2IVFC

Ethylbenzene dehydrogenase from aromatoleum aromaticum
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
MKAKRVPGGKELLLDLDAPIWAGAESTTFEMFPTPLVMVKEVSPFLALSEGHGVIKRLDVAALHNGSMIALRLKWASEKHDKIVDLNSFVDGVGAMFPVARGAQAVTMGATGRPVNAWYWKANANEPMEIVAEGFSAVRRMKDKAGSDLKAVAQHRNGEWNVILCRSMATGDGLAKLQAGGSSKIAFAVWSGGNAERSGRKSYSGEFVDFEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Ethylbenzene Dehydrogenase from Aromatoleum Aromaticum
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords ETHYLBENZENE DEHYDROGENASE ALPHA-SUBUNIT
total genus 49
structure length 214
sequence length 214
ec nomenclature ec 1.17.99.2: Ethylbenzene hydroxylase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09459 EB_dh Ethylbenzene dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ivfC00
1ULVA 4JPQA 2IVFC 1UG9A 1I8UA 1I82A 1I8AA
chains in the Genus database with same CATH superfamily
4FKKA 1GZQA 1GIGL 4RETB 1YECH 1IC5L 3F3HA 1LM8V 4NZDA 4UQDA 4WFFE 2YD2A 1QFPA 4RA3A 1B4TA 4PRBB 5KJ7E 1S78D 5C08A 3X14B 2VXTH 3MRHB 3LKSA 3PIQB 4KX8A 4XZUA 2VITA 1N2RB 4K8RC 1ACYL 3FSOA 3CN2A 2WD0A 1CF8L 1IMHC 1A4CA 3MNMA 1NUDA 1S9XA 4PIBA 1GYWA 2I9LB 1S7XA 1HHGA 3LRLA 5EBLA 2FR4B 1CGSL 2OL3B 3HI6L 5DS8A 1F11B 3SBWA 3HB3D 4RWYL 4IMLA 5E6SB 1EH9A 2O61B 2BP8A 3HHRB 2YQBA 3F7QA 3V6OA 4WLCA 3RUGE 1R34A 5DVPA 2UUDH 8FABA 5LB1A 2LLGA 2YN3A 2I9TB 4FKHA 2BP0B 4OUUB 2X2YA 3SOTA 3V8CA 4TPRH 5KZCB 1XF5A 3GSQA 2TRYA 2WINA 2ZD0A 4AG4L 4HJGA 1G84A 2IXQB 5LAXA 4XAWH 3DROB 3E3QE 4OM1H 5EZIH 3S7GA 5I66A 2H3NB 4Q74A 3CFDA 2QQKH 5D7JD 4R0LB 3MV01 2FBRA 5F7DA 4JUTA 1S7TA 5C0AA 5MEPB 2R1WB 3ME0A 1J9SA 4JAMA 1FGNL 4GAAA 1NFIB 3BSHA 3MV8B 4YGVB 3UTZB 3N41F 2P28B 1ODUA 3HE6D 1SFDA 3O8XB 4D0BB 4RX4A 4YDJA 2BNQD 2WXJA 4J5VA 5FECA 2PR4L 3X3FH 2YGVA 5AZEH 1MN4A 5C0DB 2F74B 5E9AA 4L9LA 3WENA 1E5AA 2IPKB 4PJFA 3WNNA 1LXMA 4EI0A 3UZVA 5J12C 4HETA 4NQEA 4U1HB 1BOGA 4N2CA 3UABA 1N5AB 5GHWL 4A38A 2PN5A 1J0ZA 4ILDA 3EOYG 2FH6A 2DMHA 2R4SH 1VF5C 4J3OC 5B4MD 4UOW0 1M6UA 3K1DA 4OJDH 5A16B 2JJWA 2Y1YA 3BPNB 2X4UB 5LG1A 2ICEA 5DZ9A 4AKOA 1DBKH 4KFMA 4L1HA 5JW4R 3GMRA 3QWOB 2NX5A 2CGYA 5BUGA 4N2FA 2EKJA 2BOBB 3VB9A 1NOLA 2WBJB 4HCRH 2DIAA 4IBYA 2C34A 1TMCB 5EU4B 5HHVL 4I3SL 3VXQB 1T7XA 3INUH 2A9BA 3MR9B 3PAVA 3ZSTA 2OXHA 2Z31B 1Z7JA 3LKRB 3AUWB 5DEGB 4DQAA 3BHBA 5IBTH 1F4WL 1O6TA 3OJ2C 4JN1L 2DQJH 4Y2OA 4M8QA 4H1LA 4LASH 5AYUH 3CVIH 1PZCA 3CIAA 3MKGA 3NCCB 2MQGA 4OJYA 4A2FA 1YMME 4ONGH 4QEGA 3TEZA 1MWAA 3L13A 3FB5A 2O72A 1RI8A 1D2OA 2MPAH 1F4YL 3VXSB 3ZZLA 2O30A 5FFLA 2QGDA 4N0YL 43CAB 4KXZI 4E9WA 4TL4A 2ZUXA 1RU9L 2OQJA 4BCYA 4B7IA 1HK6A 1DJWA 3H53A 4YSDA 1JGEA 3UGUA 1Z9NA 2QHLA 4G6AD 4P4RB 1PNDA 1T7WA 5C0GB 1OGAE 4EN3B 2L0DA 4RBPH 3UPRB 3U4BL 1VFAA 4HXBH 1U3NA 1EXUA 2CJSA 3D07A 3QBTB 3MAWA 1ML0A 1L6ZA 4BZ2A 3BKML 3MGOA 4M48H 3Q44A 2ZKWA 3QO0B 2BHYA 4PLJD 1Q9WA 5EA0H 4ZAKD 3X2QB 1I9RH 4BH7A 4OVUA 3FC8A 5IR1B 1CFTB 1FNFA 2H0EA 2Y5QA 2UYLB 3SHSA 3PGDA 1WAPA 1T04B 5D1QC 1IM9B 4ZZFA 2LW3A 1DR9A 5LGYA 2FIKA 2CBPA 1XCQB 2GUYA 1GHFH 1M1XA 2R1XA 3FB7A 3WS3B 3QR2A 4EIZC 5EIIB 2BSSA 5I30L 2ZOKB 5F0LB 1EPFA 2XT1B 4WU7A 5FKAA 1EEYB 1XQ4A 4N9GB 5I8CB 1I7UA 4RRPA 3OHMB 4FMFA 1JNHB 1KLUB 2A6IA 3NA9H 2O6FA 3UPAA 4P5TD 1BJ1J 4M7KH 4TULH 2JIXA 3Q1EA 2AJUH 1YYMH 4YBLB 2WXIA 2RGSA 3MDJA 4MXQC 3P9WB 3REVB 3L3DA 5D7KD 4WNQB 4LLMB 5IESL 1YEFL 1XGRA 1U9KA 3CDYA 4JFXA 3WYRA 3TCXA 1OALA 1NWOA 1ETZB 3FRPA 3P3YA 4NHUA 2GTZA 2WGNB 2QKIA 1BJ1H 2BSTA 5ANMB 3VYNA 3FB8A 4JDVB 1IE4A 4CN4A 3RU8L 3UAJC 2TSBA 4FFWD 3NA9L 3P11L 2BSTB 4NHUB 4ECNA 2GTQA 3C5JA 5H37G 4U49A 4OZHA 2B1AL 1OCZB 4X42A 5C09D 3VFRA 1KEGH 2FYVA 5JHDA 4TSCH 3UTSA 1OAQL 2XY1A 3NFSL 1K2DA 1YYCA 4OT1H 3LZPA 1TU2A 2BY1A 3H2PA 3QIUC 4OFVA 4L37A 4HKJA 4HV8B 3EUDA 4EQ3A 4IK7A 3C60D 4W81A 4B53A 1BFVL 2PO6A 4F8TA 3ATAA 5JW4N 4L2LA 1TJGL 4YAQB 5DA0B 3RYMA 5KYWB 1R19A 3C6LA 1MW1A 1HH6B 5HVGB 4JFVA 4ZMZA 4J28A 1BLNB 2DQIL 4XTRD 1QQDA 3ZE0F 3TA3C 3KYAA 4N2LA 1ZLWH 3BPNC 3CWGA 2W9EL 4JL1A 2YHGA 2OZNA 1OQXA 1A1MB 1FCCA 3RPIA 4J6IA 3MV7E 1ZANH 3BP4B 1P6WA 3A4DA 2ALWA 4G7QB 3GINA 2EIMB 1LNUB 3LNEA 1L9OA 2V4LA 1HCYA 3KR3L 2VDRH 4WWOA 4JFQA 3WEXB 2DEXX 3ZRSA 1G5GA 4WY7L 3TBYB 4KC3B 5L4IA 1L7TL 3HC3L 2IGFH 2XTJC 4YPGA 3CVIL 5JOPE 1G4MA 1I1YA 3QDMD 1PLAA 2NY3D 3LZFL 3QUMH 5EZPA 3ZHDA 2FX8L 1D5BB 3ZTDC 5HVWA 1EZSA 1JYWA 1S7SA 5I6OA 4Q2ZB 3WDHA 5T5FA 2JK5A 4ZSOB 3I74A 3RLSA 3UYPA 3MLVL 1ZLDA 1ZV9A 1AY1H 4HBCH 1MDTA 4XMXA 4G72B 3S3BB 3EO0B 2AQ1A 4JZOB 4N8UA 4WUKH 3VSUA 1JG9A 1V3MA 4HIPA 4P3WA 3A6BL 4MZRA 4X99B 1MNUH 3RNQA 5C0CA 1P69B 3CSYB 2MEJB 4UQBA 1OAZL 1JVLA 5I1KL 3VD3A 4FQXB 4RFOL 3G6AA 4NJAH 4LSQH 4FQCL 4BQ9A 3AB0C 3QARA 2YRPA 2ZCLL 4JG0H 2XJLA 3BUDA 4PJDE 4PRPB 4W4NA 4B9IA 3FQTA 1WS7A 1GS8A 2MNWA 3OR7B 1DUYB 1DZBA 3MZGB 4OZFA 2AABL 3N5AA 2QMJA 4N85A 1JV2A 4O02A 4UZGA 5FFGA 4A2HA 5BV7B 5IOPB 4NZRH 3QUZD 1MCHA 4ODVL 1MJJB 3DARA 4PN6A 4NWTH 4FNSA 1EZVY 1JAEA 3GSNB 3U1SH 1E8XA 2D7TH 5FIEA 1E30A 3QXTA 1ZPUA 1MF2L 3X3GL 1TNMA 3NCWA 2D9CA 2W0FB 4L4VE 4XBPB 4NQCE 4CADB 4CVZA 1EBPA 4HBQA 1GA2A 4W9DC 2X4NA 1FGNH 4CMMA 1AMYA 5HJGA 3FB5B 5L8JB 3PWJB 3SDAC 5HPOA 5FYJD 2V6HA 4ODUB 1S9VA 3L5WA 4UQ3A 2X6BA 2PPCA 3K91A 3WO4B 2XZCL 3L2LA 2HLEB 1S7VB 4IRJB 2FWUA 3H6JA 4LARL 2BVOA 4JFYB 1PY0A 1MCPL 4TL5A 1HL4A 4X0KB 3RAJH 3ILEA 2YUWA 4M93B 3QORD 3OG6B 2BRRL 4G9DB 4JJ5B 1RVFL 4LIQE 2CUMA 3CVCA 3ARDB 4XMTA 1AS8A 5DLML 4AW7A 2X1WL 5IZ7A 4N2HA 2GJ6E 2NT0A 1Q9LA 3MJ7A 4GO9A 3G04B 3FQNA 3O6FD 2CR3A 5CZXD 5F6IB 3R19A 4P5TA 4PEEA 3QIBA 4OGAD 2EXTA 2XN9D 3HG4A 3EGDB 1FVDB 2BNRB 3VXOA 2SEBB 1AR1C 2XKNA 1CYXA 2ZWYA 1UM5H 1KPUB 2WBKA 4CU6A 5IHUH 5GGRB 3NIGF 4F7TA 1HAWA 5TGBA 3IDUA 3I84A 3FUHA 4OF7A 4PJAA 4LCIH 1YN6B 2F1EA 4EVNB 4EKJA 3NESA 1W72A 5EB9A 5BQ7A 2IGLA 3KBPA 2EAEA 2UY6A 4JUSA 5E8PB 2EIDA 3S96B 2MTAA 3BWAB 4NQED 5TQ2H 4PG2C 5E03A 5DEJA 2WJ5A 3WFEH 2NSXA 3LSOA 3QJHB 3MYJB 3IDXH 4KKCD 3N42B 4Z23A 2V9UA 2IC2A 2XG4A 4OZGB 3W57A 2KT6A 4ZXBC 1KTDB 4YR6A 4P2OA 3L3DB 2ZWNA 2QPSA 1RV6X 5E9NA 3GMPB 3KS0J 5L7XL 3WUWA 1NCWH 5BRZE 3BZ4B 2X1QA 3AS3A 5JHDD 1DL7H 5IHLB 1EBAA 4NI6A 1YUHA 2VSDA 4F57H 4JPKH 2H32B 4ONFH 3R4DA 2ATAA 3ML9A 4EE2A 5IFAH 3RWIA 4MJID 1VRSA 5DDHB 1F1AA 4TUKL 2HTLD 2NLJB 4BBWA 4XAKD 4MB1A 5T1KD 4CKVX 3B3BA 4TNEA 4PYHA 4QPEA 3R0MA 5IROD 5EHFA 3ATEA 4ACPA 3EOAB 4XP4H 4CDHA 2AJVH 4G8FB 4GAYB 1HI6A 4LSRH 1H5BA 4OF0A 4BZ1A 2X4SB 3VI4E 3LMJL 2J8UB 3QQNA 4G3YH 4IRZH 1SM3L 5JQIB 2J55A 4QF1B 1O7DE 1R46A 2K6WA 2EKSB 4PJXA 1MLBB 3QRFM 3I9AA 5IEHB 3NSXA 2DM4A 5BZZA 2FWLB 2R7EB 3S3PA 5B38B 4W9IC 1KPVA 3QS3A 4YMPA 3TO2B 4QY8B 3SE3C 4UCFA 4NQSA 1AGCB 1QATA 2WVVB 3PGCB 4UV4L 1ASQA 3NGBC 3HFMH 4PY7B 5I6KA 4MCNA 1JCKA 1R3HB 4QRRE 1UM4H 4G9FD 2XIDA 4LLDA 4G70B 3VW3L 4P57A 5B22A 3OXSB 1C1EH 2K70A 5LCVL 3SYOA 3KNBA 1WWBX 5JLZA 1FH5H 5E0FA 4PLKC 2BIQA 5I6LA 3DSFH 3DVNB 3VI4F 4J27A 1JZEA 2BZDA 2P8LB 2LT9A 1HWHB 1E0OB 1DVQA 4IOIB 2E75C 3FO0L 4M62H 2CHXA 3L6FA 1B0IA 1FZOB 1RP8A 1G7LA 3LS4H 1A4BA 2J6EA 3S2CA 4O2EB 3DX6A 3QQ4B 4XNUH 5C0IB 3II2A 5I8OL 1MRFH 5JW5A 4NO2A 5JA8B 5AWNL 3LPWA 4C83A 2VDPB 3TN0C 4P04A 3T0VA 4U2YA 2VXVL 3RTLA 2FX7H 4G82A 3ULVC 3MRNB 4NQDE 3M86A 2UWEB 1QSFD 4FXKB 3S3CB 5MERA 1UM6L 3M7FB 2CHZA 1USZA 4TUUA 4AMKH 1AC0A 1ZT1A 1S9VB 3L5WB 4F5CA 5J8OA 1OHQA 4U1IB 1KF9B 2QSTA 1H19A 4DZBA 5I1KH 2ARJA 2YO3A 1R5IA 2AV1A 4N0UA 1WPCA 1OSZB 2KL6A 1MELA 5F0JB 2FBJH 1CL7L 4EBQH 5AUMB 1VGKB 3UAAA 1X5XA 2E9WA 3AG4B 4OH2A 1WBZA 4C56A 2GW5A 5K9KA 4AH2B 4H5SB 2AKRA 2ZX8A 1X5GA 1FL5B 1UWFA 2WYIA 4MXVF 3CAFA 4GXVL 4GYBA 4GMTH 5T1DH 2WBWB 3D6GA 4BZYA 4NZRL 1HAUA 1E6JH 2BNUA 2G5RA 4GRWF 1SMDA 4NNYB 2IGFL 4BK5A 2J5LC 2QV2A 1AIZA 1MW0A 2F58L 4PP2A 4UOW1 5CEZH 2QT6A 3IKCA 4L3ED 4JB9L 4Y5YB 3OB0K 3V4PL 5I66B 3DX7B 2QGEA 3GMQB 1CD9B 3BKYL 3IFLH 3KDMB 5AKRA 3WIHL 1RKRA 1R3LA 4AYDC 4Z7WE 4P23A 1KPRB 5L2KA 3KPMA 2CDFB 2W65A 1VB9A 3AC0A 5ALBH 5C92A 5CINH 3HMWH 4BH7B 4O5LH 4NNXB 1U30A 2CZNA 4HD9A 3PJLA 4QRTB 4F20A 1SXCA 1CL7I 3A6BH 2OTWB 3OXSA 4MQXC 1S9YB 1SOQA 3O3DA 3ULVE 4LSPH 5FYJL 2XKUA 4BZ1L 1UACL 2ATKA 1ET5A 1RZQA 3VI4B 2JKLA 4PAZA 2OSXA 2ZOLB 3VA6A 1P5UA 3HNVL 3WUWB 1M7UA 3GRGA 1I8AA 4GP4B 5I5JA 5ITFB 3ZE2B 2QFPA 4BQCA 1TEYA 3BWUC 2N3JA 2V2WB 4OZIA 1LNUA 5J7CC 2MIZA 2BX5A 3RB7A 5IMKB 1HZHL 3LKSB 2XY2A 3PIQA 3SQOH 2GAZB 2VDQL 3KXFD 2D4FA 4JKPH 1BP3B 2XHNA 3C6EA 2I69A 2OMXB 4FXTA 1DSFL 4IBLT 3EJYD 4M8QB 3D48R 2KZBA 4GG6B 3GMMB 1IKNA 1LK2A 1NAML 1QRNB 3D30A 5BRQA 4M6NH 4I85A 2AV7A 1YN7A 3TJEH 1DQKA 3A67L 3CLEL 4K7PY 2BIPA 1MCFA 6FABH 5F93C 1Z66A 3GEWB 4PP1D 4ZTOH 4KGJA 4OI9A 4FQPA 5B3SB 2KS0A 4HSAC 3UJTH 3WKNA 4F7PA 2LLLA 1DP0A 2CO6A 2IDSA 4RAHA 3O45A 4YDMA 1C5CH 3QIWC 2X70A 1DVXA 4EZMA 4D3CL 1NUNB 3UTSB 4L8CB 3DLQR 3QO1A 3VFMB 3CGTA 4CC0A 1DQLL 2L3BA 3UBHA 3V52L 1CICA 2WBJC 2E6QA 1KXHA 2FYYB 3WBDA 1T1WB 3EIFA 4ZUVB 1E6JL 2AK4A 4ZFGH 1PNCA 5MHSD 1U8CB 5CZXC 1CU4H 2GVYA 3FU5A 1IKFH 2CDGB 4HGWA 4OGAC 4Z3FA 1NTDA 1PKOA 2F54D 3MJ8B 1SOKA 3I75A 1E40A 1WGOA 2ERJB 4XH2B 4JFPA 4IIZA 1P7QD 2DQHL 4QXTB 4DEPB 3WFCL 1AHKA 2HP4A 3GMLA 1QNZL 4JKMA 3FFDB 5C8JB 1WZLA 2VXQH 1K4CA 3GS4A 4AQ8A 1D9KB 3PU7A 2XV3A 4F8PA 4MZ2A 2R1WA 3ME0B 3HLAA 2AGJH 2K6YA 3JWDH 1MJ8H 1PZ5B 1UA6H 1NCJA 2FJGB 1DQVA 2WUCH 2PABA 3PG2A 5AAPA 4Y89A 3B4NA 2IDQA 2WB7A 5CILH 1YEJL 1TCRB 4TULL 2OMTA 4X9FA 3BRFA 2F8VA 1KIRA 1PLCA 2A74B 1KDIA 4LCCC 5AOIA 4I77H 1INQA 1M9SA 1K8DB 3ZDZB 4MCYA 5JO5A 2P43B 2RJMA 2VMJA 2C1PA 1BQLH 4HH9B 4XVTH 3ULUF 3N85H 1U8OB 1GHFL 1VFBB 4KY1H 4WWID 3RWCA 3RA7H 4BSVB 5KVGL 1N64L 4G11A 2P8LA 3SCMA 1CFTA 3ZTEA 5FHBL 2Z92B 1TLMA 2QQNH 1P4BL 2X12A 3E6FA 1MHCA 4S0HA 4MXWL 1UH4A 4X9BA 5KJ4A 3BKMH 3GI8L 4KI5D 2F0CA 3L3OC 5MENA 4XN8A 4A6YL 1C5DB 2YGQA 5INCA 2GK2A 3FFCB 3FT3B 2YKLH 4M1GH 2MWCA 5DUJA 4XHJC 5KN5A 5K9JH 1E5BA 2VLJA 5KVEH 3ZR6A 2F2HA 1JZHA 3BLBA 4AI7A 1OTSC 1G1YA 2HJLA 2ZSVA 3TO4A 1IBDA 4DPRA 2GEEA 5FW8A 5BJTB 2M83A 5SWZD 1DJSA 4ABWA 1CDUA 3J27A 3T8XA 2NZ9D 4Z95L 5IY5B 2C4FT 5GS3A 2X6MA 2Z0UA 5BJTA 4K8RD 4AOFA 3RVTC 1EXHA 3GPSA 3FF8A 4HC1H 4TLUA 4AQEB 5ETUA 3GSRB 4M3JA 2YGPA 5DXWA 4G8IA 5BO1H 2QV4A 3CCHB 1I8MA 4R6UA 1IRAY 3VXUE 2KLTA 3WG7B 2AK4D 3O4OB 4A2MA 3CPUA 3RTQD 1WA2X 4LF3B 2P5WE 1EERB 4KK8C 1KV7A 3MBEB 5HGGS 1AO7A 1NBZA 5DT1L 2DPKA 3EJPA 1DQJB 2PUQT 4Z18A 2HVKA 3LXBA 4HKJB 4UOZA 1KXVC 4GSUA 4DQOH 1IARB 3MA9L 5E2TH 2ROYA 1QO3A 3FPYA 2QSQA 3NCJL 4NO3B 2HSIA 3B6SB 4PV8A 2F08A 4LCCB 2R4SL 3HAEB 2VIRB 4Z3JA 4AUYA 1UA3A 3IGAB 3NTCL 4YHNB 3EF7A 2YRLA 3RGHA 2CGZA 4AV5A 1LD9A 4HPOH 2L04A 4DKFL 2BJMH 3MLWH 1QP1A 3LXAA 5ANMA 5GPRA 1MFMA 1NBYA 1IAMA 5ABAA 4BFGA 2IALA 3NZ8A 5D96B 3PHAA 1MWOA 4HFWB 1IFHL 5SWQA 3V95A 4PM1A 5I2IA 5C3TA 1KUMA 5IG7B 2Y36L 5DC0A 4NXKA 1HHHB 5D5ME 3RJDA 1TCRA 4GINA 2ERJC 2P7TA 2F1AA 3H9SE 3D05A 2NY3B 2EE2A 4KMTL 1J86A 3DIFA 3KLAB 2EIZA 2EECA 2ZWZA 5FX3A 5AOZA 3TLRA 5C6TH 2B4CH 2WLIA 3E9UA 4HEPG 4XMLH 3ECBA 5E9DA 5A6LA 3ESOA 2EE6A 1YECL 2F19L 1BQSA 3OGOE 5GQBA 1CGVA 1C7TA 2D3JA 4TVPL 1CLYL 4HW6A 3IN2A 4JFOB 4OFKA 2IQ9H 1J5IA 1SQMA 5FCUL 3CHOA 2JQZA 1PLGL 1O0VA 2UYLA 1FIEA 5IMMA 1UASA 2IAAC 2YPLA 5D1XB 2ZAIA 1WFJA 3U9UB 4KXZH 1CGSH 1FN4B 1LWRA 1QUPA 3L95A 3N40P 3FMGH 2H45A 4OZHE 5EU6A 5HYJB 2GT9A 3DTXB 1SMOA 3AAZA 3WXWL 3O2DH 3F6IA 3MUUA 2A6DA 4P2CG 2HX7A 5FA4A 4DP4X 5E51A 3T77A 3A0OA 1NBZB 4PQXA 1MVFA 3EYQC 3TL5A 3EDJA 1IGJA 3QPXH 5IFAL 1OP3H 1F56A 5GGRY 2EO9A 3BRGC 4ERSH 1YPZF 3NABL 1RUAL 2YUZA 1AS6A 3FB6A 2WCGA 3ETBF 1CVRA 3ZSSA 3OKYA 5G4OA 3VXUD 5HDBE 1N0XL 1V3LA 1Y1UA 1A8JH 1G9ML 3PGDB 4H20L 4ZXBB 3GFUA 3CSYA 1NM9A 3EHBC 4WHYG 1GOFA 2VRQA 3HVDA 3SD5A 1DYZA 4PVBA 4P4KC 3PQYA 5DJ0B 5EBGA 4I0KA 1NPJA 4X5PA 1KV3A 2IWFA 4D8OA 3L4YA 2YPKB 1NCIA 1BJMA 1UC6A 4UU9B 1G0XA 1KTLB 1CDCA 2VSKB 4FQ1L 3RB5A 2H6PB 5J57B 3LRGA 4XPTL 2H1LM 3VI3E 1AOZA 4OZGA 1S7SB 1SYVA 3HG1B 3GKZA 3O11A 2H1XA 4M7LT 3OHXC 1HSAB 1ECZA 1ZVSA 4KUZL 2DLGA 1H8LA 2EDTA 3FH7A 3WOVA 1MKFA 3GI8H 2IAMA 5KOVC 2MPVA 3H4FA 4WEBH 3K3QA 1TYJA 4PJ9A 5BO1L 5K59F 1A4KA 2W80C 1CGTA 3B8YA 4Z7OB 3T2LA 3ZDXB 1VPOH 3CVHB 3GSUA 5JYLA 1U21A 2JTDA 4AIEA 4AK1A 3VB8A 1N3NA 1BXXA 4WY7H 6PCYA 5EU3B 5KUKA 2BZCA 4PJAF 5T3ZH 1R3IH 2EH8L 2YD9A 3RPKA 4K7PL 3ENEA 4L3EB 5JPMA 1WEJH 1A25A 4XNQA 5GS0L 2VMEA 4WI5A 1IGCL 3ASNB 4L4JA 2JKNA 4F92B 4ZMYA 5T33L 3MTRA 5IQLA 5JYMA 3WJLA 2DLTA 2K8MA 1N59B 1WBYA 2AJZA 4AH2A 3MBXL 3GTVA 5FUOL 2R0WL 5JW3H 5AOLA 1K6QL 3DOHA 1O9ZA 2NY5L 4FTVE 4JLRA 3DX3A 5LWYL 2NTFB 4KI5E 5L88H 2J56A 2NY6D 1JFHA 5F7FA 3B8SA 2WAQA 3BD5A 4D0CB 1R5WA 5KSBA 2FJUB 3OD3A 3S48A 5GGVL 5EOQL 1X5IA 2ITFA 1X7QB 3LRMA 5E1GA 2XETA 3DUUB 5CEZD 3GIZH 4LNRA 1USQA 2RIKA 1A2YB 4DGYH 3MJ9A 4FE9A 2F61A 2BVQA 1U8MA 2G5BA 5CUSH 5FYLH 1UH3A 1X5FA 2DWEB 1NCOA 5IB3A 1XAUA 4FQXC 5CILL 3ESVF 2NY4B 1DUYA 1MSPA 2EKSA 3MRRB 4RFOH 3POCA 4QF1A 4WGKA 2ZXGA 4O2CA 5DURB 3V5KB 5JMRA 3IAGC 1MCNA 3EH4B 2AGJL 1MNUL 4MHHG 4FA8A 3D4ZA 4S1QL 1TPXC 5CU5A 4A7GA 3A67H 1L9SA 3CLEH 3VI3B 1W80A 3KPSB 1U8QB 3TYGH 2VR4A 1MG2C 1NMAL 5ANHA 4JZOA 4PJ8B 1ZSDB 4XO3A 2D3VA 4GKNA 1R3HA 4K3DH 3UC0H 3WJJA 4CVWA 4U6YB 3MNVB 4B9FA 4W9CC 1CBJA 4E9QA 3D3VB 5KTEL 1Y18A 5AALA 3S3JA 4N90D 1CXIA 1I75A 2B3IA 1QSEE 4H88H 5IFHH 3ARGC 2P45B 2A6DB 4OFYA 3MREA 5KSUA 5I76B 3D9AH 4IIQC 4O2CB 4WDIB 4DHLA 5ACMA 1I8IB 3U9PL 4X8XA 3FN9A 3S8FB 4WEMB 3AGWA 1MWAL 2YZ8A 4KK5C 4S1RH 1T2XA 5JXEC 3A22A 1Z5LB 2YZ1A 1B4JH 4FEIA 3WY3A 2YD8A 2GK0A 4M48L 5AENA 3EOAA 3KPNA 3OPZH 4P9ML 3RVVD 4A1RA 3UMTA 1UFGA 1XGQB 2FLBT 3WL9B 3VCLB 4JFHE 5F97E 3WNKA 4Z8FL 1PAZA 1AD0A 4LAJH 5DRXA 2V7NB 4I0PD 4PRHE 2WQSA 4MJIB 4FXKC 1CF1A 1CFQA 4N2GA 1S7WB 1ITCA 2DQCH 2OMWB 2WC7A 3NEXA 3RWJA 2VLKD 3BPOC 5E6ZA 1UQSB 2HFFA 2R69L 5L9DH 5EZLB 4O9HH 4QO1B 3QNYB 3GSVB 2EICA 4HLZH 5B1KA 5B39A 1U8HB 3QHZL 3BAYA 3D50A 5F1NA 4TSCL 1RPUA 5DRWB 5DYOB 1QOKA 4G7RB 5EPMA 2AJ3A 1A7QL 3VRJA 5KVMC 3IYLW 3OKLB 4W9GC 2FCBA 2J1KA 2CO7B 2YPVL 4QHMA 3U0WL 4PVLA 3QJTB 1BXUA 3BPOB 3SE9L 5ESAB 2VTFA 3IU4L 3TZVB 4B7LA 5I74C 1NFDB 1IC0A 1X5LA 2IBBA 2OTUB 3GMRB 3QG7H 3QXWA 5GRZA 3TVMD 4HK0B 1Q90A 3GJFA 2VLLA 3GSXB 3R7RA 1TZHA 2DQUH 3MROA 4MA1C 1PIFA 3ECWA 1N0LA 1V7NL 1X7QA 1BAGA 2HFTA 3EH2A 5HHNA 3SYPA 2GIYA 3NZHH 3O9WA 3EGSB 12E8L 4NO5A 1GCYA 3NRPA 3DECA 4JFEA 3VH8B 4ODHH 3OVUB 4R9HA 4DZBB 4PRHA 2LLNA 2XN9B 3B6SA 4PV8B 3ULAB 3OKMA 4XN7A 3BKYH 4AE0A 3SKOA 1MJUH 2ILLA 3BN9C 1GYVA 1KIPB 2EYTB 3IKKA 3OAWA 4PJGF 4JB9H 4GRMB 4I2XE 4XOAA 1QLFB 4M61A 3QJZA 4RBPK 1SFHA 2QQLH 4KOBA 1Z3GL 2BNQA 5HI3D 5BNXD 1PQZB 1HFUA 3LKOA 2VOTA 5AZEL 1CZ8H 4RGMC 5IHZA 4ZT1A 5DYOA 2CBOA 2R23A 4JPIA 1U8IA 3MRQB 5TE4L 5J56B 2Z9TA 1XAKA 4J4PD 3WGVB 4RMVA 5EA0L 4U31A 2A6KB 5LAPA 5L4MA 3PJNA 4TRPL 4KNSA 4W1TA 2EDXA 1NJ9A 4KROB 5DFTA 2WYZA 4FDWA 5AKTA 3IU3A 3UMNA 5E9DE 3MNWB 1KGUA 3KNBB 3NPSB 5JLZB 3MGOB 1ODAA 3APFA 3QUGA 1LK2B 1QRNA 4JRLA 1SOSA 1CFBA 5LN4A 2OFQA 1UOVA 1C12B 2HB0A 4ATWA 4DFHA 1LP9A 4K7PH 5T1MB 2YKKA 4KH2A 4I2XA 1YUKB 5C3LD 2NSMA 3UIZA 4ORGA 3CZKA 2NMSA 5CR8A 2HFEA 1IILE 4TNGA 4DAGL 3HI6H 4Y1AD 1J18A 2JI1A 2VITB 4MLSA 3MUZ1 3MU3A 3B2UC 5CBAB 1F4WH 4GXUN 2JI2A 1CXLA 1NFDF 3WLBB 4H13C 2XN0A 5HD8D 1T3FB 4GI8A 4HIEB 4KOCA 4NIYE 2GFBA 3QXDB 3DX9A 3FO9B 4X8JB 2CIKB 3TIEA 3WAKA 5G55A 4MNHB 2G3NA 4F57L 1GKOA 1RJYA 3O2WH 1NL0L 2H1PL 2HYMA 2WPGA 4WI3A 1WAAA 3FT2A 4QYOB 4U4BA 4AYEC 3WMSA 3QDJA 3KM1A 3P0YH 4PRIE 5C9JA 1DVFA 1KCVH 1NCWL 3ETSA 5DHYB 3KPLB 2RALA 5HGBA 1VHPA 4OCWH 5HVFB 3CXDH 2ZF9A 4W4OC 3NACH 3AT8A 4X6FA 1LK3L 2X6CA 3BWZA 3O3EA 1OV8A 4AYID 1J1XL 4AVKA 3V0WH 1T1XB 1TITA 4NKMA 3MOAH 2R69H 1INEL 2CDEB 4MGXA 1AANA 4NUMA 4X9YA 2ZZUT 1RHFA 1XZWA 2FRGP 4OD1L 5JOEA 4LKCA 1KN2H 5AD0B 5EN2A 2V33A 3EYOB 3EG9B 3FULA 4HHGA 2R0KH 3IPEA 3HNTH 4ANXA 5D1ZI 3EYOA 5AZ2H 5IGXH 1ADQH 3MCKA 5HY9A 4ZW8A 4JE0A 2XWJA 5AW9B 3TN0B 5HI4C 5DO2D 2EUWA 1RZ8A 4X7FC 1ZHKB 4L1DA 1XF2B 1CE6A 3C8KA 1EUUA 2IOIA 1S7QA 3S35H 3WTSA 4QRQA 1WIOA 1YEGL 4QHUA 2R29A 4R8WL 4NN7C 1F3JB 3DRTB 1GMEA 3QZBA 1G0DA 3WSQH 2P5EE 4YHPB 2OMYA 3DX4A 3LH9A 3G9VA 2HVJB 4Z7VA 3SYAA 2OA9A 2IXQA 2FO4B 2YS4A 4KQ4L 4UIMB 2JB5L 3HZMB 4DVBB 5I5MA 4Z7UB 1R24B 2QHRH 4FG6C 1Q0EA 2EILB 4PG9B 3A47A 3U0PA 3DMMD 4WW1B 3NQKA 5AG8A 1D5RA 3NGBB 2GFBB 2HVBA 3LQZA 3QSKB 3QXDA 5A7EA 1EX0A 4AM0B 2DOCA 2FWOB 8FABB 2ICWA 3PAZA 2B4CL 1OPGL 4XB7A 4QOKE 3WEBA 3BH4A 1FZMA 3ROOB 4IHOB 2ZSWB 1XCXA 4XTRC 1XVSA 1OF0A 4N0FA 3TA3D 4Y19A 1CD0A 3BT2H 4GSQA 2FDBP 3NJJA 2A9DA 4FX5A 4PGZA 4X6CA 5ITFA 1AQKH 3ETTA 4GIAA 3RKPA 3G5VA 4NJ9H 3UO1L 5F3BB 5PCYA 1NGWA 1TTRA 3OLDA 5E6RB 3LEYL 5C07E 4HOZA 1U4FA 2JIXB 5L6YH 1C5DA 3P0GB 1OP3K 2JQAA 5ACZA 1TO5A 3NTCH 2UXFA 4PRAB 3W0WD 4YEFA 5D71L 1M7DA 3C87A 5DGQA 2YPKA 3HI5L 2UZIL 1WVZA 3ABKB 3DUSB 4LL4A 4EUPG 2A77H 3S6CA 1BGXL 3MBWB 4FS0A 3SKMA 4V2BA 4LE8A 1KTJA 4ZUWB 1HKLH 5KBMA 2CDFA 3MA9H 3WIFA 1GR7A 1P5VA 4NO0B 3NSCA 3QR1A 5FYKU 1UWEL 4N5ED 4N8PA 5K9OA 1FFQA 4XCYA 4Q9QH 4Z0BL 1DDHB 1YQVH 5FO8A 2JWYA 2AQTA 5CCKH 5FKPB 4ZQKB 3U0TA 4JN2A 4KTYA 1WK0A 2ZQKA 4LPWA 1UFUA 3WFZA 5DD3H 4G8GA 2DB8A 3MJ9L 4X6CE 1XZ0B 1DE4B 1QRND 1Q9KA 4FTDA 5T3ZD 1GH7A 1KJVA 4J3SA 1UVQB 3MQIA 5LGHH 2CPUA 2NY5C 4KJPC 2EH8H 2WXLA 2NZIA 2WXFA 3L95B 4L18A 3VWKC 4M7LH 4IJ3C 4JRYB 5F96H 3BESR 4J2XA 3ARED 4N90E 4C8XA 5D7HA 2F18A 2VDLH 4PRID 3B9KD 4JG9A 1FZMB 4HUKB 2IV9A 2ZKYA 3VD4A 3K81A 3NSDA 3RY6A 3GSNL 1A3RH 1PSKL 3EOBB 4N28A 4W9KC 3BDYH 2Y06L 2DQIH 2R0LL 5AW0B 5IREA 1K5WA 5CCKL 5EO9A 5D9SB 2BFGA 4KUZH 4L29A 1YC7A 3NPZB 5EN3A 3CXHJ 3D7PA 1P2CB 2DQGH 4L8BB 4NKQB 1ACCA 1U42A 4OCXL 4NB7A 4DP6X 3Q8FA 2AAVA 3MJ6A 4K94H 4LEOB 2I60L 5FHBH 3ZHLA 4ELDA 2JJSA 1AE6L 3LNDA 4HV8A 1KLFA 4UQEA 2FIRT 4MASA 1YEIL 3M6DA 1SLVA 2GBAA 2GTWA 3Q6GH 2PWGA 2V5MA 1F6LL 3AXHA 1NUFA 4MNQE 4PS4L 5F1IA 3LN5B 3I9GL 4OQTA 2GIXA 1AGDA 3VRLF 1PFOA 3KCPB 3FO9A 1RAMA 1UB5A 1NBYB 2EQDA 2NXZB 2PKDA 3IB4A 3QZWG 4KKAC 3FQXA 5IVXF 4YXHL 1ZIAA 4YBQD 4NJ9L 3GUTA 4MA7L 3W37A 4F1ZA 4GS7C 2LU3A 1CDIA 4NOBA 1BOYA 4Q6IB 2WIIB 4Q14A 3SY6A 4ZAKA 2NY3C 2ZUVA 1W0WB 2V8MA 2A1WH 2R1YB 3KYNA 2P8MA 1R6VA 5C07B 1Z9LA 5T1KB 1UVQA 1A1NB 1QR4A 3FCUB 4KO6A 4JQVC 2X4OB 2J88L 1J12A 3ZTCC 1AO7B 4P2YA 3DHJA 2FT6A 1AHMA 1N6UA 1WFIA 2XBTA 2IMNA 1CD1A 3NFNA 3SGDI 4ZFGL 4ZMTA 5AW4B 4OI8A 5I5IA 1IBBA 4Y4HD 2QGBA 1SDDB 3QEQB 3B7RL 3NPSC 3RWGB 1Q4NX 4IJ3B 1SEBB 2H26A 4WVRA 4E41D 1J9RA 4AQEA 3CFBB 4FA7B 2Y2WA 1U8QA 3ARTA 5CHNA 5CLTA 4E0RB 3ZLQC 1T04A 3BVWA 4Y4KB 3ZRFC 3C08H 2Y2TA 3PP4H 4FI7A 4Q9RH 5EZJB 3ILPA 4Z5RA 3T65A 5C6TL 4FQLH 3FCSA 3FAXA 1S3KH 4Q8BA 5GXBB 3MNZB 1Y0LA 4JPVL 1PF3A 1YHPA 2VZSA 5AOMA 1KXTA 1A47A 2EDYA 5AB1A 1M2OA 3VDAA 2G3ZA 2VZVA 5JNYA 2DWEA 4RNRB 5ERWA 4F27A 2XICA 5FM8A 1Q0YL 4OIIH 1GPOL 1DJYA 4OKVA 4ZO9A 3ZRCC 2YAEA 3ARWA 1KG0B 4H5SA 2PW1B 4NX0A 1MZZA 3GM8A 2ZYIA 3MA7B 2ZX5A 3MLWL 1W72B 1M9WA 3SODB 1LQSR 2VWEE 1AMXA 4OZGE 4P4KA 3L3GA 3I6GB 3FKUS 2DLIA 2YBRB 3ZDZE 1KPUA 2G60L 3O2VH 5KUMA 4ES9A 4P59L 4LASL 5AYUL 4I89A 4M8RA 4L8DB 3NCJH 2EIJB 3QZNA 3TYFA 3DX7A 3QHTC 5F0PB 3O3BA 4PBVC 3VXTA 3WIIL 3IAPA 3T0EA 4F7CA 4ETYA 1M7XA 4R4BA 2C7FA 5HHOD 1T6VN 1UACH 5M95B 2UZYA 5DO8A 15C8L 1BG1A 5IV2A 1YJDH 1MAMH 5B1JC 1I3RB 3UEQA 4WK4B 4AYMC 3BD3A 5HDWA 4ZNEA 4BKLB 1XTLA 3QEGL 4HD5A 3WEAA 5I1IH 4PRIB 3QEQD 5CINL 4ZW3A 1S4IA 3OWEA 2RH0A 1ORSB 1KOAA 1Y6KR 4PJ9D 4UBDD 3V9CA 5TJWK 1EFXB 1FNLA 2JELH 3FUDA 1N7MH 4RMTA 4AYFB 1UURA 1T0NA 3DURB 1XR8A 3K4ZA 3L3KA 4HQQH 2GJ6A 4DP5X 4ADGA 4RMBA 2R2EA 2W0FA 3BFOA 4WI7A 2EE0A 1AGCA 1V54B 5IBTL 5I75B 2VQ1B 1A6TA 1A4JA 5C0BE 5K9JL 2ORBH 1AHWA 3FW6A 3K6OA 4Y5VC 3ZKNC 4FNPA 1A02N 3BRDA 3B2UD 3QULB 4LMQI 4RGNE 4OZFB 4IKNA 4HIXL 3MXWH 3C8HA 4LSSH 4UU9A 2UZYB 3TEYA 4Z7UF 4WDIA 3L3JB 2G75A 4GRLD 1HS6A 1NFDE 1HI6B 1I31A 4OQTH 3N44F 4M5YH 2C9VA 4KUCF 5HHOE 4JRFA 3HRZA 4PCSA 1E9OA 4FFVD 4LOUC 1B0WA 3A6OA 5FK9B 3IJHB 2EUZA 4HJGB 3BN3B 2G60H 3ZK0A 1CT8B 4C56D 3B2DC 1C9SA 1MFBL 4XCFH 3V6FB 1I1FA 4J3VA 2IANA 1EXGA 2GC7C 3L3GB 1U95A 3BWUF 3H7LA 1NOFA 3DK2A 2IANB 3OF6D 4UM8A 2AQNA 4P9HC 1QRKA 3RE0A 3ZE2E 3VFNB 5D1QE 2A0LC 3ZJAA 5GRYA 3PGCA 4U1KA 4YDIH 4LOEA 3MLRL 4WCYL 2EYSA 4K7FB 2KPNA 3JV6A 4KTDL 1G0YR 2VR8A 3K46A 3VTAA 2WQVA 2ZYHA 2WN2A 1JBJA 3GHEH 4RNRA 5GJTL 2N01B 3TASA 3SPGA 4Y19D 3P4LA 4G6FD 5HYJA 5D1QB 1HHIA 3NZHL 4C4BA 1KTDA 4BZ2L 4QDGA 3WD5H 4KZEH 3MXWL 3C09C 3NCYS 3Q01A 2Y69B 4K5PA 1CIDA 2OJZL 3MYJA 2IPUK 4GAYA 4OM1L 3ZE1E 2H47C 1EGJL 1LO4H 4HS8H 4N2NA 5FWQA 2Y2YA 2JXMA 3T2NL 1JPTL 4QUOA 4QXUH 5I1AB 1WWCA 2B2XH 3IDNB 5CHNB 3D39A 5EUOE 2HTKD 2X09A 3FUJA 5I18H 4P2RE 5TGBB 4QKXB 3RWIB 2PR9A 3D5OF 3DXAE 5EZOH 3HHSB 5E8EA 2EIKB 1WIUA 1UCBL 2H32A 4FULA 3VXOB 4P2RD 3D3VE 5AAWA 1MUJA 3OLGA 1CCZA 3MRBB 1IVTA 3ZX1A 2A6KA 3E7JA 3G9AB 4QRAA 1S9KC 2C9QA 2ZT9C 1JHKL 4GUPA 4QRRA 4NZUH 1FP5A 5DWUH 4KK9C 4NQDA 4U3HA 4FADA 4NQCD 1KJ2B 3NMEA 5AZUA 2NCMA 4HEME 2YD7A 1WT5A 1HL5A 3NVQA 1I4FB 3KPSE 4YR6B 4LVOB 2DMGA 1MIEL 4JY6A 1TZIA 4IDJH 4PBDA 1YJDL 4Q0XH 4HOXA 3SDXF 3KLKA 2I7SA 3BUQA 4N0UE 4TQHA 1CGWA 1FVEB 3L4WA 4HCIA 3UACA 5IF0A 1KBBA 1GTNA 1GL4B 2CXGA 2BVPA 4EPSA 2X3BA 3SE9H 5HDQL 3K6FA 5BZDA 2OMUB 2NY2D 4X6EA 2R2EB 1WA0X 3K7UA 3WHXB 1RIHL 5JR1H 4D8PA 4GB9A 4MS8D 4AYGA 5E99H 1CG9A 1H3UA 3MSPA 4PH8A 1EJ8A 1R5IB 5E00B 2SODB 3V0FA 3X11B 4JY4A 2DLEA 3NIDF 2BNRA 1FVDA 1RZ7L 4XX1G 3VWJC 1TFHA 3ARDC 1AZUA 5BOJA 1CLOH 2F74A 4JFUA 3I6KA 1X4XA 2VW7A 5AOJA 1BHGA 5DRZA 1SJHA 5B1CA 1I9JH 2ZUTA 3WFEL 3DO7A 5D5MF 2CH8A 3IFNL 1I1AB 5C86A 1S2EA 5D2NE 4UOQA 3JTTB 1RPQA 4YIQA 1Q0YH 1ZGLP 2B0SL 5EPMB 3H9SB 1I4FA 3CCHA 3CHSA 4L29B 1NAMA 1I8MB 1HYSD 2W9DH 1M1XB 4TTGA 2PCPB 2E76C 4NKIH 3TU6A 3BH9A 1XHHA 3I3BA 3HZVB 5FXCH 1B90A 1NCDH 4ZTPH 4XPAL 3ULUD 5KS9A 1CDHA 3WNLA 4A55A 4E68A 1YG9A 1XL4A 1AGBB 1JFQH 3FH8A 1HINH 3L9EA 1U0QA 2V3DA 3Q48A 4Z7UE 1JK8B 2AVGA 3GNML 3VSQA 4C59B 4RAUB 4X7CC 5KSAA 3LZQA 1H9DA 3VFWA 2WKLA 3KYKH 2Y72A 3RX9A 5J3HD 4IBZA 2BNRE 3NBNA 4CU7A 1MPAL 1JGIA 3HB3B 4X5WA 4AYBA 1B6UA 1X5ZA 2MNJB 3DJTA 4FZEL 2XZCH 4W70A 4KPHL 1MFDH 3B5GA 4DETA 3JVGA 4DCQA 2B3RA 2BNQE 3APCA 3CC1A 3FU0A 2CO2A 3MLSL 2DDQH 3CQPA 3E80A 4NN5B 1W0WA 2B15A 5DD1L 2XI9A 4KKQA 4RGOH 5IW6B 4JFTA 4JHZA 3CSTA 4MJ6A 2ZPKH 4NFBA 4MQ7A 2Z8RA 2WWMD 5D7IB 1XEUA 2A38A 3SKMB 5KS9E 3IE9A 3LVTA 4NYLB 5LQBH 1N12A 4MCYB 3J2PA 4H7VA 4L8SC 5C0AE 3VFSB 4I4WB 4PGBB 5BOPA 2Q9OA 3VXQA 3SDCA 4QOKB 5B1JA 3PHOA 4W93A 2IAND 3Q6GL 4MQSB 1D6EB 4LHUG 2FECI 1VA9A 1S5HB 5HPMA 3TO4D 5HDRA 2O26U 3T08A 35C8L 5I8KH 2EDOA 1K5NA 2MNUA 3DRTA 3E9TA 3TBVA 5FLVA 3SPCA 4HS3B 3WUWG 1LP9E 1YNTF 3SOBH 5IJDC 1KCWA 1D9KA 3CDZB 4IRJC 1K4CB 1GZHC 1NAKH 2P24B 3EH1A 1KB5B 4G8EA 4Y1AA 1A1OA 4PJ5D 3QUMB 3NAAL 4P5MA 3S34L 2OYKA 4NZFA 2QKSA 4WO4A 4J3UA 3ZGHA 5K69A 3L7EB 2Y06H 2VXSL 3AADB 5AG9A 1GW0A 4LDCA 2VN3A 3C6LD 3SYCA 1J0HA 4ZMXA 5EN2B 4KAQL 1GYAA 1CI3M 3O4LB 3IFNH 2Q1EA 1YYLL 2YFOA 2H8PB 1QEWB 3F8UB 3IDIA 1NCCH 5DMKA 3PWVB 1R24A 1YC8A 5D1XE 3RVXC 2VM9A 4JFSA 5E56A 1JZ6A 1A6VL 3UCRA 3H3KA 2E5EA 3CK0H 4NC1E 1IUZA 2BLFA 4NC0B 5FM5O 4LGPB 4XVOA 3L1FA 2Z7WA 3O3EB 4MDIA 1IBGH 4MNQD 1HILB 2Z8VC 3GRWA 5DUPL 1OAYH 1A6WL 4E41B 2B8OT 4PJEF 5D2NB 4MDIB 5C0EA 1LO3L 1IO4C 4G8GB 4DT2A 2V3EA 3INOA 4KKCC 1UG9A 2H4EA 3WE6B 1K2DB 1IGIH 3ZYOA 1AFVL 4HX1A 4JMNA 1RK0A 2B14A 5EIIA 3U30C 3P77B 1FZJB 3WXVH 2HKHL 2BVOB 1KIQA 2C9SA 3CC5B 4M6AA 4ODTH 4DN4L 4IBWA 4HOWA 1A6ZA 2MH4A 4ONFL 3MV7B 3EG9A 4DTGH 2EDLA 1G6RL 1P0SE 3UYRL 5MENE 1VFUA 4FQ1H 3R18A 5CJ8A 5DUBB 1ETB1 1ETA1 3AWFA 2R69A 1QWNA 2Z64C 1QEXA 1MHHA 2ZSVB 3TO4B 4JRYA 4YHKL 3MODH 3S4SB 3L3OA 4WU5B 2W59A 1BEYL 1RZ7H 3L9RB 4P06A 3AWGA 4WNQA 4PD4J 1LK3H 1BWMA 1O6VA 2L8AA 4O00A 1V10A 4M93C 4JE4B 3SGEH 3V4PB 3W5NA 5E99L 1WP6A 4Y7OC 5HYSA 5E6YA 3B7SA 1T66D 3FOMA 2Z93B 3IDXL 1JRHH 4MA3B 3R0NA 2QL1A 4HJJH 2YAQA 2YOCA 1UOWA 5ADOL 1RUAH 3GZOA 4APXA 1KYOJ 3AS1A 2MCAA 3SDCD 2WW8A 1T5XA 4KHXH 3DTUB 1PKQE 1QFWH 3PWNA 2Q8AH 5KS9F 5LXGL 1CTMA 2WJ7A 2QSVA 1QHPA 5C0BD 3LV3A 1IV8A 2W5PA 3K1KC 1LLAA 5FF6A 3F84A 1UKQA 1BMGA 1DJGA 3OR6A 2QTEA 3L5HA 2HLFD 4JX0A 3ARUA 1F00I 3FB6B 2F53D 4YDZA 4HPHA 4R96B 1HOEA 1UCBH 4XBEL 3QYCA 2R2BA 3L45A 3HKFA 2LVEA 4JRYE 1VACB 1DO5A 1LDPH 2A5UA 4NKDA 2EDMA 3UBXA 3D25A 1IC7L 3B9VA 5JXAH 5INCB 3MJGX 2VXQA 3O4LD 1OAUL 2Q86B 2XLLA 5BRZA 3MUHL 1F4XH 4U1SB 1BLIA 1TTCA 4YHMH 4YBHA 4K07A 1MW3A 4OQTL 4ODSH 2JJSC 4I48A 4WW2F 3MNWA 5FAAA 3RWEB 3WD5L 4Z3GA 5H94B 3FO2A 5DUBA 5KAQG 2EEFA 1RUQL 4KROC 4JFDA 5EH1A 5JMOC 2NT1A 1A6ZB 2EP6A 4GRLC 2ID5A 2C1PB 5KG9A 5FM5M 3NP4A 4XE5B 3U1SL 5ACLA 2GBUA 5HGAB 4B5EA 2NW2B 1ZGLA 1NDMA 5TF0A 3EBHA 1SQ2N 1QBBA 4NQQA 2XZAH 1VKXB 4XNZC 5D2LA 1J1OH 4LCUB 4QLRA 3HZKA 3NJFA 1FBIL 4JDEB 4R7DB 1OIOA 4LEOA 3TBWA 1VERA 4LSQL 4X9HA 1ECYA 4JY5L 4HLEA 1NL0H 1Q72H 2H1PH 2JI3A 4ZDHA 1Q94B 1F3DJ 3VFRB 4XXDA 4GKLA 2H8PA 4N2EA 5I1EL 1PJ9A 1ZOXA 2CDGA 5IJKC 2ZICA 3O9WC 1P4IL 2LVCA 3VRLE 4CN6A 5I1EH 3L5IA 2ZF8A 4OB5L 4V11A 2FX8H 3WLWD 1DBKL 2VIRA 1PW3A 3C2AL 1JPGA 2ENPA 3BAIA 3VNZA 3D2UD 4HWEH 5SWZA 4YO0A 3MRLB 5L0QB 3MNZA 2C3XA 2Y0SA 1ET8A 3JWNE 4N8VB 4PRPD 5JPMC 5HXMA 1DQJA 5E7BA 4H25B 3AITA 4BCXA 3FN0H 4FCAA 4LF3A 3K2UL 2HN7A 5C6WH 5BXFB 3N42F 4ZD3L 3BP7A 5E95B 1U3HB 1UXWB 4YN3A 1OLLA 1UCTA 3HZYB 5IQ7L 4DK5A 1SY6H 4N68A 4P4KD 1DBAL 2R4RH 1ZJAA 5T5FL 5K9OB 3HZYA 1SDDA 1B0RB 1U2YA 1ZRUA 2XPGB 2FD6H 2WWMC 3KM2A 4GMSL 1KYDA 1X3DA 3IF1A 4FQJL 3T8XB 2VC2B 1KC5L 2Q7YA 1DHKA 3HS0A 5E4OA 4V1DB 3WFBH 2QQKL 4XWOC 1MI5E 4Y4FA 5JQ6L 1WBXA 4GBXB 2XZQH 4UUJB 2J7LA 2DQHH 4HWBH 3R4RA 3VD9A 4WJG3 4C47A 3QISA 4XN9A 1URLA 1RK1B 4OGYL 2X9YA 3ZKXB 5LJYH 3IMUA 3JUYA 4K8RL 1RZKL 1EEZB 1OXYA 2HH0H 4OJAA 1D5IL 3CU7A 3DXAD 3OZKA 3F5WB 1E4XH 4P9HL 1YY8B 1JGEB 3PXJA 1QLFA 4ENED 3PJSA 3DPDA 4LIQL 3UZEA 5CP7A 2QVFB 4D3CH 5D7IF 1UZGA 3D4YA 4JRWA 2RBLA 2Y7QA 2DQEH 4HPYH 2DIEA 1AGDB 4HVBA 1KGWA 3FU6A 4L48A 2FSEB 2YXWA 3HOGA 3FDWA 4Y88A 2YEVB 4F3FA 5IVXB 5EDSA 2NDFA 4JPVH 3QIBB 2F54E 4BFRA 2RQ8A 4FYQA 3BEWB 3SGKA 2X88A 2VZ1A 5H37H 5FR3A 2ZXEB 3VWKA 4FN0A 5E8OB 5EU5A 2NX5D 3UIYA 3HG3A 1IJNA 2X38A 3QJSB 4KRNA 4MJ5B 4XCCH 4YHYB 2HLFC 1IKFL 2PPAA 4XO5A 5IB3B 1CFVH 2J73A 1X44A 5FGBC 5G4NA 5SWQB 3EHBD 1G7IB 3KPPA 3MLUH 3NCBB 5CJOH 4NN7B 5C0ND 4X0KA 5JPMB 3VXTB 1RSFA 5F8RC 5FYKD 2ZOWA 1GCFA 2W07B 4IRJA 1AZNA 5LGKA 4MX7B 1QPKA 4IOIA 3F7VB 2YARA 4XHQA 4W9HC 3ZIYA 1Z9PA 4MS6A 2PO6C 3H2QA 4YSTA 1IAKA 3V4VB 3I85A 5E7FA 3ARFD 3I6GA 4OCXH 2CPCA 5GSVA 1VADB 3Q9PA 4FZ8L 3WHXA 4N2AA 1A4KB 2A1WL 3PWPD 4G1EB 2VLLB 2OW7A 3WL9A 2HKHH 4OU3A 4RLDA 3AW5A 2P5ED 1HOCA 1TEFA 1XX9C 3B83A 1WUZA 3FNKA 3B43A 3NJKA 1QPPA 3BVUA 3GZQA 1BFOA 3KPNB 3L08A 3LN4B 3D09A 3LX9A 3PCYA 4K7PX 4A66A 4P5KB 5K1NA 5T5NF 3CX5J 4OFQA 4TQPA 1H8OA 3CN1A 1ZPLA 3IGFA 1JWSA 1MWAH 1YEHL 2VZ3A 4QHLB 2FX9H 5D1QD 1I8IA 3ML8A 1IAIH 4ELMF 5D7EA 4F7MB 1GXEA 3CNKA 4M5TA 4N0YH 4UTBH 2FB4H 2W81C 3C8DA 1U91A 5CEYB 1PG7H 1BQHG 1IGMH 2C9AA 5TF1H 5E4EB 4E9VA 4L23A 1YMMD 1IVLA 2AK4E 2C3HA 2I07B 5I6MA 1S5IH 1UH2A 4JR9L 1QSEA 2L4OA 4RA0C 5MHSE 4GRLB 2DQGL 25C8L 4K3EL 4MA8L 4NQEE 4PJ8A 2EDDA 3KEDA 1CUOA 4ZUTB 4PY7A 1E2ZA 1N6VA 2WVVA 2QKIC 1XGQA 4EN3C 4GAGL 2TAAA 1CYGA 1JIBA 1JSYA 1KPVB 4L4VB 5FPIA 3KLHC 3HUJA 4ZS7H 3SJVD 4CNIA 2I85A 1F11A 5AAMC 4BFBD 3F12A 4N8VA 2EYRB 1E90A 4R4FH 1NDGB 3K74B 1MW2A 1RMFH 2Z91B 1E7VA 5D72H 5FUCE 1MQKL 4YLBA 1BM7A 1QHQA 4HS6A 1WITA 4HF5L 5DHDA 4BK5C 5T1JA 3O6ML 2R9HD 1NDGA 5GRJL 1TTUA 1MCIA 3CVDA 1H5BB 2K3TA 3ET9F 2JE8A 3PUCA 3P0VH 3MGTB 4MNQB 4TVUA 2ROXA 3BQUD 4AEIH 1ZTXL 3LNIA 4B0MM 4WNSA 2F58H 2J8HA 1H3WM 2HWZL 2OMZB 5J1AA 5HYJE 1BM3L 1AG6A 1K4DA 1ITBB 1OT4A 3EGXB 1IM3A 5MEOA 3MRJB 1TJXA 4GXVH 1EJOL 3SBWC 2PP9A 2P49B 3GS7A 3KPMB 1I8LC 4ZTEA 1K6QH 3U83A 1AYRA 1G6RA 3ZMNA 1RUQH 2VERA 4LHUB 2X4OA 1IGYA 3MLYL 4WO4C 4DWHA 2GT9B 1JTOA 1LYQA 4JO3L 1U2CA 3N1PC 4AMKL 5K1VA 2N7SA 4XNDA 5F1SA 7PCYA 2XV6B 2X89A 4E41E 4B9GA 3HN5A 4JQVA 4NM4H 3S8GB 5IQMA 4MWFB 1JPFA 4N6QA 3MUY1 4GFTB 5AWNH 3V5HA 4WO4B 1MCOL 1OARL 2V37A 4JG1L 4XR8C 4E9XA 2KERA 3QNZA 2E6PA 4O4YH 1YEGH 2XKNB 2F68X 3EGDA 3LZLA 1PG7X 4P2RA 1R75A 1ZT1B 4PI0A 1QR1A 5HHNB 1MIMH 3IJ8A 1E7UA 3F05A 1T5KA 1U92A 6PAZA 2F5AH 2ZE0A 4N0CD 3RILA 1UT2A 4GAJH 3V55A 4RMWA 4N6RA 1IFHH 1KEMH 1RJYB 4DH2A 5EBWB 2W95A 4JPKL 1RLWA 3BGMB 3HE7C 3LPOA 4NHCH 1INEH 1WF5A 3AG3B 1YJDC 5J11B 3MV9B 1H5BC 3QQXA 2A6JB 1HYRC 2Y3NA 3VYPA 1K4DB 2OP4H 3L6FB 1S8DB 2R8SH 4HMEA 4MJ6B 2X41A 2UX7A 2ZJSL 5I82A 4FG6D 4IRZL 2FJSA 3S8WA 1S7WA 4K3JL 4NQXA 5IBLD 3VH8G 4PWEA 4ZO6A 2E7LC 2WVUA 4XN1A 4E42A 3BUTA 2VM3A 4NSKA 4J3WA 5KN5B 4YZWA 4CSZA 2Z91A 3RIFF 4ERSL 3TESA 1N8OE 3VXSE 3H9HA 5FOBA 3G6JB 3KWWA 5CP3A 4XVUC 4ZOBA 4AL8H 4AUJA 5HYQB 1T4KB 3M17B 1S6NA 1T0MB 1UB6A 4LSVH 2Q3ZA 2LTQC 3LEVL 2PW2A 3KWXA 1L3NA 4NNPL 2DD8L 1VACA 5IHUL 3CN4A 5E5MA 2ZXAA 5K93A 1NPUA 4OD1H 1XXFC 4OLYL 1JUFA 4FHJA 3IETB 3ECVA 3MV9E 3VI3F 5I76A 2XOTA 1LO3H 3DHUA 1JHKH 5KVDE 3C5SA 3EF4A 3D51A 3HR5B 2EIEA 4LNVA 1NGZA 3ECQA 5TDNB 3VXRD 4JG1H 4LLVB 4BFJA 3X1NA 1Y7VA 3KJ4B 3OKKB 2CNYA 3VFPA 4QMEA 4WV1C 5DHVB 4L5FL 4TOYH 2GSIA 3UO8B 1SUHA 4GFXA 1T89A 2DQMA 2ITEA 1CDGA 3QCUL 1ES0B 4Y2LA 4CUCA 5KVDH 3QYMA 2IQ9L 2EINB 2JJVA 3DUSA 4GNKB 4PG9A 1OB0A 3I50L 1RK0B 2AJYH 5HJDA 2J71A 2C1OA 3HPLA 5TQ2L 2HZHA 1KZQA 1KIRB 4OGZA 4U2ZA 4WF7A 3NRQA 4HS8L 1DN2A 1QSED 4WK0B 4X6DB 2XTJD 2PYEE 2VJXA 1TZ8A 4LT7A 3MLYH 3V4PA 3T0DA 1KIPA 1EHKB 2EYTA 2HRHA 3T0XA 3WY2A 1NA8A 2AITA 2D03L 5FO2A 1E4WL 3MC0A 3VXSD 2BIOA 4D9QD 3L3HA 4FRWA 3BAXA 1NEZA 3KBFA 4MD4A 1OD9A 5HP5A 3GHPA 2BCMA 2ODIA 4HIJB 4NWTL 1GS7A 1B0GB 1L5GB 4P3CH 4ODUA 5E9DB 5JIPA 4FXKA 3E1F1 2OTUA 1RD6A 1L5GA 2QQLL 2K4WA 2WK2A 4HIJA 1VGEH 4KKLD 4S2SB 4AVJA 2VUOA 1BCIA 4J1UB 4UAOB 1HX0A 2A74A 1KXVA 5C70A 4P23C 2AMUA 3IWUA 4C4UA 5A2BA 1RIUL 4HP5A 4ZI8A 3LQAH 3BYYA 3CPLA 3QUZA 5I5RA 1WZMA 3RNKA 2JJTA 4XMKH 5HPMB 4L2YA 3TN0D 4Y9EA 5DD1H 3VVVA 1IQWL 5GRXG 4NBYB 3FT2B 4QYOA 3RFZB 3P02A 1IZKA 4PJ5A 4WU7B 1ZKAA 2ZOKA 3CZEA 3CFNA 1BIIB 1FLTX 3QG6A 4WO4D 4KTEH 2VSCA 2XXCB 2ZG3A 1M3JA 3FHEA 4RWHA 3KLLA 1VZGA 2HWZH 3KYKL 4ZRGA 5IKCB 2BP8B 4FFYL 2QLYA 3QIBC 5IUCA 1ZTXH 2DQFB 1PG7L 1PZ2A 2JVUA 1F5WA 4I48B 4JFXB 4GEIA 3BDXA 4GW5A 3IGKA 3FQRB 4MD5B 4KO9A 5EC2B 2B59A 3VE0B 4B9ZA 4W6YB 4KQ3H 4OQ1A 1U2HA 1NSNL 3B9EA 1TQTA 5HGBB 4DESA 5JHAA 3KGTA 4YSCA 4R4FL 3RP1A 5DO2C 2RMNA 1S5HA 1VZIA 1FE8H 3HS0B 2Y07H 3UBXB 1GZPB 3RX5A 5BRZD 1BSIA 4NN6C 4HBCL 1BAFH 2C9UA 2IQAB 4I18B 2VLKE 1PU0A 3FFOA 1SN5A 2BSSB 3E0GA 2VMDA 4G6JH 4M5ZL 1Z0NA 3Q2CA 4NKOB 4R7XA 4UQIM 4UTAA 5BMFH 1ES0A 2FIKB 3VRIB 1U3HA 3VSTA 1I9JL 5JDSB 3N55A 1XGTB 2WV3A 4JHWH 5BQDA 2OBGA 4PJIB 2MCG1 3QYNA 4NWUH 1FAIH 2PCXA 2IWKA 1CLOL 3EFOB 3FAWA 4GSXA 1CLZL 1JZDC 3S36L 1KBPA 3G3LA 1IGML 3GXMA 4XAKE 4YHZH 5TF1L 4OT1L 2V2XB 1BW8A 1CLZH 4YXLL 4M8VA 1GGIL 1Z9SB 3BI9X 1KYUA 4NUPA 4S0SD 1RUPL 4P2OD 4CMHB 4U7SA 2KZWA 2DQCL 4LVEA 2DWTA 3VFGL 1JPGB 2FEDC 4TSAH 1OWWA 3POHA 4Y7MA 4X5WB 2Y6TE 4G7VH 1T2QH 3E6HB 5HHMB 5AB0A 1SYSA 4UQ2A 1A6AB 3VI4A 1A4JB 1A6TB 1SF5A 5MENB 1KBWA 4DEUA 1D7BA 5LVEA 3CDFA 4AEHL 2EC9U 3DNKA 3NK3A 3C5ZC 4QXVA 3V4UL 3FQ1A 2ZNWA 3IRCA 43CAA 2AC0A 1MHCB 4K3GA 2R0ZH 1TKWB 2OLDA 2IG2H 3VFUB 2YXVA 4PCTA 1NIDA 3SKJL 1MLCB 2E47A 2XG5B 4N20A 4H1LH 4X7DC 1KT2B 5E8NB 4FQHA 5I1JL 1WD9A 2X3AA 1YNLL 3H8NA 3LS5L 1LEKB 3GGWB 5TK4A 1TFPA 2JKIS 1BZOA 4OCNC 1X7SA 3UAJA 5IROA 1A66A 4KX7A 3MXVL 2XXGA 3N6YA 1W72L 5A7BA 1E67A 4FNQA 4RGND 4ZFFB 1DSWA 4GI6A 4HCFA 2DM3A 2VZOA 3K8MA 4POYA 1M7IA 1FDLH 4NO2B 4EIBA 1YMMB 5JW4Q 4WKXA 3O6KL 1ZGLB 3GLAA 2PO6B 1KJMB 4P99A 3FFCD 2F15A 1ZA3A 2MQCA 2OMYB 3MRPB 4JFWA 2P52A 4ZBJA 1CK0L 2COQA 1PZ5A 1A64A 2G0KA 4AM0Q 4JQIL 3CZUB 3FFCE 3KPRA 1XTMA 2R0ZL 3WFBL 3L2NA 1ORQB 4FQHB 4MAYA 4YSEA 5D2LE 5JHDB 3TNMA 2YPLE 5HI4D 2ARJB 3S5LG 4APQC 3SE8H 3RGVA 3G5XA 4KBPA 3TJEL 4NEHB 1KDJA 1KYFA 2P5EB 3EFDH 2JCCA 4NAJA 2DQEL 4HPYL 4EI6B 1NAMH 3A21A 3VXPB 4KTDH 5DMJB 3UAFA 4ZD3H 4XMWA 2B77A 4LIQH 1UOLA 3GSNA 2JXMB 1Z6JT 4ZUVA 2WUBL 3HMXH 3IGAA 5BZWB 4JFFA 4Z78B 5DSCA 2O5NA 4DGYL 2XWCA 5I30H 3IVKB 3DUHA 2H7WA 3B5HA 2HH0L 1EMTL 1BZ7B 2AAAA 4AT6B 2IADB 3C2SA 1BZ8A 1HN1A 3UZQA 1Y0LB 2IH3A 2V5RA 4ZS6C 5E08L 5FA3B 3E2HB 4OLUH 4X6FB 2HT4D 2WZ6A 1IT9L 1WCBB 3B1TA 2GUOB 4AIZB 1HC1A 2WHVA 3G6AB 4L4VA 4FQIH 4O02H 2WQRA 4LDLB 3QUYD 1XGUA 5T1LD 3ESUF 3RX8A 3CVHH 3U79A 2HFFB 1EHAA 2F5BL 5SWZE 3VQ2C 4AVHA 4LP4A 1OP4A 4HIQA 2JMRA 2WXPA 3QNXA 1C1EL 4PSRA 4HAGA 3SPJA 1DBML 5IVXE 3ARDD 3WN5B 5HBBA 3QNXB 5IB2B 1SY6L 4ZSOA 3UYPB 2E8ZA 4MMXC 3RWHA 4RISH 1IGCH 1MZYA 5GS0H 3SD2A 4XXWA 1D5BA 1SJMA 2YWYA 5GS2H 3RZCB 2YLHA 2W0LA 4BKTC 5KVDL 3BGFB 1HXYA 1SZNA 3DYOA 5EIIG 2ZUQB 2GK0B 4X0NA 1G9EA 4LVNB 1MCSA 2AEQL 4TOYL 3RRQA 3DX1A 3B9KA 1JN6B 4ORZC 3BE1L 4BXSV 1TQBB 3BPCA 2R1YA 1QUNA 2X42A 3ARVA 4H44C 5SWZB 4A04A 2X6VA 3MZTA 3K6NA 4R5XA 5CZKA 5GGSB 2EYRA 4OM0H 5E2WH 4XB8A 1BYNA 1C8PA 1CICD 1U8MB 2G5BB 5CXPA 1AGEB 3IMVA 2JLPA 1MEXL 5L2KD 2UY6B 5EO0A 5KYNA 3FHAA 3G5WA 5IIEB 1LO5A 1GS6X 4WWKC 3CFCH 3WN5A 5I1LA 3QDGD 4IIQA 4DKTA 1OB1B 2FBJL 4XPTH 1RIVH 2I07A 3IEAA 3C60A 2HX9A 3FMGL 2AJSL 4G1MB 2AEIT 2EDEA 3MCLH 1VEPA 3QUZC 5J1SC 5CEYA 3QFJD 4F7EA 1AXSA 1FNEB 5E1IA 2HTKC 3G04A 3O9WD 4U0RC 4Q4IA 2AJZB 1JMXA 1XR9A 4GIPD 1PTZA 3TGXA 3RGVD 1FBIH 1KB9J 2YAPA 3N04A 4LOFA 4U0RB 4WZ9A 2R59A 1D5MA 1UJ3C 3FONB 3Q6FA 3WUZA 4P5KA 4QJ5B 5ICYB 4A2EA 4HFWA 4DW2L 2GBTA 3UO1H 3VFOB 3EBGA 5DHEA 2F19H 4YLCA 2NX5B 4PJIE 1SJHB 2G4EA 2Z4QB 5D8JH 1Z32X 4H26A 1T83C 3GGWA 4UT7H 1LEKA 1ERNA 4EI5D 4TTDC 1PJWA 1DBJL 1X6NA 2XJKA 1MJ7L 1Q38A 2ODHA 4JFPB 1MIML 1L0PA 1BQRA 3VNYA 5FO7B 4XPFH 3V5HB 4Z3TA 3RVWD 3AABA 3VW3H 3Q2WA 1IEAB 4JEGB 3GJFB 5CLZA 3FQNB 3GLDA 5BZDB 4PD4K 5ISZB 3MJ7B 3EJZC 1N59A 1WBYB 1RCYA 1MCCA 4AL8C 3PHQB 5DD6B 1FFRA 3KH4A 5HTSA 1GC1L 3KPPB 2NPLX 4X2UA 3PDOA 4C83B 4LGRB 1LWJA 2ATPA 1ZLWK 4IRSD 5IV2B 1DQIA 1RK1A 4Z6AT 2JKJA 4N3UA 5GSRA 4Y16A 3ORJA 3RL1A 3QZLA 5C08D 2AQ2A 4F7CB 5C0BA 5TQ0H 4U0QB 4R7NB 4NCC2 4NRZB 4DKEL 2YQ3A 4QRRB 4XN5A 3UBGA 4K71B 1S7VA 2VN6A 3H3PL 1MCEA 2APTA 2PWDA 2VMCA 2W94A 4XPFL 4YH6A 1WTGT 4HU2A 4QO1A 9CGTA 1MUJB 1BFTA 1ASOA 4YDVA 4AQAA 1T5WB 3C60B 1KMGA 4RVBA 1A5FL 4UILL 3DETD 3CTTA 1I7ZA 5DU7A 2YBRA 1YN7B 3QO0A 3JZYA 4URTB 4LSVL 5K9QG 3F2LA 1I3VA 2WO2B 1EDQA 2Y36H 1XF3B 2FJFA 1YUHB 4WIQA 5TPWL 1OF2A 2FQFA 3SY0A 4AJVA 1E27A 1JZGA 1JERA 1OKEA 1JRHL 2WQUA 2Y7SA 3QJOA 5TK2A 2WSPA 2I9LA 1IEBB 3G5ZA 3GHBH 4KNTA 3CLWA 4UTAL 1OAYL 1TETH 4F2FA 4WJ5B 3CJJA 4HH8A 5D1QA 3D39E 5EUOA 2FUQA 4YVNA 1FN4A 5CKGA 1KCVL 2L7EA 3VXUB 2ZUSA 4ZODA 1YQ2A 1P1ZA 5C0NC 2LU5A 1MHPL 2EUXA 1SJXA 3FO1A 3D3VA 5AW6B 3GB7A 3U46B 5I1HL 5L2JB 5B8CA 2J5WA 2UY7B 4ZUTA 4PHZA 3X1GA 1N68A 1UB5B 3DX2A 4ODTL 2G3XA 3CFCL 3MLVH 2ZWKA 3JTSA 5C71A 5J9PB 1QSEB 3ZKMC 2F5BH 5HGDB 2X28A 3KPSA 3W5MA 3P4OA 5D5MB 2DV6A 3QXUA 3N1FC 3US0A 4FOMA 1HH9A 3HE6C 5GZND 1AIFB 3RFRA 1BVKA 3CG8A 3LIUA 2FNBA 4N9OB 2LGNA 2BVEA 4F15B 5G5DB 4JM2A 2VDLL 5CGMA 4IQHA 4ZUSB 1KB5H 3ZYJA 5AVTB 3RL1B 1WISA 4PGDB 5C07A 5C09E 2FGWH 1T03H 1MCOH 4RFEA 4YXKL 1E2VA 4KZDL 1D9KC 2BRRH 2WXMA 4XH2A 1QLRA 3FU9A 3TN0A 2VZTA 2O6PA 3BWAA 1MDAA 4HZAA 4HKBA 2FEEL 2GPZA 1C08B 3DBXA 3P3UA 4ZX6A 1WBZB 4C56B 1K3ZA 1TQWA 5J6SA 1NDTA 3DBXB 4MFHA 1W0VA 2VLMD 4W6XB 2NW3A 4Z7OE 4OZFH 1CJYA 3VWJB 5T3XE 3WTXA 3EYSL 3RFZA 4CMMB 1UJ3B 2FEJA 4AYFA 3RTQA 1N5YH 4JKWA 4TSBH 1QNZH 3WFCH 4NFDA 3C6LC 5C0AB 4KK6C 2V5TA 1QD0A 2NYYC 5DZJA 4EN3D 5TE4H 4G8GE 1BVKB 3HLKA 3VFOA 1FDLL 1CFNA 3MRBA 4PHXA 3EJSA 1FO0L 4R0LC 4D9QE 1DQTA 1KEGL 2B5IB 5I6XC 4L9LC 4MBRA 1I9EA 4R96A 1VEMA 4MDJA 1DQLH 3D69A 4X8JA 3ZT5A 1QI5A 4DN3H 4OUUA 4H8PA 1WHOA 5FGSA 2C3VB 4B9YA 4QD2E 5D93C 4GPVA 1UZ6F 2EXYC 3O4LE 4N5UA 2CR0A 2W91A 3ZUNC 3BT2L 3Q5TA 2CUHA 2XFGB 5CZRA 4NERA 4QLWA 1FFNB 4M9OA 2P4AB 1SJVA 1PD6A 1LJMA 1JZ7A 3C6SA 4DVRL 3QIWA 1GGTA 1HCFX 3R1GL 4DGIH 1OCRB 1PFCA 4XOCA 4MVBC 5HYIA 3ARGD 1TZGL 5CF3A 3T3PE 3T3MB 1I3GL 2X7LB 3ILQC 4WEEA 3TNNB 3NCXA 4CNIB 3N40F 3ULUH 4X98A 4WI2A 1T21B 4MA8H 5HYQA 4RAVB 4XC3L 5HJ3A 2WZPA 4TVSa 2YQ2A 3HPLB 1H15B 5F9OL 5GZNA 1GZQB 1RZJH 5EOTB 3SCMD 1F45A 3LH8A 1NQBA 2A9MH 3MXVH 5ETUB 4N1EA 1C5BH 2P80D 3LIZH 4NENB 2ZXQA 5IFJB 4O9HL 5KYXB 1AI1L 3SCMB 3DVIA 4Q89A 5IFJA 5CU9A 4ZFZA 2D0HA 2E7HA 3U0PB 3OZLA 3KVDD 1EHLL 4QRPB 2ZKMX 2ZXWB 4QXWA 4PS7A 2DL9A 1JGUH 2XCMC 1NANI 1ILSA 4IDJL 3MX0B 2DS4A 1AZBA 4RAVA 5HJ3B 1FG2A 3DETC 1NCAL 4XPHH 4UAOC 3OV6A 4N1CA 1KN2L 1SXSA 1ZSHA 3MOBH 4HIIA 4HJTA 3TZVC 2DYRB 5E0QA 1OSEA 3MLZL 5E8DH 1U3HC 4JS7A 3LRKA 4IGBB 4PS8A 3CD4A 1JZ2A 3BPLB 3L9RA 1VGKA 3K72B 1EAJA 1RFDH 4H88L 2CKBB 5HHPB 4HALA 4QXTA 3FSVA 2D31A 5FDWA 4ODXA 4ZUUA 2VDPL 5GS1A 4L4TB 3MJ8A 3MTXA 1A1MA 1H3XA 1T1ZB 3ARZA 3I02B 2Y9RT 1EANA 3UROR 3NT0A 5E5UB 4J6RH 4WJKB 3IJ7A 3O41B 1KJ2L 4LSUH 4PJ9C 1ZS8A 3QUKB 1YNKH 4P2QA 3D33A 3J07A 4P5MB 2OI9C 3T2NH 5ITBH 2I5YH 4PJ5B 1BAFL 2Z31A 3QO1B 3VFMA 5E1AB 5IMLA 3DVGB 2P26A 2YC1B 1FE8L 4S1QH 1BQUA 3N43F 1CFNB 4F1SA 5JIIA 1QBML 4JW3A 1G7QB 1XGPB 5ALBL 1N9PA 4BSWA 1FI8C 1PZDA 2WYTA 3KL0A 4AGPA 4HIHA 3PHOB 3MLRH 2FJHB 4UDTA 2E59A 2FX7L 4MS8C 1XDTT 1RUMH 2EEAA 3OQ3B 1ZDSA 4U6TA 1F13A 3QDMA 5D9SA 3WKMH 1N5AA 4YEEA 4U1HA 1GGBL 2XYCA 4Y2DC 3SYQA 1HQ4A 3OKOB 3TWYA 2FATH 2UXVA 1E4HA 3KVQA 2QVTA 3CSFA 5DJ6B 1YY8A 1PG7W 4MD0B 5B3JE 4YPJA 4PJGE 3RIAF 4XO4A 1J88A 1JVKA 4GBXD 4IU3B 2AQSA 4UT9A 4OZIB 4NKMB 1UWGL 1ID5I 1ZCRA 2HG0A 5JHLL 2VR5A 4N8VG 3M46A 2YK1L 3UPRA 5JHLH 2WOYA 4CBPA 4FNLL 5ILTH 4QIRA 3GXDA 5D7KE 2FT8A 4S1DC 1KWKA 4XP5H 3RZCA 3BIBX 1F4XL 1XT5A 1ZLVH 3P4MA 4IMKC 4QGTA 3H42H 5E6IC 3PWPB 1T22A 4W68A 1YPZE 1MRDH 5FKAB 2NDGA 5DI8A 3F7LA 2PTUA 2LE9A 4NOFA 3QCUH 1QFUH 4W4OA 1ZT4A 3H54A 5T3ZL 5BV7L 2XWTA 2EC8A 2WBXA 1FL6A 3RIFK 4RIRB 1IKNC 4HDIA 5HI5D 3KDMA 3DYPA 3OC5A 1AO7D 2ZYSA 3MBWA 4J12A 4RZKA 1KGXA 3ULVD 4NKOA 2G75B 2FQEA 2D03H 2QPDB 1KELL 32C2B 2VN7A 5GISL 2HA1A 1VFAB 3IS0X 2OULB 2DQUL 5C97A 2NNAB 5JHMA 1MG3C 1T89C 5JPNA 2ICEC 5HHVH 4Q6IA 3LHAA 1QKZL 5FHAH 5BZWA 4UTBA 2F54B 3SDDB 4KKRA 2RCSL 4JZNB 4IRSB 3E1ZA 4BGDA 4LSUL 5HYJD 2EVIA 4XRCA 2ICWI 3THML 4I13B 5A16A 2K9FB 4FNUA 2FQGA 5CGYC 3DX8B 4AQ1B 3DOSA 4P59H 2HRLA 4U1LB 5KSBB 4KKAD 3TNMB 4WI8A 3V0HA 1NLBL 1JE6A 4KH9A 4IBUA 2VW4A 1HL9A 2DICA 2DWDB 1OP9A 5I0WA 4JGJA 1S7UA 2Z4QA 5CBEA 2XVBA 4A7UA 5KSBF 3ISWA 2JV6A 1EAPA 3M1CA 1AQ8A 1J8HB 3RKDD 1JHLL 4KVCH 2JLLA 4XE0A 1HH6A 1G7MA 2DI8A 4PBWD 1YMHB 3BP5B 3K5SA 2BY3A 1JZ4A 3QQDA 5J13B 4Z8FH 1FYTD 3SE4C 1G7MB 3MFGB 4CJ1A 4F2ME 1UGKA 2Q2LA 4BA0A 3VWKB 5ISZA 1TTFA 2EDFA 3LPGA 4PB0L 4V1DD 4B0MB 1O9WA 5AVXB 1ZT7A 2ADIB 3BSZH 5B7FA 1JXGA 1Y6MR 2G0LA 2N4IA 4ODSL 5D1ZA 3O0LA 5FWRA 1LILA 5L4JA 4AK2A 1N3NB 1VESA 2JCCF 2EDWA 3D18A 5DJZB 4X8GA 3OAUL 4RQQB 2K1MA 1C5BL 2EE9A 3M1OA 4L3EE 3NJNA 3AMKA 3C5JB 4M4RA 5KTEH 1CLYH 1L4IA 5DJDA 5DD5H 1WV7T 1NC4A 4GQ9L 5B1BB 3V0AC 3L9BA 3AUVA 3JWOC 3STLB 4OKVB 2IFFH 5F88B 4BIKA 1FQ9C 1BZ9B 2NNAA 3ZDXE 4OIIL 4XVJH 3JQOB 3V4VL 1PEZA 4ZK8A 2FAUA 3B2XA 3OKDA 2UV3A 3CMGA 3TCLA 2AQPA 1G94A 3UJIH 3ZO9A 3UP1A 1DBJH 2EEDA 3T2PA 2P5PA 2XYBA 4DP2X 5EU5B 4PJBE 5ENWA 3GJEB 4PJ6A 3ELQA 1EJOH 1E43A 4Y9BA 4U1KB 2BDNH 4NRYB 4MA7H 4Y4FD 1KTRL 3LD8C 3RVUD 1OOAA 4UMGA 1BVLB 1D5ZA 1OTSD 1TDQA 3PNRB 4WNJA 4UZSA 3WDIA 2ZUWA 2WP3O 5DK3A 4ZAKC 3W0WB 3CSPA 1V55B 2ZP9A 2DLFH 1MAKA 1WQVT 4L8SA 4GQPH 4PJDF 4N5EC 2YA2A 3GIZL 1QX1A 2KQMA 2YAFA 5F44A 5LQBL 4HCGA 5C0RH 4AUUA 2F6AA 2GHWB 1I1YB 1Q9WB 3R8BB 4Z7WF 3VGGA 4IKIA 4D0DA 3HE6B 4HF5H 1M71B 1IM9D 2YWZA 1AKPA 1ND0A 3KPOA 5EC2A 2VCOA 5DK0B 5FGRA 1M71A 1JN6A 4ZOCA 3GXNA 3HE6A 4XZ4A 4BRVA 4J3TA 1ROCA 1F41A 3V0VB 1TXKA 4ZAKB 1WBXB 4GBXA 2B4CC 3DBSA 4GQZA 4ZW6A 1XSKA 4KKNA 1XV8A 2NY7H 1G6VK 1N26A 3X3GH 4EI5B 2A9CA 1NMBL 1NFAA 4KPHH 7FABL 2YR3A 4FZEH 2HJFB 3RWDA 2C7UB 2CA3A 4ENZA 25C8H 4K3EH 2NLJA 3HAEG 3BISA 2ZOUA 5KSBE 3R06A 2VL5B 4QTIH 1TLKA 1Q0XL 2WLLB 2ZX7A 1EQWA 4H1LG 5TDOB 1CR9H 1ZS2A 3HC3H 2FHBA 5DJZA 5K33A 3A6CH 4HWNA 1T5WA 2KLSA 3BE1H 4HJEA 3MHZA 5I6NA 2CMRH 3F58L 3GNMH 3ZN6A 2AF2A 4ZYKA 5J89A 1QVOA 5LGHL 2VQ4A 1KB9K 2GYSA 1P6AB 3CLFH 4FLOA 1OLZA 1WYJA 2VR6A 3GSWB 3QB7C 4OIFA 1OAZH 2WXRA 5IW1B 4UNIA 2QFRA 1RMFL 5TFSL 1EFXD 1NGQH 2O5YH 1YCSA 1BVNP 3TWCH 4E9LA 5CN2A 4X80H 2UUDK 2C26A 5F3HA 2VXUH 3PGFH 1IM3D 4JCWA 1Z3RA 3TFBA 5ID0A 2QADC 3HC4H 1UA7A 3QP3A 1TJGH 4PGEB 5LKNA 1UWEH 4GUQA 5I9QB 2WLKA 4MXWH 4TQ8A 3NIGE 4EI6A 4Q6YA 3IXTA 1LMKA 5IVZB 3T71A 4JR9H 4G7YL 4JRXB 4BEIA 1HKLL 4NC2B 4GS7B 5D4IA 5DYFA 3PWPE 2PPDA 1IQDA 3CLFL 4CC4C 3QS2A 3FQ4A 3K72A 4BINA 1PYWA 2ED8A 1HSBB 1EMTH 4XOEA 1J0YA 2CAKA 3CVBA 2VDOB 4HS3A 3SO5A 2OMUA 3C75A 4BE6A 2BS71 1XH3B 3TURA 1DO6A 1KG0A 4M1CC 1N0XH 4CC1A 1NFDA 5FYJE 4GBXC 4QCIB 2WYHA 2OAAA 3ATDA 3DJ9A 4I5BB 4QHMB 2E7BA 1YMMA 4X6BA 1DBBH 3BZFB 3GK8H 4Y8AA 4YHLL 5IW1A 4JAMB 3SIKA 3DVFA 3V0GA 3T0EB 3LH2H 4N2DA 5DQDH 1MJ8L 4NQDB 1IGYB 4A7QA 1NCTA 1U8HA 5JDJA 2VXQL 5I9QC 3FCTB 3RTQC 2EVJA 1KCRL 2DWDA 2GI7A 3BJLA 4S10A 4AEFA 1DVYA 1H0DA 3VGFA 1OANA 4NENA 5F9AC 2WP3T 3FTGB 3AB0B 3PPEA 1P4LB 1ZHBA 2HG5B 1G5AA 3RJQB 4YJZL 4ZPTB 4EDXB 5KEZA 4OZ4B 2QVMA 5EOTA 3VGEA 3JUZA 3SDAA 2MCPH 2E7DA 5I1DA 4NRXA 1TJHL 2OMZA 5J1AB 2OJEB 5CN3A 2D8KA 3U2IA 1E3ZA 5JZ7C 2BRQA 1MJJA 1CFVL 3WI9A 2E7LA 3V0VA 2A7BA 2XKSA 4QXUL 4BUHA 3HW7A 5LBSH 3PDGA 5L8KB 3ESMA 4PJEE 3WSQL 3MJWA 4Z7VE 2ADFL 1I9RL 3ALWA 5FDYA