2IVWA

The solution structure of a domain from the neisseria meningitidis pilp pilot protein.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
113
structure length
113
Chain Sequence
ETDKKGENAPDTKRIKETLEKFSLENMRYVGILKSGQKVSGFIEAEGYVYTVGVGNYLGQNYGRIESITDDSIVLNELIEDSTGNWVSRKAELLLNSSDKNTEQAAAPAAEQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of a domain from the Neisseria meningitidis lipoprotein PilP reveals a new beta-sandwich fold.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Lipoprotein
molecule keywords PILP PILOT PROTEIN
total genus 9
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.830 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ivwA01
2Y4XA 2LC4A 2IVWA 2Y4YA 2LNVA 3OSSC
chains in the Genus database with same CATH superfamily
3X20B 1N5ZA 3L2QA 1X2KA 2GTJA 2K57A 1SKUB 1C0MA 1TXQA 4CC4B 1EZZB 4M7AC 1BI0A 2VXEA 2EKOA 5DLQE 5FLXE 1BB9A 2J06A 2V8IA 1B3QA 5I2MA 3M4YA 4MZPA 3QDFA 4RKUE 4A53A 4C0DB 4DBRA 2EJFA 1M1KU 1YI2Q 1WHGA 1BCMA 1VQ6T 2EYWA 4HCZA 3EG2A 2XICA 1B07A 2EJ9A 1WQWA 1TSFA 3FRNA 4OB2B 3FJPA 1SEMA 3S3NA 3EGDB 1I07A 3FDRA 2DVJA 2HD0A 2W0ZA 1K8AR 2GFAA 1VYVA 4PJNA 2QGGA 2QQRA 3QYGB 2LX7A 5GAOq 5A2QE 1PCXA 4OF1A 1S72Q 2IIMA 1BBZA 1M2VA 3INZA 1FMVA 1H641 5FROA 1VQ7T 2MK5A 1KIKA 1MNEA 3M0UA 4M4ZA 4R56A 4L6V5 4M7AB 3BFMA 4QKUA 2KYMA 3PGGA 3ASKA 3CCRQ 4KGVB 1U06A 1AVZC 2X4XA 4C92D 2C0TA 1VQ4Q 3RERA 1WDXA 2QQSA 2VB6A 4IKFA 1JEGA 1Q86R 4OB0B 1VOMA 1SRMA 3VS2A 4KH1B 9ATCB 3M9QA 3OW2P 2LQNA 2J6FA 3SHWA 3GOXA 2GGRA 2EAYA 5LJ3h 1M1KC 1M3AA 4R55A 3MCAB 4K11A 3DLLA 3H9NA 2FG0A 5GMKi 1H8KA 3CCSA 4IURA 2LQKA 3JCMQ 2X4WA 2YUPA 2CGHA 1KC8R 3JB9D 1VQ7A 3V8KA 4M7AE 2HCKA 3LLRA 4EMKC 3I56A 2PU9B 2MWOA 1VQNA 2R5AA 3OMGA 5GANg 1CKBA 1O75A 2QAZA 2DD4A 2R5MA 3CD6Q 5DY9A 4E7KA 4C8QD 5GAMh 5GMKj 2GQVA 1Q7YC 3P8DA 1VQNT 1S72T 3OYEA 2QEXQ 1K8AU 2ROLA 3HKSA 3X24B 1GRIA 3E9FA 4CRIA 4M78G 4C8QG 3MPUB 1K73U 2KT8A 4N4GA 3VYHB 3JCMV 4M75A 4PJOF 2JW4A 1VA7A 2J7IA 4FYWB 5GAOl 2C06A 4M78B 3CCEA 2Y90A 3L2VA 2L3QA 1Q86U 2X4JA 4M7AF 5IT9E 3FIFA 4JZ3A 4LDYA 2ED1A 1NEGA 3VYGA 4IUVA 1UJ0A 2LMJA 2DEQA 5FU6B 3EH1A 2EQUA 2LQWA 1B34A 4QQGA 1LVKA 3JCMP 1FYNA 2ZPFB 5KCHA 1HK9A 1M30A 3JCMf 3PE0A 1YIJA 1QCOA 1M90C 2ESWA 1WXUA 1BKBA 3TVTA 1RAGB 2LC4A 1K0XA 4ZN3A 5IN1A 2K5IA 4ZN1A 1ZA1B 3CCLA 1M2VB 5KYWB 2H3JA 2MI6A 3G6ET 1R8OB 1UEBA 2A37A 1N8RC 1HXDA 1QMCA 2B8AA 2CSIA 2JS2A 1YJ9T 3M57A 5IHNA 2CZ6B 4XU3A 1VQ9Q 4JLGA 2MOXA 3U23A 4GLKA 3VS0A 3CD6A 4M7DD 3OBYA 3TCJA 2DF6A 3I9QA 3OSVA 2I0NA 1WHKA 2RI3A 2WSEE 4M77B 1LPLA 3EFSA 3JCMb 1IHVA 3CCLQ 4ME7A 1M5Q1 5GAN2 2X9HA 3RDVA 5KH6A 3RBBB 2ZPBB 1GCPA 3EH2A 3GNFB 4M7DC 1YFNA 1PC0A 5LJ3f 3NHNA 2EQIA 4RCCA 2F5TX 2JOYA 3PIPA 2KT1A 1Q82C 4A4FA 1TUDA 2RJDA 1QVPA 3JCMg 2XIDA 4XTXA 4BDYA 1PSFA 4Z8AA 3LX7A 2MMPA 2DXTA 2HQXA 1VQ5Q 4BE0A 4C5HA 2DL8A 1KD1R 4NL2A 4LXCA 5D6XA 2DPPB 5GAMf 3I56T 5GAMd 4HXJA 5GAOm 3A8HB 4XU1A 1M2OA 3O8VA 4M75F 3BY7A 2VXFA 4DBHA 1OOTA 4IIMA 2QA4T 4M7DG 4M75B 1GCQA 3QZ9B 4LNPA 4C0FA 2YXYA 1YJNT 3CPWP 1VIFA 2HBWA 2A28A 2C0IA 2JTMA 4BE2A 3E19A 2HKNA 4E7HA 1KD1C 2DVEA 2COYA 1GL5A 1AHJB 2HNIA 3AHUA 3CCVT 2RI2A 2XMFA 5IH2A 4J6YA 4ZNXA 1RADB 1VQ5A 2R58A 4FSSA 1LNXA 2NUZA 2LT4A 1G3YA 3META 1YITA 4RTZA 3OYIA 3A1PA 3UF4A 3I55A 3QPHA 1YITQ 2DKGA 2VASA 1QWEA 2DRKA 2JXBA 3QSUA 3CCUQ 3VS7A 5LJ5d 2DXCA 1BCOA 1S1NA 3IQLA 2FPDA 2KXCA 2VWFA 3LW5E 1VYTA 2DA9A 1TOVA 1OU8A 4PJJA 3CCLT 3URGA 4M7DA 2K9GA 4J9BA 4FYXB 2CSQA 2DM1A 2V26A 2OTLA 3V7CA 2CT4A 4DA4A 3I35A 1KQ1A 3KFVA 1QKWA 2D1XA 4FM4B 3G4SQ 3M0SA 1UTIA 3OB9A 1PRLC 1IGQA 2CP5A 2KSSA 1VQMT 5CIUA 2DNUA 1K0SA 3PVLA 1GFCA 2RJFA 2EFIA 1JB0E 5HY6A 2RA2A 1M27C 2D8JA 4DEXA 1UFFA 3GPLA 4NOYA 3FB9A 2CP2A 3CC4A 4ANJA 3UT1A 3QJ6A 4XTVA 1KQSA 2Z0WA 3M53A 3JB9J 4M75E 4C92E 2QA4Q 4C0ZA 4F17A 4R0KA 3LGFA 1RLQC 4C8QF 3G71A 4M78F 4M7AD 5GMKh 1KG1A 3X26B 2KVQG 2L89A 2DE0X 1EFNA 1NG2A 1Z9QA 4OVAA 4HCBA 3Q1JA 2BUDA 1AD5A 2LVMA 4C92B 4KUDK 2QQ9A 5IHKA 4ZTFA 2BZ8A 2V8KA 1NJIU 4RG2A 4J9HA 3G4SA 1ABQA 2QI2A 3LWHA 2LCSA 1OULA 3VRYA 1GCQC 4JJBA 4RTXA 2DTIA 2RQTA 2BKDN 1VQOA 4OMPA 3G4ST 1M90U 1YJWQ 4DBFA 5J39A 4C8QC 2L3SA 3H8ZA 2DZ9A 4C8QE 1Q7YR 4BD3A 1IRXA 1YJWA 3CMEA 2OI3A 2DAQA 2CT3A 5FRMA 2MPXC 4LUEA 2LCLA 1FMKA 3PTAA 4BI8B 5IXFA 3FJ5A 2K2MA 1M8VA 3OYAA 5C0MA 3J81E 3OS0A 1VQPA 4PLIA 3EG9B 1RL2A 5GAN8 4Y91A 4JJNK 4LDXA 1QVFA 5GANh 3C0CA 1PWTA 4EMKA 4RTUA 4HVUA 2RJCA 2A0FB 3EFRA 2HSPA 5EC7A 4LDWA 1NPRA 2RMOA 5LJ5f 2NWMA 3OA6A 1G2BA 3EG3A 3UA7A 2CP3A 2D8HA 1I4K1 1AOJA 3CC4T 3CMET 3RKXA 2M02A 2DIQA 2PUOB 3OYHA 2KYBA 1VQPQ 3OYNA 4FU6A 3VS5A 2PTKA 5IAYA 4DOWA 4BB7A 1K9MU 4AFSC 3PIOA 1I5LA 2P4RA 2O9SA 5GMKe 1BK2A 4M78D 2DEUA 2M9UA 2KAFA 4PJOA 4QQ6A 4QW2A 1KJWA 4F7UB 1OX9A 2LTOA 3S3OA 5FU7B 4F7UF 4HKEA 3A8GB 5LJ3g 1G3WA 2Y4YA 2YUNA 3GF5A 1AEYA 1GXIE 1UGVA 1ZA2B 3HRSA 4A63B 4BY6C 8AT1B 5GAN7 3CBMA 2DRMA 4CI0C 1PD0A 2JN0A 3EHRA 1Y96B 1VQ4T 4OMOA 3G6EA 2X3XD 3HRTA 3JB9G 5CKBA 2PVGB 3QKJA 1YI2A 1MGQA 1X27A 3KBGA 1G83A 2DXBA 1Z9ZA 3TSZA 5GAOp 2XHCA 5GAMg 3HFOA 2RF0A 2DMOA 4EDUA 4D8DA 3OYBA 1W2BA 1EX4A 3L2WA 1ZBXA 3R6NA 3H0HA 3SD4A 4C92G 3QWXX 2K5FA 4HCKA 4JDSA 5KYNA 4A54A 3ULRB 3MEUA 1M3CA 5A0LA 1M9SA 3BDLA 3CCEQ 3GIBA 1JXOA 1VQ8A 2LNHB 4KH0B 3CMAT 3PMTA 1RACB 1RUWA 2RN8A 4IUPA 5GAMe 2IG0A 2M1HA 2QEXT 3CCRT 4DOVA 4MZTA 2HQHA 3M0QA 2K79A 4NL3A 3E9GA 2DTOA 2DL3A 3C4SA 4E2FB 2XDBA 4RG8A 1KC8U 3LH0A 1M8MA 2KQWA 1YJNA 4J8OA 1ABOA 3M4GA 1RAEB 5GANj 2AIRB 3P8HA 2CUDA 1UHFA 1Q81R 5D6WA 2DO3A 1FMWA 4ZGJB 3PT9A 3F70A 1D1AA 4A4EA 1X43A 5GANe 1DJ7B 1OZ3A 4N4HA 3OS5A 2EGEA 1VQ5T 1NE8A 1UB4A 1ZSZB 4J83A 3C94A 1PRMC 3V8LA 2RB6A 3CCVA 5GAN6 4TVRA 3QO3A 2EPDA 5LJ5h 1U8RA 5LJ5e 3L2RA 3SWNA 3VUBA 3TEEA 4AFQC 3JB9I 3OYDA 5CQYA 1S72A 1J3TA 1MNDA 1GBRA 4O5VA 1Q86C 3CCET 2OTJA 2CP6A 2K2VA 1WJQA 4OMMA 4C5EA 2KY9A 4PJOB 2VV5A 4OMNA 4N0AA 1H3HA 1K4US 4C8QB 2DFUA 2XDPA 3CC2A 2YUOA 3CMEQ 1IXDA 2P84A 3O5ZA 2HQEA 3UWNA 4J9CA 4E6RA 2MWPA 2CH4W 1D3BA 2CZ1B 3JV3A 2GTOA 2IVWA 2EQJA 3EFOA 1NYGA 4AG2C 1N27A 2V1RA 2GFUA 2YUQA 4A4HA 2KMTA 4OB3B 3VS3A 4RTTA 1SRLA 1VQMA 1IZ6A 2QYZA 6AT1B 2YLBA 4ORZA 2PQWA 1IHWA 3M0TA 1VQOT 3M54A 4M77A 4A4GA 2DL5A 4ELYC 3MEVA 2COWA 1YHQQ 2GBQA 2LCCA 2OTLT 3CXCP 2XI9A 4M75C 2YHTA 2BE7D 1YIJQ 2KRNA 4FT4A 4ELZC 1KD1U 2ATCB 4XTYA 2L2PA 3CC4Q 1Y7XA 3G6EQ 3OMCA 5C6SA 2AZVA 1QVGP 3M58A 3NTIA 2L5QA 4FL6A 1OPLA 2RHIA 2EQKA 2BIVA 2OJ2A 4PLLA 2E64A 1YJ9A 4BUGA 1QW1A 2ZGWA 5FWCA 3L1AA 4C92A 4GY5A 3ZEHA 4FW1A 5LJ3j 2JM8A 1X01A 2RHZA 1KK7A 4OGCA 2YT6A 3JCMJ 2DJZA 2X35A 3CCJQ 1QP3A 2RQVA 4PNOA 4YTLA 4HT9A 2JUFA 3VJPA 2PVDB 2SEMA 2HMAA 2GNCA 1N9SA 2JTFA 5GJWB 4PFOA 2K6DA 4VUBA 1K73R 3OYCA 3MO8A 3OYMA 2O2OA 1K9AA 3T9NA 2AKLA 2M0OA 2LJ3A 2DZCA 2D6FA 1X6OA 4L59A 2FL7A 3HFNA 3HRUA 5GANd 4F7UE 4LN2A 4IUUA 2O31A 3CCMA 2H8HA 3A8LB 3QIIA 2OTJQ 2YSQA 2DTHA 3NMZC 1ACMB 4C92C 3HSBA 2EYQA 1GBQA 2JMCA 5GAN4 1TH7A 1HSQA 2QGFB 3G7ZA 4IIOA 1PSEA 1ZQ1A 4MMKA 5IHIA 1QVGA 2KR3A 5KCOA 5KYXA 2EJGA 1NEBA 1YITT 2A7YA 2NUPB 5J26A 2JNGA 2RO0A 4M78A 5A0GA 3VRZA 5LJ3e 4C8QA 3N5BB 4LUDA 1BU1A 1NLPC 4B6MA 1R0BG 4M77C 3FLGA 3ME9A 2LQ8A 1V29B 5IXBA 3CCQT 1LJOA 2LT1A 3NTKA 3EG1A 1TTHB 3G71Q 2EYYA 1D3BB 3ZL7C 1FX7A 4MZMA 3CQTA 2KI7A 3CCMQ 3JCMh 1XJWB 1I1JA 2AHJB 3DB4A 5GAN5 1SSFA 2GCXA 1KQSP 4E7LA 1W6XA 2Y4XA 2JTEA 3OBWA 3M55A 4PJOG 1PHTA 2E41A 2E65A 3GNGA 4FYYB 1H3ZA 2JT4A 3I5RA 5HCKA 4CC7A 2XG8D 4FCYA 1M4ZA 3NTHA 1JBMA 2QASA 3ZFJA 1TU0B 3RKYA 3HPWA 4GBQA 4J9FA 1G8XA 3GLXA 5KYWA 1YNZA 2QTXA 1YBYA 3UATA 2QK0A 3DB3A 1WLPB 1ZBJA 3PFSA 3QG1A 1IREB 2KNBB 4LD6A 5KYYA 3BW1A 1MMNA 2HSEB 1YN8A 4FIBA 2CP0A 1ZUUA 2HKQB 4XU2A 1Y0MA 1HYOA 1QLYA 3CEYA 3OS1A 1PKTA 1WA7A 1N8RR 5CVIA 3THKA 1TUGB 4XK8E 1NBEB 5FU7C 4F14A 3JSCA 2WSFE 2VYTA 4OMLA 3EGXB 1JXMA 4KRTA 3ER0A 3R6OA 4KBMB 1OPKA 2RD1A 1YCYA 3OYFA 1JJ2A 4C0DC 2EGAA 2R57A 1IGUA 1YP5A 2K3XA 1M90R 2A36A 3CCQA 2ZAEA 3EHQA 4M75G 2CS7A 5I2SA 5M9OA 5FW9A 3DLMA 3PVQA 4X9CA 3C12A 4PFPA 5AT1B 5AYFA 3D7SB 3HL8A 2OAUA 5LJ5g 1UG1A 1VQ6A 3RIRA 1UHCA 3A98A 1Q82U 2CZ0B 1RAAB 1E6GA 1X6BA 3MEWA 2QG9B 2O4XA 2YDLA 4D8KA 2WACA 3CC7T 3CD6T 3LH5A 2F2XA 1LCKA 2QA4A 4E7ZA 2KGTA 4M7DE 1AZGB 4E7SA 1JU5C 3JCMW 2BTTA 2FPEA 2FB7A 2ZZDA 4EMKB 5KE3A 2M16A 3OSSC 2RQWA 4P5NA 1NJIC 1WJSA 2E6ZA 3OYLA 1KHCA 4E7JA 1XOVA 4OMFB 4JUVA 1NZ9A 1W4SA 1U3OA 2FZCB 1NJIR 1AWJA 2EKHA 4JRQA 3QYHB 3L42A 1NYFA 1K9MR 4M77D 1ZX6A 1KQ2A 3L2ZA 2LDMA 1WI7A 5LL6S 1V1CA 4LDUA 4J7FA 2K3BA 1Y07A 4KGXB 5CKHA 2EBPA 3H6ZA 2D0NA 2KDSA 2DIGA 1KC8C 3RMQA 4MMLA 4FW2A 5CR2A 5HKCA 4M7AA 3PMIA 5GJVB 4JZ4A 1O9SA 1QKXA 2X4YA 3CBOA 2RQRA 3EFOB 2FO0A 4Z88A 2K4YA 1IB8A 3CC7A 3OQ5A 3TU4K 1RLPC 1WHJA 2DYBA 4RTYA 1OQKA 2VGMA 2HBPA 2E3IA 1VQ8Q 4M7DB 1Y96A 2F69A 1PNJA 5HK3A 3A8MB 4J7IA 1UECA 2QTVA 2RM4A 2FEIA 2EYZA 2LZ6B 3WXMB 3S3MA 4RTWA 4Y92A 4X9DA 1MMAA 1K73C 4N4IA 1WYXA 1YCSB 2ECZA 2HL5C 3J7AF 3VKIA 2FRWA 4M7AG 2EW3A 5FRNA 3LGLA 1BI2A 3OW2A 1WHMA 1WHHA 4BY6B 2LJ1A 4NS5A 2E6NA 2BE9B 4GLMA 2AKKA 5CCAA 3FEOA 3GP8A 3OYJA 1CSKA 5I22A 1BIAA 2EYXA 1MMGA 5D7UA 5GMKl 3EAEA 3QBYA 3VS6A 4II1A 4DQ2A 3OW2S 1D0XA 1YJNQ 4RCBA 3V8JA 4D6WA 2WSCE 2E1HA 3CC7Q 5CKEA 2VGNA 3SB2A 1ZSGA 4OGEA 3NPFA 1VQLT 4M78E 4A4KA 4JS5A 4LD9K 4B9XA 1QVFP 3TSWA 1KHIA 2CP7A 1K76A 2PZ1A 1Q81U 1YWPA 3CBPA 4LE9A 3H0IA 5KYUA 3JCMe 2ZPEB 1RI9A 2NYSA 3KUFA 1UUEA 1VQ8T 3SDZA 5HK0A 3BDUA 1JO8A 3JRZA 1C6VX 2L3RA 1W2BP 2MYSA 3QHSA 3WVDB 4MDXA 2YRCA 2KRSA 1SG5A 1AWWA 5FU6C 1OU9A 2DX1A 1SHGA 2J05A 1Q95G 2HAXA 2RNAA 4E7IA 5I11A 3OY9A 1AWOA 5A0DA 2COZA 7AT1B 4PK4A 1W2BS 3CCUA 4J9IA 3M59A 5GANf 5LJ5j 2VC8A 2MAMA 2NUTB 3DKMA 3CCJT 3QUIA 3CPWS 1FXXA 2YRVA 4Y28E 4FT2A 3JCMd 3UA6A 2DJQA 4JRKA 4ESRA 4BDZA 1MV3A 2DBMA 4C5IA 1SSHA 4C5GA 2YRDA 4OMQA 3CCVQ 3G1JA 1XNIA 1I8FA 1VQ9A 2JZ2A 3LWIA 2BZXA 1AWXA 4MDWA 3VUZA 2XU8A 2FZKB 4XU0A 3RESA 2E4HA 3OYKA 1Q81C 1G3TA 4J6XA 2KK4A 4XQ3A 2X3WD 2F5KA 1VQMQ 8ATCB 1OZ2A 2QEXA 1XQHA 2OAWA 4BI3A 3RMSA 4HVWA 2DXUA 3PNWC 4JS4A 4PJOD 2IPOB 2XDDA 3CCJA 2LRQA 1D1CA 4F04B 4KUIA 4Z89A 2OX7A 5J3BA 1OX8A 2PNIA 1RAIB 4M75D 1QVFS 5I21A 1W1FA 2QQAA 1R77A 2XKOC 4F7UA 1A0NB 1UGSB 2FPFA 2OTLQ 3J80E 3A8OB 3EG0A 2G6FX 2HL3A 3G71T 3QDRB 3FC3A 2JVVA 2KE9A 1T0HA 2M51A 2XD0A 2CH4A 1JJ2P 1G5VA 4N0AC 4QQDA 1WHLA 1QCFA 1VQ4A 1VQKA 3CXCS 4PFZA 2F2WA 3P8BB 2DK3A 1NM7A 2RPNA 3REAB 2XK0A 2L3PA 2ZCFB 2ZPHB 2LNVA 1D09B 2DILA 2QDYB 1VYUA 5CAIA 2KXDA 5KYUB 4J9GA 1T0JA 4PJLA 4J5YA 1UE9A 1UDLA 1WXBA 1UGRB 1I5OB 4CC3A 1M3BA 1WPYA 2P4TA 5GAMj 1YHQT 3MKDA 2E3HA 1SPKA 4ATOA 2ENMA 1QVGS 1VQLQ 3X28B 3RNJA 3EGUA 3I5SA 1BI1A 1MHNA 2A3LA 4PJOC 3RUXA 1OV3A 1HJDA 1VQNQ 5GAOr 1WNLA 3VS1A 1OYXA 2G3RA 2J6KA 4QVZA 4HVVA 2O4XB 4F7UG 4IUQA 3S6WA 1AT1B 1UGPB 4XTZA 2D0QB 3CPFA 3SEMA 1W70A 1N6AA 2RHXA 1MUZA 4WTOB 1C1AA 2AK5A 4JRIA 1ZSZC 4M77G 2ROTA 1YJWT 5DM7R 3CCSQ 4M7DF 1M1FA 1VQKQ 5EG2A 3CC2T 3AT1B 1VQPT 3VV0A 2AZSA 4Q5WA 2ABLA 2K5LA 1VQ7Q 1OI1A 1VQ9T 1K1ZA 4OP0A 1BI3A 2E5KA 2ZPGB 4M77E 1B34B 3CCMT 4RUGA 4JJDA 3OYGA 3I55Q 1ZSZA 1U5SA 1Y71A 2P0QA 3C95A 5CQXA 4JJCA 1KQSS 3KXTA 2GF7A 2E70A 2FYKA 2JJ9A 3BE3A 2CYZB 3CMAA 3MP6A 4M77F 1YWOA 4KT0E 2QQBA 2MCNA 2CUBA 2E12A 3ZBDA 2QDLA 2OTJT 1WJRA 3UDCA 4X1VA 3H41A 3V7SA 1M1KR 1ZUKA 2KEAA 4C0GA 1RABB 4J9EA 2VUBA 1D1BA 4XTUA 2MF2A 1YJ9Q 2LP5A 2RQUA 1QCNA 5L23A 3JCMX 3JCMc 3WVEB 1SHFA 3M56A 1I81A 3MEAA 3I56Q 1RI0A 4ZGDB 5CKDA 4XTWA 1VQKT 5KYYB 4B9WA 1K9MC 4AG1C 5CK9A 4WF2A 2M0YA 3NFCA 1AZEA 1N9RA 3M5AA 2V1QA 2P0KA 5CO7A 4J9DA 4J6WA 1ZUYA 3MP8A 4EMHA 2AT1B 4KULA 3SWNC 2DERA 1VUBA 3H0FA 3EGXA 4LDVA 1B7TA 5LJ3d 1WIEA 4BE1A 2CKKA 3CXCA 2DL7A 5ECAA 1WFWA 1YHQA 2D9TA 3QZ5B 2A08A 2DD5A 1G3SA 2C0OA 2L0AA 2DBKA 3JB9H 1VQ6Q 1P92A 1WZOA 1X6GA 1WQ7A 1R0CB 4PL6A 3HHTB 2GQIA 3CCST 3E2UA 3QJYA 1MMDA 3V7RA 3CC2Q 4KGZB 1UJYA 4QT7A 1X75C 5D6YA 1BYMA 4ZGEB 2CREA 3CCUT 2RHYA 2I2LA 3HP9A 2E10A 3E1SA 1LOJA 3EG9A 3CMAQ 2RHUA 2CZ7B 1FWZA 1Q7YU 1T3LA 4EPCA 2RJEA 4BI4A 2YLCA 3I55T 1BIBA 1KFZA 3RKWA 3HTRA 2ED0A 4RTVA 1M1GA 4EMGA 1CKAA 1TUCA 3QXEB 1F1BB 4RMOA 4HA8A 2HDAA 2BZYA 2O01E 1HD3A 2W10A 2EGCA 2RK2A 5L8RE 1V76A 1JQQA 2NUTA 1ZLMA 1T3SA 2KBTA 1ZHIA 2F2VA 2P0PA 2K7AA 1K8AC 4ZTJA 1I0CA 3NGPA 2VVKA 1QWFA 4PKCC 2L8DA 2RK1A 2JM9A 4UC4A 5KYXB 1TG0A 4AFZC 4DEYA 1EIFA 2B86A 2NUPA 4OB1B 4X34A 2ZPIB 3RR6A 3MJXA 1U1SA 2LX9A 4WCIA 1D0YA 1ARKA 2F1LA 2O9VA 5FWBA 2FVUA 4PJOE 1WGSA 1VQOQ 2MIOA 3A5ZB 2RI5A 1VQLA 4V2SA 1E6HA 1Y57A 1XTDA 4C92F 1VIEA 3UPUA 1KSWA 3VS4A 5GAN3 4O6JA 1TS9A 3EGDA 3VU3C 4AT1B 1U1TA 5GMKm 2PVOB 4HT8A 1RAFB 4CC2A 3MP1A 4IUTA 1RAHB 1SF9A 3MHXA 2EWNA 4L5GA 3SFMA 2HEQA 2HZYA 1QQJA 4AMCA 2FZGB 2J6OA 2SRCA 4AFUC 4FYVB 1NPPA 5DLOA 2VKNA 2KRMA 2X51A 2PUKB 2JMAA 3TREA 4DBQA 1IO6A 3JB9F 2V8JA 2EVRA 2KROA 4EIKA 1E7OA 1OEBA 3OS2A 4M78C 1NLOC 1TWBA 2FRYA 1PM3A 3LYIA 2E5QA 2QXFA 3X25B 4QVDA 4E47A 4Z02A 2CDTA 4QVCA 3M0PA 4BACA 4JLIA 1JJ2S 1YI2T 4PJMA 1YIJT 2DYIA 3JAME 1X69A 3GBQA 2JS0A 5KE2A 3M0RA 3QWYA 4JRPA 1PD1A 3CPWA 3CCRA 1Q82R 1N8RU 2DLPA 4F16A 2EIFA 4XAXB 1UGQB 2K3YA 1D0ZA 2RH2A 1X2QA 5CKFA 2FHDA 3OYYA 2DETA 4FSXA 2DL4A 3TQ7P 1WX6A 2O88A 2NLUA 1PG5B 1GFDA 4JPBW 1PKSA 2LJ0A 3L2UA 1H92A 4HCCA 3CCQQ 3REBB 5GAOn 1QP2A 2EQMA 3SWNB 1MV0B 2YWWA 1WXTA 1JRIA 2H3EB
chains in the Genus database with same CATH topology
5GAN4 1TH7A 3QDRB 2RA2A 5HY6A 3X20B 2JVVA 3L2QA 3FC3A 3G7ZA 3GPLA 4NOYA 3FB9A 2XD0A 1PSEA 1ZQ1A 3CC4A 3UT1A 2K57A 4MMKA 3QJ6A 1QVGA 1G5VA 4XTVA 1KQSA 4N0AC 5KCOA 4QQDA 4M7AC 1BI0A 2EJGA 1YITT 2VXEA 2EKOA 5DLQE 3M53A 5FLXE 3CXCS 2A7YA 5J26A 3JB9J 4M75E 1VQKA 2JNGA 2RO0A 4M78A 5A0GA 5LJ3e 2V8IA 4C8QA 3N5BB 3P8BB 4C92E 2OTJT 2DK3A 5I2MA 4C0ZA 3M4YA 4MZPA 3LGFA 4M77C 3FLGA 3ME9A 4C8QF 2LQ8A 3G71A 3HSBA 1V29B 4M78F 4RKUE 3CCQT 5GMKh 4M7AD 1LJOA 4A53A 4C0DB 2XK0A 2LT1A 3NTKA 2EJFA 3X26B 2KVQG 2L89A 1M1KU 2ZCFB 1KG1A 2ZPHB 1D3BB 1FX7A 4MZMA 2LNVA 1VQ6T 2QDYB 4OVAA 4HCBA 3Q1JA 2BUDA 4HCZA 5CAIA 3JCMh 2LVMA 4KUDK 4C92B 2QQ9A 2XICA 2AHJB 3DB4A 4ZTFA 2EJ9A 1SSFA 5GAN5 2V8KA 1NJIU 1WQWA 2GCXA 4RG2A 3G4SA 4J5YA 3FRNA 4OB2B 2QI2A 3FJPA 1UGRB 4E7LA 3LWHA 3S3NA 2Y4XA 3FDRA 1WPYA 2P4TA 3OBWA 5GAMj 3M55A 4PJOG 2E41A 2HD0A 1YHQT 2E65A 3GNGA 4ATOA 1H3ZA 2DTIA 2GFAA 1QVGS 3X28B 1BI1A 1MHNA 2QQRA 2A3LA 2BKDN 3QYGB 3RUXA 5GAOq 5A2QE 4PJOC 2XG8D 1VQOA 1M4ZA 3NTHA 1JBMA 1WNLA 4OF1A 3G4ST 5GAOr 3ZFJA 5J39A 1M90U 3RKYA 1OYXA 4C8QC 3HPWA 2G3RA 3H8ZA 4QVZA 3INZA 2DZ9A 4C8QE 4BD3A 1H641 2O4XB 1YJWA 3GLXA 5FROA 4F7UG 3CMEA 1VQ7T 4IUQA 2DAQA 3S6WA 2QTXA 2DTHA 1UGPB 1YBYA 5FRMA 4R56A 4L6V5 3DB3A 2LCLA 4XTZA 4M7AB 3BFMA 2D0QB 3PGGA 3CPFA 3ASKA 3PTAA 4BI8B 1N6AA 3PFSA 2RHXA 1M8VA 3OYAA 5C0MA 3J81E 3OS0A 3QG1A 4JRIA 2X4XA 4M77G 4C92D 1VQPA 1IREB 3RERA 2QQSA 4PLIA 4LD6A 4IKFA 3BW1A 1RL2A 5GAN8 4Y91A 4JJNK 4FIBA 5DM7R 1YJWT 4LDXA 4M7DF 1M1FA 5EG2A 3CC2T 4OB0B 5GANh 1VQPT 1QVFA 3VV0A 4XU2A 4EMKA 4Q5WA 2K5LA 3M9QA 1OI1A 3CEYA 1VQ9T 3GOXA 3OS1A 2EAYA 4OP0A 2RJCA 5LJ3h 1M1KC 4M7AE 1BI3A 2ZPGB 3EFRA 4R55A 3MCAB 4LDWA 1NPRA 5CVIA 5LJ5f 4M77E 3OA6A 3DLLA 1B34B 3CCMT 4XK8E 5GMKi 3CCSA 5FU7C 4IURA 3JSCA 2WSFE 3OYGA 2VYTA 2LQKA 3JCMQ 2X4WA 1Y71A 2CGHA 3CC4T 1I4K1 3JB9D 3CMET 3V8KA 2P0QA 3RKXA 3LLRA 3C95A 5CQXA 4EMKC 3I56A 1VQ7A 3ER0A 2DIQA 2PU9B 2MWOA 3R6OA 4KBMB 2PUOB 1VQNA 1KQSS 2R5AA 3OYHA 3KXTA 2GF7A 2RD1A 1YCYA 3OYFA 2E70A 2FYKA 1JJ2A 3OYNA 4FU6A 3OMGA 4C0DC 5IAYA 5GANg 1O75A 2CYZB 2DD4A 2R57A 4DOWA 3CMAA 2R5MA 3MP6A 4BB7A 4M77F 1K9MU 5DY9A 4KT0E 2K3XA 4E7KA 3PIOA 2QQBA 3CCQA 2E12A 1I5LA 3ZBDA 4C8QD 5GAMh 4M75G 5I2SA 2CS7A 5M9OA 5GMKe 2GQVA 4M78D 5GMKj 1Q7YC 1WJRA 3DLMA 3P8DA 3UDCA 1VQNT 4X9CA 3C12A 3OYEA 2M9UA 1S72T 2KAFA 1K8AU 3V7SA 5AYFA 4PJOA 4QQ6A 4QW2A 4F7UB 3HL8A 3HKSA 3X24B 3E9FA 2OAUA 2LTOA 5LJ5g 3S3OA 4C0GA 1VQ6A 4CRIA 5FU7B 3RIRA 1Q82U 4F7UF 2CZ0B 4HKEA 3A8GB 5LJ3g 1G3WA 3MEWA 4M78G 2Y4YA 3GF5A 2O4XA 2VUBA 4C8QG 1GXIE 4XTUA 2MF2A 2WACA 3HRSA 4BY6C 5GAN7 3CBMA 1K73U 4N4GA 3CC7T 3JCMX 4CI0C 3JCMc 3CD6T 3WVEB 2JN0A 2QA4A 3VYHB 3JCMV 1Y96B 4M75A 3M56A 4M7DE 1I81A 1VQ4T 3MEAA 4PJOF 1RI0A 4ZGDB 5GAOl 4M78B 3JCMW 3G6EA 2C06A 5CKDA 3CCEA 3HRTA 4XTWA 5CKBA 3JB9G 1VQKT 2PVGB 2Y90A 3QKJA 3L2VA 2FB7A 4B9WA 1YI2A 1K9MC 1MGQA 1Q86U 5CK9A 3KBGA 2X4JA 4M7AF 5IT9E 3FIFA 4WF2A 2DXBA 3NFCA 4LDYA 2ZZDA 4EMKB 5KE3A 1N9RA 2M16A 2XHCA 3OSSC 5GAOp 5GAMg 3HFOA 4P5NA 3VYGA 4IUVA 1NJIC 3M5AA 1WJSA 2E6ZA 2P0KA 2DEQA 3OYLA 1KHCA 4E7JA 5CO7A 1XOVA 4OMFB 5FU6B 4EDUA 2EQUA 4JUVA 1NZ9A 4J6WA 1W4SA 3OYBA 3MP8A 1W2BA 4JRQA 1B34A 4EMHA 3L2WA 4KULA 4QQGA 3SWNC 3JCMP 3QYHB 2ZPFB 5KCHA 1HK9A 1VUBA 1ZBXA 3L42A 3JCMf 3SD4A 4LDVA 4JDSA 2K5FA 4M77D 4C92G 1YIJA 4A54A 1M90C 1KQ2A 5LJ3d 3L2ZA 3MEUA 1BKBA 4BE1A 2CKKA 5A0LA 1M9SA 2LDMA 3BDLA 3CXCA 3GIBA 5LL6S 1YHQA 2D9TA 3QZ5B 4LDUA 2DD5A 2LC4A 4J7FA 1VQ8A 1Y07A 4ZN3A 3CMAT 1G3SA 2K5IA 3PMTA 5IN1A 4ZN1A 5CKHA 3CCLA 4IUPA 3H6ZA 5GAMe 2IG0A 2M1HA 2QEXT 2KDSA 3CCRT 3JB9H 4DOVA 4MZTA 2DIGA 1KC8C 1P92A 4NL3A 2H3JA 3E9GA 2DTOA 1WQ7A 4MMLA 3RMQA 5CR2A 5HKCA 3C4SA 2XDBA 4RG8A 2MI6A 4PL6A 1R8OB 3PMIA 3G6ET 4M7AA 3HHTB 1UEBA 3CCST 1KC8U 3QJYA 3LH0A 3V7RA 1N8RC 1HXDA 1O9SA 2B8AA 2X4YA 1X75C 3CBOA 5D6YA 1BYMA 4ZGEB 2KQWA 1YJNA 2K4YA 3M57A 1YJ9T 3CC7A 2CZ6B 2RHYA 2I2LA 3HP9A 2E10A 3E1SA 4XU3A 3OQ5A 4JLGA 3CCUT 3TU4K 4J8OA 1LOJA 3M4GA 4GLKA 2RHUA 3CD6A 2CZ7B 2VGMA 4M7DD 1FWZA 2HBPA 3OBYA 5GANj 3P8HA 3TCJA 1Q7YU 4EPCA 4M7DB 2RJEA 4BI4A 1Y96A 2F69A 2YLCA 5HK3A 3A8MB 4J7IA 5D6WA 3I55T 1BIBA 2RM4A 3RKWA 2DO3A 3OSVA 4ZGJB 3PT9A 2RI3A 3F70A 1M1GA 2WSEE 4M77B 3WXMB 4A4EA 3S3MA 3EFSA 4EMGA 3JCMb 5GANe 1DJ7B 4ME7A 1M5Q1 1OZ3A 4N4HA 5GAN2 3QXEB 4X9DA 3OS5A 1VQ5T 5KH6A 4RMOA 1NE8A 2ZPBB 1UB4A 1K73C 3C94A 3GNFB 4HA8A 4J83A 4N4IA 3J7AF 4M7DC 3V8LA 2RB6A 3VKIA 3CCVA 4M7AG 5GAN6 5FRNA 3LGLA 5LJ3f 4TVRA 2O01E 1BI2A 3QO3A 3OW2A 1VQ4A 4RCCA 2F5TX 4BY6B 4NS5A 5LJ5h 2E6NA 2JOYA 3PIPA 1U8RA 2RK2A 5L8RE 1Q82C 4A4FA 5LJ5e 3L2RA 5CCAA 3SWNA 3VUBA 3FEOA 3GP8A 2RJDA 3TEEA 1ZHIA 2P0PA 3JB9I 3OYJA 1QVPA 3OYDA 5CQYA 1K8AC 1S72A 4ZTJA 3JCMg 2XIDA 4XTXA 4O5VA 1Q86C 3CCET 4BDYA 2OTJA 1BIAA 4PKCC 1PSFA 2K2VA 5GMKl 2L8DA 1WJQA 2RK1A 3EAEA 3QBYA 4C5EA 3LX7A 2MMPA 4UC4A 2KY9A 2DXTA 4II1A 2HQXA 1EIFA 2VV5A 4DQ2A 3OW2S 4PJOB 4RCBA 3V8JA 4D6WA 2WSCE 4N0AA 4C5HA 4BE0A 2E1HA 5CKEA 2VGNA 4OB1B 3SB2A 4C8QB 4NL2A 4X34A 4OGEA 5D6XA 2XDPA 2ZPIB 4M78E 1VQLT 2DPPB 3CC2A 5GAMf 4A4KA 3I56T 4JS5A 1U1SA 2LX9A 5GAMd 4LD9K 4B9XA 2HQEA 5GAOm 3UWNA 3A8HB 2FVUA 4XU1A 4PJOE 3O8VA 1KHIA 3BY7A 4M75F 2MWPA 1D3BA 2CZ1B 1Q81U 2VXFA 1WGSA 2IVWA 2QA4T 4M7DG 3CBPA 4M75B 2EQJA 3A5ZB 3QZ9B 2RI5A 1VQLA 1N27A 3JCMe 4C0FA 4V2SA 2GFUA 2ZPEB 1XTDA 1YJNT 4C92F 1VIEA 4A4HA 3KUFA 3UPUA 1VIFA 2KMTA 5GAN3 4O6JA 1VQ8T 3SDZA 4OB3B 5HK0A 3VU3C 1U1TA 2JTMA 3BDUA 2PVOB 5GMKm 1VQMA 4HT8A 1IZ6A 3JRZA 3E19A 3MP1A 2L3RA 4IUTA 4BE2A 4E7HA 2YLBA 1KD1C 2PQWA 3QHSA 2DVEA 3WVDB 1AHJB 3MHXA 4MDXA 2HNIA 3AHUA 2EWNA 4L5GA 1VQOT 3M54A 4M77A 3SFMA 2RI2A 5FU6C 4A4GA 3CCVT 4J6YA 4ELYC 3MEVA 2LCCA 2OTLT 2HAXA 1NPPA 5DLOA 4E7IA 3OY9A 2XI9A 5A0DA 4M75C 2YHTA 2PUKB 1W2BS 3TREA 1VQ5A 3CCUA 2R58A 3JB9F 1LNXA 2V8JA 3M59A 5GANf 5LJ5j 4FT4A 2LT4A 2VC8A 1G3YA 2MAMA 3DKMA 4ELZC 3META 1KD1U 1YITA 4XTYA 3CCJT 3QUIA 3CPWS 1FXXA 2YRVA 1Y7XA 3OYIA 4Y28E 4FT2A 3OMCA 5C6SA 3JCMd 4JRKA 4M78C 3OS2A 4BDZA 4C5IA 3I55A 3QPHA 4C5GA 3M58A 2DKGA 3NTIA 2L5QA 4FL6A 3LYIA 2E5QA 2QXFA 2RHIA 2EQKA 3QSUA 2BIVA 3X25B 4QVDA 1XNIA 1I8FA 5LJ5d 1VQ9A 4PLLA 2E64A 4E47A 2JZ2A 3LWIA 4Z02A 2DXCA 1YJ9A 4BUGA 1QW1A 4MDWA 2ZGWA 3VUZA 4QVCA 2XU8A 3L1AA 4C92A 4JLIA 4XU0A 4GY5A 4BACA 3ZEHA 5LJ3j 1YI2T 1JJ2S 3RESA 3OYKA 1Q81C 1X01A 1G3TA 2RHZA 4J6XA 4OGCA 1YIJT 2KK4A 2DJZA 4XQ3A 3JAME 3JCMJ 2X35A 2F5KA 5KE2A 1QP3A 3LW5E 1OZ2A 2QEXA 4PNOA 1XQHA 4YTLA 3URGA 3CCLT 4JRPA 4HT9A 2JUFA 3VJPA 4M7DA 2PVDB 4BI3A 3CPWA 3CCRA 3RMSA 1N8RU 2DXUA 3PNWC 4JS4A 4PJOD 2EIFA 4XAXB 1UGQB 2OTLA 1N9SA 2JTFA 3V7CA 2K3YA 2XDDA 4DA4A 4VUBA 2RH2A 1KQ1A 3CCJA 5CKFA 3OYCA 2LRQA 3MO8A 3OYMA 2FHDA 4FM4B 3T9NA 4KUIA 3OYYA 2M0OA 4FSXA 2DZCA 3OB9A 5J3BA 2D6FA 1X6OA 4L59A 2FL7A 2KSSA 1VQMT 2NLUA 4M75D 1QVFS 3HFNA 5I21A 2QQAA 3HRUA 4F7UA 2XKOC 5CIUA 4F7UE 5GANd 3L2UA 1UGSB 4HCCA 4IUUA 3J80E 3CCMA 5GAOn 3A8OB 1QP2A 2EQMA 3A8LB 3QIIA 3SWNB 1JRIA 2EFIA 2RJFA 4C92C 3G71T 2EYQA 1JB0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4X A;  2LC4 A;  2IVW A;  2Y4Y A;  2LNV A;  3OSS C; 
#chains in the Genus database with same CATH topology
 3X20 B;  1N5Z A;  3L2Q A;  1X2K A;  2GTJ A;  2K57 A;  1SKU B;  1C0M A;  1TXQ A;  4CC4 B;  1EZZ B;  4M7A C;  1BI0 A;  2VXE A;  2EKO A;  5DLQ E;  5FLX E;  1BB9 A;  2J06 A;  2V8I A;  1B3Q A;  5I2M A;  3M4Y A;  4MZP A;  3QDF A;  4RKU E;  4A53 A;  4C0D B;  4DBR A;  2EJF A;  1M1K U;  1YI2 Q;  1WHG A;  1BCM A;  1VQ6 T;  2EYW A;  4HCZ A;  3EG2 A;  2XIC A;  1B07 A;  2EJ9 A;  1WQW A;  1TSF A;  3FRN A;  4OB2 B;  3FJP A;  1SEM A;  3S3N A;  3EGD B;  1I07 A;  3FDR A;  2DVJ A;  2HD0 A;  2W0Z A;  1K8A R;  2GFA A;  1VYV A;  4PJN A;  2QGG A;  2QQR A;  3QYG B;  2LX7 A;  5GAO q;  5A2Q E;  1PCX A;  4OF1 A;  1S72 Q;  2IIM A;  1BBZ A;  1M2V A;  3INZ A;  1FMV A;  1H64 1;  5FRO A;  1VQ7 T;  2MK5 A;  1KIK A;  1MNE A;  3M0U A;  4M4Z A;  4R56 A;  4L6V 5;  4M7A B;  3BFM A;  4QKU A;  2KYM A;  3PGG A;  3ASK A;  3CCR Q;  4KGV B;  1U06 A;  1AVZ C;  2X4X A;  4C92 D;  2C0T A;  1VQ4 Q;  3RER A;  1WDX A;  2QQS A;  2VB6 A;  4IKF A;  1JEG A;  1Q86 R;  4OB0 B;  1VOM A;  1SRM A;  3VS2 A;  4KH1 B;  9ATC B;  3M9Q A;  3OW2 P;  2LQN A;  2J6F A;  3SHW A;  3GOX A;  2GGR A;  2EAY A;  5LJ3 h;  1M1K C;  1M3A A;  4R55 A;  3MCA B;  4K11 A;  3DLL A;  3H9N A;  2FG0 A;  5GMK i;  1H8K A;  3CCS A;  4IUR A;  2LQK A;  3JCM Q;  2X4W A;  2YUP A;  2CGH A;  1KC8 R;  3JB9 D;  1VQ7 A;  3V8K A;  4M7A E;  2HCK A;  3LLR A;  4EMK C;  3I56 A;  2PU9 B;  2MWO A;  1VQN A;  2R5A A;  3OMG A;  5GAN g;  1CKB A;  1O75 A;  2QAZ A;  2DD4 A;  2R5M A;  3CD6 Q;  5DY9 A;  4E7K A;  4C8Q D;  5GAM h;  5GMK j;  2GQV A;  1Q7Y C;  3P8D A;  1VQN T;  1S72 T;  3OYE A;  2QEX Q;  1K8A U;  2ROL A;  3HKS A;  3X24 B;  1GRI A;  3E9F A;  4CRI A;  4M78 G;  4C8Q G;  3MPU B;  1K73 U;  2KT8 A;  4N4G A;  3VYH B;  3JCM V;  4M75 A;  4PJO F;  2JW4 A;  1VA7 A;  2J7I A;  4FYW B;  5GAO l;  2C06 A;  4M78 B;  3CCE A;  2Y90 A;  3L2V A;  2L3Q A;  1Q86 U;  2X4J A;  4M7A F;  5IT9 E;  3FIF A;  4JZ3 A;  4LDY A;  2ED1 A;  1NEG A;  3VYG A;  4IUV A;  1UJ0 A;  2LMJ A;  2DEQ A;  5FU6 B;  3EH1 A;  2EQU A;  2LQW A;  1B34 A;  4QQG A;  1LVK A;  3JCM P;  1FYN A;  2ZPF B;  5KCH A;  1HK9 A;  1M30 A;  3JCM f;  3PE0 A;  1YIJ A;  1QCO A;  1M90 C;  2ESW A;  1WXU A;  1BKB A;  3TVT A;  1RAG B;  2LC4 A;  1K0X A;  4ZN3 A;  5IN1 A;  2K5I A;  4ZN1 A;  1ZA1 B;  3CCL A;  1M2V B;  5KYW B;  2H3J A;  2MI6 A;  3G6E T;  1R8O B;  1UEB A;  2A37 A;  1N8R C;  1HXD A;  1QMC A;  2B8A A;  2CSI A;  2JS2 A;  1YJ9 T;  3M57 A;  5IHN A;  2CZ6 B;  4XU3 A;  1VQ9 Q;  4JLG A;  2MOX A;  3U23 A;  4GLK A;  3VS0 A;  3CD6 A;  4M7D D;  3OBY A;  3TCJ A;  2DF6 A;  3I9Q A;  3OSV A;  2I0N A;  1WHK A;  2RI3 A;  2WSE E;  4M77 B;  1LPL A;  3EFS A;  3JCM b;  1IHV A;  3CCL Q;  4ME7 A;  1M5Q 1;  5GAN 2;  2X9H A;  3RDV A;  5KH6 A;  3RBB B;  2ZPB B;  1GCP A;  3EH2 A;  3GNF B;  4M7D C;  1YFN A;  1PC0 A;  5LJ3 f;  3NHN A;  2EQI A;  4RCC A;  2F5T X;  2JOY A;  3PIP A;  2KT1 A;  1Q82 C;  4A4F A;  1TUD A;  2RJD A;  1QVP A;  3JCM g;  2XID A;  4XTX A;  4BDY A;  1PSF A;  4Z8A A;  3LX7 A;  2MMP A;  2DXT A;  2HQX A;  1VQ5 Q;  4BE0 A;  4C5H A;  2DL8 A;  1KD1 R;  4NL2 A;  4LXC A;  5D6X A;  2DPP B;  5GAM f;  3I56 T;  5GAM d;  4HXJ A;  5GAO m;  3A8H B;  4XU1 A;  1M2O A;  3O8V A;  4M75 F;  3BY7 A;  2VXF A;  4DBH A;  1OOT A;  4IIM A;  2QA4 T;  4M7D G;  4M75 B;  1GCQ A;  3QZ9 B;  4LNP A;  4C0F A;  2YXY A;  1YJN T;  3CPW P;  1VIF A;  2HBW A;  2A28 A;  2C0I A;  2JTM A;  4BE2 A;  3E19 A;  2HKN A;  4E7H A;  1KD1 C;  2DVE A;  2COY A;  1GL5 A;  1AHJ B;  2HNI A;  3AHU A;  3CCV T;  2RI2 A;  2XMF A;  5IH2 A;  4J6Y A;  4ZNX A;  1RAD B;  1VQ5 A;  2R58 A;  4FSS A;  1LNX A;  2NUZ A;  2LT4 A;  1G3Y A;  3MET A;  1YIT A;  4RTZ A;  3OYI A;  3A1P A;  3UF4 A;  3I55 A;  3QPH A;  1YIT Q;  2DKG A;  2VAS A;  1QWE A;  2DRK A;  2JXB A;  3QSU A;  3CCU Q;  3VS7 A;  5LJ5 d;  2DXC A;  1BCO A;  1S1N A;  3IQL A;  2FPD A;  2KXC A;  2VWF A;  3LW5 E;  1VYT A;  2DA9 A;  1TOV A;  1OU8 A;  4PJJ A;  3CCL T;  3URG A;  4M7D A;  2K9G A;  4J9B A;  4FYX B;  2CSQ A;  2DM1 A;  2V26 A;  2OTL A;  3V7C A;  2CT4 A;  4DA4 A;  3I35 A;  1KQ1 A;  3KFV A;  1QKW A;  2D1X A;  4FM4 B;  3G4S Q;  3M0S A;  1UTI A;  3OB9 A;  1PRL C;  1IGQ A;  2CP5 A;  2KSS A;  1VQM T;  5CIU A;  2DNU A;  1K0S A;  3PVL A;  1GFC A;  2RJF A;  2EFI A;  1JB0 E;  5HY6 A;  2RA2 A;  1M27 C;  2D8J A;  4DEX A;  1UFF A;  3GPL A;  4NOY A;  3FB9 A;  2CP2 A;  3CC4 A;  4ANJ A;  3UT1 A;  3QJ6 A;  4XTV A;  1KQS A;  2Z0W A;  3M53 A;  3JB9 J;  4M75 E;  4C92 E;  2QA4 Q;  4C0Z A;  4F17 A;  4R0K A;  3LGF A;  1RLQ C;  4C8Q F;  3G71 A;  4M78 F;  4M7A D;  5GMK h;  1KG1 A;  3X26 B;  2KVQ G;  2L89 A;  2DE0 X;  1EFN A;  1NG2 A;  1Z9Q A;  4OVA A;  4HCB A;  3Q1J A;  2BUD A;  1AD5 A;  2LVM A;  4C92 B;  4KUD K;  2QQ9 A;  5IHK A;  4ZTF A;  2BZ8 A;  2V8K A;  1NJI U;  4RG2 A;  4J9H A;  3G4S A;  1ABQ A;  2QI2 A;  3LWH A;  2LCS A;  1OUL A;  3VRY A;  1GCQ C;  4JJB A;  4RTX A;  2DTI A;  2RQT A;  2BKD N;  1VQO A;  4OMP A;  3G4S T;  1M90 U;  1YJW Q;  4DBF A;  5J39 A;  4C8Q C;  2L3S A;  3H8Z A;  2DZ9 A;  4C8Q E;  1Q7Y R;  4BD3 A;  1IRX A;  1YJW A;  3CME A;  2OI3 A;  2DAQ A;  2CT3 A;  5FRM A;  2MPX C;  4LUE A;  2LCL A;  1FMK A;  3PTA A;  4BI8 B;  5IXF A;  3FJ5 A;  2K2M A;  1M8V A;  3OYA A;  5C0M A;  3J81 E;  3OS0 A;  1VQP A;  4PLI A;  3EG9 B;  1RL2 A;  5GAN 8;  4Y91 A;  4JJN K;  4LDX A;  1QVF A;  5GAN h;  3C0C A;  1PWT A;  4EMK A;  4RTU A;  4HVU A;  2RJC A;  2A0F B;  3EFR A;  2HSP A;  5EC7 A;  4LDW A;  1NPR A;  2RMO A;  5LJ5 f;  2NWM A;  3OA6 A;  1G2B A;  3EG3 A;  3UA7 A;  2CP3 A;  2D8H A;  1I4K 1;  1AOJ A;  3CC4 T;  3CME T;  3RKX A;  2M02 A;  2DIQ A;  2PUO B;  3OYH A;  2KYB A;  1VQP Q;  3OYN A;  4FU6 A;  3VS5 A;  2PTK A;  5IAY A;  4DOW A;  4BB7 A;  1K9M U;  4AFS C;  3PIO A;  1I5L A;  2P4R A;  2O9S A;  5GMK e;  1BK2 A;  4M78 D;  2DEU A;  2M9U A;  2KAF A;  4PJO A;  4QQ6 A;  4QW2 A;  1KJW A;  4F7U B;  1OX9 A;  2LTO A;  3S3O A;  5FU7 B;  4F7U F;  4HKE A;  3A8G B;  5LJ3 g;  1G3W A;  2Y4Y A;  2YUN A;  3GF5 A;  1AEY A;  1GXI E;  1UGV A;  1ZA2 B;  3HRS A;  4A63 B;  4BY6 C;  8AT1 B;  5GAN 7;  3CBM A;  2DRM A;  4CI0 C;  1PD0 A;  2JN0 A;  3EHR A;  1Y96 B;  1VQ4 T;  4OMO A;  3G6E A;  2X3X D;  3HRT A;  3JB9 G;  5CKB A;  2PVG B;  3QKJ A;  1YI2 A;  1MGQ A;  1X27 A;  3KBG A;  1G83 A;  2DXB A;  1Z9Z A;  3TSZ A;  5GAO p;  2XHC A;  5GAM g;  3HFO A;  2RF0 A;  2DMO A;  4EDU A;  4D8D A;  3OYB A;  1W2B A;  1EX4 A;  3L2W A;  1ZBX A;  3R6N A;  3H0H A;  3SD4 A;  4C92 G;  3QWX X;  2K5F A;  4HCK A;  4JDS A;  5KYN A;  4A54 A;  3ULR B;  3MEU A;  1M3C A;  5A0L A;  1M9S A;  3BDL A;  3CCE Q;  3GIB A;  1JXO A;  1VQ8 A;  2LNH B;  4KH0 B;  3CMA T;  3PMT A;  1RAC B;  1RUW A;  2RN8 A;  4IUP A;  5GAM e;  2IG0 A;  2M1H A;  2QEX T;  3CCR T;  4DOV A;  4MZT A;  2HQH A;  3M0Q A;  2K79 A;  4NL3 A;  3E9G A;  2DTO A;  2DL3 A;  3C4S A;  4E2F B;  2XDB A;  4RG8 A;  1KC8 U;  3LH0 A;  1M8M A;  2KQW A;  1YJN A;  4J8O A;  1ABO A;  3M4G A;  1RAE B;  5GAN j;  2AIR B;  3P8H A;  2CUD A;  1UHF A;  1Q81 R;  5D6W A;  2DO3 A;  1FMW A;  4ZGJ B;  3PT9 A;  3F70 A;  1D1A A;  4A4E A;  1X43 A;  5GAN e;  1DJ7 B;  1OZ3 A;  4N4H A;  3OS5 A;  2EGE A;  1VQ5 T;  1NE8 A;  1UB4 A;  1ZSZ B;  4J83 A;  3C94 A;  1PRM C;  3V8L A;  2RB6 A;  3CCV A;  5GAN 6;  4TVR A;  3QO3 A;  2EPD A;  5LJ5 h;  1U8R A;  5LJ5 e;  3L2R A;  3SWN A;  3VUB A;  3TEE A;  4AFQ C;  3JB9 I;  3OYD A;  5CQY A;  1S72 A;  1J3T A;  1MND A;  1GBR A;  4O5V A;  1Q86 C;  3CCE T;  2OTJ A;  2CP6 A;  2K2V A;  1WJQ A;  4OMM A;  4C5E A;  2KY9 A;  4PJO B;  2VV5 A;  4OMN A;  4N0A A;  1H3H A;  1K4U S;  4C8Q B;  2DFU A;  2XDP A;  3CC2 A;  2YUO A;  3CME Q;  1IXD A;  2P84 A;  3O5Z A;  2HQE A;  3UWN A;  4J9C A;  4E6R A;  2MWP A;  2CH4 W;  1D3B A;  2CZ1 B;  3JV3 A;  2GTO A;  2IVW A;  2EQJ A;  3EFO A;  1NYG A;  4AG2 C;  1N27 A;  2V1R A;  2GFU A;  2YUQ A;  4A4H A;  2KMT A;  4OB3 B;  3VS3 A;  4RTT A;  1SRL A;  1VQM A;  1IZ6 A;  2QYZ A;  6AT1 B;  2YLB A;  4ORZ A;  2PQW A;  1IHW A;  3M0T A;  1VQO T;  3M54 A;  4M77 A;  4A4G A;  2DL5 A;  4ELY C;  3MEV A;  2COW A;  1YHQ Q;  2GBQ A;  2LCC A;  2OTL T;  3CXC P;  2XI9 A;  4M75 C;  2YHT A;  2BE7 D;  1YIJ Q;  2KRN A;  4FT4 A;  4ELZ C;  1KD1 U;  2ATC B;  4XTY A;  2L2P A;  3CC4 Q;  1Y7X A;  3G6E Q;  3OMC A;  5C6S A;  2AZV A;  1QVG P;  3M58 A;  3NTI A;  2L5Q A;  4FL6 A;  1OPL A;  2RHI A;  2EQK A;  2BIV A;  2OJ2 A;  4PLL A;  2E64 A;  1YJ9 A;  4BUG A;  1QW1 A;  2ZGW A;  5FWC A;  3L1A A;  4C92 A;  4GY5 A;  3ZEH A;  4FW1 A;  5LJ3 j;  2JM8 A;  1X01 A;  2RHZ A;  1KK7 A;  4OGC A;  2YT6 A;  3JCM J;  2DJZ A;  2X35 A;  3CCJ Q;  1QP3 A;  2RQV A;  4PNO A;  4YTL A;  4HT9 A;  2JUF A;  3VJP A;  2PVD B;  2SEM A;  2HMA A;  2GNC A;  1N9S A;  2JTF A;  5GJW B;  4PFO A;  2K6D A;  4VUB A;  1K73 R;  3OYC A;  3MO8 A;  3OYM A;  2O2O A;  1K9A A;  3T9N A;  2AKL A;  2M0O A;  2LJ3 A;  2DZC A;  2D6F A;  1X6O A;  4L59 A;  2FL7 A;  3HFN A;  3HRU A;  5GAN d;  4F7U E;  4LN2 A;  4IUU A;  2O31 A;  3CCM A;  2H8H A;  3A8L B;  3QII A;  2OTJ Q;  2YSQ A;  2DTH A;  3NMZ C;  1ACM B;  4C92 C;  3HSB A;  2EYQ A;  1GBQ A;  2JMC A;  5GAN 4;  1TH7 A;  1HSQ A;  2QGF B;  3G7Z A;  4IIO A;  1PSE A;  1ZQ1 A;  4MMK A;  5IHI A;  1QVG A;  2KR3 A;  5KCO A;  5KYX A;  2EJG A;  1NEB A;  1YIT T;  2A7Y A;  2NUP B;  5J26 A;  2JNG A;  2RO0 A;  4M78 A;  5A0G A;  3VRZ A;  5LJ3 e;  4C8Q A;  3N5B B;  4LUD A;  1BU1 A;  1NLP C;  4B6M A;  1R0B G;  4M77 C;  3FLG A;  3ME9 A;  2LQ8 A;  1V29 B;  5IXB A;  3CCQ T;  1LJO A;  2LT1 A;  3NTK A;  3EG1 A;  1TTH B;  3G71 Q;  2EYY A;  1D3B B;  3ZL7 C;  1FX7 A;  4MZM A;  3CQT A;  2KI7 A;  3CCM Q;  3JCM h;  1XJW B;  1I1J A;  2AHJ B;  3DB4 A;  5GAN 5;  1SSF A;  2GCX A;  1KQS P;  4E7L A;  1W6X A;  2Y4X A;  2JTE A;  3OBW A;  3M55 A;  4PJO G;  1PHT A;  2E41 A;  2E65 A;  3GNG A;  4FYY B;  1H3Z A;  2JT4 A;  3I5R A;  5HCK A;  4CC7 A;  2XG8 D;  4FCY A;  1M4Z A;  3NTH A;  1JBM A;  2QAS A;  3ZFJ A;  1TU0 B;  3RKY A;  3HPW A;  4GBQ A;  4J9F A;  1G8X A;  3GLX A;  5KYW A;  1YNZ A;  2QTX A;  1YBY A;  3UAT A;  2QK0 A;  3DB3 A;  1WLP B;  1ZBJ A;  3PFS A;  3QG1 A;  1IRE B;  2KNB B;  4LD6 A;  5KYY A;  3BW1 A;  1MMN A;  2HSE B;  1YN8 A;  4FIB A;  2CP0 A;  1ZUU A;  2HKQ B;  4XU2 A;  1Y0M A;  1HYO A;  1QLY A;  3CEY A;  3OS1 A;  1PKT A;  1WA7 A;  1N8R R;  5CVI A;  3THK A;  1TUG B;  4XK8 E;  1NBE B;  5FU7 C;  4F14 A;  3JSC A;  2WSF E;  2VYT A;  4OML A;  3EGX B;  1JXM A;  4KRT A;  3ER0 A;  3R6O A;  4KBM B;  1OPK A;  2RD1 A;  1YCY A;  3OYF A;  1JJ2 A;  4C0D C;  2EGA A;  2R57 A;  1IGU A;  1YP5 A;  2K3X A;  1M90 R;  2A36 A;  3CCQ A;  2ZAE A;  3EHQ A;  4M75 G;  2CS7 A;  5I2S A;  5M9O A;  5FW9 A;  3DLM A;  3PVQ A;  4X9C A;  3C12 A;  4PFP A;  5AT1 B;  5AYF A;  3D7S B;  3HL8 A;  2OAU A;  5LJ5 g;  1UG1 A;  1VQ6 A;  3RIR A;  1UHC A;  3A98 A;  1Q82 U;  2CZ0 B;  1RAA B;  1E6G A;  1X6B A;  3MEW A;  2QG9 B;  2O4X A;  2YDL A;  4D8K A;  2WAC A;  3CC7 T;  3CD6 T;  3LH5 A;  2F2X A;  1LCK A;  2QA4 A;  4E7Z A;  2KGT A;  4M7D E;  1AZG B;  4E7S A;  1JU5 C;  3JCM W;  2BTT A;  2FPE A;  2FB7 A;  2ZZD A;  4EMK B;  5KE3 A;  2M16 A;  3OSS C;  2RQW A;  4P5N A;  1NJI C;  1WJS A;  2E6Z A;  3OYL A;  1KHC A;  4E7J A;  1XOV A;  4OMF B;  4JUV A;  1NZ9 A;  1W4S A;  1U3O A;  2FZC B;  1NJI R;  1AWJ A;  2EKH A;  4JRQ A;  3QYH B;  3L42 A;  1NYF A;  1K9M R;  4M77 D;  1ZX6 A;  1KQ2 A;  3L2Z A;  2LDM A;  1WI7 A;  5LL6 S;  1V1C A;  4LDU A;  4J7F A;  2K3B A;  1Y07 A;  4KGX B;  5CKH A;  2EBP A;  3H6Z A;  2D0N A;  2KDS A;  2DIG A;  1KC8 C;  3RMQ A;  4MML A;  4FW2 A;  5CR2 A;  5HKC A;  4M7A A;  3PMI A;  5GJV B;  4JZ4 A;  1O9S A;  1QKX A;  2X4Y A;  3CBO A;  2RQR A;  3EFO B;  2FO0 A;  4Z88 A;  2K4Y A;  1IB8 A;  3CC7 A;  3OQ5 A;  3TU4 K;  1RLP C;  1WHJ A;  2DYB A;  4RTY A;  1OQK A;  2VGM A;  2HBP A;  2E3I A;  1VQ8 Q;  4M7D B;  1Y96 A;  2F69 A;  1PNJ A;  5HK3 A;  3A8M B;  4J7I A;  1UEC A;  2QTV A;  2RM4 A;  2FEI A;  2EYZ A;  2LZ6 B;  3WXM B;  3S3M A;  4RTW A;  4Y92 A;  4X9D A;  1MMA A;  1K73 C;  4N4I A;  1WYX A;  1YCS B;  2ECZ A;  2HL5 C;  3J7A F;  3VKI A;  2FRW A;  4M7A G;  2EW3 A;  5FRN A;  3LGL A;  1BI2 A;  3OW2 A;  1WHM A;  1WHH A;  4BY6 B;  2LJ1 A;  4NS5 A;  2E6N A;  2BE9 B;  4GLM A;  2AKK A;  5CCA A;  3FEO A;  3GP8 A;  3OYJ A;  1CSK A;  5I22 A;  1BIA A;  2EYX A;  1MMG A;  5D7U A;  5GMK l;  3EAE A;  3QBY A;  3VS6 A;  4II1 A;  4DQ2 A;  3OW2 S;  1D0X A;  1YJN Q;  4RCB A;  3V8J A;  4D6W A;  2WSC E;  2E1H A;  3CC7 Q;  5CKE A;  2VGN A;  3SB2 A;  1ZSG A;  4OGE A;  3NPF A;  1VQL T;  4M78 E;  4A4K A;  4JS5 A;  4LD9 K;  4B9X A;  1QVF P;  3TSW A;  1KHI A;  2CP7 A;  1K76 A;  2PZ1 A;  1Q81 U;  1YWP A;  3CBP A;  4LE9 A;  3H0I A;  5KYU A;  3JCM e;  2ZPE B;  1RI9 A;  2NYS A;  3KUF A;  1UUE A;  1VQ8 T;  3SDZ A;  5HK0 A;  3BDU A;  1JO8 A;  3JRZ A;  1C6V X;  2L3R A;  1W2B P;  2MYS A;  3QHS A;  3WVD B;  4MDX A;  2YRC A;  2KRS A;  1SG5 A;  1AWW A;  5FU6 C;  1OU9 A;  2DX1 A;  1SHG A;  2J05 A;  1Q95 G;  2HAX A;  2RNA A;  4E7I A;  5I11 A;  3OY9 A;  1AWO A;  5A0D A;  2COZ A;  7AT1 B;  4PK4 A;  1W2B S;  3CCU A;  4J9I A;  3M59 A;  5GAN f;  5LJ5 j;  2VC8 A;  2MAM A;  2NUT B;  3DKM A;  3CCJ T;  3QUI A;  3CPW S;  1FXX A;  2YRV A;  4Y28 E;  4FT2 A;  3JCM d;  3UA6 A;  2DJQ A;  4JRK A;  4ESR A;  4BDZ A;  1MV3 A;  2DBM A;  4C5I A;  1SSH A;  4C5G A;  2YRD A;  4OMQ A;  3CCV Q;  3G1J A;  1XNI A;  1I8F A;  1VQ9 A;  2JZ2 A;  3LWI A;  2BZX A;  1AWX A;  4MDW A;  3VUZ A;  2XU8 A;  2FZK B;  4XU0 A;  3RES A;  2E4H A;  3OYK A;  1Q81 C;  1G3T A;  4J6X A;  2KK4 A;  4XQ3 A;  2X3W D;  2F5K A;  1VQM Q;  8ATC B;  1OZ2 A;  2QEX A;  1XQH A;  2OAW A;  4BI3 A;  3RMS A;  4HVW A;  2DXU A;  3PNW C;  4JS4 A;  4PJO D;  2IPO B;  2XDD A;  3CCJ A;  2LRQ A;  1D1C A;  4F04 B;  4KUI A;  4Z89 A;  2OX7 A;  5J3B A;  1OX8 A;  2PNI A;  1RAI B;  4M75 D;  1QVF S;  5I21 A;  1W1F A;  2QQA A;  1R77 A;  2XKO C;  4F7U A;  1A0N B;  1UGS B;  2FPF A;  2OTL Q;  3J80 E;  3A8O B;  3EG0 A;  2G6F X;  2HL3 A;  3G71 T;  3QDR B;  3FC3 A;  2JVV A;  2KE9 A;  1T0H A;  2M51 A;  2XD0 A;  2CH4 A;  1JJ2 P;  1G5V A;  4N0A C;  4QQD A;  1WHL A;  1QCF A;  1VQ4 A;  1VQK A;  3CXC S;  4PFZ A;  2F2W A;  3P8B B;  2DK3 A;  1NM7 A;  2RPN A;  3REA B;  2XK0 A;  2L3P A;  2ZCF B;  2ZPH B;  2LNV A;  1D09 B;  2DIL A;  2QDY B;  1VYU A;  5CAI A;  2KXD A;  5KYU B;  4J9G A;  1T0J A;  4PJL A;  4J5Y A;  1UE9 A;  1UDL A;  1WXB A;  1UGR B;  1I5O B;  4CC3 A;  1M3B A;  1WPY A;  2P4T A;  5GAM j;  1YHQ T;  3MKD A;  2E3H A;  1SPK A;  4ATO A;  2ENM A;  1QVG S;  1VQL Q;  3X28 B;  3RNJ A;  3EGU A;  3I5S A;  1BI1 A;  1MHN A;  2A3L A;  4PJO C;  3RUX A;  1OV3 A;  1HJD A;  1VQN Q;  5GAO r;  1WNL A;  3VS1 A;  1OYX A;  2G3R A;  2J6K A;  4QVZ A;  4HVV A;  2O4X B;  4F7U G;  4IUQ A;  3S6W A;  1AT1 B;  1UGP B;  4XTZ A;  2D0Q B;  3CPF A;  3SEM A;  1W70 A;  1N6A A;  2RHX A;  1MUZ A;  4WTO B;  1C1A A;  2AK5 A;  4JRI A;  1ZSZ C;  4M77 G;  2ROT A;  1YJW T;  5DM7 R;  3CCS Q;  4M7D F;  1M1F A;  1VQK Q;  5EG2 A;  3CC2 T;  3AT1 B;  1VQP T;  3VV0 A;  2AZS A;  4Q5W A;  2ABL A;  2K5L A;  1VQ7 Q;  1OI1 A;  1VQ9 T;  1K1Z A;  4OP0 A;  1BI3 A;  2E5K A;  2ZPG B;  4M77 E;  1B34 B;  3CCM T;  4RUG A;  4JJD A;  3OYG A;  3I55 Q;  1ZSZ A;  1U5S A;  1Y71 A;  2P0Q A;  3C95 A;  5CQX A;  4JJC A;  1KQS S;  3KXT A;  2GF7 A;  2E70 A;  2FYK A;  2JJ9 A;  3BE3 A;  2CYZ B;  3CMA A;  3MP6 A;  4M77 F;  1YWO A;  4KT0 E;  2QQB A;  2MCN A;  2CUB A;  2E12 A;  3ZBD A;  2QDL A;  2OTJ T;  1WJR A;  3UDC A;  4X1V A;  3H41 A;  3V7S A;  1M1K R;  1ZUK A;  2KEA A;  4C0G A;  1RAB B;  4J9E A;  2VUB A;  1D1B A;  4XTU A;  2MF2 A;  1YJ9 Q;  2LP5 A;  2RQU A;  1QCN A;  5L23 A;  3JCM X;  3JCM c;  3WVE B;  1SHF A;  3M56 A;  1I81 A;  3MEA A;  3I56 Q;  1RI0 A;  4ZGD B;  5CKD A;  4XTW A;  1VQK T;  5KYY B;  4B9W A;  1K9M C;  4AG1 C;  5CK9 A;  4WF2 A;  2M0Y A;  3NFC A;  1AZE A;  1N9R A;  3M5A A;  2V1Q A;  2P0K A;  5CO7 A;  4J9D A;  4J6W A;  1ZUY A;  3MP8 A;  4EMH A;  2AT1 B;  4KUL A;  3SWN C;  2DER A;  1VUB A;  3H0F A;  3EGX A;  4LDV A;  1B7T A;  5LJ3 d;  1WIE A;  4BE1 A;  2CKK A;  3CXC A;  2DL7 A;  5ECA A;  1WFW A;  1YHQ A;  2D9T A;  3QZ5 B;  2A08 A;  2DD5 A;  1G3S A;  2C0O A;  2L0A A;  2DBK A;  3JB9 H;  1VQ6 Q;  1P92 A;  1WZO A;  1X6G A;  1WQ7 A;  1R0C B;  4PL6 A;  3HHT B;  2GQI A;  3CCS T;  3E2U A;  3QJY A;  1MMD A;  3V7R A;  3CC2 Q;  4KGZ B;  1UJY A;  4QT7 A;  1X75 C;  5D6Y A;  1BYM A;  4ZGE B;  2CRE A;  3CCU T;  2RHY A;  2I2L A;  3HP9 A;  2E10 A;  3E1S A;  1LOJ A;  3EG9 A;  3CMA Q;  2RHU A;  2CZ7 B;  1FWZ A;  1Q7Y U;  1T3L A;  4EPC A;  2RJE A;  4BI4 A;  2YLC A;  3I55 T;  1BIB A;  1KFZ A;  3RKW A;  3HTR A;  2ED0 A;  4RTV A;  1M1G A;  4EMG A;  1CKA A;  1TUC A;  3QXE B;  1F1B B;  4RMO A;  4HA8 A;  2HDA A;  2BZY A;  2O01 E;  1HD3 A;  2W10 A;  2EGC A;  2RK2 A;  5L8R E;  1V76 A;  1JQQ A;  2NUT A;  1ZLM A;  1T3S A;  2KBT A;  1ZHI A;  2F2V A;  2P0P A;  2K7A A;  1K8A C;  4ZTJ A;  1I0C A;  3NGP A;  2VVK A;  1QWF A;  4PKC C;  2L8D A;  2RK1 A;  2JM9 A;  4UC4 A;  5KYX B;  1TG0 A;  4AFZ C;  4DEY A;  1EIF A;  2B86 A;  2NUP A;  4OB1 B;  4X34 A;  2ZPI B;  3RR6 A;  3MJX A;  1U1S A;  2LX9 A;  4WCI A;  1D0Y A;  1ARK A;  2F1L A;  2O9V A;  5FWB A;  2FVU A;  4PJO E;  1WGS A;  1VQO Q;  2MIO A;  3A5Z B;  2RI5 A;  1VQL A;  4V2S A;  1E6H A;  1Y57 A;  1XTD A;  4C92 F;  1VIE A;  3UPU A;  1KSW A;  3VS4 A;  5GAN 3;  4O6J A;  1TS9 A;  3EGD A;  3VU3 C;  4AT1 B;  1U1T A;  5GMK m;  2PVO B;  4HT8 A;  1RAF B;  4CC2 A;  3MP1 A;  4IUT A;  1RAH B;  1SF9 A;  3MHX A;  2EWN A;  4L5G A;  3SFM A;  2HEQ A;  2HZY A;  1QQJ A;  4AMC A;  2FZG B;  2J6O A;  2SRC A;  4AFU C;  4FYV B;  1NPP A;  5DLO A;  2VKN A;  2KRM A;  2X51 A;  2PUK B;  2JMA A;  3TRE A;  4DBQ A;  1IO6 A;  3JB9 F;  2V8J A;  2EVR A;  2KRO A;  4EIK A;  1E7O A;  1OEB A;  3OS2 A;  4M78 C;  1NLO C;  1TWB A;  2FRY A;  1PM3 A;  3LYI A;  2E5Q A;  2QXF A;  3X25 B;  4QVD A;  4E47 A;  4Z02 A;  2CDT A;  4QVC A;  3M0P A;  4BAC A;  4JLI A;  1JJ2 S;  1YI2 T;  4PJM A;  1YIJ T;  2DYI A;  3JAM E;  1X69 A;  3GBQ A;  2JS0 A;  5KE2 A;  3M0R A;  3QWY A;  4JRP A;  1PD1 A;  3CPW A;  3CCR A;  1Q82 R;  1N8R U;  2DLP A;  4F16 A;  2EIF A;  4XAX B;  1UGQ B;  2K3Y A;  1D0Z A;  2RH2 A;  1X2Q A;  5CKF A;  2FHD A;  3OYY A;  2DET A;  4FSX A;  2DL4 A;  3TQ7 P;  1WX6 A;  2O88 A;  2NLU A;  1PG5 B;  1GFD A;  4JPB W;  1PKS A;  2LJ0 A;  3L2U A;  1H92 A;  4HCC A;  3CCQ Q;  3REB B;  5GAO n;  1QP2 A;  2EQM A;  3SWN B;  1MV0 B;  2YWW A;  1WXT A;  1JRI A;  2H3E B; 
#chains in the Genus database with same CATH homology
 5GAN 4;  1TH7 A;  3QDR B;  2RA2 A;  5HY6 A;  3X20 B;  2JVV A;  3L2Q A;  3FC3 A;  3G7Z A;  3GPL A;  4NOY A;  3FB9 A;  2XD0 A;  1PSE A;  1ZQ1 A;  3CC4 A;  3UT1 A;  2K57 A;  4MMK A;  3QJ6 A;  1QVG A;  1G5V A;  4XTV A;  1KQS A;  4N0A C;  5KCO A;  4QQD A;  4M7A C;  1BI0 A;  2EJG A;  1YIT T;  2VXE A;  2EKO A;  5DLQ E;  3M53 A;  5FLX E;  3CXC S;  2A7Y A;  5J26 A;  3JB9 J;  4M75 E;  1VQK A;  2JNG A;  2RO0 A;  4M78 A;  5A0G A;  5LJ3 e;  2V8I A;  4C8Q A;  3N5B B;  3P8B B;  4C92 E;  2OTJ T;  2DK3 A;  5I2M A;  4C0Z A;  3M4Y A;  4MZP A;  3LGF A;  4M77 C;  3FLG A;  3ME9 A;  4C8Q F;  2LQ8 A;  3G71 A;  3HSB A;  1V29 B;  4M78 F;  4RKU E;  3CCQ T;  5GMK h;  4M7A D;  1LJO A;  4A53 A;  4C0D B;  2XK0 A;  2LT1 A;  3NTK A;  2EJF A;  3X26 B;  2KVQ G;  2L89 A;  1M1K U;  2ZCF B;  1KG1 A;  2ZPH B;  1D3B B;  1FX7 A;  4MZM A;  2LNV A;  1VQ6 T;  2QDY B;  4OVA A;  4HCB A;  3Q1J A;  2BUD A;  4HCZ A;  5CAI A;  3JCM h;  2LVM A;  4KUD K;  4C92 B;  2QQ9 A;  2XIC A;  2AHJ B;  3DB4 A;  4ZTF A;  2EJ9 A;  1SSF A;  5GAN 5;  2V8K A;  1NJI U;  1WQW A;  2GCX A;  4RG2 A;  3G4S A;  4J5Y A;  3FRN A;  4OB2 B;  2QI2 A;  3FJP A;  1UGR B;  4E7L A;  3LWH A;  3S3N A;  2Y4X A;  3FDR A;  1WPY A;  2P4T A;  3OBW A;  5GAM j;  3M55 A;  4PJO G;  2E41 A;  2HD0 A;  1YHQ T;  2E65 A;  3GNG A;  4ATO A;  1H3Z A;  2DTI A;  2GFA A;  1QVG S;  3X28 B;  1BI1 A;  1MHN A;  2QQR A;  2A3L A;  2BKD N;  3QYG B;  3RUX A;  5GAO q;  5A2Q E;  4PJO C;  2XG8 D;  1VQO A;  1M4Z A;  3NTH A;  1JBM A;  1WNL A;  4OF1 A;  3G4S T;  5GAO r;  3ZFJ A;  5J39 A;  1M90 U;  3RKY A;  1OYX A;  4C8Q C;  3HPW A;  2G3R A;  3H8Z A;  4QVZ A;  3INZ A;  2DZ9 A;  4C8Q E;  4BD3 A;  1H64 1;  2O4X B;  1YJW A;  3GLX A;  5FRO A;  4F7U G;  3CME A;  1VQ7 T;  4IUQ A;  2DAQ A;  3S6W A;  2QTX A;  2DTH A;  1UGP B;  1YBY A;  5FRM A;  4R56 A;  4L6V 5;  3DB3 A;  2LCL A;  4XTZ A;  4M7A B;  3BFM A;  2D0Q B;  3PGG A;  3CPF A;  3ASK A;  3PTA A;  4BI8 B;  1N6A A;  3PFS A;  2RHX A;  1M8V A;  3OYA A;  5C0M A;  3J81 E;  3OS0 A;  3QG1 A;  4JRI A;  2X4X A;  4M77 G;  4C92 D;  1VQP A;  1IRE B;  3RER A;  2QQS A;  4PLI A;  4LD6 A;  4IKF A;  3BW1 A;  1RL2 A;  5GAN 8;  4Y91 A;  4JJN K;  4FIB A;  5DM7 R;  1YJW T;  4LDX A;  4M7D F;  1M1F A;  5EG2 A;  3CC2 T;  4OB0 B;  5GAN h;  1VQP T;  1QVF A;  3VV0 A;  4XU2 A;  4EMK A;  4Q5W A;  2K5L A;  3M9Q A;  1OI1 A;  3CEY A;  1VQ9 T;  3GOX A;  3OS1 A;  2EAY A;  4OP0 A;  2RJC A;  5LJ3 h;  1M1K C;  4M7A E;  1BI3 A;  2ZPG B;  3EFR A;  4R55 A;  3MCA B;  4LDW A;  1NPR A;  5CVI A;  5LJ5 f;  4M77 E;  3OA6 A;  3DLL A;  1B34 B;  3CCM T;  4XK8 E;  5GMK i;  3CCS A;  5FU7 C;  4IUR A;  3JSC A;  2WSF E;  3OYG A;  2VYT A;  2LQK A;  3JCM Q;  2X4W A;  1Y71 A;  2CGH A;  3CC4 T;  1I4K 1;  3JB9 D;  3CME T;  3V8K A;  2P0Q A;  3RKX A;  3LLR A;  3C95 A;  5CQX A;  4EMK C;  3I56 A;  1VQ7 A;  3ER0 A;  2DIQ A;  2PU9 B;  2MWO A;  3R6O A;  4KBM B;  2PUO B;  1VQN A;  1KQS S;  2R5A A;  3OYH A;  3KXT A;  2GF7 A;  2RD1 A;  1YCY A;  3OYF A;  2E70 A;  2FYK A;  1JJ2 A;  3OYN A;  4FU6 A;  3OMG A;  4C0D C;  5IAY A;  5GAN g;  1O75 A;  2CYZ B;  2DD4 A;  2R57 A;  4DOW A;  3CMA A;  2R5M A;  3MP6 A;  4BB7 A;  4M77 F;  1K9M U;  5DY9 A;  4KT0 E;  2K3X A;  4E7K A;  3PIO A;  2QQB A;  3CCQ A;  2E12 A;  1I5L A;  3ZBD A;  4C8Q D;  5GAM h;  4M75 G;  5I2S A;  2CS7 A;  5M9O A;  5GMK e;  2GQV A;  4M78 D;  5GMK j;  1Q7Y C;  1WJR A;  3DLM A;  3P8D A;  3UDC A;  1VQN T;  4X9C A;  3C12 A;  3OYE A;  2M9U A;  1S72 T;  2KAF A;  1K8A U;  3V7S A;  5AYF A;  4PJO A;  4QQ6 A;  4QW2 A;  4F7U B;  3HL8 A;  3HKS A;  3X24 B;  3E9F A;  2OAU A;  2LTO A;  5LJ5 g;  3S3O A;  4C0G A;  1VQ6 A;  4CRI A;  5FU7 B;  3RIR A;  1Q82 U;  4F7U F;  2CZ0 B;  4HKE A;  3A8G B;  5LJ3 g;  1G3W A;  3MEW A;  4M78 G;  2Y4Y A;  3GF5 A;  2O4X A;  2VUB A;  4C8Q G;  1GXI E;  4XTU A;  2MF2 A;  2WAC A;  3HRS A;  4BY6 C;  5GAN 7;  3CBM A;  1K73 U;  4N4G A;  3CC7 T;  3JCM X;  4CI0 C;  3JCM c;  3CD6 T;  3WVE B;  2JN0 A;  2QA4 A;  3VYH B;  3JCM V;  1Y96 B;  4M75 A;  3M56 A;  4M7D E;  1I81 A;  1VQ4 T;  3MEA A;  4PJO F;  1RI0 A;  4ZGD B;  5GAO l;  4M78 B;  3JCM W;  3G6E A;  2C06 A;  5CKD A;  3CCE A;  3HRT A;  4XTW A;  5CKB A;  3JB9 G;  1VQK T;  2PVG B;  2Y90 A;  3QKJ A;  3L2V A;  2FB7 A;  4B9W A;  1YI2 A;  1K9M C;  1MGQ A;  1Q86 U;  5CK9 A;  3KBG A;  2X4J A;  4M7A F;  5IT9 E;  3FIF A;  4WF2 A;  2DXB A;  3NFC A;  4LDY A;  2ZZD A;  4EMK B;  5KE3 A;  1N9R A;  2M16 A;  2XHC A;  3OSS C;  5GAO p;  5GAM g;  3HFO A;  4P5N A;  3VYG A;  4IUV A;  1NJI C;  3M5A A;  1WJS A;  2E6Z A;  2P0K A;  2DEQ A;  3OYL A;  1KHC A;  4E7J A;  5CO7 A;  1XOV A;  4OMF B;  5FU6 B;  4EDU A;  2EQU A;  4JUV A;  1NZ9 A;  4J6W A;  1W4S A;  3OYB A;  3MP8 A;  1W2B A;  4JRQ A;  1B34 A;  4EMH A;  3L2W A;  4KUL A;  4QQG A;  3SWN C;  3JCM P;  3QYH B;  2ZPF B;  5KCH A;  1HK9 A;  1VUB A;  1ZBX A;  3L42 A;  3JCM f;  3SD4 A;  4LDV A;  4JDS A;  2K5F A;  4M77 D;  4C92 G;  1YIJ A;  4A54 A;  1M90 C;  1KQ2 A;  5LJ3 d;  3L2Z A;  3MEU A;  1BKB A;  4BE1 A;  2CKK A;  5A0L A;  1M9S A;  2LDM A;  3BDL A;  3CXC A;  3GIB A;  5LL6 S;  1YHQ A;  2D9T A;  3QZ5 B;  4LDU A;  2DD5 A;  2LC4 A;  4J7F A;  1VQ8 A;  1Y07 A;  4ZN3 A;  3CMA T;  1G3S A;  2K5I A;  3PMT A;  5IN1 A;  4ZN1 A;  5CKH A;  3CCL A;  4IUP A;  3H6Z A;  5GAM e;  2IG0 A;  2M1H A;  2QEX T;  2KDS A;  3CCR T;  3JB9 H;  4DOV A;  4MZT A;  2DIG A;  1KC8 C;  1P92 A;  4NL3 A;  2H3J A;  3E9G A;  2DTO A;  1WQ7 A;  4MML A;  3RMQ A;  5CR2 A;  5HKC A;  3C4S A;  2XDB A;  4RG8 A;  2MI6 A;  4PL6 A;  1R8O B;  3PMI A;  3G6E T;  4M7A A;  3HHT B;  1UEB A;  3CCS T;  1KC8 U;  3QJY A;  3LH0 A;  3V7R A;  1N8R C;  1HXD A;  1O9S A;  2B8A A;  2X4Y A;  1X75 C;  3CBO A;  5D6Y A;  1BYM A;  4ZGE B;  2KQW A;  1YJN A;  2K4Y A;  3M57 A;  1YJ9 T;  3CC7 A;  2CZ6 B;  2RHY A;  2I2L A;  3HP9 A;  2E10 A;  3E1S A;  4XU3 A;  3OQ5 A;  4JLG A;  3CCU T;  3TU4 K;  4J8O A;  1LOJ A;  3M4G A;  4GLK A;  2RHU A;  3CD6 A;  2CZ7 B;  2VGM A;  4M7D D;  1FWZ A;  2HBP A;  3OBY A;  5GAN j;  3P8H A;  3TCJ A;  1Q7Y U;  4EPC A;  4M7D B;  2RJE A;  4BI4 A;  1Y96 A;  2F69 A;  2YLC A;  5HK3 A;  3A8M B;  4J7I A;  5D6W A;  3I55 T;  1BIB A;  2RM4 A;  3RKW A;  2DO3 A;  3OSV A;  4ZGJ B;  3PT9 A;  2RI3 A;  3F70 A;  1M1G A;  2WSE E;  4M77 B;  3WXM B;  4A4E A;  3S3M A;  3EFS A;  4EMG A;  3JCM b;  5GAN e;  1DJ7 B;  4ME7 A;  1M5Q 1;  1OZ3 A;  4N4H A;  5GAN 2;  3QXE B;  4X9D A;  3OS5 A;  1VQ5 T;  5KH6 A;  4RMO A;  1NE8 A;  2ZPB B;  1UB4 A;  1K73 C;  3C94 A;  3GNF B;  4HA8 A;  4J83 A;  4N4I A;  3J7A F;  4M7D C;  3V8L A;  2RB6 A;  3VKI A;  3CCV A;  4M7A G;  5GAN 6;  5FRN A;  3LGL A;  5LJ3 f;  4TVR A;  2O01 E;  1BI2 A;  3QO3 A;  3OW2 A;  1VQ4 A;  4RCC A;  2F5T X;  4BY6 B;  4NS5 A;  5LJ5 h;  2E6N A;  2JOY A;  3PIP A;  1U8R A;  2RK2 A;  5L8R E;  1Q82 C;  4A4F A;  5LJ5 e;  3L2R A;  5CCA A;  3SWN A;  3VUB A;  3FEO A;  3GP8 A;  2RJD A;  3TEE A;  1ZHI A;  2P0P A;  3JB9 I;  3OYJ A;  1QVP A;  3OYD A;  5CQY A;  1K8A C;  1S72 A;  4ZTJ A;  3JCM g;  2XID A;  4XTX A;  4O5V A;  1Q86 C;  3CCE T;  4BDY A;  2OTJ A;  1BIA A;  4PKC C;  1PSF A;  2K2V A;  5GMK l;  2L8D A;  1WJQ A;  2RK1 A;  3EAE A;  3QBY A;  4C5E A;  3LX7 A;  2MMP A;  4UC4 A;  2KY9 A;  2DXT A;  4II1 A;  2HQX A;  1EIF A;  2VV5 A;  4DQ2 A;  3OW2 S;  4PJO B;  4RCB A;  3V8J A;  4D6W A;  2WSC E;  4N0A A;  4C5H A;  4BE0 A;  2E1H A;  5CKE A;  2VGN A;  4OB1 B;  3SB2 A;  4C8Q B;  4NL2 A;  4X34 A;  4OGE A;  5D6X A;  2XDP A;  2ZPI B;  4M78 E;  1VQL T;  2DPP B;  3CC2 A;  5GAM f;  4A4K A;  3I56 T;  4JS5 A;  1U1S A;  2LX9 A;  5GAM d;  4LD9 K;  4B9X A;  2HQE A;  5GAO m;  3UWN A;  3A8H B;  2FVU A;  4XU1 A;  4PJO E;  3O8V A;  1KHI A;  3BY7 A;  4M75 F;  2MWP A;  1D3B A;  2CZ1 B;  1Q81 U;  2VXF A;  1WGS A;  2IVW A;  2QA4 T;  4M7D G;  3CBP A;  4M75 B;  2EQJ A;  3A5Z B;  3QZ9 B;  2RI5 A;  1VQL A;  1N27 A;  3JCM e;  4C0F A;  4V2S A;  2GFU A;  2ZPE B;  1XTD A;  1YJN T;  4C92 F;  1VIE A;  4A4H A;  3KUF A;  3UPU A;  1VIF A;  2KMT A;  5GAN 3;  4O6J A;  1VQ8 T;  3SDZ A;  4OB3 B;  5HK0 A;  3VU3 C;  1U1T A;  2JTM A;  3BDU A;  2PVO B;  5GMK m;  1VQM A;  4HT8 A;  1IZ6 A;  3JRZ A;  3E19 A;  3MP1 A;  2L3R A;  4IUT A;  4BE2 A;  4E7H A;  2YLB A;  1KD1 C;  2PQW A;  3QHS A;  2DVE A;  3WVD B;  1AHJ B;  3MHX A;  4MDX A;  2HNI A;  3AHU A;  2EWN A;  4L5G A;  1VQO T;  3M54 A;  4M77 A;  3SFM A;  2RI2 A;  5FU6 C;  4A4G A;  3CCV T;  4J6Y A;  4ELY C;  3MEV A;  2LCC A;  2OTL T;  2HAX A;  1NPP A;  5DLO A;  4E7I A;  3OY9 A;  2XI9 A;  5A0D A;  4M75 C;  2YHT A;  2PUK B;  1W2B S;  3TRE A;  1VQ5 A;  3CCU A;  2R58 A;  3JB9 F;  1LNX A;  2V8J A;  3M59 A;  5GAN f;  5LJ5 j;  4FT4 A;  2LT4 A;  2VC8 A;  1G3Y A;  2MAM A;  3DKM A;  4ELZ C;  3MET A;  1KD1 U;  1YIT A;  4XTY A;  3CCJ T;  3QUI A;  3CPW S;  1FXX A;  2YRV A;  1Y7X A;  3OYI A;  4Y28 E;  4FT2 A;  3OMC A;  5C6S A;  3JCM d;  4JRK A;  4M78 C;  3OS2 A;  4BDZ A;  4C5I A;  3I55 A;  3QPH A;  4C5G A;  3M58 A;  2DKG A;  3NTI A;  2L5Q A;  4FL6 A;  3LYI A;  2E5Q A;  2QXF A;  2RHI A;  2EQK A;  3QSU A;  2BIV A;  3X25 B;  4QVD A;  1XNI A;  1I8F A;  5LJ5 d;  1VQ9 A;  4PLL A;  2E64 A;  4E47 A;  2JZ2 A;  3LWI A;  4Z02 A;  2DXC A;  1YJ9 A;  4BUG A;  1QW1 A;  4MDW A;  2ZGW A;  3VUZ A;  4QVC A;  2XU8 A;  3L1A A;  4C92 A;  4JLI A;  4XU0 A;  4GY5 A;  4BAC A;  3ZEH A;  5LJ3 j;  1YI2 T;  1JJ2 S;  3RES A;  3OYK A;  1Q81 C;  1X01 A;  1G3T A;  2RHZ A;  4J6X A;  4OGC A;  1YIJ T;  2KK4 A;  2DJZ A;  4XQ3 A;  3JAM E;  3JCM J;  2X35 A;  2F5K A;  5KE2 A;  1QP3 A;  3LW5 E;  1OZ2 A;  2QEX A;  4PNO A;  1XQH A;  4YTL A;  3URG A;  3CCL T;  4JRP A;  4HT9 A;  2JUF A;  3VJP A;  4M7D A;  2PVD B;  4BI3 A;  3CPW A;  3CCR A;  3RMS A;  1N8R U;  2DXU A;  3PNW C;  4JS4 A;  4PJO D;  2EIF A;  4XAX B;  1UGQ B;  2OTL A;  1N9S A;  2JTF A;  3V7C A;  2K3Y A;  2XDD A;  4DA4 A;  4VUB A;  2RH2 A;  1KQ1 A;  3CCJ A;  5CKF A;  3OYC A;  2LRQ A;  3MO8 A;  3OYM A;  2FHD A;  4FM4 B;  3T9N A;  4KUI A;  3OYY A;  2M0O A;  4FSX A;  2DZC A;  3OB9 A;  5J3B A;  2D6F A;  1X6O A;  4L59 A;  2FL7 A;  2KSS A;  1VQM T;  2NLU A;  4M75 D;  1QVF S;  3HFN A;  5I21 A;  2QQA A;  3HRU A;  4F7U A;  2XKO C;  5CIU A;  4F7U E;  5GAN d;  3L2U A;  1UGS B;  4HCC A;  4IUU A;  3J80 E;  3CCM A;  5GAO n;  3A8O B;  1QP2 A;  2EQM A;  3A8L B;  3QII A;  3SWN B;  1JRI A;  2EFI A;  2RJF A;  4C92 C;  3G71 T;  2EYQ A;  1JB0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...