2IVFC

Ethylbenzene dehydrogenase from aromatoleum aromaticum
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
MKAKRVPGGKELLLDLDAPIWAGAESTTFEMFPTPLVMVKEVSPFLALSEGHGVIKRLDVAALHNGSMIALRLKWASEKHDKIVDLNSFVDGVGAMFPVARGAQAVTMGATGRPVNAWYWKANANEPMEIVAEGFSAVRRMKDKAGSDLKAVAQHRNGEWNVILCRSMATGDGLAKLQAGGSSKIAFAVWSGGNAERSGRKSYSGEFVDFEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Ethylbenzene Dehydrogenase from Aromatoleum Aromaticum
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords ETHYLBENZENE DEHYDROGENASE ALPHA-SUBUNIT
total genus 49
structure length 214
sequence length 214
ec nomenclature ec 1.17.99.2: Ethylbenzene hydroxylase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09459 EB_dh Ethylbenzene dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ivfC00
1I8AA 2IVFC 1I82A 1UG9A 1ULVA 1I8UA 4JPQA
chains in the Genus database with same CATH superfamily
2J2ZB 2Z9TA 1ZLDA 4X4KA 4X80H 4L1LA 4OD3L 3TA3D 1NPJA 2YMXL 4OF6A 4Y2DD 1BAWA 3WMSA 1JPSL 3ELAT 1JERA 2B3IA 3FTSA 4OAWB 3FAXA 3BQUD 1A6TB 1KT2A 1A6UL 5IKCA 2XWTB 4GBXC 5D1XA 2KLTA 1P4BH 2K3TA 4I0PB 2FEDC 1OAQH 3GDCA 4OJCA 3SE4C 3EXJA 3VXQA 4YZFE 3ARBB 2N7SA 3IM1A 1QTPA 4MLIA 4KVNL 3BN9C 4YHIA 3HLAB 3WHE0 2A6DB 4Z7VB 4MDJA 1I82A 3CE1A 5EIVA 1HNFA 3VX0A 3K4ZA 3EYSH 2WAQA 3QUMA 2RA1A 3D25A 4LOUD 3LRHA 4BQ6A 3RVVC 4MMYB 5T5FL 1CL7I 1XHHA 4AQZA 2MCPL 2B4CC 2HX9A 3C8HA 4IEFB 5I6XB 2D7PA 2IBZY 3CFUA 3LKNB 4IDJL 3MBEC 1F18A 4U2YA 4EI6A 3MLUH 3QUGA 3QWOA 1JRHH 2XX1A 3QUHA 5TF0A 4B5EA 4Y16D 2B08A 1UB5B 4L0YA 4LASL 5I0ZA 1L9SA 5EOCH 1QRNE 5DHVH 1EEZA 2F1AA 5H37G 1JGDB 3MV9B 2FUTA 1MWAB 1OCCB 3LN5B 1MIEH 2B2XL 2WLYA 4UIMA 2VDPL 4U1KA 2DIJA 2YAPA 1U8QB 4CVXA 4HK0B 1FC1A 5B3JF 4G70B 4WU5A 1TZHB 3ETSA 4JJHA 2GSIB 3MV7B 2VQ1B 4M4PA 3F83A 5DR5L 3FRPB 3Q01A 5EIIB 1XZ0A 4Z3JA 4UOQA 3F6LA 5D70L 4MCYA 2H32H 3C09C 2R56L 4M6OH 4M62H 5LDSA 5FA4A 2EDLA 3L1GA 3GFUA 4AV5A 3CLWA 3MGOA 4HHGA 4HAKA 4YXHH 2UYLA 1GGTA 3QNYB 3CN2A 4B3EA 4JG1L 1DHKA 5JIQA 2A9BA 3FF7A 4MCMA 1SJHB 3ZHDA 2BSRA 4JAMA 4I87A 1QFOA 1HE8A 4BFGA 1OB1A 5AW0B 4CSZA 3WO3B 4IMKA 5KVGH 4W1TA 1NC4D 1ZLSH 2YXVA 3NFPB 2YD3A 2X3AA 1U8PB 2D7TL 2R4SH 1DN0A 4QRTA 2VDNL 3GJFB 3ZTJG 3VFTA 1X4YA 4BDVA 5BW7C 5D6DA 1DVQA 1DANT 1LK3H 4KMTL 2XNAA 4OLYL 1VGEH 4H8WC 5IK3A 5L8KB 3L95B 5IB5B 3BESR 1I8LA 4EEEA 2BOCB 4JVUA 1N3NB 4GNKB 4DW2H 1F6AA 3LQAH 1V7NH 2J72A 4RMBA 2ALAA 2BIHA 2OR9L 2KZ1B 2YRPA 1ZHNB 3LKNA 3FSOA 2ARJB 3NSFA 1GGIH 2YFOA 2XVGA 1DSFH 1WAEA 2E4TA 3MCYA 5DD6A 1AIFA 1S7WA 4WRLA 4QTIL 3QQ3A 4OIIH 1NAMB 4LVOC 5CS7A 5DZJA 3EO9L 4UQ2A 5GRJH 2X4QA 2Y23A 3STBA 1B0GA 4FE9A 4S10A 2NR6A 5F0MB 4PUBL 4H1LB 4XVOA 4K5OA 1UD3A 3DUSA 4YHIB 2Z35B 4EIBA 2P4AB 2OMYA 1A4KA 3CFCH 4E5XG 4G5ZH 2UY6B 4EZMA 1UA6L 5F9JA 3S35L 1ONQB 4CVZA 3WTTA 4YFLI 4K5MA 3TBVB 4PRBA 2YD9A 1GCFA 5C6TH 2MJWA 3GDBA 3PL6D 3DV4B 3QISA 3EGSA 1TR7A 2V2WB 4HK3J 3QCVH 4QRRB 4B53A 2EH8L 4W9EC 5L8JB 3QCTL 4APQC 3HZKB 2G2RB 1RHFA 3OKEB 4N68A 1DDHB 1Y6NR 4KKCC 1GR7A 2HG5A 5DHVA 4GUOA 2ZX7A 1XL4A 1XH2A 1BFVH 2VL5A 1RJCA 3BFWA 3P30H 2I07B 4AM0Q 3OAUL 4KGJA 4DAGH 4JKPL 5C0CB 1NDTA 5J9PB 3FT3B 3VJ6B 4DGIL 4P5TD 2GI7A 4A67A 2XZCH 4BK5A 5IM7B 3FDWA 5DJDB 2W0PA 3HMXH 4KJWD 3OHXC 1RZKL 1VZIA 4QYAA 2VLKD 4Q0XL 4ZX4A 3BI9X 2PPAA 5D7JB 2GPZA 3ZL2A 4KTYA 5E08L 1QSFA 2BPBA 3CFEA 3D39E 3EBIA 1U3ZA 1CXHA 1BWMA 5J11C 4LLYB 1XVSA 3ARFD 1N19A 2AABH 3BWUC 1IGJB 2EDYA 3QRBA 4PRHB 2WVVA 3DBSA 3JT0A 1UACL 1FFOB 5FF6B 1AZVA 2XSKA 4FNPA 4BA0A 3DWTA 4NQQA 2V3DA 1AXIB 4OVUA 5F9DC 3OR7B 4GAYB 3QEGH 1QSEB 3UTTE 4HPOH 5F1OB 3KHOA 3X13B 4X99A 1D9KC 2Y3NA 6TAAA 1EO8L 2MPAH 5HHOB 2FH6A 5MENA 1VERA 3FU7A 3SE8H 1MOEA 3QXAA 3LS5L 4ODXA 3QUXB 1SMDA 2B4CH 3A5VA 1A6VL 1IM3B 3H7BB 4FL4C 3EFFB 2BFVH 4MD4A 5D7JA 4D8OA 4P2AA 1PX8A 2N7BA 4FTDA 5T1JA 5IQOA 4OTXL 4B7LA 1RPKA 2VN7A 4IRSC 5F7HA 2WM0A 4TNWK 3PCYA 1S5HB 2HJKB 1VACA 5HGDA 1MQKH 2WZPD 1DVFD 1WAAA 1MEXL 4GRWH 3OM3B 3TZVC 4UQIM 3BPCA 1YY8A 1Z32X 3BHBA 5D1ZB 5DEFA 3G5ZB 5DEJA 4OV5B 3KHQA 2D9CA 3I9PA 1RP8A 1KTJA 4RWHA 5AYUL 4FTVD 3TIDA 3MCKB 4B9YA 3PWVA 4PVNA 1PY9A 2FNWA 5HYEA 4U05A 3AXHA 1FN4B 3DNKA 1KLUB 5EO1A 3WKQA 4QOKA 3TH3T 5CJXC 3LPWA 3ECBB 3QEUB 4G8IA 4TVPD 2R69H 8CGTA 1OGSA 1UD6A 3IVKB 2PABA 4P05A 4APQB 1JPGB 1ONQA 4CVZB 3VG9B 1TQVA 2X3CA 3OXSB 4XZ4A 3UADA 1OB0A 4LT7A 1FORH 1PCSA 2GABA 1GZPA 3P69A 1D5ZB 1KY7A 2MKWA 4JPQA 4JY5H 2V5YA 5GS1B 5I71B 4WO4B 2MSPA 1G6RH 2EIKB 2H6PA 2ORBH 3GGWB 3SPGA 2ZOLA 4ZAKA 3U1PA 3IMBA 4HW6A 4ZOAA 4OQTA 4H8WH 5HDBF 4JG1H 3PUUA 4JO8A 1F02I 4BH8A 3V79C 1J0IA 1GL4B 2O61B 4ZTPL 1Z0NA 1ZHNA 4NPKA 5CGYC 2KPWA 2CDEA 1IVTA 3Q05A 4R3SA 1NH6A 1FL6A 1UWGH 4J2QA 4XH2A 3T65B 4OJAA 3CLEL 2EILB 3C60D 5JOEA 3D69A 2EVHA 3ARTA 5E2UH 4FCHA 1EFXA 4IMLA 2WJ7A 4OD1H 4BE5A 4KZEL 3BWSA 4KTDL 2AZAA 4LLQB 3D07A 1N5AB 5IHUL 2F2HA 3IRCA 4WUUA 3DK0A 3EW3B 2CK0H 4JM0A 3X1NA 2J8UA 4WK0B 5ILTL 1EJOH 2APVA 2LR4A 3N1GC 1OHZA 4Y5XC 1MWOA 2X44D 4H7VA 3T2NH 2XBTA 3GUTB 3AS3A 4WWKA 5EC2A 2CLRA 4UAOB 1ZXKA 2PW1A 4LCWE 1BAFL 1A8ZA 5IB4A 3TURA 1RJLA 1LO3L 4KDTA 4NZFA 4PREA 1ZTMA 5C07B 3GMNB 4M7LH 2Q8BH 3RG1C 3EO9H 3QIUD 1BQLL 3BKJH 3BUYA 2AMUA 1CGTA 4RMSA 3HG5A 3O6MH 1Y0LB 4OKVA 4OZ4B 4FA7B 2NY1C 1U3HB 5JXAH 4YLQT 4ZO9A 2IH1A 1T04A 4L4VB 3W57A 3IJHB 2IAMB 4P59H 1P84J 5FUZL 1PEZA 4K73A 3RX8A 5J1AB 1TTUA 4WEBL 1ZT1B 4IKKA 4NUJA 4RAUA 4HEME 4QCIA 1CL7L 5AG8A 5BOZG 5C6WH 1CUOA 2L7QA 4WFEE 5L2JB 5C6TL 4GEJA 2XBZA 3MX0A 2HUHA 4AV4A 5I9QB 3BZ4B 3VFUB 3LMJL 3S96B 5DHXB 4KROD 1A9BA 4MCZA 1QW9A 3IB4A 1TXKA 3VG9C 2E47A 4JQIH 1ZLUH 3SDXE 1WHOA 2DMBA 3LIZH 1JDCA 3PWLB 3T4YB 2WGXA 3QYMA 4E36A 2CKNA 4R4BB 2D0FA 4XHJD 5B4MD 2AXFA 4B27A 4M5SA 4GLRH 4PP2B 3THMH 3JWDH 2DQEL 3UZVB 1MCCA 4JGMA 4IKIA 1VPOH 4RNRB 2R1XB 3GF8A 4HWZB 2XTSA 1N2RA 4JM2D 1SUHA 3REWB 5D1QA 1QBLL 3ZR6A 1NL0L 2G5RA 5D9SB 5AD0A 1YEJH 1MCPH 1JZGA 4APQD 1H5BC 3EO1A 5K33A 4Y2OB 2LV4A 4X6DE 3Q43A 1MDTA 1CLYL 3L5JA 2ZNXA 1QVOA 2K7QA 3ZX1A 1KCWA 1HEJC 2JI2A 5D7KD 4XWGH 5EZLB 5DMJB 4B5ZA 1NDGB 1TZGL 1WA0X 4HUMB 3W0WA 3EO0A 1A7NH 5GRYA 5DLLA 2CCLA 3H55A 2FECL 4X8JB 2OKMA 1OCWH 3U7YH 1JFQH 4HWBA 4ZTOH 5C09D 4LHUD 3ZDXF 5DHDA 3LS5H 4FGMA 4YSUA 4TQEL 5GSVB 3WO4C 2C9RA 3IDYB 4TSCL 2CE6A 2NSXA 1KN2H 3EZJB 2NDFA 3CMOL 4ZMQA 1TLMA 1NEPA 2Q8AH 3QNZA 3FFCD 4HJTA 3GLAA 3FU6A 3U36A 4R90H 5D7IF 3QDJB 1IKNA 3K8MA 2J6EH 4W9ZA 3FO2B 3ABGA 5F70A 4PI2A 2JKNA 2AQPA 3OR6A 3GMLB 1H3VA 4JREB 3RILA 1ZVHA 4L18A 3RWFA 2R2BA 4PP2A 3BRGC 2YARA 1YSOA 3EHBC 4G43B 5ID1B 3O0LA 2YPKB 3MRJA 1A02N 2RH0A 3O6LH 2H1PL 3QUYB 4BSJA 3SN6N 4AC2A 5KSBF 1CD1A 4YQXH 3P54A 3U6RA 4P46D 4YHOL 3RY4A 3FMGL 4U33A 3PPSA 2VLKB 3GQFA 1CDUA 1I8KB 4IMKC 5C7ZA 4KTGA 3V7AG 1Q90A 3OZ9L 1BSIA 3QQ4B 3QUKB 4E0RB 1BF8A 3JZ7A 4YHMH 5DEGB 1CLZL 1I7ZA 2WNKA 4NP4H 5ICZB 4YAQB 2LLGA 2R9HD 1H9DA 3QFJD 2VLLA 1W0YT 4YHKL 4BDVB 1AQ8A 2WOYA 2NUPB 1M7DB 5L9DL 5FCSH 1CGUA 1L3WA 3NZ8A 3PWLA 3KEHA 1HH9A 2P5PA 1YQVL 1G7HA 2JKTM 5DUPH 2FBOJ 3GMNA 4NN6C 5TDNA 4UYPA 4K94C 3O3DB 4L1SA 2H8PA 4QY8B 2QPUA 3H1ZA 4N0UB 4A7VA 4NIKB 2ICEB 1HN1A 3VWJB 4LDEB 3IMVA 3I75B 1T83C 4WO0A 1TTAA 4L9LC 1QWHA 3NCEB 4XMKH 3RVWD 3SE6A 3ZKNC 3NIGF 2WQ8A 4P2RE 1ZT1A 4N25A 1QA9B 1KB5H 3EJPA 2BIPA 2KS0A 5G5DB 3L6FA 1J8KA 4P4KA 1JPEA 4MA7H 3GIZL 5I1GL 2C3HA 3R0NA 2P8LA 5HDWA 4QHPA 2X4NB 3MMEB 3H85A 1DQML 1SYVA 4TLSA 5FM8A 3GSNB 4DOHB 5GS0H 2DLTA 3FBQA 3EYVA 2NY7H 5JIPA 4M7JH 5G4OA 1SLVA 3C9NA 4YHLH 1A4JA 2W5PA 4Q97A 3MBXH 2VT0A 1PCXA 1M05B 3BGFC 4K3DH 3BE1H 2L4OA 4MBOA 1U8JB 4NUGL 5EUOE 4XX5A 5D7LE 5FYJD 2BRQA 4AQAB 5JPNC 3FU8A 5EFIA 2HX8A 2EC8A 3HB3C 3LNGA 2AQSA 2P8MB 2XJKA 1T7VA 1TCMA 3HZVA 3O6ML 4NO0B 3EOAB 4MAYC 3DX7A 4E9VA 4HUUA 1BV8A 3P4LA 2XC8A 3RTLA 1F11A 1KLFA 3BIAX 4OIBA 3H4HA 1G9NH 1PG7X 5DMYA 2AQ1A 5IMKA 1I7UB 1CICC 3CIAA 2GIMA 1RULL 3JWDC 4R96A 4PG9B 4ZNCD 3RGVD 2VMDA 1QRNA 1FC2D 4IBYA 1C7TA 4M5ZL 4U6YB 3X17A 3QIBB 4UUJB 1B4LA 2XQYG 3MDJA 4Y4KB 4AC4A 2WYHA 1FFPB 3PHQA 1DQQB 3QH3B 3HCVA 4H2AA 4W70A 2J7LA 3B7TA 3INOA 3VFMA 1SXZA 2YEVB 4HWUA 4JLRA 4BFEA 4ZFGH 2IQ9H 4OZFG 4XCFH 2P8LB 3JV6A 1O75A 3P11H 2HVKA 2CLVA 4RQQA 3N44F 3U1QA 1TVHB 3R19A 2NPLX 1C5CH 2NY1B 4KHXL 4HWBL 4QHNB 5KVFH 1SDDB 5T1LA 4ODTH 4JN1L 5EORH 5LHDA 2XOTA 1SJMA 5GGTA 3I75A 3MV9D 4PRID 3HR6A 5HVHC 1W80A 5BRZB 4YAQA 3OJVC 2XWEA 1SY6H 5E8NA 4LCCB 4M7ZC 1MF2H 2DMHA 1CI5A 1J12A 1GSKA 1GYCA 2B15A 2ZF9A 3MRQA 4PJ7B 3ZMRA 5D7SH 3I9IA 2RHEA 3ZT7A 1XH3B 3RVTD 4NQED 1T3FA 4L4TE 1VKXB 3MLVH 4QHKJ 1OSEA 1RVFL 1KWKA 4Z7WE 2R0ZH 5DRZB 5K39A 2D73A 2EYSA 4GQ9L 2OTPA 4MKMA 4HUKB 4LEXH 3C5ZB 3MODL 1FYTE 1T21B 1SEQL 4M3HA 4ZS6C 2P80A 2P44B 5JIDA 3TOPA 3Q8FA 5E0QA 3GHEL 4BFRA 4TSCH 1SHMA 4AE0A 3NUKA 4DO4A 4HEPA 1NQBA 4UI2A 1CD1B 4AJYV 5AB1A 4Y4HA 4FEIA 4PLOB 2D8KA 4M93B 4PJ7A 3GBLA 1OGPA 2N7AA 5SX5H 3V4PB 3WE6B 5I6NA 2WO4A 4KOCA 1R17A 4UZGA 4JPWL 2WIIB 4CUCA 4OD2B 3MRBA 2HB0A 3U7AA 1BQHB 1RV6X 1Z5LB 5E5UB 1RJYA 2QKIB 4R6UA 1M2VA 2R7EA 5IHLB 4LKXA 1J8HA 1FV1B 3S88H 1HXKA 4I2XA 2F18A 3O2DA 3O6LL 3NCJH 1JDDA 1JP5A 2NXZD 2OZ4L 1CVSC 1XGPB 4F9PC 1ED3A 4YQXL 3ARRA 1W8OA 1OK0A 5DHMC 4JZJB 1S9VA 2CK2A 2ICEC 3CXDL 1T1YA 4PJ9D 2ADYA 3OMAB 3HJEA 4UILL 3VQMA 3BVDB 1G6RB 3PJNA 4YHML 1DBMH 1OAXL 1XGRB 1IGIL 1ZANH 3HZMB 5GRVK 3ECUA 4FCAA 1XQ4A 1Q72L 3ZJAA 2FLMA 2R29A 1I1AD 1WFJA 4WLCA 3M1CA 4KV5F 5I71C 3H9HA 4DETA 3CN1A 3DSNA 3FQRA 1XF2B 4MHHI 1YQVH 2DEWX 5E5MA 2P43B 1A22B 3PABA 1FFPA 1DSWA 1T66C 3RFRA 4BWUA 1NJ9A 2P8MA 4FFTA 3DX6A 2Y9RT 3V0GA 4KV5E 3E1ZA 4AENB 1GGUA 1ZIBA 2BOLA 1UZ6F 3DOHA 4P5KA 4DVRL 4ZMLA 1E5YA 3S4SA 3W56A 3GK8L 3K8LA 5BXFB 4IOSD 1I1FB 4Q52A 2X4OA 3W39B 2NY0B 4AUUA 3GXUB 2J1KA 5LXVA 3WE1A 2X4RB 4AW7A 3T3MB 4PLKC 4I7ZC 1WYJA 2UYLB 4KY1L 5TTRA 5KZCD 4NNXB 4F7TB 4OGAD 1F86A 2EAEA 3UOAB 1FBIL 1U8PA 9PCYA 5DJ0A 3GBNH 2NY2D 1CDCA 3FRPA 4EVNB 4ODHH 3GI8L 2WLMA 3QJFB 4ZSOE 4YHYC 1VFBB 3CFJA 4JG9A 4TUUA 4MA1C 3RVXD 1XZWA 3BPLB 4RMUA 3O6FA 1TU2A 1QA9A 4OCSH 3OHMB 5D6DC 4AJ0A 5DS2A 1F6AB 5CXPA 4MQXC 1JNLH 1WCQA 3CHPA 1JI1A 4BIKA 2E7LC 4XE5B 5ALBL 1CU4L 3TV8A 5JQIB 4KXAA 4LEOA 3TH2T 1OSPH 4H44C 4OFQA 4XVJH 5BV7L 1T20B 3ZK0A 2FO4B 4L9LA 5FO9B 4HKXB 2J6WA 2BS71 4OF3A 5FYLD 4N1CA 1OE2A 4FTVE 1SF3A 3JWNC 2P24A 1I8UA 2X6BA 2E74C 3DRQB 3P9WB 4UM9B 5L0QC 3ULVH 2DQCH 4NS0A 3TBYA 3SO5A 2JB6A 2A3TA 3CQQA 4LSSL 2IV9A 4YDIH 4BUHA 4YLCA 1RJLB 2WYTA 2C3VB 3NAAH 3P77A 4G1EB 3OAWA 4LLDB 2IALB 3EUDA 4ODWA 3V10A 5EC2B 3T2LA 3SIKA 3QUMB 3GSUA 1D3CA 1E43A 3T65A 1P5UB 2VM4A 5C08D 5ETUA 2OYLA 1AR1D 1NC2B 5ADOL 2AJYL 2EDEA 2NSMA 5AZ2H 5H94A 5CFAA 4F92B 5I6LA 4AENA 1ZA3B 4XCFL 3CZSA 3LOWA 1RAMA 4RWYH 3UABA 1T2QH 4JY6A 4MWFA 3VFSA 3PAUA 5E2VH 5T1KD 5IMLA 1WZ1H 5D2LE 2DI8A 2YAMA 2ICWJ 4FTVA 1B9ZA 5FCUH 3TJEH 4L8DB 3MJ7B 1AR1C 2EE3A 3LKOA 2OMVB 4HISA 4NAJA 4S2SB 5MHSD 1EEZB 2CCWA 5TE4L 4FQJL 4V1DD 1ZLVK 3MBEB 1D9KA 2CU9A 3L4UA 4QGTA 5F6HI 5TE6L 4HA1A 3WTWA 4I4WB 4KO6A 3O6FD 1MJ8L 4KUZL 1PG7L 1G9EA 3LZOA 5T33L 3QRFM 1S7RA 4XCNB 1U8LB 3WBDA 5CD3A 1IGFH 2PR4H 4E2OA 4OZGA 4A7UA 1F00I 4BK5C 4PVBA 2ZCKL 5CEYB 3WS6C 5J6GA 4Q9QL 5CR1A 3MRRB 3FSAA 1UWEL 3MRGB 5ISZE 1GZPB 1B9KA 2DLIA 3KCPA 1A1OB 3O8XC 4FFYA 1PZSA 4MMZB 4JGUA 1XF2A 4HIPA 2C9SA 5BMFL 2ZAGA 3EZ8A 4YBQD 5C9JB 5SV4A 4Z6AT 3IDIA 2A4ZA 2VLRD 2ENSA 4XO9A 1J5CA 4LCVA 3VTTA 5A40E 2E6PA 4PJFF 4B50A 3GHEH 3OAYK 3DX6B 5IR1A 2YUXA 1JPTH 5DWUH 1E5AA 1NDGA 1Y1UA 2E75C 3VW3H 3AXLB 5E5MB 1J05B 3DO3A 3SCMA 1N26A 2RQEA 2JI1A 3CTTA 3BPNC 1L9OA 2E9IA 4UT6H 1HIMH 3OLGA 3Q13A 5HGHA 2WLJA 4J3SA 1EAOA 4MNQA 4H8HA 1U2YA 4GSDH 3MRPA 3P3YA 1B6DA 2PETA 4O51A 1WBZA 4ECNA 3D7PA 3ULUF 1VEOA 3FRPG 1CFVH 3U4EA 1CPUA 2UWEE 5DVMA 4HSAC 4U6XB 4PGJA 4JO3L 4WKZA 4DQOL 3ROLA 1U3JA 1O7DC 3LVEA 2R2HB 1EAJA 3UAJC 2NZ1A 3MJ9H 3A3YB 1ITBB 3V4PA 2FJUB 2V5SA 5KSAC 2Z31C 2VOTA 3V52L 1AD0B 4D0DA 1MAKA 5I0DA 4OZHA 1SVZA 4JKMA 3FOLB 4LOEA 5C3LD 1J11A 3ZMEA 4HBCL 4PJXE 2XG4A 3KPMB 1E2ZA 3C5ZC 4ZUWB 4IGBA 3MLXH 1UQSA 4DFIA 3COOA 3C6EA 1J18A 3C6LA 1U58B 5EU6A 5F6IB 5FECA 2YA2A 2AV1A 3DRTB 4B9FA 1KY6A 2BZCA 3FYEB 5DU7A 5E9DA 2WBXA 5AALA 1EXUB 2B1AH 3LN4A 4MNHA 3MRPB 4PJ9C 1VEMA 3T0EE 4BZ2A 2HUEA 2XKSA 1OAZH 5T1KB 5F1NA 1G7QB 1AY1L 2DICA 1KFAL 2QHRL 1YEDA 3GMPB 4HYTB 4OH2A 4ZOBA 4YPGB 2BP8A 4IDJH 2E7DA 1QEWA 3UJIL 4QWWC 4N86A 2LU3A 1X5FA 5DRNA 2VO8A 1IC0A 4Q9RH 3VXUA 1LTXA 1R33A 4U7SA 3DJSA 2APFA 3FQ1A 5BJTB 2VWEE 4HZLA 5HGBB 3EF7A 3FTUA 3IDJB 2CNYA 4WSGA 3T71A 5AG9A 1VSCA 3ASNB 3QQDA 1ZT7B 3JVGA 3RPIA 2FT7A 4MMXC 3F5WB 4WNQB 4NKMB 1O7SA 4UZUA 3WIFB 4ACTA 2YC1A 5IMKB 1I1CA 2A9CA 4RVBA 2K3HA 2BSSA 4AQEA 2RJMA 3U0TB 1RSYA 2CWRA 4MD5B 3ZKND 5F7WC 1NCCL 4ZMPA 2YJLA 5E4IA 3VH8A 5IHBA 5LUMA 5D7JC 1HXYA 3MRCA 3D69B 4RDQF 4YPJA 2KH2B 1KDJA 1G0YR 1P9MA 5DQ9B 4M8QB 1T03L 3QSKB 2BMKB 3PWPE 3L3DA 2W91A 5KSBE 1IZJA 1WO2A 3TCLA 1N5AA 5D1QD 5H2BB 3PWNA 2Y7QA 3CH1A 2IMMA 4GT0A 2WSKA 5DJXA 3S36L 4DN4H 1JV5A 5CJOH 1TZ8A 2RB8A 1ZLSL 4PVLA 3AQZA 3N43F 1RERA 1Z5HA 4YSRA 3S35X 3LEVL 4NWUL 3EJZC 1VENA 3DMMD 4L1HA 5F7FA 4W6WB 1CYWA 3G9AB 3REVB 3BP4B 1CGSL 1NUFA 1NGXA 4DT2A 1DEEA 4CSTA 4UTAH 4I9XA 4DW2L 1V7NL 3RHWK 4TVSa 1V3MA 3AREB 5HI4D 4MA8H 3TTSA 3EJZD 1C08A 5AZ2L 4BHUI 1KLFB 3VQ1C 1SEBB 2V9UA 3T6XA 2ICEA 1T2QL 5F7EL 4NO0A 4LSQL 4DP7X 3LTVA 2OJZL 2VM9A 3VGAB 3LHAA 5HJBA 3CU7A 1QUPA 2BO0A 4QF1A 1RMFH 4MA1B 3V6OA 1PLBA 2C7UB 2DQGH 4AWJC 3STLB 4IJTA 3FTGB 4K07A 4KK9C 4N28A 2W0LA 3N9GL 4Y19B 2DYPB 4HT1L 3DOIA 3G5VB 3NH7L 1K9TA 2BSDA 1N10A 2H2PD 1TMCB 4G5ZL 4YVUA 3LQAL 1AZUA 5EUOB 5I82A 2PTUA 3NA9H 3BP6B 4WY7H 1E5CA 5K9OB 3TP4A 3WFHB 3GSXB 25C8H 2YGOA 5IFAL 2IH8A 3M1BB 4P4KC 4OF0A 1KCRH 2C26A 3CZKA 4XMPL 3FO1A 1RK0A 3N1FC 5K9KB 2FD6H 4QTIH 5DVKA 5ACZB 4XR8C 1VFAB 2IAMC 4JM2C 2XV0A 1FNGA 4GKNB 3QQNA 2ENJA 3QCTH 1HI6B 2A9DA 2I7OA 1K8IB 4GKOA 4GFTB 4GQRA 3LX9A 2AV7A 3S34H 2CO6A 1W91A 3JWOL 3DTXA 2CKBA 3EJJX 5SWZA 3SDAB 1UJ3A 2A7BA 1T1WB 3P30L 2H8PB 4QY8A 3K5SA 2JCCB 1N64H 3FO2A 3SDDA 1PZ2A 4DUVA 1UA6H 4G9FD 3S35H 3GSOA 4EI6B 4GXVL 4K71C 1U8MA 5GZNC 5KAQG 4YZFF 3QZNA 4TKWA 1RZ8B 4ANVA 4ZO8A 5DK0B 2BVOB 3PP4L 4M6NL 5E08H 3IEAA 5DRWB 1RQ5A 4TQHA 1UGKA 1OE1A 1FFOA 1R3LB 3SBPA 4GSDL 4TQ8A 4EAEA 3T0DA 3KPRA 3H9HB 1BVOA 4WGWB 1I8KA 2HKAA 4DZBA 1KTCA 3JTTB 4JFPA 3G9VA 2VL5B 4XCCH 4DAGL 1LD9B 3OAUH 2ZPKH 1QHPA 4K9EL 5JIMA 1VFMA 4HPOL 4QRPE 1T4KB 3FU0A 3HEIB 4KPHL 5IMOB 4QRPB 4IS6A 3NBNA 2BM3A 3X12A 4MGXA 3PQYA 4ANWA 2NYYC 2FSDA 1RLBA 3GZPA 5I15H 5F0JB 2Q76A 3AG1B 4AMXA 2A77H 4IK7A 4GY4A 5AKRA 3GLDA 3FOMB 1U8CA 3EBAA 3Q3GA 1MRFL 2Y06L 4TS6A 2PXYD 4TTDC 5I26A 2A73A 4R97C 4N0CD 4EOWH 5EH1A 5B3JE 1M9SA 2DD8H 4JMNA 2FQGA 2CM6A 5D9SA 4DP1X 5B3SB 1M2VB 2R7EB 1T0NB 3L9BA 4ZK8A 1OAZL 4M6ML 2VJ8A 5KW9L 1AIZA 3BP5A 1CXLA 2DIAA 3U46A 3NTCH 2IOOA 4GW4A 1EJ6A 4FERA 1H9VA 5ADPL 1Q1PA 3AUVA 5CJQH 5LAXA 2MPAL 5KAQF 3T2PA 3TXAA 4X0KB 3BVNB 4R7DA 5I73B 2PN5A 3QZWG 1RJZA 3BT2H 1NTDA 3MTXA 4Q9RL 2PYFB 1K8DA 2NW3A 4AYBA 5C0RH 1J9QA 2A9AA 3V6FA 5TFSH 1OM9A 3M46A 2QPEB 2X4PB 3KXFE 2Z91B 1YLBB 1HAWA 2O5ZH 3GS4A 2AJUH 3LPOA 4JM2A 4KRLB 3RVVD 3TWCH 5DF0A 3V55A 5AAMC 1QVOB 4JFEA 5DD3H 2CIIA 4Z7QE 2ALWA 3D18B 5I8KH 4PJEB 4RFEA 2EDNA 2WZPA 2XYBA 3EAKA 4F37F 3FQTB 1K8IA 2LFGA 5B4MC 3I9GH 4MJJA 5GJSH 1KXHA 1U8HA 3FN9A 4R2GD 5ETUB 2Z7UA 2V33A 4IW4C 4FFWC 2WXGA 2Z6FA 2Y72A 4LPUA 3MRHB 4ADIA 4AZUA 3HS0A 1JAEA 3VFRB 6FABH 1FE8L 1HOCB 1YEKL 4IRJA 1E4XL 4U1IB 4HKZB 3M17B 4R4BA 1ZT4A 3QG6A 4WWNA 3ESUF 3GSVB 3QGVA 4ELMF 5IVXB 1YEHH 5BV7B 1P53A 3B2DC 1OAUH 3IGFA 1UJTA 3ZVVA 4GRLC 2HKFH 5GGVY 4MMXA 4CNIA 3STLA 3I50L 2P3YA 5GGSA 4EUPH 1T7ZA 1HZLA 5IHUH 3HS8A 5CD5C 2H41A 1G4MA 1KGCE 3LPPA 4U1JA 3GRWH 5EUOA 2PW1B 1HESA 1HZKA 1XF1A 4UNTA 2FECI 2BSBA 1CXKA 1F90H 3HVNA 5KSVA 5T3XH 5CLYA 1AZBA 3BN3B 1VIWA 4WENB 5AVXB 2EO1A 1MNNA 1CG9B 1IGMH 3RL1B 4CL7A 3Q6FA 1IARB 3SOBH 4XBEH 3RX5A 4XP4H 2G0KA 2E9BA 2EKJA 4WHTB 1NFAA 5DZNA 2VMJA 4Y4HD 5GS0D 1ZEAH 1BFOB 4TUOA 5C6PB 1TQBC 4HT1H 1V8HA 1DQVA 4PJ9A 4N8UA 5I73C 1DVUA 4UBDD 1KV3A 1QPXA 3PDGA 3UTPE 2WUBL 4QNPF 3PUCA 1VGKB 4HJGB 5FKAB 43CAB 1NBZA 5MHSE 4YX2L 3ZUCA 2WPGA 3MUY1 4RDQG 3DECA 5CMAA 4IHOB 2Q3XA 1YNTB 3QBTB 4PEEA 1GS6X 4DJMA 3H42L 2Y7NA 4LSVL 2ED7A 3JT2A 4HIEB 2YQ3A 4WO4A 1CICB 2F53D 4GO8A 3WY3A 1I7TB 2Y7MA 3E0GA 2NR6D 4F9LC 4OCRH 2VH5L 1I3UA 5C08B 4GUQA 1J5DA 1FYTD 4TF4A 3IU4H 1JV2A 4WEBH 1QLFB 4KOBA 3BYTA 5DURD 5FGCE 1UCBL 4H2CA 4UQBA 5BO0D 4HOMA 3FFCB 3B9EA 4IIQC 1CTNA 1GY2A 2HRPL 2H6PB 4X9IA 3IGKA 1ZHBA 2NUTB 5HI3D 5BJTA 1A6AB 4G8IB 4A2MA 1KZYA 3VGAC 2CQVA 2FO8A 1EGJH 4JKLA 1W8EA 4K8RC 4A63A 2Q76B 3O6KL 2DWDA 1R6VA 3MRIB 1KXQE 1QEXA 2BVPA 4NOBA 3MI6A 2COVD 4KKAC 5KANG 3GB7A 3EGDA 1LK2B 2VE6A 4PWHA 1YYMH 2XIIA 3V5KA 2BSTA 4LPXA 3IDJA 2YGPA 4RRPM 1NKOA 2K70A 3GBML 4Y16C 1YA5A 3B8YA 3M07A 1QBLH 5B1AB 3T0VA 2XWZA 3ZYJA 4GP5B 4A7QA 5MEQB 1SLWA 3MRLB 2X38A 3HE6B 3WKML 1TJGL 3ARPA 3LYRA 4M9PA 4PJEE 4E42B 4HPYH 1LL1A 1HEHC 4U6VH 2D2OA 3B9KA 4BINA 2OTWA 5TH2A 5HHOE 1KN2L 4HJJH 5AVVB 3V0WL 4PSRA 5I76B 3IRPX 2HJFA 4EZJA 1SXSA 4LLVB 4ORZC 2Q8AL 5HYSA 5GRJL 3LN4B 4MNHB 4Z7AA 3TA3A 4RMTA 2BZ7A 2W9DH 3CFDA 5DLMH 4GUPA 2F68X 3V5HB 2EEAA 4FYQA 3F7PC 3KVDD 3GS7A 4TUKL 5EWIL 3LV3A 4F1ZA 4KXBA 3VQ2C 1IEAA 2R2CA 5D2LF 1WWBX 2Y2YA 4FHBD 3B7YA 3I6LD 2IC2A 2AJVH 5L4MA 5G4NA 4JFUA 1QP1A 4UB0H 3RNQA 5C0AE 3I2CL 2IG2H 2K6ZA 3B9AA 2HFEA 1QLFA 2UVEA 1SM3H 3CU1A 3BT2L 3PE9A 4ISVB 4K9EC 1UOVA 2ZXGA 3GMRB 5CINL 2YGQA 2PNDA 3T0XA 2BVPB 3SQOL 4G9DA 3W37A 4ZNEA 1IGYB 1KBVA 2NTFA 2WNXA 1WK0A 4WU7A 4AIXA 1LP9E 1UVQB 2WJ5A 5TQ0H 4IBLT 1XR8B 5D5MA 4XNZC 3MZGB 2UWEA 3EJRA 2IANA 3SGDI 1BBDH 5E1GA 3WKPA 5IEHA 1ZS2A 5GGRA 3C09B 2HVJA 2W0FA 3ZOAA 1HWGB 3U4KA 5DD3L 5FWRA 5G2NA 3CV5A 4Z8FH 4B6ZA 5I16B 2OL3B 3UBHA 5FM5O 3VFGL 3RGHA 1F3JB 4QRRE 1TCRB 2C3XA 4HIEA 35C8H 1JHTA 1WHPA 3MRIA 5DJCB 5ENWA 3ULUE 1NCTA 3Q2CA 3PGDB 1A7RH 3S8FB 1A7OL 2LFEA 2VDNB 5CMAB 5J6GB 4N90D 2DQHL 4Y4KA 3MCLH 3Q8CA 4PJ8D 3C8KA 2ETWA 4DP8X 1DLHA 4ZO7A 1BQSA 4WWOA 4Z23A 3H3BC 5F9JB 5AD0B 1OGAA 2IDFA 2JKXA 1OP5K 1T0MA 1YCSA 4LOUC 4H0GA 3BSZH 4X5PA 4FD0A 3VGDA 4C4KT 5EA0H 1T66D 2BNUB 2K8MA 2C1OB 5BZWA 4PGDA 3I02A 4B96A 1MFDL 1OQXA 4LSDA 2XV6B 4H26B 1NMCC 5EV7A 4C56E 3HNVL 3DTDA 3JTSB 1X6NA 2WLLA 2GTQA 4LPCA 4P9HH 3HB3B 1LYQA 5GISH 1EHNA 2NNFA 2HWZL 4Q56A 1C5BL 4N0FB 5C0GB 2QGCA 2APBA 3WNPA 2ITCA 3OKLA 2ZTBA 2WUCH 4HH9B 1DBKL 4YMPA 1HL8A 5IT2L 4N2FA 4XMZA 1FNEA 5BUPA 4YHLL 1FCCA 3FTXA 3MRDB 1MQKL 5JA8B 4E9TA 5M95B 3RZCD 3F8UB 5DC4B 5B22A 3ZIMA 5AKTA 2V8MA 2FVNA 3D4YA 3LZNA 3QIBC 1Q0XL 2IALA 4I13B 1EIBA 2H1XA 2AXGB 2OX5A 3FQWB 4LL1A 3DXAD 5L4JA 5F7AA 3FFOA 2MKLC 2MH4A 3KWXA 1JZ6A 5HI5D 1I85C 4NQXB 5J12B 4OCWH 3BAJA 3MKKA 1G9NL 3AFLA 4XI5D 1BZQK 4L05A 2ITFA 3MAWA 3QRLA 3S2AA 2WLNA 4NBYB 4P8QA 4TM9A 2NUPA 4BEIA 4BQ8A 2CBTA 4NQVA 1NBCA 1QZ1A 4EKXA 4ZFFB 4ODWB 4WI3A 2WWKT 5A7EA 2HPOA 3HB3D 2OMTA 4EQ3A 4Z3HA 1D6EA 3CVCA 5BZXA 3KPQB 1JCVA 3TL5A 1F3DJ 4NUGH 1Z66A 3H42H 4XNQB 3SDXA 1CD8A 3LKRB 1JD9A 5ISZD 1MHPH 3Q6GL 4AGMA 3BCDA 5JDJA 2GI0A 3OXRA 2WWMD 2IEPA 4I9WE 5D7LA 3ZDYE 3F6IA 3QJFA 1MAML 1SF5A 5BZDA 5EO9A 3TTYA 2OX5B 1KCLA 3FQWA 3II2A 1IL1A 4HIIA 4XWOC 2B0SL 3K0YA 2VLRE 5CNHA 4KK8C 5A2IH 3WNNA 3C5XA 1G6RL 2ORBL 5I8CB 2ED9A 1PDKA 3QZMA 4JFYA 4N8VB 1YUHA 3L9EA 4YIQB 4ZXBA 2AQ2A 1QYGL 2UZIH 5K1JA 4P5SA 3FUIA 5CSBA 4AH2B 4JQXA 7PCYA 1ZV9A 3KYOB 4HV8B 1IAMA 4J3OD 4JPKL 1ZSDB 5KOMC 4XPTH 1G9MC 3WI9A 3FUEA 4DGWC 4LFHD 3DC0A 2AK4D 1CLCA 4DKFL 3WN6A 1QSED 2DQIL 3APDA 1EEYA 1DVYA 4WTXA 3ZGIA 4MNGE 1FL3A 2QGEA 3HN5A 4GAGL 2WNGA 1C5CL 1WICA 1NGYB 2DQFA 3WEXA 5HY9B 3Q2VA 3UBGA 4PLNC 3ZRFC 4AW4A 4MNQE 3MV9E 1L9QA 3ARXA 5FB8B 3HMWL 2EO9A 3MRNA 1HQRA 3NFSH 5CEZD 5EDSA 3OLIA 3MV01 4FI8A 4OF8A 1MHEA 3G6DL 3ARBA 1UWXK 5AW8B 1PFOA 4Z76B 1XGTB 1O6SB 2DBLH 1IM9D 1MJUL 4FXKC 4Z7IA 5IB3A 2FR4A 5DJCA 1UXSA 1KTLB 3DX0A 4IGBD 4YSQA 5E2JA 1NDMB 3O3AA 1U3YA 2XU9A 5AQ0A 5TPWH 4HJ0C 1IQWL 2R0LH 3J07A 3BP5B 1K5NB 2OTUA 5KG9B 3V9EA 5D2NA 2WXMA 4U0RB 2FUQA 3BPCB 3D50A 1CL7H 4WW1A 5BRZE 1HINH 1ZHLA 2NX5A 2OXHA 3QHZL 3VWJD 2AJVL 4JFQA 4KXCA 4TQPA 4DKTA 3AAZA 3EGXA 1P7HL 2QPSA 4P23B 3QFDB 3K3QA 4NDMB 2ZCZA 3VXNB 4FADA 1QLEB 3L5HA 1PY4A 4QJ3B 5IW1A 1MHEB 3MZTA 1SOQA 5MI0C 2CXKA 5D1XD 3OMNB 2DKSA 4U6HA 3CXDH 4OGYL 4PGEB 3QFJB 1AMYA 4OFDA 5C0DB 3N06B 3NIFB 4BE6A 2CO1A 1J8HB 4GRMB 1QTSA 1A3RL 2BC4B 2Y7OA 1SDYA 1G7IA 2HSIA 3VD4A 4B0MB 1L7IL 4U1LA 3LEYH 3NZUA 3QUML 2DLEA 1SXCA 2BOBA 4AM0B 5AVSB 3TA3C 3EJSA 1DUZB 2ZWYA 3RBSA 3DXAA 2NX5E 2WBWB 4W9GC 4WV1C 5DC9B 1NL0H 4I18A 4P46B 3ATEA 3D3VE 4DUXA 4NT6A 3P4MB 3LCYA 1FHGA 1FLRH 1E5BA 1MI5E 4LQFL 4XBGA 1T3FB 2C4FT 1KCSL 4XWGL 1W15A 1YUHB 4MJ4A 3UCRA 4WZ9A 5EU7E 2KLSA 2MEJB 4QRQA 4PLJC 4QEGA 5IV2A 3CSYB 1QR1B 1NPNA 3R06B 2F5BL 4NC1C 1V3LA 4MXQC 2SEBA 5JYMA 1K2DA 4YDJA 5F1IA 3FFCA 4MJHA 1T6WA 2XZQL 2F8OA 5F7BA 1KXTB 2ATKA 2G3XA 4X7TB 3DMMA 3GXPA 2CO7B 4ZI8A 4NQXA 4RAHA 2GG1A 3GT6A 4WUUB 4PLJD 1P4LA 1OM3H 2F54E 1DBAL 4CMMB 1C5BH 4UYQA 2JJTC 1YAIA 3CMOH 3U4BH 1RFDL 3D85D 5AAWC 4PJHF 3F7KA 2DJUA 1KXVC 3EG9B 4ONGL 1UA7A 1A7BA 1EJ8A 1JK8B 2HA1A 3MNZA 4LBAA 4J1UA 2DMGA 1JRHL 3MXVH 1RZ7L 4F7PA 4NFCA 3JUZA 1Q0XH 1ZA6B 3IDGB 3WIAA 4LASH 3BP4A 3ZIYA 4E68A 4U6YA 3NPZB 4EVNA 1FJ1B 1JNNL 3QRGL 1TYRA 2FHFA 4OFYA 2HFGL 4H8QA 3FUHA 4UANA 5JNYA 1T4WA 2ITDA 5TDOA 1S7QB 2PTVA 3NSYA 3D0LA 4F57H 4PWIA 3ZZSA 3B3IB 4QTHA 4D2NA 1GGBL 3BUPA 1HXYB 1MCRA 3QXWA 5IB2A 5LNDA 3SGDH 4MQXD 3AJ7A 3V7MA 3L1OH 2YAHA 2YBRA 2RFXA 3U1SH 4AYGA 2CNZA 4LQ1A 4M8VA 3Q1EA 3SDCC 3OV6A 3P9MA 2HAZA 5CUSH 2VDKL 3TCLB 1IBYA 2Y5EA 3U25A 1QQDB 1PVHA 4YSAA 3NT0A 5FDWA 1SN0A 3HPLA 3PFUA 1OPGL 1ZVYA 4YXHL 2R27A 3W0WD 1A4JB 2ZG3A 2Z8VC 3BDBA 2QFRA 3GGWA 3QFGA 3QUZD 2X1OA 4ES9A 2FX8L 1ADQL 4XRCB 2F8IA 2AK1L 1CFNB 2AMGA 5FA3A 3VXSA 2D03L 3QQXA 1LQBC 4Y1AE 3HZVB 1F4XH 5LBSL 1E9PB 1S7QA 1E4KC 4FQXD 5DMKB 2WINB 5DUPL 3TPUB 2F7IA 1RH8A 3DGCR 5HVFB 1AO7A 1ZK5A 3BAYA 4ELME 1QYGH 2UZIL 1XB3A 4OJDH 2YKLL 4CAGA 4CC1A 1KEML 3S37L 3TN0B 1MVUA 2CPUA 2ZUQC 3N5AA 4R7LA 1V7ML 2BH0A 4BZ2H 1XCQB 5AW9B 3R7QA 1EERB 3UMNA 4PJBA 3SO3C 4FLHA 2HVJB 2IAMD 4XMKL 5JMRA 3KLDA 4J5VA 1PG7H 2CH8A 3H0TA 3HNTH 2R59A 3O9WC 4PVMA 3UAAA 1U3HD 4TXVB 3BKMH 3VYPA 2CRMA 1E42A 1IUZA 3OKNA 5I8OH 3BGAA 4HLJA 4C57C 4YBHA 2R8SH 5GGQH 3H7BA 4KKLD 3LKSB 1BLIA 5DFVD 4I85A 2QSQA 1L6XA 4JDVA 4OZGF 3F7RA 2X2UA 2WSPA 1G5AA 5E1HB 3FT0A 1PFCA 4AVHA 4G8AC 3K4DA 1PL3A 4XMTA 2AJ3B 4IYKA 1IKOP 1EH9A 1KFGA 2R2EA 2NT1A 4U1LB 2QQLH 4K3DL 4KUZH 3VW3L 2R9HC 4GXUM 1KIUA 5DVLA 4LB8A 2XKNA 2CO7A 4XHJC 1HH9B 5LJYH 1JMZA 2Y36H 1BOGA 2APXA 2EEXA 4OBRA 1AGFA 2ZCKH 2HX7A 2SEBB 1O5DT 2F8VA 1UHVA 1HWWA 3HG1A 4UT6L 5SWSE 3HE6A 4NQSB 4W9CC 3RFZC 4BGLA 1J1XH 1Q8MA 1A6ZA 1VLXA 5AAMA 5TD4A 5CP7B 1D6VH 3AXLA 2R2BB 2R1YB 3EADA 5E5LA 2CHWA 1LHZA 4Z7WA 4JQVA 3KLSA 2VXVL 3QJXA 5FKPB 5E03A 5F89A 3HRPA 5IR1B 2N1KA 2ZT9C 4M8RA 1N9PA 2ADIB 4PWFA 1T0OA 3V0IA 3WNJA 5DD0H 2ICCA 1O6VA 3D51A 5JOPE 2B9AA 3L13A 2LU5A 3I6LE 5GZOA 1SXAA 2K45A 4F5CE 5I18L 1MW3A 2ZUTA 2F6AA 1RSFA 1WAAE 3AMKA 3E2HB 1S9YB 1L7IH 3LEYL 4YGVA 3GMLA 3B37A 5M94B 4JW3A 1E3XA 1U6AL 2XQBL 5C08E 3U9PL 1Q9KA 3HG3A 1U8LA 3PHOA 5J12C 4ZUUA 5EU4A 2VE6B 4FQIH 4TULH 5IMOA 3P0VH 1U4EA 2ICWB 3TBTB 1UACH 4NCC2 3CLFH 1A7PH 4KTEL 3AABA 1TQWA 3IE4A 5E51A 2B1OA 1R19A 2DLFH 1J88A 1DL7L 1LEIA 3OLEA 5EBWB 4J12A 3BDYL 2YK1L 3KLAA 4ZUVA 1KCSH 3AB0B 1A4BA 3OZLA 4K9JA 4R97B 5D1ZD 3H2QA 4L4TB 5EU3B 2VN4A 2FATH 3UTZA 1RIVL 4GG6E 2LU7A 1WVZA 4M02A 4MA3A 4PJEF 3TIEA 3ZRCC 5CCJA 3UDWC 1JGUH 2WTPA 3QIBA 4ODSL 3V4VA 2V2TB 2Y69B 4MJ6A 5C08A 1IQDA 4N6RB 4I18C 3N1MC 2X70A 4QKTA 1LMKA 4JO2H 4V33A 2FBRA 3VD1A 5BQ7B 3L95A 4JO4L 1DBAH 4PRIA 5MENE 5JW5B 3GM8A 2QQQA 4EI5C 4AY0A 4LARL 2BIIA 4WGKA 5ABDE 3ZZQA 3AS0A 3TJHD 3QE5A 4PB0L 4JG0H 4AUJA 3UTOA 1JDAA 5A2JH 5H4ZA 5FR3A 2G30A 2BDNH 4XNQA 5TF1L 1ORSA 4PJ9B 1FVDA 4I1RA 5EOTB 2WO2B 1XAKA 1RK0B 5E0FA 2FJFB 3BAXA 4X2UA 5KJ4A 4JAMB 2E59A 3UC0H 1M57B 1EDQA 3LAFA 5J56B 3QORC 4N20A 5IQ9A 4UU9A 4P3DA 4BUGA 5C07E 3S36H 1TQSA 2BNQA 2B7DT 3ESOA 4EN3D 1SMOA 3AGWA 4F57L 1BCIA 4NUJB 3NFPA 3KH4A 3QR0A 4KNTA 5D7JD 3D4GA 3X1EA 1OW0C 2HRGA 5GGSB 2W60B 3CFMA 1KN4L 4OJEH 3BH8B 1OB1B 3L3IB 5JIIA 2HT3C 1GC1L 3MUGB 4HIHA 1NM9A 1JFHA 2BHUA 5LBGA 4F93B 4HGWB 1MRCL 1Q0YL 5F3FA 1ZANL 1HOCA 4K7PH 2WGNB 4TSBL 3MRDA 2W9EH 1G7PA 3RRQA 1ADQH 3IJHA 3TO4A 3WAKA 1KXVA 1J0JA 3G5XB 5DHYB 4MQSB 5F7EH 4TNVF 1FZKA 3KPNB 4DN4L 4LCIH 4Z7QB 3MV7A 1GHFL 1LWHA 2EYTB 2JE8A 5LGYA 5AOJA 4QRRD 1MFUA 2CD0A 1IKFL 4ADJA 4DGVL 4BCXA 2UZYB 5D93C 3KPQA 1NJ9B 4PJ7F 2MCG1 1AC6A 1MSPA 2GJJA 4PBXA 4KDWA 3T08A 3W2DH 4KTDH 4RAVB 4WV1A 4BZ2L 1CGSH 4G8GD 3LB6D 3WSQH 2WN2A 4GKZB 3KBPA 4MVBC 3HNTL 4NGHH 4J27A 4WTWA 4JKKA 2EVGA 4K5NA 2XFXA 1QLEH 4L1BA 3OKLB 4CKVX 1BYOA 3AQXA 1CR9L 3U6RB 2Z7YA 1SJXA 1BXUA 1OAJA 2IGLA 3ZHKA 4M8QA 1KEGL 3MLSH 4PRIB 1GZHC 4DHLA 2OJZH 4LSUL 3CNKA 3UJTL 4P9ML 1K85A 1SUJA 2WXQA 4D94A 3FQ4A 2GCYB 3DGDA 2GT9A 3T3PF 3Q8BA 5SWZD 5GS1A 1S3RA 1JV5B 4M61B 5EZPA 5GRZA 2XWBB 3U46B 1CMOA 4CVWA 5BXFA 1UH3A 1WUZA 4WI6A 4OCSL 4PJ5A 4WJKB 2VYRE 2BY2A 4ONFL 2ZWZA 4FRWA 4F7EA 3UTZB 5KYYA 5ALBH 5FYKD 4ZUUB 2JJTA 2E7HA 1OP3H 3JTBA 1KIQA 5K1NA 3LMJH 2Y22A 4HUVB 2BNUA 5HHXH 4JFZL 4NZRH 3O81A 4JO1L 1OT1A 1EANA 3NCMA 1P4LB 3LIZL 2YC1B 3I3BA 2J2ZA 4ABVA 3AQYA 2PWDA 2LTQC 1F58L 5KVDE 3E3QE 4Z7UA 4G6JL 4JNXA 3IVKA 3L17A 1A6PA 2A6KB 1AD9A 1WWAX 2R0WH 4G8GA 1HILB 2MIZA 4NUPA 3S5ZA 2CIKA 5EIIG 1FQ9C 2H0EA 2AV1B 1KV7A 1MLCB 2OR9H 2J4WH 1OTSC 3DRTA 1FVEA 3NZSA 4XTRC 1SDAB 2CHDA 1FUNA 4XB7A 4KRPD 4G8EA 5I18H 1VADA 2G3ZA 4HWEL 4QHMA 4G9DB 2XN9A 5DK0A 3NACH 4KO5A 3ILEA 3SDAC 4MNGB 1LDPL 1ZE3H 3BLKA 1LO5A 3D39B 5E5RB 5E8PB 3MXWL 5I24A 4PTTB 1EBAA 5EN3A 4P2QA 2DD8L 1RUMH 3KR3L 1QSEA 2BXYA 3DXAB 1R47A 5DUBB 4XCYA 4IKLA 4WU7B 3P0YL 2AQTA 2OAAA 4GP4B 4JJOA 3TVMA 2CG9X 5E6UB 4KPHH 4YEEA 1KELL 1YC8A 1FZOB 5FUCC 4LLVA 3T0BA 3ARDC 3MKGA 4PGEA 3LDBB 2G75B 2QDVA 5E6IB 4GKLA 4X99B 1SN5A 3IJEA 4UIKH 1UWEH 2VLRB 4NRXB 3NCYP 4KNQA 3VD2A 4EMZA 2P5EB 4OI7A 4FFVD 4GSUA 2NUTA 3QXDA 4YNYA 3FCBA 5E2WL 2ATPB 5F6HJ 2AJUL 3ZYIA 4PTTA 1WFNA 1RI8A 3FHEA 1BFVL 2E46A 1V3JA 2A74A 3BO8A 2YOAA 4PJCA 2E5EA 5ACZA 4JKPH 1E7UA 1E4WL 2GJ6E 2MCMA 1OO2A 4KROC 5CJQL 1THAA 1REIA 2OQJA 2G60H 1KJMA 1F4AA 3MLTB 4C4KO 1I8IA 5I6OA 2IV8A 5E00B 1HILA 4TNFA 3FPXA 4QT5B 4LVNC 5ERWB 2BNQD 3IGLA 1NCWH 5GGUB 1ODAA 1LDSA 2BERA 5I19L 5D5MF 4RGMC 3FT4B 4J3OH 4LP5A 4WI0A 2H1LM 2X0UA 1CLZH 2BINA 1UYWH 1SQ2N 4NPJA 3UPAA 3ZDYB 3U9UA 3RTQA 1THCA 4ELDA 1GYWA 4YL9A 5FUCE 5C1MB 2VN3A 2NXYB 3D8MA 5GJTL 3T8MA 1IEBB 2TRYA 3RZCA 1NWOA 4LCUA 3TCTA 2Q0ZX 1CE1H 2V9TA 2KZKA 4TOYL 4KKBD 4F8PA 5TDPA 5DQJB 3RL2A 3VXRB 4XH2B 1LQSR 4PI0A 1SHXA 5D2LA 3HCVB 2AAAA 4K7PL 4WUKH 2B4CL 1RZJH 1A6VH 1PLCA 1U0QA 3K6OA 2I9TA 1BDYA 3OF6A 4N2OA 1QQDA 5CGYD 2BK8A 1S9WA 1WTLA 2QGBA 4P2RA 1G9HA 2VMEA 2XWBA 3CFTA 2H2SD 1I7UA 3D33A 1DVSA 2CHXA 1GVIA 5I0YA 3CC5A 4Q6IA 2X4QB 2CR3A 1IKFH 3HFMH 2WWKO 3KS0J 4GBXA 1JD7A 4PTUB 5GRXG 4Y9BA 1UKTA 1E9OA 2ZUWA 3U79A 4M8UA 3RWIA 3VA6A 3RLSA 5EO9B 3W2DL 5H35A 4ZMWA 4CNIB 1K6QH 3NIGB 2F9BT 5D6CA 1BD2A 3LXBA 5IF0B 5HI4C 3DMMB 4UAHA 3UTSD 3WU1A 4AJWA 2QKIC 5C8JA 2D3NA 4J1UB 3GSVA 3MGTA 5FK9B 3ABLB 2MHAA 3G6AA 4RIRA 2XQYK 5SX4H 4L4VE 5T5NF 2NZ9D 4URTB 4JM4L 4FULA 2V37A 3EYVB 3WIHL 3PS6A 5JHMA 2DQJL 3L3KB 4MAYD 1QEWB 4PYGA 4PJHE 2E7CA 1FWXA 1S46A 4UV4L 1MCLA 4YDNA 4OFPA 2VITA 1M7IB 3QZBA 2JV6A 4WFED 1D9KD 3ALWA 3N40F 4Q6KA 4RMRA 3ZL1A 2G9KA 3FN0L 2QV2A 1KF9B 3EYOB 3LRLA 4MNQD 3FCTB 2BHYA 4H5SB 2PWGA 2CIIB 3LZFH 1U3HC 2X9WA 1P5VB 3KYMA 2YZ1A 2FIRT 4X9BA 1P7KB 3DA0A 1PNCA 1TLKA 4NXKA 4Y1TA 1CO1A 5GZOC 2VSCA 4QMEA 1BQRA 1G7MB 1CGWA 4ZTPH 4LVOB 4WGVB 1OT2A 3RKDC 2Y0SA 2YD8A 4GI9A 1WA2X 2IDCA 3QUYA 4FC3E 1I1AB 1CIDA 4HHAB 3VD0A 4U1KB 1VFUA 3P9LB 3VXRD 4X6DA 1R46A 5JHBA 2NQ3A 1ZTXL 2APTA 3D18A 3RWFB 2LT9A 4FP8H 4TN9A 4AE1A 1YMMA 4ZMNA 3IU4L 2NZIA 1GOFA 3LXCA 4TVUA 2I60H 2XVLA 2WVTA 4E5XB 3RHWF 2FDBP 3FL7A 4ODTL 3SKUD 3ZE0E 3HAEA 1IFRA 4GSQA 5C0JA 1SQMA 2WWOA 3W0WE 3TV3L 2VERN 3UO8B 4EN3A 3ZSSA 1SY6L 3FSWA 4MA3B 2EE9A 5FHAH 1CLOL 3UDWA 1L5GA 1TKWA 2BW5A 4I3SH 2VLJE 1QFWH 1OL0A 2GSMB 2ZCHH 5E99H 4X7SH 2ZXBA 2EIJB 4MX7A 3EGXB 3MXWH 1F2XK 3HG1E 1UM5H 4LO9A 2CDGB 4W9JC 3BRDA 3PNWA 5C97A 4RLDA 3V9CA 5HJ3B 5A2AA 5JXAL 1MHHB 4N1EA 1E2VA 4MMZC 1XF5B 2PW2B 1KACB 2R0ZL 3P0YH 5H37H 4AYFB 3WTVA 2V2TA 3MRNB 4QKXB 1BFSA 2FE0A 3NH7H 5E4EB 3ENEA 2HTKD 3O9WA 4WW2C 2HPTA 1OGTB 1RK1B 5DSCB 4YWGL 4FABH 5JOFA 1O9ZA 3OG4B 4JX0A 4DIXA 2EXWD 1ACXA 5JPMB 3ABKB 1DLFL 4FX5A 4UIKL 2FB4H 2X1PA 1TETH 4MJ5A 2KQMA 3ISYA 5GGSY 2G5BA 1F97A 3VWJC 5DFTA 3P9LA 3O4LD 4LOFA 3H3PH 4K2UL 3R18A 3N55A 4R8WH 3CPLA 3PLYA 3THML 3RDTA 3ZU8A 2GK0A 1IE4A 4Z77B 1IEAB 4Z8FL 1HHJA 2CJUL 1I4FB 1EHAA 4TSAL 5EBLA 1IBHA 2I9LB 4HCIA 1MREH 2EC9U 4Y9GA 2Z4TA 1NFKA 2X40A 2FWOB 5BRZD 5G4MA 2OZ4H 3BZFB 3GSNH 3Q0HA 3V4PL 2XVKA 2ZE0A 3UPCA 4QRSA 4DZ8B 1AR2A 4JM2F 4BFBD 3IJ8A 4R2GB 3IETA 4QLRA 3NIDF 5FGCB 3ULVD 3BWZA 5KVMC 4AGOA 3A21A 1T89C 4CMHB 3DARA 4XC1H 3K6SB 3APMA 4FTVB 3S2CA 1E28B 4XCCL 4DN3L 4F8OA 4NC0B 2XPGB 3RIAK 4N2DA 4H5SA 2NYKA 3EH5B 2D4DA 3LH2H 4LKCA 1A7NL 3WKYA 1OOAA 1MFDH 1DJZA 2QR0A 3VFGH 4MJIA 2AQNA 1AGBA 3RWEA 4D8PA 2LVCA 4HIXH 1HI6A 5KVGE 1AS7A 1LK2A 2EIZB 3HNVH 1QWUA 2XKNB 4P2OD 4JFTA 4XXWC 1FRGL 1UEYA 2XBDA 1L9TA 4POUB 1AZNA 1HSBA 2A77L 1OANA 3QORD 4PQXA 3PGFH 5FO9A 3TO4B 1OAYL 2X53A 1GXEA 2Y06H 5K93A 3ILQC 3DVNA 4OV6F 4HUXA 4PJDF 3WFHA 3EOTL 5FM5M 4YR6A 3WIHA 1Y18A 4FLOA 1TJXA 3W11D 1N70A 3HFML 5CWSA 2EDXA 4OLVL 2E7LA 5HHOD 1Z7JA 1AKJD 1WAAF 1XZ0B 4OCYL 3ZL4H 2OR8A 1QWNA 4YS4A 1BD2D 3MN8A 4N0FA 3D4ZA 1F6FB 1UXWA 2X88A 3R7RA 3HFFA 2I69A 3IXAA 1X5YA 1JNHA 2W9LA 4LSTH 4OCWL 4NPYB 3QNFA 1BM3H 2NY6D 1JSYA 2Y2WA 4PRAA 3ZKXB 4GS7C 4N5ED 3RWJA 2ZX9A 1EAPB 4BBWA 4ODHL 2ILLA 3GI8H 4CBZA 4YHOH 5IVXF 1L0XA 1A9VA 3X11B 3PWJA 2XTJD 4YVNA 1DYZA 4HX1A 5EFIB 1N6QL 5E9NA 5FGSA 4E9YA 2IANE 3US9A 2NQCA 1JNLL 3OF6D 4QF1B 5A6MA 4APXB 5DMIL 2CXGA 2FWLB 3C8KB 3C9NB 4NI3A 4NP4L 1IAOA 3KWUA 4CRPA 4L5FE 1J8HD 5IVXE 5A2FA 5C0CD 4YHKH 4XO5A 4C83A 4CU7A 4HCGA 4FJZA 3FQXB 1QOKA 4LDLB 3T1FB 1KYUA 1NMAH 2CRIA 1ERNA 4MDRA 1GZQA 3QDMD 4OLZL 4PV1C 1U33A 4GG8A 4D9LH 2EUZA 3D5OF 3K2UL 2JCWA 2WANA 2O6EA 3NAAL 3K6DA 1TVBA 2OMZB 4HALA 5LN4A 3DSFH 6FABL 3PWUA 3V0JA 5DMGC 4MBRA 4UTBL 1LILA 1OP4A 5EC1A 1ZJBA 2JKJA 5IEHB 2C9AA 3AMLA 3GSNA 1JHTB 4GB9A 5ADOH 3T8XB 4CMHC 1U8KA 3HR5B 3KDPB 4M6AA 4HUXB 4MZIA 3HUJF 3D52A 4B9ZA 4MRCA 4W4OA 4KDTC 5J1TC 1ZLEA 2OL3A 5EN2B 3SDYH 1TTBA 1QATA 1UM4H 2CKBH 4GAGH 3VFVB 4G1MB 1M7UA 3FO9B 3QA3A 2DYRB 4F7PB 2VW6A 3O9WD 4WNQA 1GGCH 3U2SA 4HSCX 3ARGC 3KD4A 1JF5A 4HKZA 5C92A 5TE4H 2EP6A 3MBWA 5ACLA 3TO4C 1JGIA 1PJWA 3QEUA 5DA0B 1JJUA 4BZYA 3GS0A 2R1WB 3O3DA 1R3IL 2DBLL 3Q9PA 2KHAA 2YBGA 5E9AA 3UGXA 3ULUL 3KYNA 2OYPA 4OJYA 3F6JA 3CVIL 5IHWA 5JR1H 1CT8A 3RNQB 2Q2LA 3L5XH 4P5MA 3WNOA 4QRSB 4DZ8A 4Y19D 5F2FA 1EZVX 2AK4B 2J71A 4N8PA 4YUEH 4KBPA 3MRBB 4AEEA 1UKQA 3UZEA 3VMPA 2XN0A 3A67L 4R0LA 1HINL 4U1GC 1ZV2A 3MU3A 3P2TA 4GS7B 4ZDHA 4XO4A 2YAFA 2YS4A 3EFDH 3BEVB 2EYSB 2KT6A 4AXWA 2EE0A 1S4IA 3F7YB 2DM4A 3EFOA 3MO1B 1OTTC 1AGFB 4WW2F 1NEZA 1X5IA 4QHMB 3WNIA 1MJUH 3G5YA 1MW1A 5IHZA 3IJ9A 4DPAX 4TTDD 4ZQKB 3ZY7A 5SX4I 2PPEA 2Z31A 2VLKE 3U7WH 3FB5B 1J05A 5I28A 3CWGA 2Q6WA 3PL6A 1JPST 2AGJH 3K6NA 2GEQA 4NRYB 2EO7A 1DUZA 3CIQA 2VC2B 1UQSB 2QTVA 1ILSA 1DO6A 3TA4D 3HG4A 5JOFB 4DUWA 3NESA 3CCHB 3QHZH 4W9DC 1UCBH 3SGKA 5F1SA 1JN6B 3VYOA 4DTGL 3QFJA 1CFVL 2NCMA 3QA3B 4FLRA 1BM7A 4K3JH 4M1GL 1DJSA 4WFFD 4DQOH 2Z3FA 2W1NA 3O6KH 5EO0B 5IW1B 3ROLB 5AVUB 5KEZA 1XGQA 4J3TA 2XY2A 3IGAA 5CZXC 3EH3B 2BXZA 4OVVA 1MW0A 5DA4A 1NAMA 4MXVF 3X12B 5JOPD 4NO5A 1RY7B 4DN3H 3PF2A 4G6MH 2ID5A 3BDXA 2HVKB 2L3BA 4G6FD 1PBYA 1PD1A 4WIQA 2GUOB 1HDMA 1HCZA 1SEQH 3US1A 4KUCD 2Q1EA 1LWRA 1FRGH 5DFAA 5IB3B 2LW3A 3ORJA 2J20A 4DFHA 3LQZB 3PWUB 3FC8A 2PCPA 1G5GA 3OGCA 4OZHE 2VSKB 2UZYA 2D4FA 3HN3A 3WTYA 2ZX5A 2NW2B 5J4MA 4AYMC 3I74A 3RFZB 3QJOA 3TF4A 5T3ZD 4M1CD 2X1XR 1FGNH 1EQWA 2WVUA 2R1XA 1P6WA 4OQTH 4GXFA 4OZHF 3K2IA 3GIVA 4N2IA 4OGAC 2ISDA 2XXCB 1JNNH 3QNXA 3QRGH 1UJ3C 4XNXL 3DTXB 4Y4KD 4PJ5E 2VNCA 4PJ8B 4XCNA 5CD3B 1WBYA 1MCOL 2WB1A 1B0RB 5F7DA 2IH3B 1FZKB 3KPNA 5KTEL 4HUCA 3IDGA 3K6FA 5G5DA 5E1AA 4JRYE 3S3CB 4C56A 1R5VB 2VDKH 2YEQA 5CWSB 5AW5B 2FRGP 1BBDL 4KQ3L 4LP4A 5IJBC 5LG6A 2BOCA 1P4IL 1V54B 2OMNA 3L3HB 4K94L 4KKZA 5KBPA 2ZUXA 3UTQA 2YD1A 4ICXA 4ZPTB 1PZCA 2OPCA 4JDZB 4E9RA 1T83A 1HTYA 2BNRE 1OTSD 4LHUA 5F3HB 4JY6B 3C60B 4MWFB 2ZKMX 1P0SE 4P4KB 3TBYB 1QFUH 4JRWA 2IJ0C 1DBJL 3DIFA 4HXBL 3VXUD 2OMWB 1NC2A 1CXIA 5B39G 5JUEH 5C2BH 1RUQH 4LCWA 4LCYA 4Q4IA 3KWWB 1QFPA 2IPKB 5IB4B 3V8OA 2P7TB 3GD1C 1BVLA 5FW6A 1NCNA 3KLQA 3EOYG 4NJ9H 2UXFA 3ZKXC 1V7MH 3BUTA 4KY2A 5CUSL 1H6EA 1HNYA 4ZFFA 3HZYA 3KH3A 1N0LA 3C75A 3VSTA 1OPGH 3DROA 1OSZA 3M86A 3S4SB 2E56A 3M8OL 1EA9C 1I1AC 1MI5D 1NCOA 1AXSB 3BKML 1DQLL 2EINB 2UZXB 3D2TA 4XPFL 3QIUC 1IZKA 4A2EA 4LCWD 2NR6C 4I77L 2I5YL 3FB8A 1Z6JT 4AQ1A 2EDBA 1JGEB 5LO7A 3T09A 4P9HL 3QDJE 5T5NG 3TBWA 3LN5A 3MFFB 1U41A 3O41A 4E0RA 4Q89A 3JV4B 4TVPE 3IJSB 4L29A 4PGDB 1ND0A 1FNEB 2DW5A 2X6AA 1F0LA 2WUCL 1BFTA 3N9GH 3WDHA 4Z7OF 5DVNA 4WCYL 3SJVE 3QIUA 2C1PB 2BMKA 1JGLH 2QQLL 4QXUL 1JXJA 1OWWA 2GK2A 3CVIH 3KAAA 1COBA 3NA9L 4WY7L 4APQA 1AHKA 1CU4H 1RU9H 1FVCA 2P42B 3RU8H 3L5XL 5DS8A 5L8LB 3IAGC 1KT2B 1H6FA 1V05A 3RWDA 3LQZA 4UWQB 3S37X 2JJSC 2FD6L 3MJ9A 5GGQL 4OM1L 4A2FA 1CS6A 5IJCC 1IAKB 3CX2A 2GK0B 4PGBB 4Z77A 5BVPH 1G87A 5JW3H 1J1XL 4J3VA 3US0A 1J10A 1XEUA 4AEFA 2A74C 4RZCA 1RCYA 1HHIA 1SJEA 3EFDL 4YDIL 3T0WA 2A6DA 1JN6A 3JWOH 3NSJA 2GQHA 4S1DD 3MROA 5IUCA 4JFDB 4HZLB 1AG6A 3BPLC 3WIIL 2ADJA 1M9WA 2XWJA 3KYAA 3DJRA 1KDIA 4XN9A 5JPMA 4XNDA 1C8PA 2ZSVA 4LLUB 2B5IB 2O72A 3TYFA 1RD6A 4WWKD 1JYWA 4X4YB 4PLKD 5ESQA 3WN5B 4ETQB 3APNA 1T4KA 5D71H 2VLRA 4CADB 5TJWK 5SWSD 1IM3A 4XO3A 3ARFB 2WKOA 3BHBB 4ZAKD 4QO1A 5F89B 1E65A 3BZEA 3QG7L 4P2CG 3L7EA 1ZJAA 5A7BA 3TM6A 3GXNA 4TQIA 3PAZA 4NN5C 4FQIL 4TULL 4XN1A 2HJKA 2ZAIA 4Z0BH 5DYFA 3MRKB 1HHGA 3OPUA 4CGTA 2EVIA 1GYVA 2J6EA 2X89A 3HG1B 1PQZA 2DLFL 3POCA 1ZGLP 4JPKH 3MA9H 3PXLA 2YK1H 4PJAA 5C0JB 3U30B 4Y4HB 4I0KA 2VR8A 3O4OC 3QWRD 1KPRA 2ZOKA 4V1DA 5GGTH 3IJYB 4QJ4B 1BGXL 5DD1L 1SYSB 3L1EA 1X5MA 2D3JA 2NY3B 2J88H 2VZUA 1HHKB 2I32A 5DUBA 5F88B 3MRLA 2GAZA 1T21A 5CKAA 3MA7B 2JTDA 4ZQTA 2WBJD 1TT6A 1DVXA 4AJVA 3ARDD 4RAUB 3MJ8A 5ID0B 4JDVB 3VRLE 2VDPB 2PTTA 4FQ1H 1B3IA 4L2YA 3EJYC 4LIQH 4AYEC 4O2EA 1YN6A 3W38A 1QABA 4L2LA 1RPUA 4W81A 1IBZA 3WL9B 3ARGA 3BDYH 5JW4Q 3WEMA 5ESQB 3WN5A 1KCKA 2J73A 4JCLA 2OZ4A 5FV1L 3CDFA 4ORGA 3TZVB 3F05A 3O2DL 2BIQA 2AJ3A 3VFOB 3G5VA 5C0RL 4PRNA 4ODSH 1FGNL 5BRZA 2IAMA 3N85H 3UC0L 7TAAA 1JWUA 7FABH 2GC4C 3MROB 3TBVA 4KROB 5AEAA 2Q87A 2C7UA 4MB3A 5HI3C 2H45A 3MV8A 4EBQH 2LE9A 3VFVA 3ZDZF 3DDFA 1NUGA 4U1SB 3UTSE 4YSTA 3VSUA 3VNZA 4G7SB 4C83B 1I7TA 3TBCA 2ZX8A 1CFNA 3DX9B 4FAAB 2XZZA 4RGMB 5EC1B 1P4IH 4K94H 3I6SA 2W38A 2Y7QB 3CVDA 2PP8A 3IPEA 2ZXCA 3CN4A 3TBBA 4HS6A 3QIUB 4J39A 1TVBB 3A47A 1WS7A 3MV8D 1P2CA 5C07D 1X5AA 5SWQB 4AGLA 1FPTL 2OMUA 3ZTEA 2B8OT 3LPGA 1JTOA 4EZLA 1IT9L 3L2NA 4A7TA 1G94A 1PLAA 5LCVH 3UIZA 1RHHA 2B1AL 3FRUB 1S7UB 3FUNA 4N2GA 4HXBH 4J2XA 2DWXA 1E9QB 5DWPA 2YN3A 1YJDC 4MFHA 4ANUA 2EZ0C 1NPUA 5TDOB 4TUOB 4JUTA 2IGFL 5FHBL 1KFAH 1PJ9A 5AVTB 1AIFB 1S7WB 4AITA 4QD2E 3MTRA 4NJ9L 1MCWM 5DCCA 4FNLH 5EDXA 3Q6FB 4WK4B 1B6UA 5JLZB 4JFFE 4IKNA 2EYTA 2HLAA 3MLWL 1MQ8A 1S9KC 1DQLH 3P02A 3SYOA 5LGJB 2WWMC 2VAAA 2WXPA 3TESA 5ICYB 3U0TA 5FYKL 4I77H 1INEH 4K7PY 2D3VA 4N0UA 3D85A 1JZFA 1ZAGA 1K3ZA 5HPMB 2VDRB 4LCIL 3K71B 1GHFH 3C6SB 1KEGH 2F1EA 4LCYB 1T5KA 4P9MH 3KBHE 5D1XC 2VZSA 1PSKH 1YRKA 3ARGB 4OB5L 1JHLH 2N1TE 3KLKA 4XP6L 1E4HA 1K2DB 4YDJB 3U4BL 3EBHA 4PIBA 1G9NC 1XBDA 3GXFA 5E7BA 4NQEB 3LQMA 3WSQL 5FFLA 1QR1A 3ZQXA 3RIFF 2ATAA 1SOSA 1ZHKA 4A04A 3INUH 4LVNB 4ONFH 4Q8BA 2K0RA 2R15A 4L5FL 4XP1L 5INDA 2WKLA 3R0MA 5FYLE 3SY6A 1I9JH 2X0WA 1KBWA 3ZPDA 4KJPC 4UT9A 2P5WE 3IDXH 3O3UN 4P5TA 1DCEA 2X12A 4MS6A 4XBGB 3BZ5A 2YD2A 4LIQE 1E4XI 3UJTH 1S5IH 1GGBH 1FDLH 5MENB 1KJVA 5E70A 4M9OA 3EH2A 3LEVH 4NWUH 1DJIA 1QLRA 1HKLL 4YFDB 4HCRL 5F88A 3ZYOA 3KGUA 2IOMA 3QFDA 4F91B 5IEKA 3M88A 4L37B 1S78D 2BC4A 3DX4A 4LLYA 4UQ3B 2YOCA 5A2KH 2J4WL 3FU7B 4KAQL 4QI3A 5DT1H 4X9HA 4YE4L 3HJ0A 3FN3A 5KG9A 3H8NA 1EGJL 3BIKA 3KM2A 3EUUA 2Z93A 4JFZH 4FA6A 3DVIA 4GPVA 5K59E 3P4MA 3DPDA 4FF9A 1LDPH 3NQKA 4MJIE 1QKZL 4WEEA 3VX1A 3KLAB 1IIKA 4JGJA 1A6TA 2YD5A 2F7PA 4NBZB 1YYML 1PMYA 3PV6A 1FFRA 4Z0BL 5HDOA 1PAMA 1D5IH 3SBRA 1ETZB 5AWNL 2OJ1A 3E8VA 3RVXC 1SLXA 1RPQA 4OW6A 3VI4B 3QZWA 1A65A 4ETQA 5C0DA 3ASWA 4KVPA 1LP9A 5DTFB 2NRDA 2QFPA 2YPKA 5H8DA 3WKMH 1EEQA 4MX7B 4BCZA 1J5IA 1T5XB 4PRHD 15C8H 3CJJA 5ICXB 5I8OL 3FFDA 4U6VL 4CJ0A 1I4FA 1MIML 1BZ7A 1OPOA 1WLHA 2DI7A 5DD1H 4Y9FA 5JDSB 4FXKB 2VC2H 5GSRA 1DQDL 2YD7A 5JHDE 3OMZA 3TVMD 2DS4A 3V0AC 4C58B 1ZWIB 1MZZA 2UVFA 4GW5A 2J8OA 3MRMB 1NMBL 2PYEE 3IMSA 3JXAA 3S34L 4PWEA 3O9WB 2GITB 3HAEB 1DVFC 3A24A 2W9DL 1MXGA 2WLIA 2VLJD 3QIWB 5DLML 1EZUA 5I1IH 5EWIH 3DTUB 3RTQD 4WDIA 3TS8A 3QQ9D 5JYLA 1GSMA 3PV7A 1D2PA 1YEEL 4M61A 4OFYD 1KJ2L 2JQMA 2W95A 1VCAA 5E4OA 4UB0L 4OLEA 4L8DA 5B38B 5J13B 1P1ZB 3PJLA 4RGNB 4WNSA 3FH8A 3EF4A 3SQOH 2RAMA 3STZB 2A1WH 3ZE0B 4M6NH 4ZD3L 1DZ0A 3OXRB 1AXTL 3O11A 5I19H 5DZ9A 3IJSA 4L29B 2VDKB 3BOVA 2A0LD 4DKEL 1P84K 5D1QB 4X5LA 3FNKA 3UERA 5B7MA 2IPTH 1L0QA 4KX7A 2ESVE 4P2OC 3WHE1 1IBDA 1DBBH 3L9RB 4TUJB 5FYJU 4EBQL 5LLIC 4OJFL 5KSBA 2DWEA 4GOSA 4YDLB 2IPKA 1NCIA 1BIHA 5DD0L 3VFTB 2MOGA 2AJXH 1CE1L 2LAGB 4O2FA 5JQ6L 1BYPA 3P4OB 4R2GC 3UX9B 4DCQB 1X7SA 2VXQH 1OSZB 3MRQB 3UO1L 1A9BB 1H3GA 1A7RL 1N3NA 2NMSA 4M43L 4LMQI 2BNQE 2XTJB 1FO0B 3KS0H 4A2HA 1NAKL 3AU0A 3U9PH 2EDRA 2HFTA 1L3NA 1Q94B 2V2XB 5CJXA 1HYSD 2ZOOA 1U21A 2ZZUT 2H47C 4H0IA 5SV3A 4EKJA 5I8CA 2LGNA 4Y2DA 3VCLA 2VR7A 2OW7A 4AMKL 4J4PD 4P3CH 4C56B 4N2AA 1KGCD 5DO2D 5KW9H 5D6CB 4D0CA 3FK3A 4TPRH 2PCFA 1DL7H 2FWSA 2DJ4A 3GHBH 2AXWA 4TOYH 1K6QL 1A6UH 3F7QA 3ML9A 4MXWL 4QTFA 4YGAB 3HC4L 5IVXA 5L2KE 1OLLA 3IBOA 2BVEA 1A1MA 2TRHA 1CE6A 3F64A 2FATL 5GISL 3T4AC 3VMNA 1IB5A 4Q6IB 2F7OA 1TZOA 4XN7A 5J1SC 3UBXB 2OMTB 3S3DB 2ZONA 3S3SA 5TFSL 4L4VA 5LBVA 4HDIA 3BQUA 1INEL 4NKDA 2ITCB 2VQ1A 1NBQA 2P28B 1C8QA 5E9DE 5F97E 1TSHA 2DL2A 4N5UA 1B4JH 3S8WA 5IF0A 2EXWC 5F9OH 3UBFA 1JHLL 1M1XB 1BZ8A 1NFIB 1HEZB 5I1EL 5L2KB 4Z3EA 3F12B 3VA2C 4JHAL 4PB0H 4PJGB 2QSVA 4JG0L 1ZLVH 3I9GL 5GJSL 4Y2LA 3AXIA 5CEXA 3BQUC 5B1CA 2OCFD 4P46C 2ZXAA 2PXYC 3NVQA 4Z7VA 1FJ1A 1O9WA 2V9QA 1DLHB 2JF1A 4JDEB 1BZEA 1KIRB 4FG6C 1HOEA 1GW6A 2BX5A 3G6JE 1CDIA 4QT5A 3WTUA 1X7TA 1U30A 4UZSA 4LRIC 4G59C 3NIGE 2I85A 2EXSA 2XG5A 2XUWA 4CGUB 1UGNA 4KXZI 4PCTA 2HKFL 3D9AH 4X6EB 1DE4B 3CFQA 4ZOCA 1MAMH 2AEPH 4U7KA 4FHKA 1U3NA 4XAWH 5HYFA 1A8JH 2JKRM 2ICWA 3TBTA 5FUOL 2GITA 3QIWA 4WI0B 4X5XA 4N9GA 3QI9C 1AGDA 3DPBA 1CZ8H 4TSBH 1NIFA 3GRWL 5EPMA 3RY6C 2R69A 4UQ9A 3RL2B 3BZDA 3ECVA 5KOVC 3ECBA 1CXFA 1IEBA 2ZXQA 4TV3A 3SO3B 2BRRH 3BSZA 2YWYA 1UUSA 3WJMA 4H1LG 1OCOB 5CHNB 4X7SL 1ZS8A 2V7HB 4F27A 1DO5A 1RUAH 3MGAA 4RGNE 4DKFH 2DPKA 1MUJB 4O4YL 1J9RA 3VXSE 4E41A 3EDDA 3E6FA 4I0PC 1G1CA 1XX9C 3B2UC 2HJLA 1FIEA 3BCFA 4XNYH 5IV2B 1DUYB 4XTRD 3WXWL 5KN5A 1FN4A 4MAZA 2OJEB 1NUNB 1KGIA 3BH9B 3CVHA 2Q6WB 2XN9E 2WVVB 3N42F 3QEHA 4YC2C 3NGBC 3CZLA 3TA3B 5GXBB 2NYYD 5KJRL 5I1CL 1J5OL 1BEYL 1HHHA 3QB7C 1F8TH 2BOBB 1GGIL 1M4KA 1CLVA 1SYSA 4D7PA 3RNKB 4YX2H 3LKQA 3V9FA 5I1HH 2FB4L 5FHAL 4O2EB 1CLOH 1BQHG 3WUWB 3K4AA 3PWPD 3MLSL 5JHAA 1YY8B 1OQOA 5GGVH 1BVKB 1I53A 1IILE 3B4NA 4PH8A 4ZPVA 2ZNWA 3V4LA 4NT6B 4J7RA 1JI2A 1Q0EA 1I3GL 2Z4QA 4R8WL 1RZFL 3NZHL 5IQ7L 3FZUC 1MKFA 1JCKA 2J12B 2R2EB 3FUFA 1ASQA 5JXEC 1PYWA 5DJ2A 1DR9A 1EEUA 1WIPA 3SJVB 3KGRA 1M56B 1GOGA 5D8JL 1U93A 4GRWB 4TSAH 4XAKE 3HBQA 1J0HA 2ADGB 2VN5A 2A83A 4PPTA 4FABL 2HRPH 4PWJA 2BS9A 4FFZA 4M29A 3ESPA 1MRDH 1P69B 2DB8A 3QCVL 3V4PH 1TTFA 2A1WL 4NZRL 3ZQ9A 2KDGA 4QYOB 2GBTA 1CF8H 4G2AA 4LK4A 4PGCA 2C5DC 1YNLH 4JFOA 3ML8A 3L81A 2CUMA 5KYXA 2CUHA 2EACA 3UACA 1PU0A 3SBQA 3VDAA 2HJLB 1AD9B 1BXVA 4RA3A 3U0WH 3HAEG 1AHWC 3QUMH 4JL2A 4J8RA 5AZEH 2VDRH 3BKYL 1MFCL 5ANMB 3I3DA 5A2BA 4YDMA 4JE4B 3VTMA 5HJ3A 5EOQH 3F01A 1TZAA 4V2CB 4Y7MA 1OV8A 1N59A 5IFJB 3V0FA 5HXMA 4FI6A 5I74B 3VGGA 2X10A 5DJYA 4X6CF 5L2KA 4I1NB 5AW7B 1EMTL 3PL6C 1A6AA 4S1QH 3DUHA 2A9MH 1UG9A 2GIYA 3NCWA 3B2MA 3O8XD 2DMKA 4X5XB 1XIWC 3NJHA 2HKHH 1YO4A 1ILUA 1MPAH 3MR9B 1G7LA 4FJ6A 3NK4A 2IXQA 2PP9A 2OA9A 2JXMA 2W65B 4S1SH 3MV8E 3WJLC 1C12B 2GCYA 2BHFA 2XHNA 4Y9CA 3TASA 5IB2B 1K72A 4B9CA 3FUDA 4MB5A 3C5JB 3KXFD 5CINH 1UH4A 2OMUB 3IAPA 4AMWA 3PWNB 1IC5H 3GZQA 1RIUH 3S7GA 3KYOA 4HV8A 3CUPB 3P9MB 4WI9A 4L8BA 4P07A 3G3LA 3N42B 1SLUA 3QUXD 4H1LA 3EOTH 1N6QH 2FWUA 4P49A 5CJ5A 1KGWA 4ONGH 2LAAA 2QL1A 1ZRUA 4JFHD 1T22A 5DZLA 2BNRB 4OSUL 4X9FA 3OL2A 1BD2E 4I1PA 4IRJC 3X3GH 2YGNA 4MSWA 2WYIA 3C8DA 4OF5A 5K5YA 2L04A 4QRTB 4OIFA 4LZKA 2O4EA 1PKQA 1TVDA 2WMPA 3L2LA 2XTJC 4OLZH 1BM3L 1Z9PA 5CP3H 3H7LA 4WHYH 5F9WC 5AB9A 3L3OB 3K7UA 1XF3A 5IBTH 2L7EA 3VRLF 5CZVL 1N12A 3HS9A 3Q5YA 4KJQC 5I75C 4G3YH 4XPBH 1AOHA 3KXFB 4A2GA 3L4CA 3DSFL