 3AQZA 1NEPA 3JZYA 1WFTA 1HHGA 4JPSA 3KR3L 3HZMA 1TEYA 4QRSA 1SYSA 3MLVH 2Z8SA 5AW9B 3QEGH 4A2LA 4OGZA 4YQXH 4ZX4A 2BY1A 1ZK9A 1KBKA 2D7OA 4EI6A 5E6ZA 1JPSH 4FHKA 4ZS7H 2X9WA 4DCQB 1IGTB 4KRPC 2BVPB 2IQ9L 4PGCA 4Q0XL 5D71H 3EF4A 3TO4B 5GGSB 1MUJB 4KK9D 3NZ8B 3N40F 3PWVA 2FQFA 3KPMB 2IPUG 3VGEA 3FTGA 3QDJD 1CFBA 5FO7A 3S7GA 3STZA 2G5BB 5CR1A 2NX5A 4TRPH 3FOLA 5F7MC 3W9DA 5CCHE 3QCVL 5AOJA 1CK0L 2Y24A 3FU7B 4FA8A 1PZAA 3W5MA 1K2DA 4IKIA 2Y7NA 4FZEH 1ZANH 3L1FA 5EF1A 3TWYA 1ZT7B 1T7VA 3VE0A 2A73A 1MWAH 1S46A 5D1XC 5PAZA 4BSVB 4AEHL 1G1CA 1KXTB 1MCEA 4DN3H 2B4CH 3LD8B 1KNOB 2GJRA 3TFKD 1GCYA 3ARFB 1I4FA 3QQDA 3VMPA 5IMKB 2E27H 2P9RA 2B3IA 2WJ7A 3QXWA 1AOHA 3T1WA 5JORA 3LXUX 4HIHA 2P46B 3HG4A 5H37A 2AZUA 3AXIA 2AQ3A 3CLEH 5E5RB 4C58B 1MHCB 4ODXB 2LU4A 1JZJA 2B1AL 2NY6C 4BKSC 3PXJA 1THAA 2V3EA 1OARL 4LBEB 4EI5D 4KHTH 3D06A 4AQAA 1QUNA 5D1ZC 2ZCKH 5F7DA 5AAMA 2WBWB 1KJ3L 3GTTA 4HHAA 5C0CE 1MG3C 1XEUA 4AQ1B 4AIZA 4AZUA 5BVJB 3RBGA 4JPVL 2HJKB 4DP0X 1UURA 4G9FB 4NKOA 1P5VB 3GHBH 4M56A 3IJEB 4KKCC 3EXJA 2FJHB 1DLHB 2P5EA 1EJFA 1ORSB 5HVFB 1DBAH 3FUDA 2Z93A 2A9DA 1HL8A 4RFEB 5E1AB 5J0BA 2AK1H 1EPFA 2NR6D 1A7OL 4HXAL 4U4BA 3KWVA 2FBRA 1NZRA 2SEBB 5CEZE 2YD6A 4RSYA 3H7BB 4KQ3L 1NLBH 2B16A 3TT3H 3QIBB 5ANME 3MXVH 3D0AA 5E5UB 1VIWA 5EIQA 3FDWA 2AITA 4KI5E 3HBPA 5T1DH 4BFBD 4BZ2L 1YEHH 1ZJAA 4PJEE 4JFSA 4XPHL 4Y4HA 3RGVC 3LRLA 2WNWA 5ID0A 5KANG 1X5JA 3APFA 4LDCA 3AXLA 3TA3D 3HMXA 4MSWA 1UM5H 5F21B 5GS3A 4MD5A 1AXIB 3KPLA 1N8ZA 4X83A 4JL1A 3N1PC 4UT7L 2BXZA 4IOFC 4UU9A 3ETTA 1T5XA 1GKOA 1GJWA 5D2NA 5B39B 3N50A 1D5BA 5BZDA 5DJXA 4AYDC 1YJDL 4Y9EA 4W9JC 4X5RA 4MGXA 3QXTA 1JF1A 4JZOB 3JWNG 3CN2A 3ULUF 4D0DB 5MENA 2WTRB 4DK5A 1G9NH 2UVFA 2VERN 4MJ4A 3VA6A 4Z7VA 3L3JA 2CGZA 1E4XL 1EAPA 4JRXD 1G9EA 4KRPD 1IU1A 3DUSB 3KJ6L 4MB5A 1ZVYA 4O2CA 3FN0L 2DWDA 3OHXB 3KJ4B 1HZKA 1FBIL 1MQKL 3Q2CA 5CP3A 4YDKL 3QK0A 1BQHA 3UBHA 4GRMB 1SXZA 2V4LA 3UYPA 1VDGA 5I15L 3DJRA 1E27B 2VLJA 4HUXA 5GS2D 3DOSA 2VQ1B 3RWCA 2JQZA 3BHBB 5F8QC 3P2DA 3WTWA 3MRFB 3W9EA 2EIZA 3D39A 1FH5L 3V4UL 4AYFA 4PJ7F 3SOBH 1AHWA 5D1XD 3LAFA 2NNCA 3TYGH 4KZ0A 5I6XC 3GK8L 1WBZB 1ROCA 2XBDA 5I1KH 4ILDA 4P5MB 2QL1A 2YS4A 4QCIA 3MJ8B 5BRZE 2D7TL 4NENB 3K7UA 4OJAA 4UM8A 4QHMA 4EZMA 2FGWH 1YNLL 4DTGH 1N19A 3PNWB 4XGZA 3X3FL 5CBEA 4DERA 5C0IA 2FL5A 4MD4B 2NY6D 3LN9A 1FFOA 5A2CA 2MQ0A 4WF7A 1ZLWK 3TEUA 4ZUUA 2IPUK 5K39B 4UQEA 5D1ZD 1CF8L 1FVEB 4NQDD 2OM5A 3REVB 3EO1A 1DO6A 2YPLB 2GB2A 3QAZB 3QUYB 5D7SL 3QRGH 4BHUA 5BO1H 1NC4B 3UG5A 3P69A 4J4PD 2VABB 1NIBA 6CGTA 3RZCA 4Y7MA 3KPSA 4N6QA 4IU2B 1ZHLA 4RGOH 3UFIA 1NL0L 4OZHB 3C5ZA 3IDMA 1PZ5B 2VM3A 3HN3A 4GINA 4QRPD 4LK4A 2JKIS 4DETA 1O9VA 1WQVT 4HLZG 3ECUA 4QRRD 5F3BA 1GOFA 5KYXA 4I9WE 2K4AA 2ZICA 4OAWA 4Z0BH 1RZJH 5LBSH 3Q6GL 5AUMB 4CUCA 4RX4D 2JCCF 4ZX3A 2BNUA 3X1EA 3G3LA 2B4CC 4O02H 2IJ0C 3Q7JA 2EP6A 2K8QA 5HHXL 3VG9B 1F00I 1I9EA 3RVXC 1HYRC 2G5UA 3FQUB 2FEDC 2IOIA 2WW8A 3NH7L 4F3FB 1GH7A 4JQXA 2J5LB 2KQMA 3RGVD 2VB5A 1ZSHA 3ZMNA 4A6YA 2HA1A 1DQDL 1UD2A 2ATKB 4ZFFB 2HB0A 2FB4L 3WFZA 2XFGB 4JO1H 1QEXA 3QUKB 1BVLA 4AC2A 1EH9A 3F7VB 3M8OL 5F9DC 5DWPA 2YFOA 3VRJB 4IRJB 3IJHA 1JGDA 2JKXA 4XN1A 1BJ1H 3LZNA 3NQIA 2JB6B 3CSYB 4OKDA 1SQ2N 1MCDA 2A7BA 5DLML 3O0RL 2H26A 3S98A 5DJ0B 3SJVA 3DRTA 3VJ6B 3F5WB 1X44A 4XBPB 2JKWA 4AVHA 2BVTA 4L1HA 4YJZL 2F19L 2ED6A 1G43A 2UWEA 5FUZH 3AS0A 3MSPA 1X4ZA 4PD4K 4OD1H 3F65A 2HJFA 2JVUA 2HKFL 3L1EA 1HEHC 5B7MA 1QR1A 3WXWL 2V7NB 5LG6A 1WFJA 4TSCL 1XGQB 3MROB 1HOCB 3SBWA 2FZ3A 3TBWA 1GPOL 4NO5A 2BIPA 1FV1B 2RALA 2B15A 4DH2A 5AB2A 1IQDB 1AQKH 3CFDB 2D7MA 4PGJA 4FI7A 1A5FL 2YGPA 3BQUB 3N0AA 3NZSA 3X3GH 3PAVA 4S0SD 4KVNL 3O41B 1A1NA 2YAFA 1SHSA 1QSFD 2X1XR 1F4XL 4MMZB 3P2TA 2NY7H 2YPKB 5DGQA 1I3VA 4RZCA 5F7EL 2BFVH 3FU5A 3MLZH 3CVHA 4HISA 2WVVA 2R2EB 5GRUL 3UTQB 4ESKA 3MUZ1 1E5UI 2D4FA 4JCMA 3VXSA 1A9EB 2D2CC 2WAQA 4YZFF 4MB4A 2F1BA 3PGCA 3W11C 4LCYA 4LASH 4NBXB 1UM4L 1WAPA 4A2EA 2E7DA 3VB8A 4PHZA 3AG4B 2DQJH 5ABAA 1H8OA 3MJWA 3ZE0B 2BHZA 1W0VA 4C56D 3DC0A 4TV3A 5IFHL 3HS0A 1MDAA 1LM8V 3HE7B 4NPJA 2DQFA 1UYWH 2P8PA 1AC6A 1ROWA 4D9QD 2IF7A 2V3FA 2VYRE 3MRHB 3ZKMC 4PJCA 4TLTA 5CSGA 4JMXA 4N0UE 1CXIA 5I0ZA 1SVCP 3FB5B 5KVEH 4PJ5B 3B7TA 4XNBA 2KZ1B 1ZLSL 2QPEB 2VLKB 4FYTA 4P4RA 3O6LH 5KSBB 4LLWB 5EUOB 1SEQL 3PREA 4H0HB 4HLJA 3CC5B 4UB0H 3T6VA 3BT0A 2UY6A 4XP5L 3FF7A 1E8XA 1JL8A 1CDCA 4OFYA 5IHZB 4FQJL 3S3SA 2D0FA 3U7YH 2WNKA 4A2GA 2XWBB 1WAAA 2YBRA 5T33H 7FABL 3IBOA 3E8VA 3TU6A 3H2QA 3U9UA 3IMWA 2FEDD 2GKIA 2F74B 4BA8A 5SWSE 4AGOA 4U0RB 4JHAL 1KFGA 5HDQL 4ZFGL 2XX1A 2L3BA 4K7FB 3QPXH 1Z66A 1OHQA 3QZWG 5IFJB 3AJ7A 4FTVA 2CCWA 1NLDL 1HKLH 1R3HB 1WICA 2IPKA 3E0GA 4KKRA 3LS5H 5HI3C 1M6UA 4TPRH 3RY5A 5KSVA 2VERA 1VCBC 2IMMA 3MRBA 1HAWA 4ZO6A 2YQGA 4XCCL 1D5MA 3V6OE 4YO0B 4AUJA 1SVZA 1KENL 2E6PA 1F58H 1HINH 1OK8A 2F7RA 5F9OH 4Z78B 1W91A 1BZOA 3OAWA 3MV8B 1L7TH 1CXKA 3SKUD 2HCZX 5I1IH 3GJEA 3TN0B 2X4QB 3ZO0A 4Y4HC 3SGEH 2WSKA 5LHDA 2OI9B 3H3BC 2X6VA 5C3IA 3AG3B 1RIUH 3Q05A 4R4FH 2QLYA 1TPXC 1IARB 5D5MB 3SODB 4YDJA 3VFWA 3IFOA 4M93B 5IB1A 3WNLA 3CPUA 4P9HH 5CINH 3FO2A 3VFNA 3G08B 3HHMA 4ZQKA 2V17H 4HEMA 5F9JA 4GW1A 3FT2B 4P5TA 4EOWH 2XYCA 3THML 3LN5A 4ZFOA 1Z9OA 3OKKA 4BGDA 3X14B 4PV8A 4IJ3C 5T3XL 3MFFB 4QHKJ 4KPHL 5IUCA 3RVVC 2AVGA 3X12A 4BUGA 3AUWB 4FMFA 4Y5YA 1FFPA 3TEZA 3RL2A 3VXRB 2W60B 4PRID 2BM3A 5E1GA 4L1LA 5IVXF 4AQ8A 5AVUB 2NX5D 4FD0A 2QSVA 4XPTL 5FM5M 1WCBA 4MKTA 2P44B 3W11D 2KLSA 3JUZA 1JPGB 5JA9A 43CAA 4AGQA 2J43A 1SHXA 1C5BH 2ITFA 2QQNL 1FI8C 3L3GA 2BIHA 2EVJA 4P4KA 5MEPB 1VLXA 2EILB 5C0EA 2XVKA 2IQAB 3L17A 1FP5A 1OO2A 1AHWC 5DFTA 2HLAA 3BVNB 4W4NA 5HPMA 2X6UA 3QJOA 5JDJA 2QQLH 4JO2H 4HOMA 1M9WA 3CBKB 5DDHA 3IJYA 1LE5B 1FZMB 4S1RH 1KTKE 3V5DA 4F20A 3NEEA 3ZKMD 1INQA 2CDFB 4O4YH 5TQ0L 5EEWA 3VXOA 1UM6L 2B2XH 4XOCA 4B5ZA 2DYPB 4J8RB 1BVNT 5I6NA 3B3BA 5DK2A 4TUOB 2ZONA 1DZBA 5E0QA 3WIAA 1R3KB 4Z7WA 2VDRH 5SWZA 3T3ME 2OR7A 1OCWL 1EX0A 3SKOB 4XC1L 5B1AB 2JLLA 2DKUA 1AY1L 3ARQA 2ZUVA 3CJJA 4DUVA 2OZ4L 3WUWB 4NERA 4ZW7A 4JFPB 4PWJA 4TLUA 4HWEH 3SDYH 4A68A 5BV7C 3BGMA 3RZCC 5ICYA 4FQ1L 4BCYA 4XMUA 3KS0H 5GSRB 3GMLA 1B0RB 2GG1A 3PHQA 2P5ED 3QIUC 3QCUL 1FNGA 3J2PA 3HNVL 3SKNA 3POCA 2VLMD 4N25A 4YR6B 1QFWH 3H1ZA 3HJEA 3OV6A 5HI3D 2DM3A 3G5XA 3WHE0 5B1BB 3IJ8A 4LCCB 4K8RC 3TZVB 2FH6A 2HT4C 3EJRA 4TVPE 5FA3A 5BRQA 2FAUA 4AIOA 4KJYA 3FO1A 1T0MB 3TJEH 3Q1SH 1YY8B 3U1SL 4FJ6A 4LSQL 1NAKL 1UXSA 1CBVH 4NQTA 1RK1B 1CGTA 4Y4HD 3SCMA 4NC0B 3RVTC 3U6RA 4P2AA 1J8HA 2A83A 3LHPL 5E4IA 2XXGA 5EZIH 5EU3A 4NAJA 4LPWA 1OSZB 2CKBA 5SX4H 3GJFK 5JYMA 3MQIA 1IL1A 1UOLA 1NC2A 1ONQB 1QLEB 2FBOJ 2LE9A 1PVHA 2YN5A 4H8HA 1HS6A 2BSSA 1M57B 3DBXA 3MVSA 1JHKL 1P5UA 1B0GB 2W8CA 3JWOH 3UTSB 5J56B 1FLTX 1OP3H 4J6IA 3QHZL 3GZQA 3O4LB 1SY6L 3F58H 1N4XH 5MEND 2D3LA 3RY4A 4ZT1A 3O11A 1U95B 4R6UA 2O5ZH 4OKVB 5IJBC 3LEVL 5GISL 5ID1B 4LXFA 2IAMC 4K7PL 2MNWA 1IC4H 3I6GA 3FSZA 3IFLL 4HKBA 4TSBL 2P8LB 1NWOA 43C9B 4QAWA 4FNTA 5DO8A 1VF5C 3DGGB 4UQ3A 5IW1A 4FLOA 1MJ7H 4UYQA 4BCXA 5LN4A 1ZV9A 3X1BA 4IYKA 4Z1PA 1ZS8B 2DDQL 5IW6B 4G8AC 2YPVA 2VE6A 5FKPA 1MH5A 4B50A 3VCLA 4A39A 3ZSSA 4AVKA 5DCCA 3EOTL 3FMGH 4LSVH 4ZPTA 1CWVA 3V0HA 4OLXH 4N0FA 3ULUH 1TEGA 3C08H 3T65B 3F8UB 1AACA 5TE6L 3EFDH 2TSBA 1M1XA 1RH8A 4LLQA 2AMUA 1B4TA 2B08A 5IHHA 2EDHA 4XMWA 3WTTA 2ENQA 2FTAA 3VFOB 2WP3O 4QO1B 3FZUC 3QZNA 3WTUA 3NCXA 1UZ8A 1BECA 1Z9MA 4R9HA 5D70H 4KMQA 3IJ7A 4U49A 2F58L 1W72H 4HJSA 2G0KA 2N01B 3IFNH 3OLDA 1MCBA 4DP1X 2PXYC 32C2B 3C09C 1BQLL 4JFDE 3VWKC 4D9RD 3BPOB 1EHKB 1F3RB 3IDUA 3P0YL 4YFLI 1MRDL 4ZUSA 5KBKA 1BYOA 2X7LA 3SGDI 5E7BA 1X5HA 2WB1A 3VDCA 3GI8L 4D3CL 3ASNB 3CH1B 1BYNA 4A37A 4YDLB 4JFFA 3K72A 1CFNB 3AREC 1O6VA 1TETL 3PWUB 1A25A 4OF0A 5KSUB 1E5BA 1GR7A 2CDEB 2OMYB 3HR5A 3FO9B 2X89D 2DLEA 4V1DE 1ZV5A 5KYUA 1KJ2L 1JXJA 3RZCD 3KPSD 4EEEA 3FT4B 1UOVA 2LU3A 1J1OL 3O2WL 2B1HH 3BH4A 4ZSOE 3QIUD 1KGCE 4HCRA 3FUKA 5T5FA 1ZLWH 1J8SA 3EJTA 2DI9A 3NIDF 4G8EB 4NZJA 3LN4A 3QFDA 5F97E 3SSGA 3P9LB 3CSBA 5KVEE 5FYKU 2RGSA 1I3RB 2A4CA 4BZYA 1HHJB 4K8RD 2ICES 4HWBH 5KBNC 2NNFA 3F6JA 4LVHB 1R33A 2HT4D 4CVZB 1IC5H 5KJ4A 3KL5A 3A4AA 3D0LB 3QG6B 2BCMA 3OKLA 4GI6A 4KKPA 1FA4A 2F7QA 3DIFA 1U92A 1ANUA 4N90D 4CVUA 3GSQB 1PZ3A 1BQ5A 2WSPA 3ZE2B 1KGCD 3WXVH 4DCQA 3RVTD 2BVPA 3TO4A 2O72A 3ARWA 1ZHNB 1U8JB 4HV8A 2YLHA 5BS0E 2LU5A 5GGSA 3UJJH 1MUJA 1JK9B 5JHDE 4XP9H 1ACCA 3NZ8A 1KN4H 4WW2B 4HC1L 1BJ8A 1V8HA 2X0VA 2ZCHH 1U8IB 5H37G 4GKOA 4F33B 4HH9A 4XNQB 3AAZB 1T7ZA 2C4FU 3LB6C 1AR1B 2OA9A 4Y8DC 1N9PA 1KIRB 4M8QA 2G5BA 4IIQC 1KJ2B 2WLLB 4I7ZC 2DRUA 2A1WH 2G2PA 4P2OC 3FU7A 3FB6B 2Y7MA 3DA0A 2X05A 2Y06L 5H2BB 2H32H 3CU1A 4LDOB 4RNRB 1FIGL 2IAMD 4XPAL 4CGTA 4F15B 2P5WE 5KSAA 3NJIA 2AJYH 1BM3L 1QNZH 4GNKB 3K46A 4LEEA 2Y4SA 1D2OA 3WS6A 4BSVA 3ZYIA 1KXTA 1M7XA 3IWUA 4N5EC 5JW3L 4J5VA 1KNOA 2HX8A 3IDNB 1MFAH 3ARFA 4LCVA 4BQ9A 1FDLH 3P11H 5IMKA 4B5EA 4BDVB 3WN6A 4LAQH 4M7JH 4X6EA 3ARSA 3BSZH 4JFEE 1U8CA 3GYRA 3EJZC 2J55A 3QUGA 3T2NL 2J25A 1NMCB 2VN5A 3C12A 1OANA 2FX9L 1CD9B 4R96B 1BOGB 2ARWA 1MHCA 4ODXA 4CKVX 4DQOL 4YFEA 2Z7UA 1NOAA 2EH8H 3K5RA 3GRWA 2MCMA 4LBEA 2OAAA 1ND0B 4HIJA 2J44A 4WHDA 3RKDC 2KPNA 1NBYB 4ZS6C 4MA3B 3FZUD 1FAIL 4KROC 5F89B 5B22A 4NT6B 2XN9E 5DUPL 5BVJA 4F91B 2HJKA 1OK0A 3UMNA 4M48H 2I9LB 4FQ2H 1DQLL 5F8RC 1P5VA 3B9VA 4ICXA 4IEFB 3MGOB 2FX8H 4HSCX 1E5YA 3ENEA 3IJEA 3JWOC 3KBEA 3QNFA 4L2YA 2FJHA 5EF0A 5KVGH 1DLHA 2GTWB 1IGYB 2PXYD 1ORSA 3VWKD 5JPMA 5FDYA 3SE3A 1A3LH 4OFDA 1V3JA 3CDFA 4RFEA 4P4KC 5E1AA 2Z91A 1T0NB 1MY7A 2PWHA 3D05A 2JQMA 3RX7A 3KL3A 3V4PH 1R3IL 3ZMEA 3ARED 4XZ4A 1L0QA 3H4FA 4ODHH 3PF2A 2V9RA 1Q0XL 2JK5B 3PWJA 1VFUA 1EUTA 3H7BA 4OLWH 1MHPH 5LDUA 5FGCB 3CHQA 3QZOA 1LNUB 3QIBA 4R5XA 1VFAA 2CHZA 2FATH 2P5PA 2EH7L 3RA7H 1JZ7A 4YIQA 2MFNA 1BQHG 1I1YB 4J28A 3TEYA 4TS6A 5JW4N 2JI2A 5MP6H 2KZBA 3CFCH 4M7KH 3L3KA 2QTVA 5GJSL 3FTWA 2WBKA 4OFYD 4KDWA 4OLYH 3UGUA 2MH4A 5C9JA 3CXDH 5ANHA 2BNRA 2J8UB 1MCPL 3D52A 1JS4A 4N8CL 4OUUB 4ZODA 4S11A 2E4FA 4JZOA 2KZWA 1NKGA 3FB8B 3VFSB 5BMFH 4K9EL 5IB2B 1LEKB 2Y1ZA 4RSVA 2WM0A 3VDBA