2IVFC

Ethylbenzene dehydrogenase from aromatoleum aromaticum
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
b'MKAKRVPGGKELLLDLDAPIWAGAESTTFEMFPTPLVMVKEVSPFLALSEGHGVIKRLDVAALHNGSMIALRLKWASEKHDKIVDLNSFVDGVGAMFPVARGAQAVTMGATGRPVNAWYWKANANEPMEIVAEGFSAVRRMKDKAGSDLKAVAQHRNGEWNVILCRSMATGDGLAKLQAGGSSKIAFAVWSGGNAERSGRKSYSGEFVDFEILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ETHYLBENZENE DEHYDROGENASE ALPHA-SUBUNIT
molecule tags Oxidoreductase
publication title Crystal Structure of Ethylbenzene Dehydrogenase from Aromatoleum Aromaticum
pubmed doi rcsb
total genus 49
structure length 214
sequence length 214
ec nomenclature ec 1.17.99.2: Ethylbenzene hydroxylase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09459 EB_dh Ethylbenzene dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ivfC00
1UG9A 4JPQA 1I82A 1I8AA 2IVFC 1ULVA 1I8UA
chains in the Genus database with same CATH superfamily
5JZ7C 4LSPH 4GP5B 5EUOA 1JNLH 4F2MB 1SOQA 4OFKA 4AJ0A 5D71L 4HWZA 3ZT6A 5E94A 2VLJE 4PJGF 3ARDC 3N1PC 2BY3A 1T20A 1WS7A 4ELMB 4OCLC 1HE8A 5I5IA 1RIUH 3VG9B 3VXUB 3QJRB 4KHXL 1KGUA 3BZ4B 1LWHA 3RWFB 3NN8A 4XCCL 5DZVA 5K9JH 3MRCA 1JPSL 1SY6L 1G0YR 3HG4A 5L7XL 3KPSE 3ES6A 2I26N 3A23A 3QQNA 2BOCB 3O8XD 1H9DA 2VR6A 4D8OA 4FFZH 3SQRA 1T1XA 3V0IA 3VI3F 5I1LB 3VXOA 3PP4H 2F7OA 1BECA 4UAOB 1MCDA 2J6EL 3GLAA 4WO0A 4Y2DC 2WTOA 3MYJA 5JO5B 3ZX1A 3P11L 3THMH 3BAKA 1RZ8A 5TK4A 3U0WL 1RJLB 4Z0XA 5E1QA 1KLGB 5HVFB 2OTWA 2C1OB 2OMWB 3L5JA 5HHQB 1Z9SA 3ZMNA 1ZPUA 4QOKE 4GBXB 4DK5A 5BJTB 1W91A 3BUQA 2C1PA 2TSBA 3GLEA 3DO4A 3H6JA 4UYPA 1P4LB 3KPMB 5ESVB 5BNXD 3B7SA 4DUXA 3WNNA 3WIFA 4J4PD 1O7SA 3B5HA 1QWHA 3IS0X 4M7LL 4U1LA 5EOCL 1R6VA 4KRPC 1NMCB 4PJCF 5AZEH 2RALA 1J86A 1UEMA 1JWSA 4UT6H 4OAWB 4NWTH 3VD2A 2EXYD 3G5YB 2WN2A 3EO1B 1CLZH 3MLWH 4A7GF 4JB9L 4HUXB 4XVJH 2H6OA 4D0DB 5BUGA 4PS4H 2XDHA 3BHBB 4IMKC 3LD8C 4DP7X 1MI5B 1MVUB 1OGTA 4Q2ZA 4PW4A 4GSDH 4WTZG 5DUBB 4AGQA 3VJ6A 1YUKB 5AUMA 1M6OB 4N0UB 4UTAH 4QHNB 2BNQE 4DKEH 2IPTL 4P06A 3QAZB 4PJ9C 4N0YL 1UWEL 1OT1A 2YAPA 3IS1X 1G6VK 2W94A 3WDJA 5I19L 4G8IA 3BH8A 1WBXA 2XVGA 3ALXA 4N2OA 3UO8B 2P5WA 1NJ9A 1MW0A 4RH4A 3AB0B 4NKMA 2Q3ZA 5F3BA 3IVKB 2H1PH 2A9AA 5I9QB 2IANE 1WE5A 4YR6A 2QPSA 3R8QA 1ZV5A 3LRSB 4UM9A 1QUPA 2M8XA 3HZVA 5DFVD 2WQVA 4WWKC 1FBIH 4TULH 4U4IA 4GG6B 4N0FB 5LXGL 3O2VH 4KJPC 3ZW3A 2R7EA 5ISZB 1JTOA 2R29H 3M6DA 5D1XD 3TN0C 4D0CA 4QRQB 2ATKB 3FT3A 4KDVA 3GNMH 3MBEC 1ADQA 1VF5C 5HYSA 4P2YA 3VGHA 2P5EB 3ZHNA 3H54A 2H2PC 3MRQA 5TJWK 2VRQA 4FQIL 5FB8B 1FL3B 4HIEA 4AYEC 3VFVA 2Q8AL 1G84A 2BHYA 4HPHA 5I1GL 5E0QA 1QI3A 3VWJD 4LL9A 2XQYG 4CA4A 5D7KD 1EEUA 3FUDA 1G9MH 4ZX4A 1EV2E 5GXBB 3FT1A 3O8XB 3VXNB 2YK1H 1PDKB 5E6YA 3INOA 5DK0B 3T4AC 3DVGA 3PAZA 4F8NA 1V27A 1Z5HA 3BQUD 2JCCF 2FNWA 1A3ZA 1IC5H 3TZVB 1IX2A 1JHTB 1IGIL 5AB9A 3A6CL 3WEOA 1P7BA 4LPUA 5GGSB 3EFFA 4Z0XB 2JMRA 4KTEH 3RWFA 1EXGA 1I1YA 2OTWB 4X6CB 3MRCB 4G6MH 5EZOH 5T5FH 3VG0L 4DGWC 1P1VA 3CWGA 1A3LH 2BO0A 1XL6A 3CZKA 3O11B 2HT2C 2YAMA 4NOFA 2ZWNA 1ID2A 2UWEB 4IBVA 4XB7A 2GEEA 1ACZA 4YHYC 5BJTA 2YEQA 4MBRA 3TTSA 3VSTA 2R4SL 4NPJA 1I8MA 3FQTB 2DQJL 4MSWB 5IQMA 2C26A 4M62H 3LQAH 4PGEB 3SZ6A 2H7WA 4XH2B 1P69B 4NLHA 5GRZA 3QCVH 1SY6H 4O2FA 4Q4EA 4YLCA 2EUXA 2UZPA 4KKLC 4H8WC 2W0PA 5BUPA 1FA4A 3AACA 4FAAB 3BISA 3PNRB 5EFIA 3CPUA 3QG6A 2VSMB 4AM0B 4M61B 4HIPA 2OL3H 3F62A 3PDGA 4LXFA 3K81A 4BZ1H 2AI0H 3QDGE 4X6BA 3F01A 4EKJA 4J28A 4AEHL 2QADC 3OX8A 5IBUG 4QY8B 3ZTJG 2J1YA 3F7RA 5JIPA 4MCZA 1KCSH 2ZUWA 4QXGL 2AERT 4UT7H 4ZQKA 1NEZG 3L2MA 1E9QB 3RURA 3U2SB 5HYJE 1M6OA 4B3VA 1S3KH 1GGTA 4KQ0A 1R5WB 3D69A 3TBWB 3G04A 2EDKA 1QSFD 3BOVA 3NRQA 3QFDA 3LV3A 3QUYA 4FHKA 4DKFL 5IKCB 1ZS8A 1QSEB 3PWNA 4OFYA 3VXUA 1XB3A 1MJUL 3C60B 3HE7B 3WHE0 4XP1H 1QO3B 4IGBA 4XR8C 1B0WA 2AXFB 4PP1D 2X4SA 5CP7B 3WKQA 2MQGA 3BJLA 2PW2A 4BXVA 1GC1L 1WGOA 4K5LA 4PP2A 2NUPA 1SYSA 4NQEB 2HPOA 3VH8G 4BK5C 5IEHB 1G1YA 5TQ2H 4ODWA 3TEZA 4TS6A 4DCQA 2IWFA 4OCYH 5CFAA 1JN6B 1F90H 1JWUA 2VN4A 1DSWA 5ADPL 2QQLL 2EP6A 2YA1A 4X98B 1Q9KA 1TU2A 5LN4A 3BKMH 4K9EL 1DQVA 2VABB 2C9VA 4XB3A 1RZ8B 1PLBA 4R5TA 4WLCA 3P9MA 4PR5B 3D2UD 1NJ9B 1TMCB 5I8CA 4PJAE 4KNUA 2VXQH 3JT2A 4HOMA 1UCTA 1Y1UA 5FO7A 1RFDH 3ARSA 3EH3B 2DQEH 4HWNA 2QGCA 2IOMA 3SKNB 3RPIA 3KJ4B 1IFRA 2H9GB 5CKGA 1CGTA 1OALA 2YHGA 3RHWF 4XRCA 3SYCA 3PWVB 2IBZY 5CLTA 1A1NB 2UY6A 2BRRL 4AL8H 1DR9A 4MDIB 3KLHC 3C6SB 3DIFB 5BV7L 2ZE0A 1PFCA 3EOAB 1QR4A 4MAYD 3LKSB 1LE9A 1AO7B 5F7LB 4Q0XL 3CFMA 2R15A 3GDCA 4YC2C 3O41A 1CLOH 4XO9A 3N40P 2BERA 3HC3H 2R51A 3QUMH 4WENB 1YJDL 2V7NB 4WI0A 3F8UB 4WUKH 2YS4A 2RD0A 1C16B 1LEKB 1PNCA 2B8OT 4NZDA 4S0SD 4FD0A 3II2A 2QQNH 5J0BA 1PG7L 3OR6A 5SWQB 1GOGA 2N4IA 4HOXA 4FQJH 5A16B 4PSPA 1Q0XH 5F21B 3TZVA 1TQUA 2G3MA 2L7UA 1COBA 1NIDA 1MFUA 4QEGA 4L5FE 5GS0C 1PZ5A 3DYPA 2WBJA 4MQ7B 3VWKD 1P7HL 4OV6F 4JVWA 5J1SC 1G7LA 2FB4H 3UAJA 3VFSA 5JIQA 1BJMA 1X9QA 4RSVA 2CR0A 1IAOB 3GK8H 2J1ZA 2IWEA 2J8HA 4HVBA 2V2XB 1RZFL 1CE6A 1E4XI 4I9XA 1T03L 3CIQA 3S5LG 4ZZKA 4DESA 4JFQA 5F7UA 4XPFL 1QSFB 3OAZK 3MJ8B 3HNSL 3HI1B 5LXVA 1FL5B 2F54E 3EH2A 1CQYA 1QSEA 1OPGH 4WZ9A 3MLUH 1ZVNA 3AXHA 4NKOA 1S7XB 1J7VR 3CFIC 2HAZA 3J8F7 1F18A 1YEFH 3U9UB 2YMTA 1IJNA 3OC5A 4S2SB 3QI9C 3FSZA 3CNKA 1XIWA 4OT1L 5AVSB 3D48R 4F3FB 3SQOH 1KSRA 1OGAE 3O3DA 5DLMH 5D7JB 1K2DA 1IAKB 4GP4B 3RWCB 5KBDA 4HS8L 1EO5A 3ALWA 4RAHA 4PEEA 1XR9B 3VYOA 2WLLA 2V17H 3LV3B 3QUYB 4AEIL 4EF3A 2YIHA 5I1GH 4YNYB 4N2DA 2XNAB 4LLMB 4UANA 5AVUB 3G9VA 3RTQA 1MFMA 2CD0A 4R96A 3NSXA 5CEXA 5D1QA 4S0HA 4KXZH 3GO1L 4H4NA 4NDMB 1QHOA 1RVFL 1SUHA 3EUDA 3GNML 4G59C 5LB1A 4BH7A 2V8LA 4JRXE 2CDGB 2PWHA 5F44A 3WLBB 3WIHL 2VXTH 2V9RA 3GO1H 3ASWA 5CCKH 3SKNA 4E9SA 3R18A 1JN6A 4YSRA 5F89A 1ETZA 5KG9B 4X6FA 43C9B 4LRNH 2FT8A 1UEYA 4JFVA 2W9EH 4EAEA 3K46A 4ZX6A 3VACA 3ET9F 1TLKA 1VERA 2CIIA 4HAKA 3IMVA 2FLMA 3MA7B 1M7IB 3BPOB 1JWMA 1YEEH 1S9KC 1QW9A 2QKIA 4Z1PA 2E27H 4NENB 4QRPB 4JPVH 1IBHA 5E99L 4N0YH 1SRDA 3QDMB 4PJDA 4F24A 5C8JB 1QFWI 1PD1A 1DJXA 2XZAL 3LNGA 4LL4A 3HBQA 1EAPB 3ETTA 3T0XA 4JKNA 2OR9L 4LEXH 5FA3A 3ZJAA 3NFPA 1DQML 4XPFH 1X9LA 5D2LB 3BZFA 3V10A 1NCDH 1IM3D 5C9JA 3OR6B 3UZEC 5C0RL 1MVFA 2X10A 3OMNB 5GJTH 2VSKB 5KBKA 4D8PA 4HKJB 1K9TA 3BWUC 2AV7B 5EMYA 3RB7A 1I9RL 4JHZA 1GS7A 4E41A 4NRZB 1AO7D 4FA8A 4NZ8A 3VE0B 2LFEA 1NUFA 3GXUB 1OGPA 1MJJB 2MOQA 4IRJA 1F6FB 5DS1A 1YEIL 3V0WL 4IRSC 1BQLH 4JPVL 5E99H 1GOFA 1DANU 5GS1A 2UUDH 4AUUA 2IALB 1FN4A 3VD0A 3I84A 2KZ1B 2GSIA 3VSVA 2R8SL 1U8LB 2WLNA 1P0SE 5IESH 1KTRL 4UBDC 1Q9OA 3HAEG 5C0IB 5D1XE 3V0GA 3VA2C 5ITFB 3V6OC 5B3JF 4YC2B 3MJ9H 4WEUD 3QIUA 2XN1A 1UB5B 4LCWA 4LHUD 1E30A 3FRPG 2F61A 2D7OA 4NZUH 2ZJSL 1Z9PA 4PJGE 4K23L 2Z1PA 1BD2D 4RMWA 4WJ5B 4X9GA 1S5HA 3IGUA 4Q4IA 5F7DA 1EHLL 3RWDB 4RRPA 2OMNA 5HGGS 4HIHB 2IWGA 4ZOAA 2H41A 3KYOA 3WEBA 4UIMB 3OB0K 4JFQB 4X7TB 1TCMA 2QMKA 3QJSB 5AALA 4U6HA 2YPKB 3SCMA 5H4YA 4NN7C 2ROYA 3MRIB 1YMME 3NJGA 2CLVA 2GJRA 2UZIL 4G7QB 1HK6A 2NR6C 4GW1B 1HN1A 5CGMA 1CLCA 4CVWA 2OQJB 5JHDA 1BVOA 5KVDH 2WPGA 2DMCA 1U8IA 1AS7A 5KSBA 1FO0H 1RZGB 1TNNA 2V3FA 3GKWH 3KR3L 2MCMA 2R23A 3KGSA 4LSRH 4AW4A 4P2CG 4KUZH 3DURA 5HYSB 4UBDD 4TSBL 1P53A 3S5ZA 1KCRL 3FH8A 4FXGA 3VMPA 1UWGL 1MCWM 2HG5A 4HHAB 3TJEL 3G6JB 3CX5J 1A9BA 2O5YL 2Z9TA 1PTZA 4JL2A 4FCAA 3D25B 4M93B 4EJ1C 4Z0BL 2CDGA 5BXFA 3NAAL 1VENA 4YMPA 5K9QG 3IDIB 3QDGD 4P99A 3WNIA 4KXZI 3I3EA 3W39B 2ITDB 4CVXA 3CVCA 1S7QB 2DI9A 1DBAL 2R1YB 1QUNB 4APQC 5IMMB 3FO9B 5L8LB 2DMKA 3BSZH 4XOBA 5ETUB 1WS8A 4N0UE 1LD9B 4HSCX 3ZKXB 2NCEA 1HXYA 4QHUB 4NP4L 3T2QA 3NABL 5ACMA 5SWZD 1MY7A 1N3NB 3VGBA 1G7PA 2V9UA 1I85A 1XGPB 4YDMA 3K74B 1W0YT 3U9UA 3R19A 1PAMA 3QCTH 1XF2B 1GVIA 2V5SA 3P4OB 5I0DA 4BZ1L 1U9KA 4NHUA 1U8CB 1XH3A 3APDA 4J7RA 1DFBL 2DQIL 4A37A 4DT2A 3GTTA 5D7JA 1MCWW 2IALA 1N7MH 3NFPB 3P0GB 3VW3H 4WK0B 4BUHA 2GSIB 2DKSA 3K8KA 3QO1A 4K5OA 4K5PA 5IB4A 3J27A 2VDLB 2NRDA 4XHQA 5E2WH 5L8JB 1JYWA 2NSXA 3CLWA 4MDJB 4ZPVA 3U36A 4NRZA 4WF7A 2VDPH 1E3ZA 1X5JA 3VE0A 4DKTA 2V5RA 4NUJA 5I1JH 1GGCH 3QIBB 4B9IA 3NIFB 3WLBA 5J1AB 1E4XH 1E9QA 2MH4A 2NZ9C 4JM2B 1T66D 2H26B 2Q86A 1ED3B 4LLWA 1AKJA 4AGMA 2ZX5A 1K8DB 3GKWL 4F7TB 5I8KH 2EIJB 1UOVA 4POYA 4XX1E 1KT2B 4E2OA 1GW6A 2XA8H 3HB3D 1Q94A 3BSHA 3QEQD 3T8XA 3MRHA 4J3UA 3H56A 2FJUB 2XG4B 5FKPB 1WWAX 4LDCA 1FDLL 3LPPA 4ZFFA 3US0A 3CFDA 8CGTA 2MFNA 4WTQA 4OB5H 1UZ6E 4G7SB 4KKAD 1RERA 5DO8A 4Z8FL 1UOKA 5DC2A 9PCYA 2AS5M 2ZG2A 4MNQD 3ML9A 4XP9L 2Q0ZX 4BRJA 3G5XB 4K5MA 1HDMB 1KCUL 1OE1A 1F4AA 3U9PL 1GL4B 4S1SL 4G43A 2FHBA 2H45A 1TZ8A 1F02I 1NSNH 4V33A 1V3LA 2ZUQC 1RSFA 4GBXD 1B6UA 4WWKB 5LGJA 1THAA 3D4CA 4ZK8A 3WG7B 5LCVL 3FT2B 2CKBA 1J8HE 2J8UF 4NUPA 4RGNB 4WU5B 5DJYB 3VXMD 4J39A 3ZYJA 2XTJD 1GOHA 2RB8A 2G2NA 3FB7B 5C0EB 4RMTA 1JGLH 3HZYA 5KYXB 4Q97A 4BZYA 3SY0A 1MJJA 1GTNA 1CIDA 3Q8AA 4LDEB 1O9VA 4CADA 3BE1H 5EPMB 3MGTB 5DRZB 3FUIA 1FSKB 1SBBA 4WRLA 4LLDA 5GS2H 3SE4C 2Z8VC 2GT9B 1S7QA 3C6SA 2WWMD 4ZNCD 3X3FL 1UURA 3DIFA 3HB3C 5FUOL 3HCVB 5ANME 5HY9A 3F58H 2GUYA 2PWEA 3QARA 1IFHL 4MLSA 3S4SG 1L0XA 3JTTA 3D2UB 4JDVB 2C4FT 5DS2A 3K8MA 2AJSL 3MTXA 3DX9A 4I0PA 1A9BB 1U93B 4IDLA 4LRIA 4MRBA 4PV8B 2XWBB 4WKZB 2ITFA 5TK2A 5LGHH 2GFBB 4ODHH 1C16A 1LEKA 4FLHA 1E5AA 2AJ3B 4ZUSA 3HR5A 2VDNB 4JMNA 3TT1H 4JZJB 1DDTA 5HDLA 2P26A 2K45A 1J9TA 5HVHB 1FZMB 1I7ZA 4IOIB 4U3SA 1BWWA 1VZIA 5SWQA 4LB8A 4GBXC 3KYOB 4UQAA 4NFCA 2Q9OA 2UVEA 3LXUX 2XJKA 3GXTA 1FHGA 3S2CA 2OMZA 4UU9B 2DICA 1T2JA 2VDLL 5DEGB 1HL9A 1BHGA 3GJFA 1MPAH 4IBLT 4PRPD 1J87A 4QYOB 5E6ZA 1G7LB 1JUFA 2DMGA 2OYLA 4HH8A 2L8AA 3FAXA 1NPJA 1RQ5A 3B9KD 2AK4A 3DROA 3TA3B 4L4TA 1YN6A 2E46A 2WXJA 1FZKA 1NTDA 5J1AA 4YHZH 1U8PB 2D9QB 1NSNL 3U0WH 2GEQA 4JQIL 2Y7MA 4HC1L 2YMOA 3SGJA 5CEZL 4M8UA 4PRDB 1CF8H 1G6RH 2FEDD 1KBWA 3D39B 3EYFA 5F6HI 3ARGC 2FZ3B 4IHBA 4NPYA 1MCCA 3PWJB 1BBDH 4UDUB 4U7SA 5I0XA 3WNJA 1TO5A 4EBQL 5CBEA 5E8OA 4LCIH 2IDCA 4LCUB 2X4PA 5CZXC 3POHA 4S2SA 2VR8A 4MMYB 5FYJE 4ALAC 3GRGA 5G4OA 5J5EA 3ME0A 2WNKA 3FHAA 1U3ZA 1KJ2B 2ITDA 4PV9B 4LEOA 1EJ8A 1K8DA 1RIUL 2FQDA 2QR0A 3MV9E 3QPXH 4X5QA 4G43B 4ZJ9A 1GZPB 4OJAA 2X1XR 4FA7B 3CSBA 2WXNA 1H8NA 1T4KB 1QG3A 1KDJA 4JFUA 4QT5B 1CXEA 2ESVD 3GBNH 4OZHA 1QLRB 1JD9A 2CR6A 3V8CA 3WE6A 1JNLL 3RTQD 4P5MA 2NW3A 4O9HH 3SDDB 4EQ2A 1P5UB 4RBPK 2PR4L 3EGXB 2CBTA 3WS6A 4JFXA 3P0VH 3ZPDA 1OSYA 4J3OC 1AVAA 2EZ0D 5E9DD 2WO3B 1TVHB 3NSYA 2W95A 3N9GL 4CJ1A 2EO1A 2IXQA 3W56A 3OKMB 5DRZA 5FGBC 2DTSA 3JWNH 1RZFH 3D4YA 3SBQA 2PYFB 3BYTA 3E6HB 3UAFA 4JZNA 3V4PL 1LK2A 1Y0LB 2KPNA 3A4FA 4QTHA 4LOUD 1IE5A 2FO8A 3HMXH 4N9OB 4BCXA 2FIKA 3NJMA 1IFGA 1M7IA 3NJFA 3RBSA 4CBZA 4GQRA 2HPTA 1DVSA 3WL9A 3DBXB 4NENA 3FB7A 3AY4A 2WUBH 4JANB 5KZCB 5IK3A 2UZYB 5E24E 2AF2A 3HFMH 1GGUA 2PABA 2DLHA 1PS3A 3STZB 3GDBA 2WP3T 1BFTA 5CN1A 2DKMA 1D9KB 3MGTA 1BP3B 5DQ9A 5KWYC 3GTVA 2X4RB 7FABH 4PVMA 1CR9L 3NQKA 1MW2A 1RHHA 4PIBA 3F12B 3H3PH 2X3CA 3VSUA 2OV0A 2F54A 4JUTA 3ZTEA 1UD3A 3MNMA 2NZ1A 2BC4A 1F4WL 3WHXB 3LNHA 5F96H 1U93A 1A7QL 1FYHB 3PREA 1KCVL 4XPTL 2YD2A 4NJAL 1HQ4B 4Q7DA 4TSBH 5DUBA 4M93C 3SYPA 5IVXB 1B4JL 5A40E 4QLRA 2CM6A 3KYNB 1AGEB 3CFBA 1MXGA 4K3HA 3N85H 5SWSD 3FQTA 3L4XA 3LNIA 3ZE0E 3BAJA 4G1EA 3QG7L 5C0CE 1O7VA 4ELME 3FFCA 2ED8A 1ZSHA 4JM4H 1L4IA 2OMZB 1MFBL 3L4TA 3JWNG 4Q56A 4UU9A 3E0GA 4B0MB 4BHUI 1EUTA 1JIBA 3CIAA 1UXSA 2WXPA 4Y4HD 3AMKA 5J11B 4FQ2H 3RU8L 1UXWB 1B0IA 3KLAB 5GGTA 3SDYH 3WJJA 3SPJA 1CG9B 1LK3H 1QRNE 2HTKD 2XICA 4MNHB 3E9TA 3FB5B 4A68A 3MC0A 1SMOA 2QQLH 4K2UL 4AEEA 4PV9A 1Y6NR 3L5WB 4FLQA 1BJ8A 3FOLA 1MDTA 2MIZA 4DAGH 2CJ3A 2I60L 4BRVA 4P2OC 3SCMB 1IBGL 1KG0A 4I18C 3D2UA 4JDVA 5C3TA 5K1VA 3MRIA 4DP9X 1FL3A 4HIEB 2CPCA 4ZTPL 3MRFB 1FVCA 1SF3A 1BZ7B 5MERB 4E42B 1GA2A 2VL5B 1PY9A 1BSIA 5HDWA 5HPMB 1ZVYA 4ZSOB 4PJBF 4BK4A 2PO6B 4Y4FA 2KS0A 4EPSA 2DWTA 1DJGA 1WCQA 4E9YA 3QPQD 5ID1B 4PJAA 4PJFE 5CJOL 1J0YA 2C3VB 4NQUA 1TU2B 3L1OH 4GRWE 2R1WA 1ZVHA 4XMPH 1MCNA 3RWEA 4X0KB 3NCWA 1QP1A 4NKIL 1OM3L 5M7QA 1GGIL 4JW3A 3GJFB 4RQQA 3SOBL 2R2BB 2DQGL 4WHDA 4JREC 2D0HA 1JI1A 5BW7A 1U4FA 3PNWB 3KXFD 2ZPKH 3N3EA 4W93A 4NN6B 3KBPA 2YQ2A 2OJ1A 3ZQWA 3OAYK 2FT6A 3GGWA 2GHZA 1AR1D 1OARH 2JTYA 1A3QA 1R19A 1HQRB 2CHZA 4AGOA 2FIKB 3HI5L 1MCHA 4FFTA 3HHSA 1OTTD 2Q87A 5B22A 1LO4L 3LJ3A 3P02A 1QFOA 4V2BA 4U1NA 5ACZB 1P4IH 4ZUUA 3B9DA 5LBSA 3US9A 4LU5L 5IK3B 2Y24A 3WTWA 2X6UA 4HIXH 4LL1A 4PS7A 4UM8B 2DJUA 3FCGA 5KVEE 1XD0A 4R7XA 2B5IC 4GT0A 1CL7L 4YN3A 2JV6A 4LMQE 2R69H 3MX0B 5JPNC 1DJHA 1JGDA 4NI3A 2JB6A 5L88L 5MHSE 1T4KA 3ABZA 3FFCB 5F7FA 4FNPA 4ETQA 4OLZL 4Z23A 3WEAA 4ZXBD 2XI9A 4PJFF 2AXFA 2GJZA 5CP7A 3FSOA 1XXDC 1QHQA 5HVWA 3HUJE 1P4BH 3BWSA 8FABB 4HZAA 3IE9A 1MLCB 5IM7B 1HQ4A 4JRWA 3GRBA 2Q7YB 2I9LB 3DWTA 1VFMA 3INUL 4A04A 2R0WH 1IIKA 1NEPA 3MNZB 5D55A 3GSRA 2W0KA 1MCPH 1QLEB 4HGWB 1FZJA 1I8LA 4I2XE 4I1RA 4UTBH 4O00A 3MOAL 4OVVA 3HZ3A 3WTYA 3LH9A 1I9EA 1KLUB 3MMEB 3QUYC 1J05B 4XMPL 2VN5A 3MRMA 1NLDL 1YVLA 3Q8BA 5HHOA 1P7QB 2XA8L 5FYJL 5I8CB 4HJIA 3UJIH 2YZ1A 5ERWB 2IH1B 3BLPX 3UTPE 1LILA 4NO0D 5IT2L 3RPKA 1MIMH 4L3EE 4PV1C 5KSAC 1INEL 1XIWB 1SXSA 3RQ3A 3PWVA 3NJLA 1Q1PA 5IBTH 2OTUA 1OARL 4BWUA 1MWOA 1VA9A 4NZRH 2F0CA 1N67A 3UBHA 3VH8B 1YAIA 3RWGA 2DS4A 2DLFH 5EO1B 3QR0A 1I8IA 5TDOA 1CFSA 5DRXA 1T80A 1LP9B 3NZ8A 4GG8A 4LPWA 5DUPL 5E5UB 2YAHA 1U8NA 4JY4A 2WZAA 3VI3A 3S88H 3MJ9A 4WWPA 5KYUA 3O9WA 1JE6A 4TUUA 5JPNA 4TPRL 1NLBH 2LFGA 3VFOB 2QSVA 4YSCA 4MZIA 3ULVF 3FQRB 3H7BB 4MHHG 2VL4A 3SDXA 4FG2A 1CDHA 5CZXD 5B7MA 4UIKL 2QFRA 3GGWB 4N0CD 5JDJA 1OW0C 5IROA 3G5WA 1MG3C 2ED6A 5JORB 1WG3A 1KXTB 1AAJA 2K6YA 1YDPA 2AJYL 3GMMB 1R46A 5E08L 2LU4A 1OAZH 3GZQA 3H42H 3NZUA 3BUDA 4I0PD 5K39A 5LBGA 5DTFA 1RSYA 3L81A 4KDTC 1XGYH 3QC5X 4Z0BH 1TYJA 4HXAH 1KCVH 1HX0A 4XPTH 3TWCH 5FYJD 1RZKL 4IW4C 4BGDA 4YHPB 3BP5B 3ARFB 1KXQA 4OJCA 3TJEH 2IF7A 2XVKA 4A7GA 3FQXB 1O9WA 1D5ZB 1JGDB 1HU8A 3O3AB 3SGJC 3TBYA 1RFDL 5GRVK 5DEGA 4ZFGL 3MLXH 4TNGA 1DZBA 2UXVA 1SXZA 1XEDA 2E76C 4S1DC 2V2WA 4GSUA 4E42A 2JKNA 4L4TB 1CGYA 3W9EB 4L4VD 5I28A 3EO0B 2Q3AA 1TO4A 2QQKH 4P23B 1D5XB 4XBMA 4L4TD 4UYQA 3O3EA 2ZKHL 3VFMA 2G3XA 3HG5A 3O4LE 4XPGL 1YEHH 4XMUA 4DF9A 5D7JD 2VR9A 4B0MM 3RVXC 4Z7OE 4OCYL 3LIUA 5D7HA 4H88L 3Q01A 2B0SH 2ZOKA 4Y5YB 3BJ91 4AH2B 3KPRB 3PLYA 4FYSA 1WUNT 3IJSA 4GFTB 3ZDZB 1MWAB 2J5LC 5I2IA 2XT1B 3SBRA 1JZ3A 2XU9A 2H2SD 1MJUH 3FZUD 1N19A 2BFVL 5FV2A 3RNQA 3ORJA 4L05A 2Z7WA 3ESMA 3DUHA 3ME0B 5DC4B 1WH0A 1DQQB 1LMKA 1NWOA 2JSFA 3SDCD 3HAEA 2R0LH 1C08A 3KG5A 5F7DB 2ISDA 2XZQH 3FO1A 3DXAE 4X6FB 4H88H 5EU5B 5TE7H 1MRFL 1C7TA 1MAMH 1IQWL 25C8H 1AACA 2B16A 2A9MH 2OTUB 3QVAA 4HLZH 4AE0A 2AZAA 1G0DA 2CZNA 2EDOA 2F58H 4X7TA 3ULUL 1BVLB 4FQLL 1KB9J 4QO1B 2HVBA 3VFTB 3SO5A 5ENWA 1KTJA 3MNWA 5GGVH 1HYSD 2CO6B 3W0WE 4BA8A 3L9RB 2QADB 2XXGA 4G6AD 4N6RA 4NO0B 1PLCA 2HVJB 2VSDA 3KM1A 4M62L 4TSCH 2CG9X 3O3UN 1RMFH 3Q6GH 2J8OA 2X1WL 3CZNA 3HKFA 3BEVA 4Y2LA 3RZCC 1O6SB 2YMXL 2ADJB 2ADIB 1HHGB 1NIAA 3WTUA 3VXMA 1C5BL 4RSYA 4NCDA 5KJRL 4L3CB 3CX2A 5FM8A 3B2XA 1I1RA 1RULL 4GJTB 1AFVH 2XTJB 3V7AE 4O9HL 4BFFA 3SKOA 2P44B 1CXLA 2EO9A 5GHWH 4M6NL 3RGVC 5HYSG 3H7BA 5BVPL 3LX9A 1ZLSL 1MRCH 1ZS2A 5HGBA 3L5IA 2YK1L 4DKDC 1QKZH 1JNHB 3HE6A 2XIBA 1R3LB 4KI5F 1NLBL 2EECA 4GQZA 1X9UA 2X4UA 5K9QI 2NY4B 1AD0B 3HN5A 4AQZA 2CE6A 2GCYB 1A6AA 2DQUH 4QRUB 3REVB 4RBPH 4MA3B 3T6XA 3WY3A 5KS9B 2QHRH 3AAZB 4W9ZA 3NZHL 4JGUA 4KTDH 2WKOA 3L45A 4LGPB 3RWHB 1QBLL 4BDVB 3GMLA 1L5GA 1H0DA 1D2OA 3JWDC 3UGEA 1OCWH 1RVFH 3IETA 1J8KA 2YJQA 2ZJSH 3GXFA 4GRLA 4PJFB 4GS7B 3WMQA 4GPVA 4MMZB 4B5EA 5KBMA 1J8HA 4M9OA 3C08H 1WWCA 3OSKA 3V6ZA 1R5VA 3MCKB 1EHAA 4P8QA 2QSCL 2WVTA 2O26U 1PZ3A 2VLRD 3N6YA 3MLSH 4ADGA 4RMSA 5DWUL 1DVFA 1XF3A 1PKOA 1Q0YL 4PCYA 3U0PB 4GW1A 4J1UA 3ARDA 3IGAB 2BHUA 1MPAL 1WZKA 4TUKH 5I9QC 2DLGA 2N7BA 1YEFL 2ZCHH 4AIZA 4DTGH 4WEBH 4NBYB 2JKRM 4TTDD 5AVYB 5D2LE 2FEEL 2FSEB 5DZAA 2A1WL 3BRDA 5IW6A 3KXFE 3G6AB 4G7RB 1CGVA 2WXQA 1M7XA 4UT9A 1MCPL 1RZJC 3MRHB 1LLAA 4JCLA 3A24A 3GC3A 4XP6H 4Y1SA 1UCBL 2HRLA 2KDYA 2EE0A 3FTGB 2EIKB 4X42A 1YDPB 4PRHE 1FVCB 2V6HA 1BZ7A 2WNGA 4M1CD 1MSPA 1W16A 1JMXA 3O0RH 1CI3M 5I0VA 3MLYH 4OLZH 2QADD 2NQCA 1I9IH 3ZSSA 3RVWC 1VRSA 4AV4A 1W72L 3N41B 3GMPB 5FHBH 3OKYA 3AQYA 3NJKA 3QULA 4FQQA 1KTKE 4H8WL 2J1XA 1YRKA 3L2NA 1D5MA 1FYTA 4AK1A 4U31A 3QQ4B 4Q9QL 1JYNA 4QO1A 1TEGA 3VXPB 1T04B 4KKAC 2EUZA 5CEZD 2X6AA 4OU3A 2OK0H 1LGVA 4M43H 4JVUA 2CJUL 1XF2A 1L7IL 1UT2A 2PO6D 4MD5A 3RPBA 5IFAL 4CADB 1KWGA 15C8L 4C55A 3Q5TA 2BWQA 3I6LD 3DARA 4NUMA 1HZKA 2A73B 3N43F 3BUTA 1F5WA 4Q0XH 1L9RA 3QJFB 4NJ9L 4OLYH 4OLVH 3MRLB 1SJEA 1Z1WA 2WIIB 4ORGA 4Y2DB 4EI6A 5HI3D 1PZUB 4PRPA 5B38G 5GRVL 2PWDA 1SN0A 3TCLA 3W57A 5LDSA 2ZP8A 4OJDH 4KJQC 4MD4B 2DQIH 4AL8L 4E0RB 4M02A 3L3KA 3L7EB 3FONA 3ECBA 4W4OC 5KSUB 4JBSA 1KELL 1YQVH 3EG9A 2HFFA 1JMZA 1SVBA 1NIBA 1SY6A 2E6QA 1BD2E 2YKLH 2AV1B 2UYLA 3EOTH 3RL1A 1L5GB 4L3ED 5GGTH 4ZMLA 1S9VB 3NIGE 3EJYC 3NABH 5KANG 2R56H 5FA4A 2E9BA 4HFWA 4Z7OB 4TNWF 4M5SA 2N0KA 4YX2L 3CFDB 1OTSD 3C6LD 1Y18A 2BSCA 1YNTB 4TQEL 1L7TL 4HETA 1R5VB 4CVZB 3PY9A 1E4XL 1A7PH 1I31A 5JNYB 4P46C 3FO2A 3H6AA 4TLTA 1PBYA 3AS1A 4JN1L 1WO2A 3TCXA 2APWA 4OUUB 4X7FC 4PMFA 4DQAA 1KACB 3CMGA 1UATA 2DOCA 3OJDB 4O58H 1ZTMA 4M00A 4ZMQA 2FBJL 4DAGL 4H1LH 4JO4H 1UB6B 5ADOL 4D0BA 2Z4QB 1X4XA 1Y7VA 5IGXL 3MNVB 5DMYA 1M71A 5DJ8A 3W11C 1UENA 1KJ2H 1KXHA 5EZLA 3TYFA 3GEWB 2IADA 3VFGH 3NIFF 3UERA 2VN3A 2IV8A 3BT0A 3LH8A 4UNIA 4FQJL 3MJ6A 1Q1JH 3WN5A 1NBZB 2NTSP 4NSKB 2CDFB 4XWOD 1B3JA 2C9PA 2N56A 3GSNL 5E56A 2KL6A 5MEPB 2QZQA 2WBWB 2YPVA 3OLGA 2DQMA 4OVUA 5ESQB 5FUCE 2VMEA 4NP4H 4QAWA 2ZKYA 3O3BA 4YVUA 4F2ME 4YEEA 3QH3B 4HH9A 1QMUA 2FATH 2HMIC 5HHNB 1MOEA 2HRGA 1B88A 1T2QH 2X41A 4HC1A 2G5BB 4LKXA 5JR1H 3PL6B 3OPUA 1DBAH 3QULB 2HYMA 3D06A 4B53A 1G9HA 2D7TL 3QYMA 3NZSA 1R3LA 2F68X 2VJ0A 4OLUL 4DPCX 1HILB 3UO1L 3VXRB 1J0HA 3DX8A 5DA4A 1MNNA 4ODTL 4FYRA 5CSBA 3AXLA 3F04A 4MQSB 5BZWB 1R3JB 4I48B 4WFFD 3V5HB 5CJXA 1S7TA 3GHEL 1OAXL 2NLJA 4FYTA 4HMCA 3LYRA 2A74B 3QI9D 1JGVH 2QMJA 3LQZB 2ZXGA 1WISA 1SDDB 3NCYP 4QUOA 4LSRL 5I73C 1IGTA 4JZNB 5DU7A 2XWZA 1AH1A 3P3RA 4FQHB 3OLEA 4DPBX 4Q9QH 1UA6L 1QTSA 3EFDH 1KXTA 3SJVA 3KPRE 3CXFA 4PRPB 4QYOA 1MRDH 2FGZA 4XXWC 1D7BA 5T3XL 3ZDZE 1EXUA 2QLVB 3PXJA 2FD6H 5IQ7L 4ZRGA 1MHPH 3L7EA 1AQDA 1UKQA 4MD5B 3V55A 3VXUD 3G7TA 1E5CA 2WO4A 4NM8L 3QZLA 4H0LC 3C5ZB 2MCAA 4NT6B 4R4BA 4ODVH 3A4EA 3UTSB 2YXFA 1D9KA 2GIMA 3B2MA 2E7CA 1NIFA 4QRTA 4RFOH 4L3EB 1GC1H 4PH8A 1QR1B 4BKLB 3DXAD 4GMSL 2HH0L 1J1PH 4A66A 3HMWH 2X05A 2WIIA 4MA1C 4ORGB 2D73A 3MQIA 3N5AA 1TZIA 3HVDA 4GMTL 3WD5H 3PHQB 1YNTA 3Q2VA 4TLSA 4RZCB 3BUPA 4K23H 4BM7A 5E8OB 2VMCA 3O2VL 5JQIB 3MRBB 3I85A 4WI9A 1AZUA 3KWVA 35C8H 3GHBH 3L3KB 1MI5E 2I85A 1NCBH 1DHKA 5IB3B 2QKIC 4J4PC 1D5XA 3IYLW 1RIHL 3KDMB 4LVNC 5HDBE 2FO1A 3VFMB 2LLLA 5C2BH 4ZMOA 4CGUB 3KYNA 3S98A 5DUML 1J0KA 5ANMB 2LAGB 1BIIB 1QBMH 1A21A 3QEHA 4XNYH 5IQNA 5CLXA 1FVEA 5ITBL 4HISA 1HKFA 5CGTA 3S35L 3W2DH 1UWEH 4NN6C 2AANA 2Q5BA 3WE6B 2DTML 4DFHA 1UASA 4DP0X 3BPNC 5DMKB 1C7SA 3ETBF 5EOTA 4J3WA 5DFWH 1ZLUH 3S5LB 2ZONA 3CFJA 2XTJE 4OGQC 5I6KA 1BBDL 1L3NA 4C47A 1IQDA 5M95B 5E9DB 5A2IH 4I13B 3HTLX 4OZ4B 5FYLE 3FDWA 5B3NA 3F5WB 1UH2A 3NG5A 1F4HA 5FWRA 4HDIB 3G08B 4JQXA 1ZEAL 3RLSA 2EH8L 4K3JL 5D7IF 4UT6L 3GXMA 3K6DA 3NCCB 1SJEB 4Y2DA 1BVLA 1FRGH 1GC1C 2VTFA 3C5JA 5F2FA 4HS8H 3ZE1F 5EIIB 5IB5A 1KG0B 3CGTA 1TITA 3OJVC 4JANA 1KC5L 2V9QA 3U1QA 1UA7A 3L95B 3WNMA 2AQ3A 1FAIH 1IGJB 1E4WL 2HJLA 4XMZA 1OTUD 4JE4B 3SCMC 4P2OB 1GS6X 1U91B 2H2PD 3CCHA 5A3IC 3LQZA 2D31B 3DSNB 2G5BA 1BLNA 2HJKB 4G6JH 4NOBA 4YXKH 1KLFB 2ZQKA 3IRPX 2NR6A 4H0IA 4LRNL 5HDOA 3P11H 3V0VB 2BSBA 3ASNB 4AMKH 5LG6A 1ZEAH 3QISA 3HG3A 5C70A 5AW9B 4TLKA 5GRUL 5DQJB 1FNLA 2DEWX 5F7NC 1ECZA 4FG6D 4TQ8A 4GNKB 1OLZA 3D08A 4ADIA 5D1ZD 5DYOB 3QORC 4K94H 5AOIA 4NQXB 4XNMB 1EDYA 3ZKNC 4BZ2A 2AJSH 3ESNA 1W6WA 4ZMWA 5KW9H 4AGNA 3TIDA 2Z8RA 1YECL 2YKKA 4FKKA 3EYUH 3QUZD 2A6DA 3CFBB 2UX6A 2ZNXA 3BMWA 4CC1A 4GUPA 5C0FA 2K9UA 1QWUA 2WQWA 3RE0A 5EEXA 3W3BA 4LOFA 4DETA 2Y72A 5ITBH 1M56B 2OMUB 2FYVA 4C56B 4JHBA 1SVCP 5BVJA 4M3JA 4EQ3A 2VQ1B 3S36X 4AOFA 4ZFQA 4AUJA 3JTBA 5IB2A 1YEWA 4R0LB 3BAXA 4MAYB 2OW6A 2VOTA 2WLYA 4P5KA 2VW4A 3QZBA 2FO4B 4YSOA 3BZDA 3FB6A 1UA3A 4XC1H 3ULAB 2Q10A 2AEPL 3P9LA 1MFDL 4WO4D 3SE6A 3AY2A 4YHMH 4CKVX 1OWRM 2EINB 1ZA3B 4JFFD 3GMOB 4MAZA 3RP1A 3RX8A 2AXHA 1DCEA 1XGQB 3CDCA 3VFRA 2JI3A 4PS8A 1SF5A 3V6ZB 3MCKA 4O5LH 1A2YB 2ZXDA 3PIQA 2P80A 3ARYA 2ZCKL 1OB0A 4KMTH 4YDVA 5CHNA 5F9OL 4MX7B 1MHPL 5DI8A 4ODVL 4ZNEE 3WHE1 2GJZB 3GXNA 2BRRH 2VAAA 3WU1A 5E9AA 5BZWA 3NGBC 4CUCA 1XF5A 2COQA 2KERA 3OZ9L 2CDEB 4ESKA 2J8UA 5K93A 1ZDQA 3GTNA 4OV5B 1DDHA 1ET5A 1V10A 3RVUD 3KS0J 1X44A 4M56A 3WDIA 5IBUB 2V5YA 3SJVE 3NTCL 4DOHE 2DLIA 3EBAA 1A0QH 4JY5L 1L9NA 1DANT 3WJLC 3T0EC 4ES9A 1IM9B 3FUMA 2BIHA 4RFEB 4OJEH 3IE4A 1GGCL 4RQQB 3SQBA 4BFRA 4Z7QB 3C12A 1EXUB 3KPLA 1Z5LB 4FQ1H 1AQDB 1BREA 1S9YB 2YD4A 1OTSC 3C6LC 3KBFA 3CHRA 2B1AL 1PZAA 4ODTH 3WMSA 4DVBA 2XXCB 2X88A 1MDAA 2EDFA 4Y2NA 2OMWA 3ESVF 4QOKB 1ZT1B 3PJSA 4P2OA 1QR1A 3ARBB 4X5LA 5JLZA 2YR3A 4UTBA 4AIXA 2YWYA 2HXAA 5C86A 3W38A 3P4NA 3QUYD 5ESVA 1O0VA 3KPQA 4KHTL 2EKSA 5T1LB 3QWOB 4LLAA 4RWYH 1IAMA 2F19L 1RU9L 3BEWA 3X14B 4XNXH 1G7JB 5IWLC 4FE9A 3F83A 4BSVA 2D4DA 4YXHH 3B8YA 1AQHA 3IDYC 5IB3A 4YDNA 1IGFL 2PXYA 2HSIA 4X6CE 5E8NB 5A2BA 1CFVH 5F1IB 4FERA 2HA1A 3DYMA 3MV01 3RFRA 1G7IB 2ID5A 3LDBC 4HUKB 4NIKB 1GZQB 3DUUB 1TENA 4KXAA 3ARGB 3ZIYA 3KH4A 4ZW7A 4BXSV 1I3UA 1QI5A 3MUY1 3TX4A 2O6CA 3TPKA 5G55A 4ETQB 4TUJB 2ZIDA 5ADOH 2P9RA 3MFGB 3QEQB 3T5WA 3ZRSA 4BFJA 3D34A 3V4VH 3ZDXB 5BV7B 4H2CA 3K6NA 4WSKA 5IMLB 5E5MB 3IGKA 3AG2B 3FONB 4YHLL 2NXYC 4NNPH 4Z95L 3V95A 4YFLI 2P48B 1KEGH 5JHAA 1EERB 2Q7YA 1CQKA 2CK0L 3LHPH 2RTTA 1U8KA 2JJVA 2LU7A 3D3VD 4GUPB 4DKFH 2B7DT 4KO6A 5ICZA 3QZWG 4HBCH 2SEBB 1PCSA 3FULA 2W9DH 3MOBH 4XXDA 5JW3H 4DGYL 4IYKA 3PXHA 4AKOA 1X5MA 1IM3B 3JQOB 3QEUA 5KANI 2VJXA 4LCCA 2CKBH 1TR7A 2QZ5A 3C6LA 3RVTC 5A6MA 1QSEE 1AI1L 5EBMB 3O4OB 1UQSA 5LAXB 3FB6B 2BY2A 3SOTA 2MCPH 2VR7A 3BVDB 1HL5A 2FYYB 4I0PC 3SDCA 3W9EA 3Q1EA 2APFA 4TVPH 4MXWL 1JYXA 3ECUA 1DVTA 2C3GA 2NY5C 2WWKO 3DOSB 1UKTA 4OZHF 5HI4C 1OP3H 4OLYL 4D2NA 2BJMH 2EICA 1CPUA 3BAIA 2EH7H 1QFWL 1V3JA 4YBQD 3U6XA 1LWJA 3L4WA 3K6OA 5AVQB 4BE5A 1EVTC 3HB3B 3OKLB 1EHLH 4Z7WE 5I0ZA 2ZOKB 4S11A 5CHNB 4XOCA 1EMTL 1RUQL 5AL0A 4FTVD 3WN5B 4E9LA 4QCIA 3WFDH 1WC7A 4N20A 2XIIA 1EK3A 3VD1A 4FFVD 2ATAA 3OR7A 3BCDA 5C0BB 4F7MB 2VDML 2HLEB 2VR3A 1KFAH 5FOJA 1X5AA 1I9JH 5E5RB 4ZMYA 3OF6D 3QA3B 3FRUA 3ZTCC 3D9AH 4F1ZA 1F8TH 3HAEH 5HVGB 1J1XH 3WUWB 2FBRA 3LQMA 1I1AB 3PL6A 4P59L 4QHMB 5FK9A 3JUYA 4AYBA 1YPZB 1JNNL 1B9ZA 1YYLL 4QF1B 3PJSB 1FVDA 3ARBD 4UT9L 3BW9B 1RL1A 3GIZL 4FQCH 3WIIL 1H3PL 2Y5QA 5J9PA 3I6GB 3M1BA 3DX8B 3QDJA 1R4XA 3LVTA 2EKSB 5L0QC 1HWHB 4P5KB 1UJ3A 2NDFA 4UTAL 3MNWB 4WIQA 1F4XH 5EFIB 3W82A 3NPSB 3FUNA 4X5WB 1BWMA 2IGFH 1NZRA 4WEEA 5HI4D 1QHPA 1VFBB 1WCBB 2BPBA 1UCBH 3QPKA 4FI7A 3PXLA 5HHME 5AVXB 3HOGA 3KJ6H 2YD0A 3ERXA 4XC1L 1M05A 3D50A 2NSQA 1AKJD 2JIXD 3IF1B 4OZIA 3P4NB 1HHGA 5D9SB 1T5XA 4L8SB 3RX7A 4F9PA 3PGDA 2DQDL 4N2CA 6FABL 1G9NH 3VD7A 1PD6A 4FJZA 5D2NA 3V0DA 1ZOXA 3MBXH 1LO5A 1NINA 2AK4E 3S0PA 1EZSA 4GO8A 3RDTA 2GC4C 5GZNC 1JPGB 3EO0A 4PTTA 2P28B 3SBPA 1AQKL 1C12B 4P23A 2ZXQA 1WEJL 2DQTL 3OJ2C 4X9BA 2BHZA 3GPSA 5L2JA 4OV5A 1ML0A 1REIA 2QDVA 2DM7A 4DGVL 2WINB 1U30A 3DNKA 1Z9LA 4MYWB 4GW4A 2HUHA 4HS3B 2PTVA 4X6DB 3HRZB 1A1MB 4JN2A 4PRBB 1AHWC 1PF3A 3QJHA 2J6EH 3VGGA 3APFA 4CMMB 3BDXA 2DLEA 4NQDA 3GS0A 3EIFA 4KTDL 4XPAH 1LM8V 1QWNA 3KLLA 5I75B 5IW3A 1K4CB 4KZCA 1DZ0A 4UILL 3MRDB 4H25A 2FL5A 3AABA 3H9SE 1T6VN 4XN5A 3UTPD 2JJTC 3OXSA 1I1FA 1YYMH 1AHWB 1G1CA 2R0KL 2X2UA 4D3CL 1CICD 1JDAA 3GD1C 1T4WA 4KHXH 5ANMA 1FAIL 2Y1ZA 3JV4B 1ZLSH 1NKRA 3MNDA 3RPIB 3GBML 1X5HA 2YARA 3BXNB 3QHTC 4PU2A 2DWXA 2WXOA 3BFQG 3EAKA 4PRHA 4APQB 4PJBA 1U3NA 4C4UA 5E95B 4M6NH 1SMDA 3MRGA 2CO6A 1GCFA 1C1EH 1KBPA 4KROB 4PJAF 4YHKH 4G42B 3LRLA 2MQ3A 4LLQB 1YA5A 4PWEA 5FW6A 3H7LA 5E1GA 3DIDA 1YEGL 4W9CC 3HNSH 1KJVA 4A2LA 3IRZA 1T0MA 4MWFA 2Y2WA 5BQ7A 3IU4H 3NMEA 1DJYA 5GS1C 4KY2A 2FJHA 5FFOA 3CQPA 3QRGH 3U82B 2PCFA 2QVMA 4BWWA 5MEOB 5J9PB 3QEQA 1UG9A 2NUTB 3QNXB 3X1GA 3I6GA 3M1BB 2RMNA 3HE7D 3O6FC 5EBLB 1S7VA 2JJSA 5ESAA 4DGIL 1QFPA 2BZ7A 2WJ5A 3SDDD 5KYNA 5BO1L 1FH2A 1ZV9A 1GS8A 3T4AA 1EAJA 1MCJA 2D4FA 4ODSL 2QPUA 1BFVL 1P1ZA 1Q0XL 3U46B 4P4KC 2K0RA 5D93B 5EUOE 1SNRA 4FFYH 3A67L 5DHDA 4YSAA 2VE6B 1MRFH 3AUWB 1UZGA 2B2XH 1WGVA 5FCUH 3ZUCA 3PHSA 2DIBA 2JKSA 3HMXL 3PUUA 2NTFA 1FGVL 3ZDXE 2WO2B 1NBVL 4RAVB 4X5RA 3X13A 2DD8H 1N68A 1O75A 5DRWB 2MNJB 4LCVA 5KS9A 3K2IA 2E7DA 1KCWA 1BYNA 1BXUA 3ZZSA 4M1DH 3GBDA 3PUCA 1C8PA 4L4VE 4P3WA 5F7EH 4F8QA 1FAKT 4RFNB 4PJFA 3R4DA 2A73A 2EDRA 2X6BA 3LZOA 4KZ0A 1KV7A 4OBSA 3AS2A 4QYAA 1XSJA 1IAIH 1T7VA 5EZIL 3OC8A 4RETB 5AVWB 4FZEL 4DN4H 3SJVD 4AYGA 1DQLH 3S2AA 4JPWL 1DEEA 1XF3B 3U0PA 5AW5B 1NCJA 1AP2B 1IGYA 2ZXAA 3MJGX 5AENA 4JX0A 3GMQA 4KJYA 4IRJD 4XBEH 3F7VB 1J1OL 2XYCA 4YO0A 4PJGB 3PQYA 1F6LL 2IH3A 4K71B 3VM7A 2BP0A 4OCMC 2J56A 2Y7OA 4K3DH 3GHEH 3CD4A 3IEAA 3HE6C 4PB0H 1J5HA 1RURL 4N3UA 1CI5A 2VH5L 3FTSA 3B7UX 1B6DA 2J2ZA 1OQXA 3BXNA 3M1CA 1RJZA 4RNRB 3V0EA 2DI7A 5DI8B 4OIIH 3KZ8A 1BQSA 1TZHA 4H5SA 1HZHH 3R7QA 4XOAA 4PJ5A 4JFDB 1NCIA 4KKLD 5I16A 2VISB 3LS4L 3BP7A 2A38A 4YEFA 2FATL 2J8UB 4JDZB 1MCLA 3Q7JA 3BPOC 3FN0L 4N1CA 3W0WD 3TNNB 3KNBA 3HBPA 4UIKH 4HIIB 2PPEA 2BX5A 1D6VL 1CT8A 1IC4L 2BNQD 1XMEB 4P5TC 4AGLA 5D7LB 4G3YL 4Q6YA 1E7VA 3E2HB 4UT7L 1KTBA 4PRAA 4WTXA 3HPJB 4XNQA 3KWWB 5T1MA 4F58H 5FW8A 4EE2A 3K6FA 4TPRH 5KS9E 3WELA 4TRPL 5KYWA 1DQIA 5CIPA 5C3LD 3R1GH 4FXKB 4A38A 4PTTB 2XKSA 4PJXE 4JO4L 1UVQB 1SQ2N 2KUTA 4LPTA 5FF6A 5IUCA 5CBAB 4EIGB 3I3BA 2E7LC 4HH9B 3FU5A 1BYOA 4P5SA 2CMRH 3JWOH 4LQFH 4GQQA 4M4PA 2J7LA 32C2A 4ODXB 3CK0H 1A1MA 4JN2B 3VB9A 3D30A 4AGPA 5T1LA 1SLXA 4IIQC 5KSAA 3UPRB 3TCLB 1XR8B 3TV3H 2K8QA 3I50H 4MKMA 3QXDB 1HAWA 2X7LA 5DHVA 5HPOA 3MJ7A 5IWLA 2ZOLB 4OFVA 3GI9H 2PXYB 2R56L 4H13C 5JUEH 3KWXA 3NJVA 3DLQR 2KKQA 4XGZB 4Y5VC 3ZE2F 4JO1L 4CDHA 3SY6A 2VDRB 1PAZA 5JIKA 3NVQA 5B4MD 2YOAA 4X8CA 4FLOA 2JCWA 4BE6A 2WBJC 4AZ8A 5AW4B 3ZK0A 4AV5A 3U4KA 1JHLL 3HG1B 5A7BA 4TUOA 3E6FA 1KJMB 1N4XH 3HNTH 5J6HB 3S35X 4EZJA 4JFED 2ZYHA 3TVMB 3HUJA 2AKRA 3SJVB 5LCVH 4DOHB 4UIMA 4ZD3H 3KMDA 1CLVA 1S7RA 2FJGB 4J3TA 4U1SB 4K3EL 3UTOA 4KXCA 4FTVE 3CFNA 2NMSA 2B9BA 3VCLB 2NX5D 5C09A 2JELL 1J8SA 1S9XB 2GTWB 1XEUA 1E6OH 1A6TA 3K2UH 1KCUH 2IAMC 1OAUH 3OKNB 4UQDA 5CZRA 3TBTB 2CLVB 3SGEH 2ZSWB 3IK2A 1IEAB 3RVVD 3ROLB 1K72A 3GQFA 2IBBA 3MV9A 5DZPA 1KXVA 4PG9A 2X89D 2IADB 3CZGA 3NIDF 3ZGIA 3L6FB 5ABAA 3APNA 2BMKB 1T7XA 3MO1B 2GY7B 1KIRB 1MNUH 5CU9A 4UDTB 2JIXA 3BC9A 3NEEA 1DQDL 4NAJA 1CGWA 3HS8A 2WNWA 2ENQA 3BSGA 5J6GA 4W9GC 4CSPA 5E00B 3TS8A 2BSED 1N8ZA 4CU6A 2H6PA 1JVOA 5HHNA 2XVBA 3DHPA 1FC1A 4NYLA 3T2PA 5I71B 1AGDA 2OMTA 4JFFB 4X8JB 4F2MA 1OAUL 3GMRB 3QIWD 3OKLA 2H3XC 2CALA 3IAQA 1PX3A 2J44A 5F8RC 5HHMD 5E8PA 5TDNA 1FVEB 3DXAB 1FPTL 1N26A 4EI5B 4G70B 4PS4L 4N68A 4PRAB 3IDXH 3FTZA 1B3IA 4DIXA 1MIEH 5DJ0B 4K8RH 3UZVB 5I16B 2A0LC 5IEKA 4DHLA 5D2NC 3N43B 1RJLA 1KTDA 1GXEA 3QXAB 5GGRB 5CJ8A 2AK4D 4XVUD 4Y4HA 3V4UH 2FIRT 3VXSB 2O5XH 3HJ0A 3CHSA 3KNBB 3ROOB 5E51A 1JV2A 2J43A 2CRIA 2XFXB 5DRNA 3HBZA 4GIPD 2W9DL 3MOBL 4GBXA 5DVOA 3VO0A 2ODIA 2PLTA 1HESA 4HBCL 4APXB 2C1PB 4MASA 4Y2OA 5HJ3A 3FSAA 4J3OD 2A5UA 4ISVB 2FEJA 5BS0A 1ND0A 3O6MH 2UWEF 1JGIA 2NYZA 1TZOA 3OPZL 1LEIA 2QSQA 2C9AA 2HFGH 1D7FA 4QJ5B 4F92B 3QUXA 4OF6A 4NT6A 4R4BB 3UTSA 1HSBA 1OF0A 2I60H 2LOEA 4XVSH 4GAJH 2BP0B 4L4VB 4OQ1A 1IBGH 3DI2B 4C8XA 3WSQL 1WWBX 3TEXA 2CO1A 1I4FA 5FYKE 4XCFH 4PJ5E 1FGNL 4IRZL 2D9CA 1ILSA 3LEVH 4Y9CA 2BXZA 2E9GA 1BVNT 2QTEA 3L54A 1ETB1 2WKOF 5FECB 4NRXA 2NY2D 1CFVL 3L9BA 5EORH 5I5RA 5FKPA 3WYRA 2Z8SA 3CLFH 5HGDB 3HZKA 5IY5B 1WBXB 1HNGA 2DRUA 1G5AA 2Z65C 3ULVC 4KK8D 4R26H 4JPWH 2P49B 3QBTB 4KQ3H 2EXTA 2Y06L 4H8QA 5CUSH 5C6WH 3TBTA 4YR6B 4DFIA 1IAIL 3K4AA 1QACA 2A6JA 4F2EA 5AUMB 4YIQB 4PRNB 5AZUA 4GP8B 4PWIA 2OMUA 1G43A 2BP8A 3MR9B 3RB5A 1H9VA 3CDZB 5GIRA 1OP3K 2Y7LA 4NLAA 1TFHA 2AKRB 1JDDA 1TQCC 1O5DT 2OZNA 3JT0A 1PLAA 2YUVA 2YGPA 4OF5A 2XN2A 4HPYL 1IQDB 3GZKA 2P8MB 3ZQ9A 2BSRB 4FKEA 1XHHA 3APCA 4Y16C 1MUJB 4X4ZA 1B2YA 2W92A 1SJHA 5TQ0L 4OLWL 3FCSB 4XVSL 2AK1L 5MENB 2EADA 2ZSWA 1K85A 4JHWH 4NX0A 3IDNB 4NZUL 5DMGD 2BRQA 2Y25A 2H0JA 4ZX5A 3DGDA 4UQBA 4JDTL 3D0VB 3NCYS 5EULV 2OKMA 3PIQB 4F80A 2W60B 3KPNB 5AKRA 1SN5A 1E5UI 1VHPA 2J3SA 4FJ6A 2HRPH 3CVHH 5SWSB 2F54D 4ODUA 4WTWA 3RI5F 3IJ8A 2P5EA 1TTGA 2ZOLA 5A6IA 2EXWC 4JRLA 3UMNA 5K1JA 1GYUA 3MUJA 2H3NA 3SPIA 3GUFA 3HJEA 3BVXA 4K94C 3LKNB 1QTYT 4L48A 3VI3E 4Y4HB 4PRIA 3NFNB 2H6PB 3LZLA 4P2OD 2IPUK 4F15C 3CSYB 3MV8B 2DPKA 4OLWH 4X8JA 2Z34A 4KK6D 1IO4C 1JL8A 1MIEL 2M83A 3FQUA 4GY4A 4IBYA 3C5SB 5D1QC 3ATEA 4Z7WA 1KPRB 3L5XH 5GZOC 1WA0X 1MCOL 3NUKA 4JO2L 3SEPA 5ALCL 2JB5H 4LHUB 1BJ1J 2VMFA 4JJOA 1DQMH 2ICEC 4WGVB 4X4YB 3DBSA 3GLDA 1EUUA 1PL3A 1S9WA 2YBGA 4Y89A 2ZYIA 2W8CA 2WXKA 5EN2B 3DJTA 3HS9A 2L0DA 4HKBA 4GXFA 2DWYA 4R2GD 1CCZA 1FLTX 4EN3D 3EF4A 2VE6A 4L4VA 4YSSA 5A2JH 4TTDC 5K9OA 3MA9H 4C56A 2WCPA 3V2AR 2HLAB 1FG9C 4PGDA 2YD8A 3BZEB 4CC4C 4JJ5B 4CBPA 4PAZA 4WJG3 4UDTA 4O2FB 2G0LA 4NQCA 3X13B 2A83B 5EBWA 1ND0B 3ZR5A 3BEWB 1QSVA 5F6IC 5AYQA 4HUMB 3K2KA 4LLUA 1KB3A 4P5TD 5DMIL 3NJHA 1LDPL 4AVIA 4X9HA 1MI5D 4Y88A 1HSAB 2CIKA 4PFEA 2VUYA 3DK2A 3B1UA 1NMCC 4CC0A 3TH2T 4ZQKB 1MLBB 4JGJA 5C0ND 1ORSA 4F20A 5CU5A 1CF8L 2OXGA 2QKSA 4G7YH 5EU6D 3ZHKA 5MHSD 3CDZA 3UTTA 2DQHL 4EI5A 3QFDB 1DEEB 1TEYA 3K71B 4P49A 1HCFX 2IQ9H 1OP5H 4YSQA 1UWXH 1XF5B 1AO7E 2B20A 3GI8H 4I0CC 5D7IB 5E6SB 1A9EB 1G7QB 3MBXL 4ZNEA 3QXAA 2EYTA 3GBMH 3ARXA 4IKIA 5IFHL 2YXMA 2NUPB 4NQEA 3ZHFA 5DDHB 1CL7I 4NO5B 4Z3FA 4IGBD 2DL2A 2YC1A 5FYLD 3WTXA 5AAMA 3CVBA 3RRQA 3CHPA 1GJUA 4QD2E 1ASQA 5DD0L 2Z0BA 1MFEH 1PKQA 1V7NH 4HLJA 4UAOC 4XOEA 2VIRB 1VGKB 4G8GE 3TBVB 4WHTA 3E6HA 3CBKB 4J6RL 1WFJA 2WXRA 4XPHH 5CWSB 3I74A 4JFEA 1A7OH 1T20B 4WFHD 2BWDA 1GRWA 4OQTA 1CYGA 1WP6A 2C9RA 2GI7A 2N7AA 3BPCA 4TQPA 2D03H 2ORBH 3RIFK 3SDCB 5LGHL 2V2TB 4LF3A 2JKJA 3VG9C 4E36A 1PJWA 5DJDB 1CT8B 2QVTA 3ARBA 4ZTOL 5BMFH 2IANB 2C8NA 5JIMA 1UD8A 2BY1A 2NYKA 1OWWA 1Q0EA 5LBVA 3TASA 1U8HA 2ADFH 4X6EB 1OT2A 4HUUA 3X14A 3ULSA 1A8ZA 3T6ZA 2GUOB 4JFEE 3T0AA 35C8L 1AY1H 1X7TA 2K78A 4MTMA 5HHVH 1CK0H 3GI8L 4N8VB 3EO9H 4FFYA 1K5NA 5EN3A 4IGBC 3KJ6L 2B59B 1XSKA 4NAMA 4MJ2A 2VWEC 5TF0A 2LVEA 5EC2A 4F9LC 1E6OL 3H0TA 3N0AA 5IVXA 1FVDB 4OGZA 1JZ2A 5HHQA 4KZEH 4N22A 4Z18A 1B0RA 2DWSA 2YEZB 3IXTB 3CBRA 2XPGB 5T33L 5TFSL 2XOTA 3QXDA 4OIIL 4MB4A 4ZFOA 3L48A 3D12B 1AGBA 4YL4A 3BLBA 4M1GL 3IMBA 3F7YB 2VITB 3AREA 1MJ8H 3QCUH 3ZTDC 1NGPH 2R2EB 1S9WB 3L4CA 4UWQB 1FDLH 2O5NA 3NIDB 7CGTA 4PB9H 3SZKC 4KROD 3UC0H 4B27A 1UD6A 4OCSH 4AYFA 4Z77A 2RGSA 4JO3H 2JKTM 1SYVB 5I8EA 4JFFE 5D8JH 4G9DB 2WYHA 4IRZA 4P3CH 3WFCL 5A6LA 1UGKA 3ARZA 3BZEA 1I9JL 3MGOB 5F70A 3LXCA 1BVKA 1I75A 3VI4E 3KHOA 2LW3A 4L9LA 1OAXH 2V8MA 1CBJA 3F00A 3TIEA 3AZUA 5FHAL 1UADC 1JSYA 1EGJA 2O6FA 5BRPA 5D1QB 2KLSA 2IAMA 2H3NB 1MCSA 2VUKA 3TFBA 3VQ2C 1A9EA 4KKBC 3B3BA 1QZ1A 3H1ZA 4PRIB 3IVKA 2I5YL 2VL5A 3IU3A 3QQ3A 5EF1A 1I8LC 4OI9A 3O4LD 3E3QE 4XCEB 4YHOL 5JW4R 1AZRA 1N7ML 3G6DL 1NMBL 2D3VA 3PV6B 2XXFA 1K2DB 1MCEA 3VW3L 1IRAY 2Z35A 5I1IL 5FYKL 5HDBF 3FFDA 4GLRI 4F7MA 5BOZG 4DEPC 1FYTD 3IMWA 4AYSA 3FT3B 3U4EB 1NEZA 2J88H 4RDQF 5D7IA 3AU1B 4KVNH 4YH6A 1D6VH 1IC4H 1JTTA 2DQFA 3HC0A 4J12A 4RWYL 1CBVH 12E8H 1U95B 3T9WA 4MRCA 1E27A 2XJLA 5FR3A 1HIML 1MELA 4N8PA 3JV4A 4WTZA 3PNWA 2GSMB 1ACXA 5I23A 5DSCB 3QEQE 2G0KA 2EIMB 1X3DA 3LS4H 1FNGA 1ZJBA 4C58B 5T1KD 4LKCB 2Y4SA 4PJ5D 1UJ3B 3ESPA 3N55A 3AGWA 1BPLB 1MN4A 1TQCB 4IMKA 4LLUB 5ICXA 4S1QH 1VZHA 5BZXA 1NMAH 4D8PB 4PJ8C 1GY1A 4BA0A 3KL3A 4MNQE 3TA3D 3SKJH 3S37L 4A2GA 1AYRA 1MWAL 4JG5A 2WP3O 5L4JA 3ILEA 1A1OA 5DHVH 1P4UA 3ARDD 2WLHA 4ZUUB 4V11A 3RZCB 2L4OA 4WK2B 4G6ML 1OAKH 2NOYA 5EZOL 5T5FL 3NTCH 4P2RB 3HW7A 3S8WA 1MHHA 1C1EL 2DIEA 5B1CA 2H2SC 4HEPA 1IKNA 2BVPA 5DQDL 1SEQL 2YEZA 2VC2L 1VB9A 3BPLC 5I74C 43CAB 2HJFA 3WIAA 4GLRH 3N2JA 1E65A 4XNUH 1NKGA 2FECL 2EDYA 1I53A 3ISYA 4OCXH 3AREB 3N85L 1E67A 3RTQC 1OSPH 3IJYB 5KVEL 4WI4A 4BFOA 1XH1A 8FABA 1GYVA 3P77B 4U6VL 3U46A 4AQ1A 1MLCA 5IM7A 3ECVA 2WUCL 2BINA 3NJJA 4XN1A 4O5LL 3HC4L 2RJMA 4G7VL 2YO3A 4OTXH 4IKJA 1RZJH 3VU2A 5L2KE 4KWUA 5E8DH 3CN0A 4OGXH 1XV8A 4ZO9A 2F1EA 1N5YH 1BQHA 3AROA 4XI5C 4E5XA 4IBTA 4JQVA 1K4DB 1RP8A 2ED7A 1U6AH 1HL4A 1AZCA 2CLZB 3FXIC 4LOUC 4DP1X 5CWSA 1AGFA 1PKQE 1AYOA 3DSFH 2BNRA 2PCPB 4ZOCA 2K7QA 5TDPA 5ABDE 3BGAA 3KPOA 5D1QD 3UMTA 4LF3B 3WY2A 3IBOA 5JQ6L 3UXFA 3MJ9L 2X4SB 3C5ZD 2GIXA 2XG5A 1CDIA 4WDIA 4Z76A 4YGVA 3LZFH 4ELDA 1FJ1A 1U8MB 4FHBD 4PJEA 3RDJA 1T1YB 1GHFL 5GPRA 3CH1A 4DZBA 5GIRB 3WO3B 4IRSA 1PIGA 2QV2A 4HIHA 4HKZB 5C6PB 3VDCA 2CUAA 3AW5A 3QZOA 2NNRA 3RWGB 3U7YH 3ISRA 5I76A 2H1XA 1EFXA 5FUZH 3FFDB 5D7SL 3KDPB 3RA7H 3TIEB 5KZCD 1I9RH 4GKNA 1KYFA 5AWNL 3V4UL 5FUCC 1SJHB 3NJIA 3X2QB 5C0RH 2LQRA 3BT2L 2DJSA 4HEME 3LCYA 1N64L 2ITCA 5J06A 5I71C 4XODA 3BDYL 1TJHL 2Z3FA 2CCWA 3JUZA 3LVEA 4TNEA 4B9JA 1JK9B 4C4KO 1Y07A 1J5CA 2EIZB 1VDGA 5DSCA 1QUNA 5F7YC 5IMMA 4GEIA 1E28A 4J3BA 5JYMA 3KEHA 2CHWA 4MJIA 2A9CA 4PJ5B 1KPVA 5M94B 3QUMA 2VRKA 2W0FB 1ZLUK 3U6XS 3PWUB 5GRXG 5F0JB 3G6JA 2XN9B 2P5ED 5ICXB 1CMOA 1IKFH 2R2EA 1CWVA 4KJPD 4TNWK 2IVFC 4JDZA 2BSEA 4KK9D 4Z3GA 4LASH 4KOCA 3B9VA 2Y2YA 3SDAB 5GS0H 3MUHL 2H3KA 4G1MB 4FEIA 3MBED 2ARWA 4D3CH 2KT6A 2FLBT 3FQUB 4D9LL 2FVNA 5G5DA 1HXKA 3RKDC 5D7LA 3ARFA 1RUQH 3CUPA 3A5VA 4HWBA 3RIAF 1CTOA 3D39D 4P07A 2VSCA 4GT7A 3FHQA 2RQEA 3CZSA 4UMGA 1NBQA 1AXSB 3QSKB 1YUHA 4R4ND 4U6XA 4M5YL 5I66B 3C9NA 3H85A 4N28A 1AC6A 3QIUD 1QO3A 3T0EA 4KO9A 5KVGH 4WUUB 5SWZA 3HC4H 3MUGB 4E68A 2WBJB 2JTDA 3A22A 4ZS6D 4EIZC 1SYSB 2CKNA 1Z9SB 1ZSDB 5B7EA 3FN9A 1ZHBB 4NHUB 1N4XL 3HNTL 4JM2A 4PGDB 4XCEA 5EDSA 4P05A 4GW5A 1VKXB 4Y5VB 3GJFK 3U7AA 5KSAB 4OZFH 2VM9A 1OP9A 4PVLA 1XR8A 4LOEA 1IT9L 2XRAH 3WLWC 3MLVH 4G8GD 2DEXX 3VGFA 3M1OA 4TVPE 2X2IA 4X5XB 1QNZH 1TJGL 4PY8I 4DPAX 1BG1A 2ZG1A 3G5YA 3IJSB 4U7MA 4OIAA 5SV3A 3MKKA 4WFHE 4LSPL 3SE8H 4GMTH 5FYLH 3BH4A 1NCWL 4BWTA 1MI5A 1MVUA 1OGTB 5D5MB 3I50L 4FN0A 4I4WB 5CFHA 2Y36H 3H3KA 4K15A 2UY7B 4MQXD 3HA0A 4YHLH 2X38A 3AS0A 4YAQA 5IG7B 3TP4A 1U3HA 1J48A 3VRIB 1F2XK 4GI8A 1U42A 1ERNA 5A2CA 3FOMB 5AWNH 1FF5A 5I1DB 2R2HB 4LSSL 5BRZA 5ID0B 2DB8A 3ZZQA 4Y2DD 4Z9KB 4JDEA 3DMMD 4R4NC 5CP3H 3BVWA 2ZUXA 4MNGE 4XMKH 5TE6L 3ZIMA 4OSUH 5KTEL 4CU8A 5AG8A 5B1AB 5C08A 2FJFB 2VGLM 3Q1SH 2LTQB 3ARUA 1OSEA 3NT0A 4P46D 5I8OH 1PIFA 2BWIA 1JGLL 25C8L 3UX9B 1PG7H 2NZIA 1MJ7H 1RUPL 3ILDA 4KNSA 2CH8A 1KBKA 3P30H 43C9A 1T0PB 1KN2L 4M6MH 3UBXB 1HL8A 4RGOL 1ZK9A 4YSPA 2DYPB 5I1IH 3CU7A 5CIPB 2KMWA 3EW3B 5DFAA 4ILDA 4GMSH 4N2IA 1PZ5B 5IB1B 1KENL 3CVIH 1NCCL 4W9HC 5E8DL 2FEDC 2GFBA 3ATBA 1XB8A 4NQVA 3NEOA 2JVUA 3B2UD 4WWID 6CGTA 2AJ3A 4JPIB 1A7RH 3E9UA 4L1TA 3RVVC 2EDHA 3LB6C 1GPOL 5CJQH 1PDKA 3LTVA 3LQAC 1O5PA 4P04A 3QWQB 1NANI 1SBSL 3Q2CA 5DC9B 1BQUA 3MJ8A 2DQEL 1CIUA 5IEKB 4LSDA 3S34L 2Z31C 3CN2A 1N2RB 2CA3A 3AREC 1W2KT 3C9NB 1ZCRA 3S34H 1MHEB 2IMMA 4AENA 5DVLA 3H3BC 5F7AA 4EUPG 1E50A 1QPXA 4NAQA 2Y22A 1Q9WB 1BF2A 2VDPL 2OP4H 1KBVA 1UFGA 2Q1EA 5E6IC 1I8MB 3M86A 3QUGA 2HT4D 3KYKL 4P9HL 4DP4X 5TQ2L 4ABUA 4LSSH 4D9QE 3AG4B 1NGYA 4MQTB 1U58A 1JPFA 3KPRD 3B5GA 1ZT7B 2CGRH 4LCYA 4F91B 4OLUH 3H9HA 4AM0A 1ZTXL 4GAGH 1Q9OB 5C0IA 5C09B 4H20L 1U8QA 1UOWA 3SKUD 3QUXB 1FLRL 2N0MA 2PF6A 1OSZB 3PWPB 2F53E 4PJ8B 3U79A 4NRYB 3WS3B 5JQHC 4Z77B 1KYAA 3TA3A 4NKDA 1ODAA 4DERA 3QRFM 5EBGA 5FCUL 1I4FB 2YUWA 1G7HB 3D51A 3IMTA 2ZP0T 5HYIA 4FMKA 2JJUA 1L9TA 3P30L 4NKQB 1TJGH 4FNQA 3AM8A 4O2CB 1SXAA 2XRAL 2YUXA 2YGNA 3LNDA 2O5XL 3V7MA 1NCAH 2HVKB 2ZXEB 3L17A 4ONGL 4ENZA 5DHEA 5FGSA 4WFED 3DMMB 4MZRA 1BIHA 1J11A 2LLGA 3OAWA 4W4NA 3VYNA 3BH9A 2VDKB 4PVBA 1ZHKB 3EGXA 3EYUL 4QNPE 3K0WA 1Q9LA 3L3HA 2ZUSA 4ADJA 4PY8J 2HT2D 2F5AL 2APVA 3I2CL 3MXVH 1JZ6A 4PRNA 2OQJA 4HCFA 1YMHA 1QW8A 2HT4C 3MCLL 3O4LA 4X80L 2DQJH 3FBKA 5F9WB 3VXTA 4OI8A 1WZAA 2PYFA 3ARPA 4EI5D 4AWJC 2BHFA 3V6BR 2NY4D 5IV2B 3NBNA 1L0YA 5I1DA 2MQ0A 4KTEL 4PJ7A 4KUZL 4N2LA 1OANA 4YXKL 1HYRC 1ZLVK 1A0QL 4JY5H 4ZYKB 4YX2H 3ULVD 2J71A 3B2PA 4LNRB 1XF4A 4LGRB 4H44C 2UZYA 3A6CH 1YY9D 4JO5A 5H2BA 3TO4D 5MENA 1HI6B 2GJ6A 3I3DA 5MEQB 3VD3A 5AVVB 5GZOA 1OZUA 4JO3L 2AW2A 3AG3B 5F93C 5IBLC 2ICES 4X9FA 5FHBL 1A1NA 5GSVA 3MOAH 3VVVA 3N1FC 1D9KC 2MPVA 3D0VA 4MDIA 3W39A 4K7FA 4HWZB 2EYRB 3ZE2B 5E9NA 4HF5L 1FRGL 1E40A 1KF9B 3IPEA 4PSRA 2R0KH 5EU6B 1ADQL 3RZWA 1TOXA 2ZKWA 1PZCA 2EAEA 4WJKB 1TPXC 2MCG1 3BZ4A 4K3EH 1ZIAA 4FYQA 3VWJC 1G1KA 3NFNA 3UYPA 5ECJE 1JF5A 1L3WA 5D1QE 4X4XB 4ONOA 5SX5K 2VDQH 3QZNA 4AQAA 3SDXE 2VW6A 5KBPA 2WXGA 1D5RA 2RHEA 1RHHB 3OJMB 5JXAH 2DTMH 1CK0L 2MTAA 1R5IB 3VA6A 1OGAA 2EDQA 2EDWA 4PY7A 1EHKB 4KKCC 1LO3L 3UAJC 4L1SA 4LU5H 3G5VB 4MJID 5A3ID 3SODB 2ADFL 1OV8A 2XZZA 4MQ7A 4H8WH 2WWOA 4QTFA 5D4HA 1S7UA 4AQ1B 2YRLA 3D85A 5C0AD 2NX5E 4MDJA 3U36B 4NRYA 4WHCA 3DJRA 3MLZH 4FG4A 1V7MH 2K4AA 3I02A 2APSA 2OR8A 5IBLD 6TAAA 1DLFH 4UZUA 2D0FA 5DCCA 1M2VB 4LAQH 2OJZH 2B3IA 2BK8A 2Q76A 2WZPD 1C5DA 2CLZA 4O2CA 5AD0A 5E1AB 2GIYA 2E56A 5F1SA 5IVOA 1MCOH 2NY1B 1E8ZA 1IBDA 4XVJL 4Y1AB 4EEEA 4GG6E 1GCYA 1ZHNA 3OHMB 4WW2C 2OX5B 1WFNA 1ZJAA 4BINA 3RY4A 2OR9H 4I88A 4N90E 4AG4H 4GXUN 3NSDA 1PJ9A 3L3GB 4B41A 3MRFA 5MERA 2VO5A 1AR1C 5DHYA 5DD0H 2E7MA 4U6VH 4F7CA 3TBSA 2R9HD 3T8VA 2XQYA 5IVXE 4F3FA 5BZDA 4M7LH 4G3YH 5BVPH 4PUBH 2Q7AA 5ID1A 2C3VA 1J5DA 1EGJH 4YGAB 1YC7A 3T3PB 3GBLA 1EFXB 3V0AC 1X7SA 1I85C 5AB2A 4WWKA 5DURD 5LGJB 4AITA 1BAFL 4QHLB 2I07A 5T5FA 2ZAGA 4D7BA 3ZLQC 4J5VA 4Y16A 3VXRA 1N2RA 3NN8B 3QDJE 3THML 4ZYKA 1DSFL 2ZOTA 2EH8H 1NGQH 2MKWA 1XGPA 2X1PA 3JXAA 3QORA 4RGMC 4UF7C 3ATFA 3CSYA 2OZ4H 5D2LF 1XGUA 3SYOA 3V5HA 5HGAB 2CWRA 3UBFA 4ANWA 4MVBC 2EABA 1SDYA 1HOCB 1OCZB 2EIZA 2DQCL 4NNYB 2A3TA 3CFCH 3ZL4L 3IFPB 1N5YL 3ZKSD 4OGXL 3MCLH 4EUPB 3DVNB 3Q3GA 3QJXA 1NOAA 2X4TA 1U3HD 3NH7L 2G2RA 1JPSH 5BZZA 5IB4B 3WE1A 2M2DA 1JWMB 4YBLB 5CINH 1W0WA 3PJNA 3FFOA 4J23A 5HD8C 5FB8A 1ITCA 1MAKA 2AFNA 4TVPD 5DUMH 2XY2A 1NGWB 3DYOA 4M3KB 4IRJC 3WV0A 1WUZA 3NCEB 5BO0D 5K9OB 1TETL 1DBBH 3ABMB 4FKHA 4KQ3L 3D0LB 5AW8B 4R26L 1FSKC 1OAJA 1E42A 4G80B 1KB5H 4NO3A 4O02H 5JW3L 1HEHC 3IN0A 2EYRA 5FCSH 2DKUA 1HWWA 4GSQA 4NQCB 3POCA 3KYMB 3LHPL 3P0YL 1UXLA 1USZA 5DUJA 4XHJC 3GS7A 1VJSA 3U6RB 4EN2A 2BFVH 2NT0A 5FV1L 3MLTA 3SO3C 3TA4D 2KBGA 2HH0H 4IU2B 3V5KB 4PGBA 1KEGL 4NQDD 3SKJL 3QE5A 3T0ED 1OKEA 4QDGA 1WAAF 4B50A 4U6YB 2ZUQB 4P4RA 3S36H 1NDTA 2EILB 2WVUA 4Z7VE 3IDJA 3OG4B 2CGZA 4Y4FC 4N0RA 3V6OA 3K4DA 4JE0A 1M9WA 5EEUA 1E4KA 4H1LG 2ARJA 3NJXA 4ZFOB 3U1PA 5L9DH 3K71A 4S1RH 2E7LA 1KTLB 4PRDA 2G3ZA 3BH8B 3T4YA 4PJ7B 3IKCA 2OCFD 2VXVL 3PU7A 5KOVC 4NC0B 3I9PA 5HD8D 2HRPL 3CVHL 1SJXA 4NQTA 5DDHA 2WWMC 1URLA 4FEMA 3DKHA 3WGUB 3V79C 4BSWB 2GK0A 5MEQA 1YJDH 1CD8A 1YNKL 5AYUL 1HCZA 1U2CA 2AK1H 2UZXB 3B9KB 4HGWA 2FSDA 1OP4A 2CHNA 3QQ9D 3ZR6A 3MRPA 1H3VA 2FLRT 5D1XB 5IHWA 3QIBC 3FQYA 3RX9A 1SEBB 3BUYA 4U6HB 1UKSA 1YC8A 3P0VL 1UFUA 2F5BL 1KYDA 2E9IA 2DJMA 3LZRA 1QD0A 2KI6A 1X5YA 2CBOA 4Y16B 4PWKA 4PV8A 2XWCA 1CICB 4NNXA 4QLWA 2N1KA 3SDDA 3L95A 5DJDA 5C92A 2JJSC 1IGJA 4ELMF 3BKYH 3AVEA 3FU9A 4NWUH 4IRSD 3GSNH 1AS6A 4MA8L 2R23B 3NGBB 4OZGB 3RNKA 2Z35B 3OKMA 3LN9A 1DQDH 3BWAA 2ZUUA 3DETC 3V0VA 2XBZA 2VLRE 1CFSB 5DRXB 3WFBL 3OZ9H 4H8VA 1QSZA 2I07B 4JAMA 4OCSL 2IOOA 1J9RA 3IB4A 5DC0A 1NEZB 2BLFA 3EFFB 1OCRB 3GMMA 2BY0A 4WI7A 2OL3A 5HI5C 4HAGA 1ES0B 2PCYA 4LE8A 3W9DB 3ZTNL 4AC4A 3K4ZA 5LWYH 3ILPA 4XCFL 3NCJL 4G8EB 2P47B 5HGAA 3M7FB 2UWEA 1E6JL 1H19A 1F56A 2HN7B 3SDXB 1XGYL 1CFMA 5HJDA 3B3IB 3FCUB 1SHXA 1JK8B 4JLRA 5HGHB 5IMKB 5JYLA 2W5PA 4F27A 3IGLA 3SGKA 1NIEA 2YAOA 4LKCA 4RMRA 3S7GA 5JPMB 1A7PL 1EX0A 4PRHD 2WQAA 1JHKH 4V2CB 3TBYB 3B7YA 3UL4A 3ZGHA 5I6NA 1A6WL 3QG6B 3IAPA 3UJIL 2X6CA 5I1CL 3UTZA 3D7PA 5MI0B 2IPUG 1MZZA 1T5WA 3PGFL 1S7SB 2ZUTA 1RHFA 1AY1L 1F6AB 1ONQA 2OYMA 2Y9RT 4TUKL 3CC1A 2C9UA 4GKLA 2E5EA 1N9PA 2OSWA 1FQ9C 3C75A 1XO8A 3CDFA 1AE6L 3FU6A 5IHHA 5I15H 4FFVC 4BGLA 4HZLA 3PGFH 4UTBL 5IJBC 1CUOA 4Z3TA 1NEUA 5C0CA 1OB1A 4GH7B 3LRKA 3L3DA 4FI8A 1FNSH 5ECGA 3TC9A 2ETWA 1R9FA 3MRNA 4WVRA 3KPRA 4AVKA 5CEZE 4HSQA 2MNWA 4NN7B 1P4BL 3HE7A 1JJUA 3G5ZB 1FFTB 2E9WA 2R4SH 4ZPVB 2Z92B 5JOFA 4XO4A 4W1TA 1P5UA 3P77A 4IJ3B 3OV6A 3VFSB 1XGUB 3ULVE 4ODWB 4ZOEA 4XTRC 4U0RB 3NCJH 4S0TD 1FP5A 1KY7A 2X0UA 4F7TA 3R1GL 5LVEA 4JRXB 1RK0A 3AXIA 4N8CH 4X98A 5IVNA 4KI5C 4Y5YA 4NB7A 3REWA 2HVKA 3BE1L 1KTLA 2J20A 4HT1L 4R3SB 5MI0C 2P45B 4KFMA 4KRMB 1MRCL 1YAZA 3SKMB 1Q72H 1RZPA 2DQFB 5T3ZD 1KC5H 3GSOA 2H0FA 2VC2B 2O1AA 4JG1L 4HJSA 3WEXA 1V55B 2JI2A 5INCA 4PREB 5T3XE 1W72H 3D3VA 4RISL 2JXMA 3BFOA 1WZ1L 4OCNC 5E2JA 5E70A 3B2DC 1DBMH 1USQA 3VXTB 5DQ9B 4IRSB 4KVPA 1JXGA 4X8GA 4N3TA 3U9PH 1AMYA 4B9GA 1IAKA 5AAWA 2OULB 1KIPA 4P57B 1ROCA 3GT6A 1HT6A 4MKTA 5IROC 1BZDA 2OCJA 4NC2B 3BPNB 4ZOBA 5AOZA 2V4LA 3IRCA 5PCYA 2GHWB 3TEUA 3CDGB 1Z3GL 5GRWA 4TVPL 3VFTA 2FEEI 5F7MC 2DQ6A 3WHXA 1OM3H 1MCQA 4MJIE 5GZNA 3RDTC 2OL3B 1JHLH