2IVWA

The solution structure of a domain from the neisseria meningitidis pilp pilot protein.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
113
structure length
113
Chain Sequence
b'ETDKKGENAPDTKRIKETLEKFSLENMRYVGILKSGQKVSGFIEAEGYVYTVGVGNYLGQNYGRIESITDDSIVLNELIEDSTGNWVSRKAELLLNSSDKNTEQAAAPAAEQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PILP PILOT PROTEIN
molecule tags Lipoprotein
source organism Neisseria meningitidis
publication title The solution structure of a domain from the Neisseria meningitidis lipoprotein PilP reveals a new beta-sandwich fold.
pubmed doi rcsb
total genus 9
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.830 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ivwA01
2Y4YA 2LC4A 2LNVA 3OSSC 2Y4XA 2IVWA
chains in the Genus database with same CATH superfamily
1K73U 1VQOQ 4ME7A 2KT8A 4C5HA 4MZTA 4QKUA 4LUDA 5LJ3d 4C8QB 5FU6C 2RHYA 4GLMA 1B34B 1VQPQ 3JAME 2RQTA 4K11A 1VQLT 3CXCS 4PFPA 4KT0E 2MAMA 1SRMA 1SKUB 1VQ4A 3JRZA 4DBRA 1HXDA 7AT1B 5LJ3e 1RAHB 1EIFA 2CP3A 1VQNT 2XKOC 3NTHA 1BIAA 4A53A 4M7AE 1K8AU 2H8HA 1GCQA 2ZZDA 2O88A 4MZPA 4Z89A 1YJ9Q 3CQTA 2JUFA 1N9SA 1KD1U 4NL3A 2PVOB 3M4GA 1PSFA 4JDSA 1PSEA 1WLPB 2L0AA 1M2VB 4HCZA 4N0AC 3CBMA 4CI0C 1Q81U 1IGUA 3JCMf 4BD3A 1D3BB 1LOJA 2YRCA 4JPBW 4M7DG 3LWIA 2LTOA 1H3HA 4BACA 5CKHA 2FZKB 3CMAA 3CCMT 3HP9A 3BDLA 1M1KU 3P8HA 4M7DB 2EJFA 3LGLA 1IGQA 1Y0MA 1IHWA 2BE7D 2JM9A 3OBYA 5J39A 2EQKA 2FB7A 4C92G 1VUBA 4XTVA 4DEYA 1K76A 1H8KA 2F1LA 3HL8A 2RI5A 2LJ0A 1PNJA 2DL3A 2DF6A 2MF2A 1M90C 2NUPA 3NHNA 1VQMQ 2RJFA 4X34A 2FVUA 4C92F 1WDXA 2EVRA 5I2SA 2L2PA 5J3BA 4KH0B 1NPPA 2DRKA 2FL7A 1IB8A 1JJ2S 1N27A 3LX7A 5LJ5h 3EGDA 1JXOA 2WSFE 1YJNT 1QKWA 1PC0A 2H3EB 1HYOA 3HRSA 4C92A 2AK5A 3CCQQ 4A4HA 4X1VA 1KHIA 1QKXA 4AG1C 2MPXC 1SF9A 1NYFA 4NOYA 1ZA2B 4R0KA 2LVMA 1BCOA 2VB6A 2RK2A 2CYZB 3T9NA 1M5Q1 3UA6A 4J9GA 1GXIE 5AT1B 3EAEA 4RCCA 5KYYB 5LJ3j 1QVPA 4MMKA 2M1HA 2AT1B 4L5GA 5CCAA 1R77A 1BBZA 4JRIA 4MDWA 4DBHA 3OW2A 1O75A 2KSSA 3MKDA 3CCQA 3OYEA 4DEXA 3VV0A 3EFOA 1I1JA 2E3HA 3OYCA 5LL6S 1M8VA 1OX8A 1V29B 1OOTA 2R5MA 3A8LB 3CXCA 1K9MC 2AZVA 1VQ7A 5D6XA 3I5SA 2CREA 4OB2B 5A0DA 2CH4W 3UF4A 3X28B 5GAOl 1U06A 5LJ3g 3ZBDA 3E9GA 3INZA 4LD9K 2I2LA 2HCKA 2DK3A 1P92A 2O31A 4JZ3A 4FYWB 1G8XA 4J9CA 1WHMA 4X9CA 4JJCA 4M7DE 5IHKA 4IKFA 1I5LA 1BCMA 1VQOT 1LVKA 5GAN3 1D0YA 1VQMA 1N6AA 5A0GA 4NL2A 2HEQA 2P4RA 2AKLA 3QBYA 4Z02A 1VQ6T 3EFRA 4BE1A 4C8QD 3VS2A 3CCLA 4HVWA 4RKUE 5GAMf 1RUWA 1YJWQ 2XIDA 2LMJA 1TWBA 3GOXA 3L2WA 2P0KA 2VWFA 4JZ4A 1NM7A 1AOJA 1OULA 2MK5A 1OX9A 5FRMA 5IT9E 2F69A 1KQ1A 3OS2A 4ZN1A 2PUOB 4PJOD 4CRIA 4DA4A 2QA4Q 4VUBA 2GBQA 1T3LA 3PNWC 2DD4A 3HRUA 3EHRA 2FPEA 2AKKA 2MWOA 1G2BA 2OTJA 1VIFA 4M77B 3PMTA 1OU9A 1WNLA 2QQSA 4M7AB 1NJIU 4A4EA 4J7IA 2L3RA 3VS1A 1XOVA 3OQ5A 2CT3A 3PGGA 3I56A 3HTRA 1TTHB 4IUVA 5IH2A 5KYNA 5GANh 1BI0A 4LN2A 4A63B 4M77D 3U23A 3EG9A 5IAYA 2DETA 2QGGA 4E7SA 2EQJA 4E7JA 2DBMA 3FDRA 1VYTA 4OMFB 4PNOA 3M0TA 2E5KA 2MIOA 4KGXB 1Q81C 5GAN7 1ZSGA 2LQWA 1X01A 2K7AA 3OB9A 4ZNXA 5KYYA 4N4IA 1MMGA 3G7ZA 9ATCB 4C0GA 5GAN5 2OI3A 4O5VA 1UHCA 3H9NA 3QKJA 4AFSC 3FLGA 3PIOA 4JRPA 5A2QE 4J6WA 1VA7A 3CC7A 4E6RA 5GMKl 5KH6A 1H92A 4J8OA 3PMIA 2MMPA 4F7UA 4C8QC 2QDYB 2XMFA 2CKKA 3PIPA 2ABLA 1IRXA 4RG2A 4RTXA 2FYKA 2RI2A 2R58A 2GGRA 1OI1A 2F5KA 1WQ7A 4E7ZA 3CCQT 3TCJA 2CSQA 4FT2A 1QWEA 1VQ9Q 1BKBA 3LH5A 1Q86C 5CIUA 2KE9A 1WQWA 4C0DC 5GMKi 2FPFA 1ABOA 1D3BA 4OMQA 3FRNA 3UPUA 3F70A 4CC4B 3HFNA 1VQLQ 1KG1A 4C92C 1JXMA 1X6GA 1M27C 3BW1A 1B07A 5GAOm 2X4YA 4F7UG 3JCMW 1RAGB 1JBMA 3PT9A 1U5SA 1PD1A 5CKBA 1WX6A 2NWMA 4J9FA 1OPLA 1YJNA 3GNGA 1YI2Q 3QPHA 1XJWB 1HJDA 2KBTA 3FB9A 1GFDA 2KQWA 1UJ0A 4M7DC 1MHNA 1UGVA 3SHWA 2OTLA 4FSXA 3NMZC 2VXEA 5DLOA 4F7UE 4M75G 4PJOF 2DNUA 1NZ9A 4FYYB 5GAMe 2LRQA 4TVRA 2MI6A 2HDAA 1ZSZC 4L59A 3CCJA 1YJWT 1PHTA 1JJ2A 2LP5A 1VQ9T 3I55T 2ZPHB 1U1TA 3TEEA 4LDXA 1ZBXA 5D6WA 3META 3ZEHA 3J7AF 2LCSA 2EGEA 1KQSP 3TVTA 4BY6C 3HSBA 1W2BS 1Y7XA 2PU9B 3M54A 1AWOA 2HMAA 4HCBA 3KUFA 3L2UA 1YNZA 5FU7C 2JJ9A 5HK3A 3A98A 4M75A 2FZGB 3ASKA 1NBEB 2C0TA 4O6JA 3V7SA 3JCMe 2G6FX 3OYHA 2A3LA 4ORZA 4GY5A 4MDXA 2P84A 2XDPA 1FMKA 2YRDA 1M8MA 2ROTA 2K2MA 1VOMA 5LJ5g 4XTZA 1T3SA 4KRTA 4WF2A 1YJNQ 1ABQA 4N4HA 3OYGA 2HNIA 4AFUC 1VQ6A 2KROA 1VQ8Q 3FIFA 3M57A 2ECZA 2F2VA 3EHQA 3CCLT 4HVVA 1RI9A 3NTKA 3JB9F 4E47A 1E6HA 4J9IA 1RAIB 3EGDB 3JV3A 4B9XA 4FW2A 2GNCA 2QTXA 3D7SB 3EG2A 4M77E 3CMAQ 1VQKA 1FMWA 5GANe 1VQ7Q 1G3SA 2JMAA 3V8KA 3DB4A 1K0SA 1VQ5A 5LJ5j 3M5AA 1KQSA 1ZSZA 3CMEA 4MMLA 2XU8A 3AT1B 2IIMA 1VQ5T 1CKAA 3X24B 2V8JA 1D0ZA 4M78C 2MYSA 4Y28E 1ZUYA 1OPKA 1ZX6A 5GMKm 4C5GA 4J5YA 2YXYA 2XHCA 5I22A 3HFOA 4J6YA 1VQNQ 2OTLQ 5I2MA 5GAOr 2K57A 1MUZA 1GBRA 2G3RA 3OYAA 1OU8A 2QQ9A 3QO3A 2KI7A 4DBFA 5GAMj 4OMOA 2CZ6B 3M55A 3JCMV 1JU5C 1WJQA 3VS5A 1N8RU 2P0QA 3GIBA 2D0NA 3N5BB 1GRIA 1RABB 1I0CA 1NYGA 4XTYA 3SWNB 1SHGA 2CS7A 2QASA 4Y92A 3CCVT 4JJBA 3BDUA 3E1SA 4IURA 1J3TA 3A1PA 3C95A 2DVEA 2PVDB 2RHIA 1QCNA 1YN8A 1NEGA 1AWJA 3M0QA 1TU0B 1UJYA 2VV5A 4M78F 2CUDA 1UFFA 2YLBA 1HK9A 5GAMg 3CC2A 1QCFA 2X3WD 2DO3A 5FLXE 4GBQA 2DXCA 4QW2A 2VASA 2JOYA 3OSVA 4EMGA 4C8QE 1BYMA 3CD6T 2I0NA 2JZ2A 2M02A 1FYNA 5DM7R 3X26B 3CC7T 3PVLA 2LX7A 5KYUA 1WXUA 3CC2Q 5CAIA 2DD5A 4EPCA 1VQLA 3REBB 4M7DA 2BZXA 3S3MA 1YP5A 2A08A 3EH2A 4FM4B 2SRCA 5KYXA 1K4US 1K8AC 5KYWA 2NYSA 5CQXA 2DPPB 2EJGA 1VQ4T 1VQNA 1YFNA 2P4TA 1SSHA 1BI3A 3JB9I 1SHFA 1R0CB 4HCKA 5GANj 3VYHB 1ZBJA 2B8AA 4RCBA 4FYVB 1ZSZB 3OS0A 2CGHA 5IXBA 1G5VA 2DZ9A 1YJ9A 5AYFA 2JT4A 4EMKA 2DTHA 2DYIA 3SB2A 2XICA 2JM8A 3V8JA 2K9GA 2A7YA 2GCXA 2ZPIB 3QZ9B 5GAN4 3CCEA 5GAN8 3CCUA 8AT1B 1N9RA 5GMKj 4BI3A 5KE3A 3G6EA 1UDLA 2GFAA 4BDZA 4XTXA 2L3SA 2F2WA 2PZ1A 1VQPA 2XD0A 1OZ3A 2OX7A 4E7HA 1QVGA 1WGSA 1KD1R 3QWXX 4BI4A 1M90U 4ATOA 2YSQA 4M78A 1S72A 1A0NB 2K2VA 3CCEQ 1YBYA 1R8OB 3EGXA 4RMOA 4DOWA 1Y57A 1F1BB 1S72T 1TUDA 3MO8A 3OYJA 1B34A 3DB3A 3UATA 1PRLC 4C0DB 1QQJA 4M7DD 3G71Q 4BDYA 1QWFA 3O5ZA 3H0HA 4DQ2A 1KHCA 4XU0A 1VQ7T 2J7IA 2MOXA 3A8GB 1YJ9T 1N8RR 5IHNA 3JB9H 3I5RA 4XQ3A 3OYYA 2EYYA 2A36A 3WVEB 4C92D 2V8IA 3H6ZA 2YWWA 4DOVA 3CC4Q 3VS4A 5IHIA 1G3TA 4V2SA 2LJ1A 4ZGJB 2EGCA 3SWNC 2B86A 4PJLA 4II1A 1U3OA 3NTIA 2XG8D 1VQMT 3JCMg 1WPYA 3G1JA 5EG2A 3QXEB 1HSQA 2RHUA 2ATCB 3ER0A 2JS2A 4OGCA 3JCMc 1QCOA 1M9SA 3J80E 1OEBA 2CP7A 3ZL7C 2X4XA 4J9EA 1MMDA 1K9MR 2KXCA 1VQKT 2VYTA 2DRMA 4HKEA 1YI2T 1RI0A 1K73R 2X51A 3OSSC 1WHJA 2K3BA 3G4SA 4F17A 1Q82R 1UGRB 2DILA 5FROA 2YHTA 2MWPA 5I21A 3MHXA 4XK8E 1DJ7B 1M1FA 3I55A 1YIJQ 2ED0A 3JCMX 2K4YA 4ESRA 2EQIA 4M78E 4RTWA 3MP1A 3MEAA 4M75E 2RPNA 5FU7B 3SD4A 3X25B 2DXBA 3RERA 3BY7A 4JLGA 2Y4YA 2KRSA 2X9HA 4M77G 4R56A 3EG0A 4M77C 3BFMA 3FJ5A 3JCMh 2L89A 1UECA 1RAFB 4F7UB 2NUTA 2BUDA 2KXDA 2C06A 2CP0A 3EFSA 2DEUA 3TSWA 2RO0A 1EFNA 1NEBA 2M0OA 2KAFA 2M51A 2RB6A 4KH1B 2ESWA 2EKOA 3QYHB 3AHUA 2HQXA 4PL6A 3RKYA 2R57A 3OYMA 2CP5A 4OB1B 2DX1A 4RTZA 2RNAA 1PCXA 5LJ5f 3G4ST 1KQSS 3OY9A 1Z9QA 3VKIA 1X43A 3JSCA 2XDDA 5KCOA 1OYXA 2WSEE 1WYXA 4JS4A 1TUGB 2D8JA 2IG0A 2P0PA 3M59A 2DYBA 2DTIA 1D0XA 5HY6A 2GQIA 1D09B 3KFVA 4PJOC 2KVQG 1X75C 4FYXB 3OW2P 3CXCP 3I9QA 1PG5B 4C8QG 2V1RA 4EMKC 3RR6A 3GBQA 3CCMQ 2VKNA 3M58A 4OB0B 4LDVA 3PE0A 2KR3A 3UT1A 1UG1A 1IO6A 5CQYA 5DY9A 2KK4A 1N5ZA 4RTVA 1X6BA 1B3QA 2HAXA 1GCPA 2QYZA 2LNHB 3E2UA 1X2QA 3ZFJA 1WJSA 2OAWA 3KXTA 2EFIA 2RJEA 4FW1A 3L42A 1ZLMA 4J6XA 3CPWP 1I8FA 2QG9B 4M77A 4AG2C 4LE9A 1Q7YU 1PWTA 4AT1B 3QHSA 1SEMA 4ZGEB 2LQKA 2ZPBB 1NG2A 1NLPC 2DL7A 2OTJQ 4PFZA 1Y71A 1ZHIA 2DL5A 2XDBA 2DIQA 3KBGA 1WHHA 1W70A 3QDFA 2EYWA 5CKEA 3S6WA 3JB9D 2DLPA 2E3IA 2JVVA 4HA8A 1NPRA 1E6GA 2EAYA 2QQRA 3OYLA 3C12A 1HD3A 1SRLA 2ROLA 3PFSA 2LQ8A 1Q82C 1M90R 1VYVA 1VQPT 1I07A 4JS5A 1K73C 1AD5A 2CUBA 4PLLA 3CCJT 3VUZA 1YJWA 1NJIR 4E2FB 3QWYA 2QEXT 1YI2A 1NLOC 4DBQA 4KUDK 2HL5C 1YHQA 2BE9B 1M30A 2KRNA 2HQHA 1Z9ZA 2EW3A 3VRZA 4J9HA 5LJ5d 3JB9J 1GCQC 5ECAA 4M7AF 1WHGA 1FMVA 2HD0A 2FPDA 2YUQA 4M7AC 4BE2A 1M3BA 4LDWA 4RUGA 4EIKA 3QDRB 5C6SA 2FEIA 4QT7A 2SEMA 4A4GA 2L5QA 1KD1C 4Z88A 1EX4A 5IXFA 2QQAA 1M1GA 3E19A 3LYIA 4YTLA 4XU2A 3MEWA 5KYXB 3S3NA 1Q86R 1QVFS 1WHLA 5GAOn 2COWA 2LCCA 4C92E 1X2KA 1C6VX 2RHXA 2K79A 2DIGA 4EDUA 4PFOA 1YITA 2CZ1B 1XTDA 1RADB 3M9QA 2O9SA 1XQHA 3CEYA 3TQ7P 1M3AA 1UTIA 2EYZA 1U1SA 2RI3A 1G3YA 2HQEA 1C1AA 1JRIA 1Q81R 4LUEA 2FO0A 2Y90A 1YITQ 3V7CA 3QJYA 2BKDN 2EKHA 2ZAEA 4C92B 5HK0A 4LDYA 1I5OB 2E10A 1UUEA 4HVUA 1JQQA 4OMMA 2DTOA 4J9BA 2O01E 2QK0A 2RK1A 5LJ3h 3THKA 2RQUA 3C0CA 2VGNA 5GMKh 4C5IA 2QQBA 1WI7A 4L6V5 2JXBA 1TUCA 2KY9A 2O2OA 3JCMd 2J6KA 4CC7A 4M77F 1QP2A 3WXMB 2D9TA 4JRKA 3X20B 2LDMA 4PLIA 1W2BA 1ZQ1A 2NUTB 3CPFA 2FRYA 1MV0B 1WHKA 4QQDA 3IQLA 4ELZC 3FJPA 2K5FA 2EYXA 2KRMA 3CC4T 1YHQQ 2Z0WA 1AZEA 4RTUA 5GAMd 3OYKA 2PNIA 1K8AR 1UGPB 3CCRA 3CD6Q 1WXTA 1Y96A 2E70A 2HBPA 4FL6A 1AT1B 2HL3A 1X27A 2RD1A 4QVZA 2DJZA 1D1AA 1RAAB 2AZSA 2K5LA 2HKQB 3M0UA 3VUBA 3QZ5B 3FEOA 2J06A 1MV3A 2IVWA 3CMEQ 2OTJT 1TXQA 3CD6A 2KT1A 2YUOA 2JN0A 3CCLQ 2E64A 2C0IA 4F04B 1KC8C 3TSZA 3G71A 3CPWA 2E12A 2DL4A 2L3QA 2DZCA 4C8QA 2ZPFB 3TU4K 3OMGA 1D1BA 2X35A 4N0AA 3ULRB 4BY6B 5HKCA 2ZPEB 1Q86U 3L2ZA 1YHQT 2A0FB 4KULA 3PVQA 4NS5A 2VUBA 2AHJB 1FX7A 4C8QF 3R6NA 1X69A 2IPOB 4OB3B 1YCSB 1PRMC 4F14A 2DERA 2XK0A 4ZTFA 4J83A 3CCUT 3QJ6A 1UEBA 2V8KA 5GANd 2DAQA 2PTKA 2EIFA 3VS3A 3GLXA 3CCET 3J81E 1Q95G 2QEXQ 2BIVA 2BZ8A 2EGAA 4PK4A 2EYQA 3CMET 3OA6A 5CK9A 4Z8AA 1Q7YC 1KFZA 3VYGA 2FZCB 2KYBA 2CZ7B 3EG9B 1WA7A 2OTLT 3G71T 2HSPA 2KDSA 2DBKA 1QMCA 1PKTA 4IUPA 4OMLA 3HPWA 2QEXA 5GAOp 1QVFA 2ZGWA 3P8DA 2DL8A 4WCIA 4QQ6A 4OP0A 5CO7A 1UE9A 1CKBA 2QGFB 2CP6A 4C0FA 1I81A 3GP8A 4HXJA 2L8DA 2J6FA 1M4ZA 2HBWA 5M9OA 1RAEB 2YUNA 3DLMA 2GFUA 4FIBA 3OYFA 4M78D 2RM4A 4B6MA 3LGFA 2VVKA 1M1KC 2J6OA 4M78B 4AFZC 4JJDA 1Q82U 1D1CA 3MEVA 2DKGA 1YWPA 3Q1JA 2L3PA 4JJNK 2C0OA 2RA2A 2CH4A 2NUZA 4ANJA 3DKMA 4LXCA 4J7FA 3RDVA 3JCMP 2A37A 4A4FA 1QVGS 3URGA 5CKDA 1M2VA 1QW1A 2OAUA 1QP3A 4XTWA 4QVDA 1H641 4M7AA 5L8RE 2LNVA 2KEAA 1MNDA 2YUPA 3OW2S 1YITT 1BI1A 2DE0X 1G83A 1VIEA 2E41A 2QTVA 3EGUA 4BUGA 1WXBA 2A28A 3OBWA 3L2QA 1W4SA 1YIJT 4KUIA 2W10A 3SFMA 1I4K1 3JCMQ 2NUPB 3SEMA 4A54A 3L2RA 3JCMb 3CC4A 1GL5A 5A0LA 3EFOB 1SSFA 5CR2A 1VQ8T 4E7IA 2QI2A 1XNIA 3M0SA 4P5NA 2O9VA 3I35A 1VQ9A 4LNPA 3CPWS 2GTJA 1TS9A 3E9FA 1RL2A 1RLPC 1WFWA 1LPLA 3RKWA 1JB0E 3NGPA 3VS0A 3EG3A 3H0IA 2E6NA 3MPUB 5GAOq 4HT8A 1WZOA 2WSCE 2RN8A 2RJCA 1V1CA 2EQMA 4F7UF 2CT4A 2DFUA 1TOVA 1IXDA 2LT4A 2CP2A 1VQ6Q 1K1ZA 1KSWA 2JMCA 1VQ5Q 1AZGB 2JTEA 1W1FA 4RTTA 4M7AD 1S72Q 3GF5A 4ZGDB 3M4YA 1CSKA 4QVCA 2YDLA 4QQGA 2FG0A 1K9MU 2COYA 4C0ZA 3VRYA 1GBQA 3CBOA 1UHFA 4XAXB 1LNXA 2KYMA 3OMCA 4PJOG 3A8HB 2HZYA 4E7KA 2ZPGB 1PD0A 3PTAA 8ATCB 2D6FA 1VQOA 2K5IA 3QYGB 2W0ZA 2FRWA 4PJJA 4PJOB 4JRQA 2EQUA 3CCRT 1QVGP 2ED1A 2VC8A 1NE8A 3A8OB 4C5EA 5KYWB 5GJVB 4B9WA 4M7DF 2DMOA 3MJXA 2YLCA 1ZUKA 3S3OA 1KC8U 3CCUQ 5GANf 3QIIA 5I11A 2V1QA 3LH0A 2EWNA 2KNBB 2DXTA 5D7UA 4ELYC 2X4WA 2COZA 4PJOA 2K3XA 2DA9A 1BU1A 3QSUA 1G3WA 1UGQB 4M75C 3CCSQ 3RBBB 1S1NA 2JNGA 3NPFA 3R6OA 3RUXA 2DJQA 3WVDB 5LJ3f 2RHZA 4BB7A 1TH7A 1ACMB 3RKXA 4JLIA 3RMQA 3MCAB 3H41A 4JUVA 2KGTA 5FWBA 1FXXA 3MEUA 4IUTA 4CC3A 2GQVA 2M9UA 1VQ4Q 2NLUA 1B7TA 5LJ5e 3O8VA 3HHTB 1O9SA 3CCRQ 2MCNA 1NJIC 1R0BG 4D8DA 2CZ0B 4IUQA 4MZMA 1M2OA 4IIMA 1EZZB 1MNEA 3OYIA 2K6DA 2OJ2A 1ARKA 3LW5E 5KE2A 1T0HA 2E1HA 2QDLA 4M75D 2QXFA 5GAMh 4EMHA 3P8BB 1AHJB 3LLRA 4RTYA 2YRVA 2EJ9A 4M78G 4FCYA 3NFCA 1M1KR 2BTTA 4XU1A 2RQWA 5CVIA 3RMSA 1TG0A 2R5AA 4J9DA 3CCST 1UGSB 4D6WA 2HSEB 5FRNA 3MP8A 4LDUA 1YIJA 1YCYA 2J05A 3GPLA 3SWNA 3HRTA 2VXFA 3SDZA 3CCSA 2HKNA 4KGVB 4PJOE 4E7LA 2ENMA 3V7RA 5GMKe 1Y96B 2QA4T 3OYNA 4M7AG 2H3JA 3VU3C 1WJRA 1SG5A 1OQKA 2GTOA 1K0XA 5FW9A 2DXUA 2JW4A 4BE0A 1X6OA 2E65A 2LQNA 2M0YA 1LCKA 3I56T 1UB4A 4X9DA 2KMTA 2RF0A 2PQWA 3VJPA 2EBPA 5GAN6 4A4KA 4M4ZA 2LX9A 2LT1A 4RG8A 2RMOA 3G6ET 4KGZB 4FU6A 4IUUA 1QLYA 3EH1A 2RQVA 2JTFA 3BE3A 5C0MA 2LZ6B 1PM3A 1M3CA 4EMKB 4IIOA 3CCMA 2E4HA 3L2VA 3TREA 4R55A 4BI8B 1KQ2A 3EGXB 1AVZC 1TSFA 1Y07A 2XI9A 3I55Q 2X3XD 2LC4A 1T0JA 4ZN3A 2F2XA 4D8KA 1QVFP 5D6YA 2ZCFB 3QUIA 1IREB 2RH2A 1WIEA 2JS0A 2QA4A 3JCMJ 2O4XB 1LJOA 2F5TX 3M0RA 1SPKA 4XU3A 2BZYA 3GNFB 3M56A 1FWZA 1AWXA 1VQ8A 3QG1A 4PJNA 4FSSA 5KYUB 3I56Q 5FU6B 1BK2A 2D1XA 2DM1A 2V26A 2CSIA 1C0MA 4KBMB 1AWWA 3OS1A 2X4JA 2VGMA 4LD6A 3DLLA 1E7OA 1ZUUA 1Q7YR 2E5QA 3G6EQ 1JJ2P 1JO8A 2CDTA 2D0QB 2Y4XA 3MP6A 4HCCA 1RACB 1IHVA 2K3YA 3CBPA 2LJ3A 3RNJA 4F16A 2WACA 1H3ZA 1AEYA 4Y91A 5KCHA 2DEQA 2EPDA 4GLKA 2RJDA 4M75F 5GJWB 5CKFA 3CCJQ 2YT6A 1W2BP 3OYDA 4OGEA 4OMPA 3C4SA 3CCVA 1PKSA 3RESA 2PUKB 1OV3A 2E6ZA 4OMNA 3G4SQ 4PKCC 3H8ZA 4WTOB 1W6XA 1ZA1B 1BB9A 3UDCA 4Q5WA 4AMCA 3EG1A 1KC8R 3M53A 3UA7A 5HCKA 3A8MB 2M16A 5IN1A 2O4XA 3ME9A 1U8RA 1BI2A 2LCLA 3VS7A 1BIBA 1YWOA 3CCVQ 4OF1A 2DVJA 3H0FA 3CC7Q 4XTUA 4N4GA 3HKSA 1RLQC 2GF7A 4OVAA 1KIKA 1N8RC 3OS5A 5DLQE 1MGQA 2D8HA 1GFCA 2FHDA 1K9AA 3LWHA 3L1AA 2JTMA 3VS6A 5L23A 3V8LA 3RIRA 3JB9G 1VQKQ 5EC7A 1MMAA 2PVGB 5FWCA 4FT4A 3C94A 4PJMA 3CC2T 1IZ6A 1OZ2A 2QAZA 4AFQC 6AT1B 1KK7A 4UC4A 3REAB 3OYBA 3FC3A 4CC2A 1VYUA 1V76A 3A5ZB 4HT9A 3M0PA 5GAN2 4M75B 3UWNA 1MMNA 5J26A 2AIRB 2RQRA 5GANg 1KJWA 4ZTJA 1JEGA 3CMAT
chains in the Genus database with same CATH topology
1VQ9T 1K73U 3I55T 2E6NA 3M58A 5GAOq 2ZPHB 1U1TA 4ME7A 4OB0B 4C5HA 4LDVA 4MZTA 4HT8A 5LJ3d 4C8QB 3TEEA 3UT1A 5FU6C 4LDXA 2WSCE 1ZBXA 5D6WA 5CQYA 5DY9A 2RHYA 2KK4A 3META 2RJCA 1B34B 3ZEHA 3JAME 3J7AF 3HSBA 4BY6C 2EQMA 4F7UF 1W2BS 1Y7XA 2HAXA 2PU9B 3M54A 1VQLT 3CXCS 4HCBA 4KT0E 2MAMA 3KUFA 2LT4A 3ZFJA 1VQ4A 3JRZA 3L2UA 1WJSA 3KXTA 5FU7C 4M7AD 2EFIA 5HK3A 1HXDA 4M75A 3ASKA 3GF5A 4ZGDB 3M4YA 4QVCA 2RJEA 4O6JA 4QQGA 3V7SA 3JCMe 3OYHA 5LJ3e 1K9MU 2A3LA 1EIFA 3L42A 4C0ZA 1VQNT 2XKOC 3NTHA 1BIAA 4GY5A 4J6XA 4A53A 4M7AE 1I8FA 1K8AU 4M77A 4MDXA 2XDPA 3CBOA 4XAXB 2ZZDA 4MZPA 1Q7YU 1LNXA 3OMCA 3QHSA 4PJOG 3A8HB 4ZGEB 2JUFA 2LQKA 5LJ5g 1N9SA 2ZPBB 2ZPGB 4XTZA 4E7KA 4NL3A 1KD1U 2PVOB 3PTAA 3M4GA 2D6FA 1PSFA 4JDSA 4WF2A 1VQOA 2K5IA 1PSEA 3CMAT 3QYGB 4N4HA 1Y71A 1ZHIA 3OYGA 2HNIA 1VQ6A 4HCZA 2XDBA 4JRQA 4PJOB 4N0AC 3FIFA 3CBMA 3M57A 2DIQA 4CI0C 2EQUA 1Q81U 3CCLT 3JCMf 4BD3A 3CCRT 1D3BB 1LOJA 3KBGA 3NTKA 3JB9F 4M7DG 2VC8A 1NE8A 3A8OB 4C5EA 4E47A 3LWIA 5CKEA 2LTOA 3S6WA 4B9XA 5CKHA 4BACA 3JB9D 2QTXA 4B9WA 2JVVA 4HA8A 1NPRA 4M77E 4M7DF 2EAYA 3CMAA 3HP9A 3CCMT 1VQKA 2YLCA 2QQRA 5GANe 1G3SA 3OYLA 3C12A 3S3OA 3BDLA 3V8KA 1KC8U 3P8HA 1M1KU 4M7DB 2EJFA 5GANf 3LGLA 3DB4A 3PFSA 2LQ8A 3QIIA 1Q82C 1VQ5A 3LH0A 2EWNA 5LJ5j 3M5AA 1KQSA 3OBYA 1VQPT 5J39A 4JS5A 1K73C 2DXTA 2EQKA 4ELYC 2FB7A 4C92G 3CMEA 1VUBA 2X4WA 4MMLA 4PLLA 2XU8A 4XTVA 3VUZA 3CCJT 1YJWA 4PJOA 2K3XA 2QEXT 3QSUA 1G3WA 1UGQB 1YI2A 1VQ5T 4M75C 3HL8A 3X24B 2RI5A 2V8JA 4M78C 4KUDK 4Y28E 2MF2A 1YHQA 1M90C 2JNGA 5GMKm 4C5GA 4J5YA 2XHCA 3HFOA 5LJ5d 3JB9J 4J6YA 2RJFA 4X34A 3R6OA 3RUXA 2FVUA 4C92F 5I2MA 5GAOr 2K57A 3WVDB 4M7AF 5I2SA 1BYMA 5LJ3f 2G3RA 2RHZA 5J3BA 4BB7A 2HD0A 1TH7A 1NPPA 3RKXA 3OYAA 2QQ9A 2FL7A 3MCAB 3QO3A 4JLIA 3RMQA 5GAMj 1JJ2S 1N27A 4JUVA 3LX7A 2CZ6B 4M7AC 5LJ5h 4BE2A 3M55A 1FXXA 2WSFE 3MEUA 4LDWA 3JCMV 4M7DC 4IUTA 1WJQA 1YJNT 2GQVA 2M9UA 2P0QA 1N8RU 3GIBA 3QDRB 2NLUA 3N5BB 5C6SA 4XTYA 3SWNB 5LJ5e 4A4GA 2CS7A 3O8VA 2L5QA 3HRSA 3HHTB 4C92A 1KD1C 3CCVT 1O9SA 3BDUA 3E1SA 4IURA 4A4HA 1NJIC 2QQAA 1M1GA 2CZ0B 3E19A 3LYIA 4IUQA 3C95A 3MEWA 2DVEA 2PVDB 1KHIA 2RHIA 4XU2A 1QVFS 5GAOn 3OYIA 2LCCA 4C92E 3LW5E 2VV5A 5KE2A 2RHXA 4M78F 4NOYA 2DIGA 2E1HA 4M75D 2QXFA 2LVMA 4EDUA 5GAMh 3S3NA 2YLBA 1HK9A 4EMHA 2RK2A 2CYZB 3P8BB 1AHJB 1M5Q1 1XTDA 2CZ1B 3LLRA 3T9NA 3CC2A 2DO3A 5FLXE 2DXCA 1GXIE 2YRVA 3M9QA 2EJ9A 1XQHA 3CEYA 3EAEA 4RCCA 5LJ3j 4QW2A 1QVPA 4M78G 4MMKA 2M1HA 4L5GA 2JOYA 3NFCA 3OSVA 4EMGA 5CCAA 4XU1A 4C8QE 5CVIA 1U1SA 2RI3A 3RMSA 1G3YA 3CD6T 4JRIA 2HQEA 2R5AA 4MDWA 3OW2A 2JZ2A 3CCST 1UGSB 1JRIA 1O75A 5DM7R 2KSSA 4D6WA 3CCQA 3X26B 3OYEA 3CC7T 3VV0A 5FRNA 3MP8A 5LL6S 3OYCA 2Y90A 1M8VA 4LDUA 5CAIA 2DD5A 3V7CA 1V29B 4EPCA 1YIJA 1YCYA 3QJYA 3GPLA 2BKDN 3SWNA 2R5MA 1VQLA 3HRTA 4M7DA 3S3MA 2VXFA 3SDZA 3A8LB 3CXCA 3CCSA 1K9MC 4C92B 5HK0A 4LDYA 1VQ7A 4PJOE 5D6XA 4E7LA 3V7RA 2E10A 4FM4B 5GMKe 4OB2B 1Y96B 5A0DA 1K8AC 2DTOA 2QA4T 2O01E 2RK1A 3OYNA 2H3JA 4M7AG 3VU3C 5CQXA 1WJRA 3X28B 2DPPB 5LJ3h 5GAOl 2EJGA 5LJ3g 1VQ4T 3ZBDA 2VGNA 5GMKh 3E9GA 3INZA 4LD9K 2P4TA 2I2LA 1VQNA 2DK3A 4C5IA 1P92A 2DXUA 4BE0A 2QQBA 4L6V5 1X6OA 2E65A 1BI3A 3JB9I 2KY9A 3JCMd 4X9CA 5GANj 4M77F 4YTLA 1QP2A 3VYHB 2B8AA 3WXMB 3I56T 4M7DE 4RCBA 1UB4A 4X9DA 4IKFA 2KMTA 3OS0A 1I5LA 2D9TA 4JRKA 2CGHA 3X20B 1G5VA 2DZ9A 2LDMA 4PLIA 1YJ9A 2PQWA 3VJPA 1VQOT 5AYFA 1W2BA 5GAN3 5GAN6 1ZQ1A 4A4KA 4EMKA 2DTHA 3SB2A 2XICA 3CPFA 3V8JA 2LX9A 2LT1A 2A7YA 4RG8A 2GCXA 1VQMA 4QQDA 1N6AA 2ZPIB 3G6ET 3QZ9B 4ELZC 5A0GA 3FJPA 2K5FA 4NL2A 5GAN4 3CCEA 5GAN8 3CC4T 4FU6A 4IUUA 3CCUA 3QBYA 1N9RA 4Z02A 2JTFA 3EFRA 4BE1A 5C0MA 5GMKj 1VQ6T 4BI3A 5KE3A 5GAMd 3OYKA 4C8QD 4EMKB 3CCLA 1UGPB 3G6EA 3CCMA 5GAMf 4RKUE 3CCRA 3L2VA 2GFAA 3TREA 4R55A 4BDZA 4XTXA 1Y96A 2E70A 2HBPA 2XIDA 4FL6A 4BI8B 1KQ2A 1Y07A 3GOXA 2XI9A 3L2WA 2LC4A 2P0KA 2RD1A 4QVZA 2DJZA 1VQPA 2XD0A 4ZN3A 5FRMA 1OZ3A 2F69A 5IT9E 4E7HA 1QVGA 1WGSA 1KQ1A 2K5LA 4BI4A 1M90U 4ATOA 3OS2A 4ZN1A 5D6YA 2PUOB 2ZCFB 4M78A 4PJOD 1S72A 3VUBA 2K2VA 3QUIA 3QZ5B 3FEOA 4CRIA 1IREB 1YBYA 1R8OB 4RMOA 2RH2A 4DOWA 4DA4A 2IVWA 4VUBA 2OTJT 2QA4A 3JCMJ 2O4XB 1LJOA 3PNWC 1S72T 2F5TX 2DD4A 3CD6A 3HRUA 3MO8A 4XU3A 2JN0A 3GNFB 1B34A 1FWZA 2E64A 3M56A 3OYJA 1VQ8A 2MWOA 3DB3A 1KC8C 2OTJA 3QG1A 4C0DB 1VIFA 3G71A 3CPWA 4M7DD 4BDYA 2E12A 5FU6B 4M77B 2DZCA 3PMTA 4C8QA 1KHCA 4DQ2A 1WNLA 2ZPFB 4XU0A 1VQ7T 3TU4K 3A8GB 3OMGA 1YJ9T 3JB9H 2QQSA 4M7AB 4KBMB 1NJIU 4A4EA 2X4JA 3OS1A 4J7IA 4XQ3A 2L3RA 2VGMA 4LD6A 1XOVA 3OYYA 3DLLA 2X35A 3OQ5A 4N0AA 3PGGA 3WVEB 2E5QA 4BY6B 4C92D 5HKCA 3I56A 2ZPEB 2V8IA 3H6ZA 4DOVA 2D0QB 1Q86U 4IUVA 3L2ZA 1YHQT 2Y4XA 1G3TA 3MP6A 4KULA 4V2SA 4NS5A 2VUBA 2AHJB 4HCCA 1FX7A 4C8QF 4ZGJB 4OB3B 5GANh 3SWNC 1BI0A 2K3YA 3CBPA 4M77D 5IAYA 4II1A 3NTIA 2XG8D 2EQJA 4E7JA 1WPYA 2WACA 3JCMg 3FDRA 1VQMT 5EG2A 4OMFB 2XK0A 4PNOA 4ZTFA 1H3ZA 3QXEB 4Y91A 5KCHA 4J83A 3CCUT 3QJ6A 2DEQA 1UEBA 2V8KA 5GANd 2DAQA 4GLKA 2RHUA 3ER0A 1Q81C 2RJDA 5GAN7 2EIFA 4M75F 3GLXA 3CCET 4OGCA 5CKFA 3JCMc 3J81E 1X01A 1M9SA 3OYDA 3OB9A 3J80E 2BIVA 3CMET 4N4IA 2EYQA 4OGEA 3C4SA 3CCVA 1YITA 2X4XA 3OA6A 3G7ZA 5CK9A 4C0GA 1VQKT 1Q7YC 2VYTA 5GAN5 4HKEA 1YI2T 1RI0A 3RESA 4O5VA 2PUKB 2E6ZA 3OSSC 3QKJA 3G4SA 3FLGA 3VYGA 1UGRB 2CZ7B 5FROA 3PIOA 2YHTA 4PKCC 5A2QE 4JRPA 4J6WA 3H8ZA 2MWPA 5I21A 2OTLT 3CC7A 3MHXA 5GMKl 4XK8E 3G71T 2KDSA 1DJ7B 1M1FA 5KH6A 3I55A 4J8OA 3UDCA 3PMIA 2MMPA 4IUPA 3JCMX 3HPWA 4F7UA 4C8QC 2QEXA 2K4YA 4Q5WA 5GAOp 4M78E 1QVFA 2ZGWA 3P8DA 2QDYB 4QQ6A 3MP1A 3MEAA 4M75E 2CKKA 3M53A 4OP0A 5CO7A 5FU7B 3SD4A 3X25B 3PIPA 3A8MB 4RG2A 2FYKA 2M16A 4C0FA 2RI2A 5IN1A 1I81A 2R58A 3GP8A 2O4XA 2L8DA 3ME9A 1U8RA 1M4ZA 2DXBA 1BI2A 5M9OA 2LCLA 3DLMA 1BIBA 2GFUA 4FIBA 3OYFA 4M78D 1OI1A 2RM4A 2F5KA 1WQ7A 3RERA 3BY7A 3LGFA 4JLGA 4OF1A 3CCQT 2Y4YA 1M1KC 3TCJA 4M78B 4M77G 4R56A 5GAMg 1Q82U 4FT2A 1BKBA 3MEVA 2DKGA 4M77C 3BFMA 1Q86C 5CIUA 3Q1JA 4XTUA 2L89A 4N4GA 3HKSA 1WQWA 3JCMh 4JJNK 4C0DC 2GF7A 5GMKi 4OVAA 4F7UB 2RA2A 3OS5A 1N8RC 1D3BA 3FRNA 1MGQA 2BUDA 5DLQE 3UPUA 2C06A 3F70A 3DKMA 4J7FA 3EFSA 3HFNA 2FHDA 3JCMP 1KG1A 3LWHA 4C92C 2RO0A 4A4FA 2M0OA 2KAFA 2JTMA 3BW1A 3L1AA 5GAOm 2RB6A 3URGA 1QVGS 2X4YA 4F7UG 3JCMW 5CKDA 1JBMA 2EKOA 3PT9A 1QW1A 3QYHB 3AHUA 2HQXA 1QP3A 2OAUA 4XTWA 5CKBA 4QVDA 4PL6A 3RKYA 2R57A 3V8LA 3RIRA 3OYMA 1H641 3JB9G 4M7AA 1YJNA 3GNGA 4OB1B 3QPHA 2PVGB 5LJ5f 2LNVA 5L8RE 4FT4A 3FB9A 3C94A 2KQWA 3G4ST 3OW2S 1MHNA 1BI1A 1YITT 1KQSS 3CC2T 1IZ6A 3VKIA 2XDDA 3OY9A 3JSCA 1VIEA 2E41A 5KCOA 4FSXA 4BUGA 2OTLA 1OYXA 1OZ2A 2WSEE 3OBWA 3L2QA 2VXEA 4JS4A 1W4SA 1YIJT 4KUIA 4UC4A 3OYBA 3SFMA 5DLOA 1I4K1 3JCMQ 3FC3A 2IG0A 2P0PA 3M59A 4F7UE 4A54A 4M75G 4PJOF 3JCMb 3L2RA 3CC4A 5A0LA 2DTIA 1SSFA 5CR2A 5HY6A 1NZ9A 4E7IA 2QI2A 1VQ8T 1XNIA 5GAMe 3A5ZB 4P5NA 4HT9A 4PJOC 2KVQG 1VQ9A 1X75C 3CPWS 5GAN2 2LRQA 3E9FA 4M75B 3UWNA 4MZMA 5J26A 4TVRA 2MI6A 5GANg 4C8QG 1RL2A 4L59A 4ZTJA 4EMKC 3RKWA 3CCJA 1YJWT 1JJ2A 1JB0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4Y A;  2LC4 A;  2LNV A;  3OSS C;  2Y4X A;  2IVW A; 
#chains in the Genus database with same CATH topology
 1K73 U;  1VQO Q;  4ME7 A;  2KT8 A;  4C5H A;  4MZT A;  4QKU A;  4LUD A;  5LJ3 d;  4C8Q B;  5FU6 C;  2RHY A;  4GLM A;  1B34 B;  1VQP Q;  3JAM E;  2RQT A;  4K11 A;  1VQL T;  3CXC S;  4PFP A;  4KT0 E;  2MAM A;  1SRM A;  1SKU B;  1VQ4 A;  3JRZ A;  4DBR A;  1HXD A;  7AT1 B;  5LJ3 e;  1RAH B;  1EIF A;  2CP3 A;  1VQN T;  2XKO C;  3NTH A;  1BIA A;  4A53 A;  4M7A E;  1K8A U;  2H8H A;  1GCQ A;  2ZZD A;  2O88 A;  4MZP A;  4Z89 A;  1YJ9 Q;  3CQT A;  2JUF A;  1N9S A;  1KD1 U;  4NL3 A;  2PVO B;  3M4G A;  1PSF A;  4JDS A;  1PSE A;  1WLP B;  2L0A A;  1M2V B;  4HCZ A;  4N0A C;  3CBM A;  4CI0 C;  1Q81 U;  1IGU A;  3JCM f;  4BD3 A;  1D3B B;  1LOJ A;  2YRC A;  4JPB W;  4M7D G;  3LWI A;  2LTO A;  1H3H A;  4BAC A;  5CKH A;  2FZK B;  3CMA A;  3CCM T;  3HP9 A;  3BDL A;  1M1K U;  3P8H A;  4M7D B;  2EJF A;  3LGL A;  1IGQ A;  1Y0M A;  1IHW A;  2BE7 D;  2JM9 A;  3OBY A;  5J39 A;  2EQK A;  2FB7 A;  4C92 G;  1VUB A;  4XTV A;  4DEY A;  1K76 A;  1H8K A;  2F1L A;  3HL8 A;  2RI5 A;  2LJ0 A;  1PNJ A;  2DL3 A;  2DF6 A;  2MF2 A;  1M90 C;  2NUP A;  3NHN A;  1VQM Q;  2RJF A;  4X34 A;  2FVU A;  4C92 F;  1WDX A;  2EVR A;  5I2S A;  2L2P A;  5J3B A;  4KH0 B;  1NPP A;  2DRK A;  2FL7 A;  1IB8 A;  1JJ2 S;  1N27 A;  3LX7 A;  5LJ5 h;  3EGD A;  1JXO A;  2WSF E;  1YJN T;  1QKW A;  1PC0 A;  2H3E B;  1HYO A;  3HRS A;  4C92 A;  2AK5 A;  3CCQ Q;  4A4H A;  4X1V A;  1KHI A;  1QKX A;  4AG1 C;  2MPX C;  1SF9 A;  1NYF A;  4NOY A;  1ZA2 B;  4R0K A;  2LVM A;  1BCO A;  2VB6 A;  2RK2 A;  2CYZ B;  3T9N A;  1M5Q 1;  3UA6 A;  4J9G A;  1GXI E;  5AT1 B;  3EAE A;  4RCC A;  5KYY B;  5LJ3 j;  1QVP A;  4MMK A;  2M1H A;  2AT1 B;  4L5G A;  5CCA A;  1R77 A;  1BBZ A;  4JRI A;  4MDW A;  4DBH A;  3OW2 A;  1O75 A;  2KSS A;  3MKD A;  3CCQ A;  3OYE A;  4DEX A;  3VV0 A;  3EFO A;  1I1J A;  2E3H A;  3OYC A;  5LL6 S;  1M8V A;  1OX8 A;  1V29 B;  1OOT A;  2R5M A;  3A8L B;  3CXC A;  1K9M C;  2AZV A;  1VQ7 A;  5D6X A;  3I5S A;  2CRE A;  4OB2 B;  5A0D A;  2CH4 W;  3UF4 A;  3X28 B;  5GAO l;  1U06 A;  5LJ3 g;  3ZBD A;  3E9G A;  3INZ A;  4LD9 K;  2I2L A;  2HCK A;  2DK3 A;  1P92 A;  2O31 A;  4JZ3 A;  4FYW B;  1G8X A;  4J9C A;  1WHM A;  4X9C A;  4JJC A;  4M7D E;  5IHK A;  4IKF A;  1I5L A;  1BCM A;  1VQO T;  1LVK A;  5GAN 3;  1D0Y A;  1VQM A;  1N6A A;  5A0G A;  4NL2 A;  2HEQ A;  2P4R A;  2AKL A;  3QBY A;  4Z02 A;  1VQ6 T;  3EFR A;  4BE1 A;  4C8Q D;  3VS2 A;  3CCL A;  4HVW A;  4RKU E;  5GAM f;  1RUW A;  1YJW Q;  2XID A;  2LMJ A;  1TWB A;  3GOX A;  3L2W A;  2P0K A;  2VWF A;  4JZ4 A;  1NM7 A;  1AOJ A;  1OUL A;  2MK5 A;  1OX9 A;  5FRM A;  5IT9 E;  2F69 A;  1KQ1 A;  3OS2 A;  4ZN1 A;  2PUO B;  4PJO D;  4CRI A;  4DA4 A;  2QA4 Q;  4VUB A;  2GBQ A;  1T3L A;  3PNW C;  2DD4 A;  3HRU A;  3EHR A;  2FPE A;  2AKK A;  2MWO A;  1G2B A;  2OTJ A;  1VIF A;  4M77 B;  3PMT A;  1OU9 A;  1WNL A;  2QQS A;  4M7A B;  1NJI U;  4A4E A;  4J7I A;  2L3R A;  3VS1 A;  1XOV A;  3OQ5 A;  2CT3 A;  3PGG A;  3I56 A;  3HTR A;  1TTH B;  4IUV A;  5IH2 A;  5KYN A;  5GAN h;  1BI0 A;  4LN2 A;  4A63 B;  4M77 D;  3U23 A;  3EG9 A;  5IAY A;  2DET A;  2QGG A;  4E7S A;  2EQJ A;  4E7J A;  2DBM A;  3FDR A;  1VYT A;  4OMF B;  4PNO A;  3M0T A;  2E5K A;  2MIO A;  4KGX B;  1Q81 C;  5GAN 7;  1ZSG A;  2LQW A;  1X01 A;  2K7A A;  3OB9 A;  4ZNX A;  5KYY A;  4N4I A;  1MMG A;  3G7Z A;  9ATC B;  4C0G A;  5GAN 5;  2OI3 A;  4O5V A;  1UHC A;  3H9N A;  3QKJ A;  4AFS C;  3FLG A;  3PIO A;  4JRP A;  5A2Q E;  4J6W A;  1VA7 A;  3CC7 A;  4E6R A;  5GMK l;  5KH6 A;  1H92 A;  4J8O A;  3PMI A;  2MMP A;  4F7U A;  4C8Q C;  2QDY B;  2XMF A;  2CKK A;  3PIP A;  2ABL A;  1IRX A;  4RG2 A;  4RTX A;  2FYK A;  2RI2 A;  2R58 A;  2GGR A;  1OI1 A;  2F5K A;  1WQ7 A;  4E7Z A;  3CCQ T;  3TCJ A;  2CSQ A;  4FT2 A;  1QWE A;  1VQ9 Q;  1BKB A;  3LH5 A;  1Q86 C;  5CIU A;  2KE9 A;  1WQW A;  4C0D C;  5GMK i;  2FPF A;  1ABO A;  1D3B A;  4OMQ A;  3FRN A;  3UPU A;  3F70 A;  4CC4 B;  3HFN A;  1VQL Q;  1KG1 A;  4C92 C;  1JXM A;  1X6G A;  1M27 C;  3BW1 A;  1B07 A;  5GAO m;  2X4Y A;  4F7U G;  3JCM W;  1RAG B;  1JBM A;  3PT9 A;  1U5S A;  1PD1 A;  5CKB A;  1WX6 A;  2NWM A;  4J9F A;  1OPL A;  1YJN A;  3GNG A;  1YI2 Q;  3QPH A;  1XJW B;  1HJD A;  2KBT A;  3FB9 A;  1GFD A;  2KQW A;  1UJ0 A;  4M7D C;  1MHN A;  1UGV A;  3SHW A;  2OTL A;  4FSX A;  3NMZ C;  2VXE A;  5DLO A;  4F7U E;  4M75 G;  4PJO F;  2DNU A;  1NZ9 A;  4FYY B;  5GAM e;  2LRQ A;  4TVR A;  2MI6 A;  2HDA A;  1ZSZ C;  4L59 A;  3CCJ A;  1YJW T;  1PHT A;  1JJ2 A;  2LP5 A;  1VQ9 T;  3I55 T;  2ZPH B;  1U1T A;  3TEE A;  4LDX A;  1ZBX A;  5D6W A;  3MET A;  3ZEH A;  3J7A F;  2LCS A;  2EGE A;  1KQS P;  3TVT A;  4BY6 C;  3HSB A;  1W2B S;  1Y7X A;  2PU9 B;  3M54 A;  1AWO A;  2HMA A;  4HCB A;  3KUF A;  3L2U A;  1YNZ A;  5FU7 C;  2JJ9 A;  5HK3 A;  3A98 A;  4M75 A;  2FZG B;  3ASK A;  1NBE B;  2C0T A;  4O6J A;  3V7S A;  3JCM e;  2G6F X;  3OYH A;  2A3L A;  4ORZ A;  4GY5 A;  4MDX A;  2P84 A;  2XDP A;  1FMK A;  2YRD A;  1M8M A;  2ROT A;  2K2M A;  1VOM A;  5LJ5 g;  4XTZ A;  1T3S A;  4KRT A;  4WF2 A;  1YJN Q;  1ABQ A;  4N4H A;  3OYG A;  2HNI A;  4AFU C;  1VQ6 A;  2KRO A;  1VQ8 Q;  3FIF A;  3M57 A;  2ECZ A;  2F2V A;  3EHQ A;  3CCL T;  4HVV A;  1RI9 A;  3NTK A;  3JB9 F;  4E47 A;  1E6H A;  4J9I A;  1RAI B;  3EGD B;  3JV3 A;  4B9X A;  4FW2 A;  2GNC A;  2QTX A;  3D7S B;  3EG2 A;  4M77 E;  3CMA Q;  1VQK A;  1FMW A;  5GAN e;  1VQ7 Q;  1G3S A;  2JMA A;  3V8K A;  3DB4 A;  1K0S A;  1VQ5 A;  5LJ5 j;  3M5A A;  1KQS A;  1ZSZ A;  3CME A;  4MML A;  2XU8 A;  3AT1 B;  2IIM A;  1VQ5 T;  1CKA A;  3X24 B;  2V8J A;  1D0Z A;  4M78 C;  2MYS A;  4Y28 E;  1ZUY A;  1OPK A;  1ZX6 A;  5GMK m;  4C5G A;  4J5Y A;  2YXY A;  2XHC A;  5I22 A;  3HFO A;  4J6Y A;  1VQN Q;  2OTL Q;  5I2M A;  5GAO r;  2K57 A;  1MUZ A;  1GBR A;  2G3R A;  3OYA A;  1OU8 A;  2QQ9 A;  3QO3 A;  2KI7 A;  4DBF A;  5GAM j;  4OMO A;  2CZ6 B;  3M55 A;  3JCM V;  1JU5 C;  1WJQ A;  3VS5 A;  1N8R U;  2P0Q A;  3GIB A;  2D0N A;  3N5B B;  1GRI A;  1RAB B;  1I0C A;  1NYG A;  4XTY A;  3SWN B;  1SHG A;  2CS7 A;  2QAS A;  4Y92 A;  3CCV T;  4JJB A;  3BDU A;  3E1S A;  4IUR A;  1J3T A;  3A1P A;  3C95 A;  2DVE A;  2PVD B;  2RHI A;  1QCN A;  1YN8 A;  1NEG A;  1AWJ A;  3M0Q A;  1TU0 B;  1UJY A;  2VV5 A;  4M78 F;  2CUD A;  1UFF A;  2YLB A;  1HK9 A;  5GAM g;  3CC2 A;  1QCF A;  2X3W D;  2DO3 A;  5FLX E;  4GBQ A;  2DXC A;  4QW2 A;  2VAS A;  2JOY A;  3OSV A;  4EMG A;  4C8Q E;  1BYM A;  3CD6 T;  2I0N A;  2JZ2 A;  2M02 A;  1FYN A;  5DM7 R;  3X26 B;  3CC7 T;  3PVL A;  2LX7 A;  5KYU A;  1WXU A;  3CC2 Q;  5CAI A;  2DD5 A;  4EPC A;  1VQL A;  3REB B;  4M7D A;  2BZX A;  3S3M A;  1YP5 A;  2A08 A;  3EH2 A;  4FM4 B;  2SRC A;  5KYX A;  1K4U S;  1K8A C;  5KYW A;  2NYS A;  5CQX A;  2DPP B;  2EJG A;  1VQ4 T;  1VQN A;  1YFN A;  2P4T A;  1SSH A;  1BI3 A;  3JB9 I;  1SHF A;  1R0C B;  4HCK A;  5GAN j;  3VYH B;  1ZBJ A;  2B8A A;  4RCB A;  4FYV B;  1ZSZ B;  3OS0 A;  2CGH A;  5IXB A;  1G5V A;  2DZ9 A;  1YJ9 A;  5AYF A;  2JT4 A;  4EMK A;  2DTH A;  2DYI A;  3SB2 A;  2XIC A;  2JM8 A;  3V8J A;  2K9G A;  2A7Y A;  2GCX A;  2ZPI B;  3QZ9 B;  5GAN 4;  3CCE A;  5GAN 8;  3CCU A;  8AT1 B;  1N9R A;  5GMK j;  4BI3 A;  5KE3 A;  3G6E A;  1UDL A;  2GFA A;  4BDZ A;  4XTX A;  2L3S A;  2F2W A;  2PZ1 A;  1VQP A;  2XD0 A;  1OZ3 A;  2OX7 A;  4E7H A;  1QVG A;  1WGS A;  1KD1 R;  3QWX X;  4BI4 A;  1M90 U;  4ATO A;  2YSQ A;  4M78 A;  1S72 A;  1A0N B;  2K2V A;  3CCE Q;  1YBY A;  1R8O B;  3EGX A;  4RMO A;  4DOW A;  1Y57 A;  1F1B B;  1S72 T;  1TUD A;  3MO8 A;  3OYJ A;  1B34 A;  3DB3 A;  3UAT A;  1PRL C;  4C0D B;  1QQJ A;  4M7D D;  3G71 Q;  4BDY A;  1QWF A;  3O5Z A;  3H0H A;  4DQ2 A;  1KHC A;  4XU0 A;  1VQ7 T;  2J7I A;  2MOX A;  3A8G B;  1YJ9 T;  1N8R R;  5IHN A;  3JB9 H;  3I5R A;  4XQ3 A;  3OYY A;  2EYY A;  2A36 A;  3WVE B;  4C92 D;  2V8I A;  3H6Z A;  2YWW A;  4DOV A;  3CC4 Q;  3VS4 A;  5IHI A;  1G3T A;  4V2S A;  2LJ1 A;  4ZGJ B;  2EGC A;  3SWN C;  2B86 A;  4PJL A;  4II1 A;  1U3O A;  3NTI A;  2XG8 D;  1VQM T;  3JCM g;  1WPY A;  3G1J A;  5EG2 A;  3QXE B;  1HSQ A;  2RHU A;  2ATC B;  3ER0 A;  2JS2 A;  4OGC A;  3JCM c;  1QCO A;  1M9S A;  3J80 E;  1OEB A;  2CP7 A;  3ZL7 C;  2X4X A;  4J9E A;  1MMD A;  1K9M R;  2KXC A;  1VQK T;  2VYT A;  2DRM A;  4HKE A;  1YI2 T;  1RI0 A;  1K73 R;  2X51 A;  3OSS C;  1WHJ A;  2K3B A;  3G4S A;  4F17 A;  1Q82 R;  1UGR B;  2DIL A;  5FRO A;  2YHT A;  2MWP A;  5I21 A;  3MHX A;  4XK8 E;  1DJ7 B;  1M1F A;  3I55 A;  1YIJ Q;  2ED0 A;  3JCM X;  2K4Y A;  4ESR A;  2EQI A;  4M78 E;  4RTW A;  3MP1 A;  3MEA A;  4M75 E;  2RPN A;  5FU7 B;  3SD4 A;  3X25 B;  2DXB A;  3RER A;  3BY7 A;  4JLG A;  2Y4Y A;  2KRS A;  2X9H A;  4M77 G;  4R56 A;  3EG0 A;  4M77 C;  3BFM A;  3FJ5 A;  3JCM h;  2L89 A;  1UEC A;  1RAF B;  4F7U B;  2NUT A;  2BUD A;  2KXD A;  2C06 A;  2CP0 A;  3EFS A;  2DEU A;  3TSW A;  2RO0 A;  1EFN A;  1NEB A;  2M0O A;  2KAF A;  2M51 A;  2RB6 A;  4KH1 B;  2ESW A;  2EKO A;  3QYH B;  3AHU A;  2HQX A;  4PL6 A;  3RKY A;  2R57 A;  3OYM A;  2CP5 A;  4OB1 B;  2DX1 A;  4RTZ A;  2RNA A;  1PCX A;  5LJ5 f;  3G4S T;  1KQS S;  3OY9 A;  1Z9Q A;  3VKI A;  1X43 A;  3JSC A;  2XDD A;  5KCO A;  1OYX A;  2WSE E;  1WYX A;  4JS4 A;  1TUG B;  2D8J A;  2IG0 A;  2P0P A;  3M59 A;  2DYB A;  2DTI A;  1D0X A;  5HY6 A;  2GQI A;  1D09 B;  3KFV A;  4PJO C;  2KVQ G;  1X75 C;  4FYX B;  3OW2 P;  3CXC P;  3I9Q A;  1PG5 B;  4C8Q G;  2V1R A;  4EMK C;  3RR6 A;  3GBQ A;  3CCM Q;  2VKN A;  3M58 A;  4OB0 B;  4LDV A;  3PE0 A;  2KR3 A;  3UT1 A;  1UG1 A;  1IO6 A;  5CQY A;  5DY9 A;  2KK4 A;  1N5Z A;  4RTV A;  1X6B A;  1B3Q A;  2HAX A;  1GCP A;  2QYZ A;  2LNH B;  3E2U A;  1X2Q A;  3ZFJ A;  1WJS A;  2OAW A;  3KXT A;  2EFI A;  2RJE A;  4FW1 A;  3L42 A;  1ZLM A;  4J6X A;  3CPW P;  1I8F A;  2QG9 B;  4M77 A;  4AG2 C;  4LE9 A;  1Q7Y U;  1PWT A;  4AT1 B;  3QHS A;  1SEM A;  4ZGE B;  2LQK A;  2ZPB B;  1NG2 A;  1NLP C;  2DL7 A;  2OTJ Q;  4PFZ A;  1Y71 A;  1ZHI A;  2DL5 A;  2XDB A;  2DIQ A;  3KBG A;  1WHH A;  1W70 A;  3QDF A;  2EYW A;  5CKE A;  3S6W A;  3JB9 D;  2DLP A;  2E3I A;  2JVV A;  4HA8 A;  1NPR A;  1E6G A;  2EAY A;  2QQR A;  3OYL A;  3C12 A;  1HD3 A;  1SRL A;  2ROL A;  3PFS A;  2LQ8 A;  1Q82 C;  1M90 R;  1VYV A;  1VQP T;  1I07 A;  4JS5 A;  1K73 C;  1AD5 A;  2CUB A;  4PLL A;  3CCJ T;  3VUZ A;  1YJW A;  1NJI R;  4E2F B;  3QWY A;  2QEX T;  1YI2 A;  1NLO C;  4DBQ A;  4KUD K;  2HL5 C;  1YHQ A;  2BE9 B;  1M30 A;  2KRN A;  2HQH A;  1Z9Z A;  2EW3 A;  3VRZ A;  4J9H A;  5LJ5 d;  3JB9 J;  1GCQ C;  5ECA A;  4M7A F;  1WHG A;  1FMV A;  2HD0 A;  2FPD A;  2YUQ A;  4M7A C;  4BE2 A;  1M3B A;  4LDW A;  4RUG A;  4EIK A;  3QDR B;  5C6S A;  2FEI A;  4QT7 A;  2SEM A;  4A4G A;  2L5Q A;  1KD1 C;  4Z88 A;  1EX4 A;  5IXF A;  2QQA A;  1M1G A;  3E19 A;  3LYI A;  4YTL A;  4XU2 A;  3MEW A;  5KYX B;  3S3N A;  1Q86 R;  1QVF S;  1WHL A;  5GAO n;  2COW A;  2LCC A;  4C92 E;  1X2K A;  1C6V X;  2RHX A;  2K79 A;  2DIG A;  4EDU A;  4PFO A;  1YIT A;  2CZ1 B;  1XTD A;  1RAD B;  3M9Q A;  2O9S A;  1XQH A;  3CEY A;  3TQ7 P;  1M3A A;  1UTI A;  2EYZ A;  1U1S A;  2RI3 A;  1G3Y A;  2HQE A;  1C1A A;  1JRI A;  1Q81 R;  4LUE A;  2FO0 A;  2Y90 A;  1YIT Q;  3V7C A;  3QJY A;  2BKD N;  2EKH A;  2ZAE A;  4C92 B;  5HK0 A;  4LDY A;  1I5O B;  2E10 A;  1UUE A;  4HVU A;  1JQQ A;  4OMM A;  2DTO A;  4J9B A;  2O01 E;  2QK0 A;  2RK1 A;  5LJ3 h;  3THK A;  2RQU A;  3C0C A;  2VGN A;  5GMK h;  4C5I A;  2QQB A;  1WI7 A;  4L6V 5;  2JXB A;  1TUC A;  2KY9 A;  2O2O A;  3JCM d;  2J6K A;  4CC7 A;  4M77 F;  1QP2 A;  3WXM B;  2D9T A;  4JRK A;  3X20 B;  2LDM A;  4PLI A;  1W2B A;  1ZQ1 A;  2NUT B;  3CPF A;  2FRY A;  1MV0 B;  1WHK A;  4QQD A;  3IQL A;  4ELZ C;  3FJP A;  2K5F A;  2EYX A;  2KRM A;  3CC4 T;  1YHQ Q;  2Z0W A;  1AZE A;  4RTU A;  5GAM d;  3OYK A;  2PNI A;  1K8A R;  1UGP B;  3CCR A;  3CD6 Q;  1WXT A;  1Y96 A;  2E70 A;  2HBP A;  4FL6 A;  1AT1 B;  2HL3 A;  1X27 A;  2RD1 A;  4QVZ A;  2DJZ A;  1D1A A;  1RAA B;  2AZS A;  2K5L A;  2HKQ B;  3M0U A;  3VUB A;  3QZ5 B;  3FEO A;  2J06 A;  1MV3 A;  2IVW A;  3CME Q;  2OTJ T;  1TXQ A;  3CD6 A;  2KT1 A;  2YUO A;  2JN0 A;  3CCL Q;  2E64 A;  2C0I A;  4F04 B;  1KC8 C;  3TSZ A;  3G71 A;  3CPW A;  2E12 A;  2DL4 A;  2L3Q A;  2DZC A;  4C8Q A;  2ZPF B;  3TU4 K;  3OMG A;  1D1B A;  2X35 A;  4N0A A;  3ULR B;  4BY6 B;  5HKC A;  2ZPE B;  1Q86 U;  3L2Z A;  1YHQ T;  2A0F B;  4KUL A;  3PVQ A;  4NS5 A;  2VUB A;  2AHJ B;  1FX7 A;  4C8Q F;  3R6N A;  1X69 A;  2IPO B;  4OB3 B;  1YCS B;  1PRM C;  4F14 A;  2DER A;  2XK0 A;  4ZTF A;  4J83 A;  3CCU T;  3QJ6 A;  1UEB A;  2V8K A;  5GAN d;  2DAQ A;  2PTK A;  2EIF A;  3VS3 A;  3GLX A;  3CCE T;  3J81 E;  1Q95 G;  2QEX Q;  2BIV A;  2BZ8 A;  2EGA A;  4PK4 A;  2EYQ A;  3CME T;  3OA6 A;  5CK9 A;  4Z8A A;  1Q7Y C;  1KFZ A;  3VYG A;  2FZC B;  2KYB A;  2CZ7 B;  3EG9 B;  1WA7 A;  2OTL T;  3G71 T;  2HSP A;  2KDS A;  2DBK A;  1QMC A;  1PKT A;  4IUP A;  4OML A;  3HPW A;  2QEX A;  5GAO p;  1QVF A;  2ZGW A;  3P8D A;  2DL8 A;  4WCI A;  4QQ6 A;  4OP0 A;  5CO7 A;  1UE9 A;  1CKB A;  2QGF B;  2CP6 A;  4C0F A;  1I81 A;  3GP8 A;  4HXJ A;  2L8D A;  2J6F A;  1M4Z A;  2HBW A;  5M9O A;  1RAE B;  2YUN A;  3DLM A;  2GFU A;  4FIB A;  3OYF A;  4M78 D;  2RM4 A;  4B6M A;  3LGF A;  2VVK A;  1M1K C;  2J6O A;  4M78 B;  4AFZ C;  4JJD A;  1Q82 U;  1D1C A;  3MEV A;  2DKG A;  1YWP A;  3Q1J A;  2L3P A;  4JJN K;  2C0O A;  2RA2 A;  2CH4 A;  2NUZ A;  4ANJ A;  3DKM A;  4LXC A;  4J7F A;  3RDV A;  3JCM P;  2A37 A;  4A4F A;  1QVG S;  3URG A;  5CKD A;  1M2V A;  1QW1 A;  2OAU A;  1QP3 A;  4XTW A;  4QVD A;  1H64 1;  4M7A A;  5L8R E;  2LNV A;  2KEA A;  1MND A;  2YUP A;  3OW2 S;  1YIT T;  1BI1 A;  2DE0 X;  1G83 A;  1VIE A;  2E41 A;  2QTV A;  3EGU A;  4BUG A;  1WXB A;  2A28 A;  3OBW A;  3L2Q A;  1W4S A;  1YIJ T;  4KUI A;  2W10 A;  3SFM A;  1I4K 1;  3JCM Q;  2NUP B;  3SEM A;  4A54 A;  3L2R A;  3JCM b;  3CC4 A;  1GL5 A;  5A0L A;  3EFO B;  1SSF A;  5CR2 A;  1VQ8 T;  4E7I A;  2QI2 A;  1XNI A;  3M0S A;  4P5N A;  2O9V A;  3I35 A;  1VQ9 A;  4LNP A;  3CPW S;  2GTJ A;  1TS9 A;  3E9F A;  1RL2 A;  1RLP C;  1WFW A;  1LPL A;  3RKW A;  1JB0 E;  3NGP A;  3VS0 A;  3EG3 A;  3H0I A;  2E6N A;  3MPU B;  5GAO q;  4HT8 A;  1WZO A;  2WSC E;  2RN8 A;  2RJC A;  1V1C A;  2EQM A;  4F7U F;  2CT4 A;  2DFU A;  1TOV A;  1IXD A;  2LT4 A;  2CP2 A;  1VQ6 Q;  1K1Z A;  1KSW A;  2JMC A;  1VQ5 Q;  1AZG B;  2JTE A;  1W1F A;  4RTT A;  4M7A D;  1S72 Q;  3GF5 A;  4ZGD B;  3M4Y A;  1CSK A;  4QVC A;  2YDL A;  4QQG A;  2FG0 A;  1K9M U;  2COY A;  4C0Z A;  3VRY A;  1GBQ A;  3CBO A;  1UHF A;  4XAX B;  1LNX A;  2KYM A;  3OMC A;  4PJO G;  3A8H B;  2HZY A;  4E7K A;  2ZPG B;  1PD0 A;  3PTA A;  8ATC B;  2D6F A;  1VQO A;  2K5I A;  3QYG B;  2W0Z A;  2FRW A;  4PJJ A;  4PJO B;  4JRQ A;  2EQU A;  3CCR T;  1QVG P;  2ED1 A;  2VC8 A;  1NE8 A;  3A8O B;  4C5E A;  5KYW B;  5GJV B;  4B9W A;  4M7D F;  2DMO A;  3MJX A;  2YLC A;  1ZUK A;  3S3O A;  1KC8 U;  3CCU Q;  5GAN f;  3QII A;  5I11 A;  2V1Q A;  3LH0 A;  2EWN A;  2KNB B;  2DXT A;  5D7U A;  4ELY C;  2X4W A;  2COZ A;  4PJO A;  2K3X A;  2DA9 A;  1BU1 A;  3QSU A;  1G3W A;  1UGQ B;  4M75 C;  3CCS Q;  3RBB B;  1S1N A;  2JNG A;  3NPF A;  3R6O A;  3RUX A;  2DJQ A;  3WVD B;  5LJ3 f;  2RHZ A;  4BB7 A;  1TH7 A;  1ACM B;  3RKX A;  4JLI A;  3RMQ A;  3MCA B;  3H41 A;  4JUV A;  2KGT A;  5FWB A;  1FXX A;  3MEU A;  4IUT A;  4CC3 A;  2GQV A;  2M9U A;  1VQ4 Q;  2NLU A;  1B7T A;  5LJ5 e;  3O8V A;  3HHT B;  1O9S A;  3CCR Q;  2MCN A;  1NJI C;  1R0B G;  4D8D A;  2CZ0 B;  4IUQ A;  4MZM A;  1M2O A;  4IIM A;  1EZZ B;  1MNE A;  3OYI A;  2K6D A;  2OJ2 A;  1ARK A;  3LW5 E;  5KE2 A;  1T0H A;  2E1H A;  2QDL A;  4M75 D;  2QXF A;  5GAM h;  4EMH A;  3P8B B;  1AHJ B;  3LLR A;  4RTY A;  2YRV A;  2EJ9 A;  4M78 G;  4FCY A;  3NFC A;  1M1K R;  2BTT A;  4XU1 A;  2RQW A;  5CVI A;  3RMS A;  1TG0 A;  2R5A A;  4J9D A;  3CCS T;  1UGS B;  4D6W A;  2HSE B;  5FRN A;  3MP8 A;  4LDU A;  1YIJ A;  1YCY A;  2J05 A;  3GPL A;  3SWN A;  3HRT A;  2VXF A;  3SDZ A;  3CCS A;  2HKN A;  4KGV B;  4PJO E;  4E7L A;  2ENM A;  3V7R A;  5GMK e;  1Y96 B;  2QA4 T;  3OYN A;  4M7A G;  2H3J A;  3VU3 C;  1WJR A;  1SG5 A;  1OQK A;  2GTO A;  1K0X A;  5FW9 A;  2DXU A;  2JW4 A;  4BE0 A;  1X6O A;  2E65 A;  2LQN A;  2M0Y A;  1LCK A;  3I56 T;  1UB4 A;  4X9D A;  2KMT A;  2RF0 A;  2PQW A;  3VJP A;  2EBP A;  5GAN 6;  4A4K A;  4M4Z A;  2LX9 A;  2LT1 A;  4RG8 A;  2RMO A;  3G6E T;  4KGZ B;  4FU6 A;  4IUU A;  1QLY A;  3EH1 A;  2RQV A;  2JTF A;  3BE3 A;  5C0M A;  2LZ6 B;  1PM3 A;  1M3C A;  4EMK B;  4IIO A;  3CCM A;  2E4H A;  3L2V A;  3TRE A;  4R55 A;  4BI8 B;  1KQ2 A;  3EGX B;  1AVZ C;  1TSF A;  1Y07 A;  2XI9 A;  3I55 Q;  2X3X D;  2LC4 A;  1T0J A;  4ZN3 A;  2F2X A;  4D8K A;  1QVF P;  5D6Y A;  2ZCF B;  3QUI A;  1IRE B;  2RH2 A;  1WIE A;  2JS0 A;  2QA4 A;  3JCM J;  2O4X B;  1LJO A;  2F5T X;  3M0R A;  1SPK A;  4XU3 A;  2BZY A;  3GNF B;  3M56 A;  1FWZ A;  1AWX A;  1VQ8 A;  3QG1 A;  4PJN A;  4FSS A;  5KYU B;  3I56 Q;  5FU6 B;  1BK2 A;  2D1X A;  2DM1 A;  2V26 A;  2CSI A;  1C0M A;  4KBM B;  1AWW A;  3OS1 A;  2X4J A;  2VGM A;  4LD6 A;  3DLL A;  1E7O A;  1ZUU A;  1Q7Y R;  2E5Q A;  3G6E Q;  1JJ2 P;  1JO8 A;  2CDT A;  2D0Q B;  2Y4X A;  3MP6 A;  4HCC A;  1RAC B;  1IHV A;  2K3Y A;  3CBP A;  2LJ3 A;  3RNJ A;  4F16 A;  2WAC A;  1H3Z A;  1AEY A;  4Y91 A;  5KCH A;  2DEQ A;  2EPD A;  4GLK A;  2RJD A;  4M75 F;  5GJW B;  5CKF A;  3CCJ Q;  2YT6 A;  1W2B P;  3OYD A;  4OGE A;  4OMP A;  3C4S A;  3CCV A;  1PKS A;  3RES A;  2PUK B;  1OV3 A;  2E6Z A;  4OMN A;  3G4S Q;  4PKC C;  3H8Z A;  4WTO B;  1W6X A;  1ZA1 B;  1BB9 A;  3UDC A;  4Q5W A;  4AMC A;  3EG1 A;  1KC8 R;  3M53 A;  3UA7 A;  5HCK A;  3A8M B;  2M16 A;  5IN1 A;  2O4X A;  3ME9 A;  1U8R A;  1BI2 A;  2LCL A;  3VS7 A;  1BIB A;  1YWO A;  3CCV Q;  4OF1 A;  2DVJ A;  3H0F A;  3CC7 Q;  4XTU A;  4N4G A;  3HKS A;  1RLQ C;  2GF7 A;  4OVA A;  1KIK A;  1N8R C;  3OS5 A;  5DLQ E;  1MGQ A;  2D8H A;  1GFC A;  2FHD A;  1K9A A;  3LWH A;  3L1A A;  2JTM A;  3VS6 A;  5L23 A;  3V8L A;  3RIR A;  3JB9 G;  1VQK Q;  5EC7 A;  1MMA A;  2PVG B;  5FWC A;  4FT4 A;  3C94 A;  4PJM A;  3CC2 T;  1IZ6 A;  1OZ2 A;  2QAZ A;  4AFQ C;  6AT1 B;  1KK7 A;  4UC4 A;  3REA B;  3OYB A;  3FC3 A;  4CC2 A;  1VYU A;  1V76 A;  3A5Z B;  4HT9 A;  3M0P A;  5GAN 2;  4M75 B;  3UWN A;  1MMN A;  5J26 A;  2AIR B;  2RQR A;  5GAN g;  1KJW A;  4ZTJ A;  1JEG A;  3CMA T; 
#chains in the Genus database with same CATH homology
 1VQ9 T;  1K73 U;  3I55 T;  2E6N A;  3M58 A;  5GAO q;  2ZPH B;  1U1T A;  4ME7 A;  4OB0 B;  4C5H A;  4LDV A;  4MZT A;  4HT8 A;  5LJ3 d;  4C8Q B;  3TEE A;  3UT1 A;  5FU6 C;  4LDX A;  2WSC E;  1ZBX A;  5D6W A;  5CQY A;  5DY9 A;  2RHY A;  2KK4 A;  3MET A;  2RJC A;  1B34 B;  3ZEH A;  3JAM E;  3J7A F;  3HSB A;  4BY6 C;  2EQM A;  4F7U F;  1W2B S;  1Y7X A;  2HAX A;  2PU9 B;  3M54 A;  1VQL T;  3CXC S;  4HCB A;  4KT0 E;  2MAM A;  3KUF A;  2LT4 A;  3ZFJ A;  1VQ4 A;  3JRZ A;  3L2U A;  1WJS A;  3KXT A;  5FU7 C;  4M7A D;  2EFI A;  5HK3 A;  1HXD A;  4M75 A;  3ASK A;  3GF5 A;  4ZGD B;  3M4Y A;  4QVC A;  2RJE A;  4O6J A;  4QQG A;  3V7S A;  3JCM e;  3OYH A;  5LJ3 e;  1K9M U;  2A3L A;  1EIF A;  3L42 A;  4C0Z A;  1VQN T;  2XKO C;  3NTH A;  1BIA A;  4GY5 A;  4J6X A;  4A53 A;  4M7A E;  1I8F A;  1K8A U;  4M77 A;  4MDX A;  2XDP A;  3CBO A;  4XAX B;  2ZZD A;  4MZP A;  1Q7Y U;  1LNX A;  3OMC A;  3QHS A;  4PJO G;  3A8H B;  4ZGE B;  2JUF A;  2LQK A;  5LJ5 g;  1N9S A;  2ZPB B;  2ZPG B;  4XTZ A;  4E7K A;  4NL3 A;  1KD1 U;  2PVO B;  3PTA A;  3M4G A;  2D6F A;  1PSF A;  4JDS A;  4WF2 A;  1VQO A;  2K5I A;  1PSE A;  3CMA T;  3QYG B;  4N4H A;  1Y71 A;  1ZHI A;  3OYG A;  2HNI A;  1VQ6 A;  4HCZ A;  2XDB A;  4JRQ A;  4PJO B;  4N0A C;  3FIF A;  3CBM A;  3M57 A;  2DIQ A;  4CI0 C;  2EQU A;  1Q81 U;  3CCL T;  3JCM f;  4BD3 A;  3CCR T;  1D3B B;  1LOJ A;  3KBG A;  3NTK A;  3JB9 F;  4M7D G;  2VC8 A;  1NE8 A;  3A8O B;  4C5E A;  4E47 A;  3LWI A;  5CKE A;  2LTO A;  3S6W A;  4B9X A;  5CKH A;  4BAC A;  3JB9 D;  2QTX A;  4B9W A;  2JVV A;  4HA8 A;  1NPR A;  4M77 E;  4M7D F;  2EAY A;  3CMA A;  3HP9 A;  3CCM T;  1VQK A;  2YLC A;  2QQR A;  5GAN e;  1G3S A;  3OYL A;  3C12 A;  3S3O A;  3BDL A;  3V8K A;  1KC8 U;  3P8H A;  1M1K U;  4M7D B;  2EJF A;  5GAN f;  3LGL A;  3DB4 A;  3PFS A;  2LQ8 A;  3QII A;  1Q82 C;  1VQ5 A;  3LH0 A;  2EWN A;  5LJ5 j;  3M5A A;  1KQS A;  3OBY A;  1VQP T;  5J39 A;  4JS5 A;  1K73 C;  2DXT A;  2EQK A;  4ELY C;  2FB7 A;  4C92 G;  3CME A;  1VUB A;  2X4W A;  4MML A;  4PLL A;  2XU8 A;  4XTV A;  3VUZ A;  3CCJ T;  1YJW A;  4PJO A;  2K3X A;  2QEX T;  3QSU A;  1G3W A;  1UGQ B;  1YI2 A;  1VQ5 T;  4M75 C;  3HL8 A;  3X24 B;  2RI5 A;  2V8J A;  4M78 C;  4KUD K;  4Y28 E;  2MF2 A;  1YHQ A;  1M90 C;  2JNG A;  5GMK m;  4C5G A;  4J5Y A;  2XHC A;  3HFO A;  5LJ5 d;  3JB9 J;  4J6Y A;  2RJF A;  4X34 A;  3R6O A;  3RUX A;  2FVU A;  4C92 F;  5I2M A;  5GAO r;  2K57 A;  3WVD B;  4M7A F;  5I2S A;  1BYM A;  5LJ3 f;  2G3R A;  2RHZ A;  5J3B A;  4BB7 A;  2HD0 A;  1TH7 A;  1NPP A;  3RKX A;  3OYA A;  2QQ9 A;  2FL7 A;  3MCA B;  3QO3 A;  4JLI A;  3RMQ A;  5GAM j;  1JJ2 S;  1N27 A;  4JUV A;  3LX7 A;  2CZ6 B;  4M7A C;  5LJ5 h;  4BE2 A;  3M55 A;  1FXX A;  2WSF E;  3MEU A;  4LDW A;  3JCM V;  4M7D C;  4IUT A;  1WJQ A;  1YJN T;  2GQV A;  2M9U A;  2P0Q A;  1N8R U;  3GIB A;  3QDR B;  2NLU A;  3N5B B;  5C6S A;  4XTY A;  3SWN B;  5LJ5 e;  4A4G A;  2CS7 A;  3O8V A;  2L5Q A;  3HRS A;  3HHT B;  4C92 A;  1KD1 C;  3CCV T;  1O9S A;  3BDU A;  3E1S A;  4IUR A;  4A4H A;  1NJI C;  2QQA A;  1M1G A;  2CZ0 B;  3E19 A;  3LYI A;  4IUQ A;  3C95 A;  3MEW A;  2DVE A;  2PVD B;  1KHI A;  2RHI A;  4XU2 A;  1QVF S;  5GAO n;  3OYI A;  2LCC A;  4C92 E;  3LW5 E;  2VV5 A;  5KE2 A;  2RHX A;  4M78 F;  4NOY A;  2DIG A;  2E1H A;  4M75 D;  2QXF A;  2LVM A;  4EDU A;  5GAM h;  3S3N A;  2YLB A;  1HK9 A;  4EMH A;  2RK2 A;  2CYZ B;  3P8B B;  1AHJ B;  1M5Q 1;  1XTD A;  2CZ1 B;  3LLR A;  3T9N A;  3CC2 A;  2DO3 A;  5FLX E;  2DXC A;  1GXI E;  2YRV A;  3M9Q A;  2EJ9 A;  1XQH A;  3CEY A;  3EAE A;  4RCC A;  5LJ3 j;  4QW2 A;  1QVP A;  4M78 G;  4MMK A;  2M1H A;  4L5G A;  2JOY A;  3NFC A;  3OSV A;  4EMG A;  5CCA A;  4XU1 A;  4C8Q E;  5CVI A;  1U1S A;  2RI3 A;  3RMS A;  1G3Y A;  3CD6 T;  4JRI A;  2HQE A;  2R5A A;  4MDW A;  3OW2 A;  2JZ2 A;  3CCS T;  1UGS B;  1JRI A;  1O75 A;  5DM7 R;  2KSS A;  4D6W A;  3CCQ A;  3X26 B;  3OYE A;  3CC7 T;  3VV0 A;  5FRN A;  3MP8 A;  5LL6 S;  3OYC A;  2Y90 A;  1M8V A;  4LDU A;  5CAI A;  2DD5 A;  3V7C A;  1V29 B;  4EPC A;  1YIJ A;  1YCY A;  3QJY A;  3GPL A;  2BKD N;  3SWN A;  2R5M A;  1VQL A;  3HRT A;  4M7D A;  3S3M A;  2VXF A;  3SDZ A;  3A8L B;  3CXC A;  3CCS A;  1K9M C;  4C92 B;  5HK0 A;  4LDY A;  1VQ7 A;  4PJO E;  5D6X A;  4E7L A;  3V7R A;  2E10 A;  4FM4 B;  5GMK e;  4OB2 B;  1Y96 B;  5A0D A;  1K8A C;  2DTO A;  2QA4 T;  2O01 E;  2RK1 A;  3OYN A;  2H3J A;  4M7A G;  3VU3 C;  5CQX A;  1WJR A;  3X28 B;  2DPP B;  5LJ3 h;  5GAO l;  2EJG A;  5LJ3 g;  1VQ4 T;  3ZBD A;  2VGN A;  5GMK h;  3E9G A;  3INZ A;  4LD9 K;  2P4T A;  2I2L A;  1VQN A;  2DK3 A;  4C5I A;  1P92 A;  2DXU A;  4BE0 A;  2QQB A;  4L6V 5;  1X6O A;  2E65 A;  1BI3 A;  3JB9 I;  2KY9 A;  3JCM d;  4X9C A;  5GAN j;  4M77 F;  4YTL A;  1QP2 A;  3VYH B;  2B8A A;  3WXM B;  3I56 T;  4M7D E;  4RCB A;  1UB4 A;  4X9D A;  4IKF A;  2KMT A;  3OS0 A;  1I5L A;  2D9T A;  4JRK A;  2CGH A;  3X20 B;  1G5V A;  2DZ9 A;  2LDM A;  4PLI A;  1YJ9 A;  2PQW A;  3VJP A;  1VQO T;  5AYF A;  1W2B A;  5GAN 3;  5GAN 6;  1ZQ1 A;  4A4K A;  4EMK A;  2DTH A;  3SB2 A;  2XIC A;  3CPF A;  3V8J A;  2LX9 A;  2LT1 A;  2A7Y A;  4RG8 A;  2GCX A;  1VQM A;  4QQD A;  1N6A A;  2ZPI B;  3G6E T;  3QZ9 B;  4ELZ C;  5A0G A;  3FJP A;  2K5F A;  4NL2 A;  5GAN 4;  3CCE A;  5GAN 8;  3CC4 T;  4FU6 A;  4IUU A;  3CCU A;  3QBY A;  1N9R A;  4Z02 A;  2JTF A;  3EFR A;  4BE1 A;  5C0M A;  5GMK j;  1VQ6 T;  4BI3 A;  5KE3 A;  5GAM d;  3OYK A;  4C8Q D;  4EMK B;  3CCL A;  1UGP B;  3G6E A;  3CCM A;  5GAM f;  4RKU E;  3CCR A;  3L2V A;  2GFA A;  3TRE A;  4R55 A;  4BDZ A;  4XTX A;  1Y96 A;  2E70 A;  2HBP A;  2XID A;  4FL6 A;  4BI8 B;  1KQ2 A;  1Y07 A;  3GOX A;  2XI9 A;  3L2W A;  2LC4 A;  2P0K A;  2RD1 A;  4QVZ A;  2DJZ A;  1VQP A;  2XD0 A;  4ZN3 A;  5FRM A;  1OZ3 A;  2F69 A;  5IT9 E;  4E7H A;  1QVG A;  1WGS A;  1KQ1 A;  2K5L A;  4BI4 A;  1M90 U;  4ATO A;  3OS2 A;  4ZN1 A;  5D6Y A;  2PUO B;  2ZCF B;  4M78 A;  4PJO D;  1S72 A;  3VUB A;  2K2V A;  3QUI A;  3QZ5 B;  3FEO A;  4CRI A;  1IRE B;  1YBY A;  1R8O B;  4RMO A;  2RH2 A;  4DOW A;  4DA4 A;  2IVW A;  4VUB A;  2OTJ T;  2QA4 A;  3JCM J;  2O4X B;  1LJO A;  3PNW C;  1S72 T;  2F5T X;  2DD4 A;  3CD6 A;  3HRU A;  3MO8 A;  4XU3 A;  2JN0 A;  3GNF B;  1B34 A;  1FWZ A;  2E64 A;  3M56 A;  3OYJ A;  1VQ8 A;  2MWO A;  3DB3 A;  1KC8 C;  2OTJ A;  3QG1 A;  4C0D B;  1VIF A;  3G71 A;  3CPW A;  4M7D D;  4BDY A;  2E12 A;  5FU6 B;  4M77 B;  2DZC A;  3PMT A;  4C8Q A;  1KHC A;  4DQ2 A;  1WNL A;  2ZPF B;  4XU0 A;  1VQ7 T;  3TU4 K;  3A8G B;  3OMG A;  1YJ9 T;  3JB9 H;  2QQS A;  4M7A B;  4KBM B;  1NJI U;  4A4E A;  2X4J A;  3OS1 A;  4J7I A;  4XQ3 A;  2L3R A;  2VGM A;  4LD6 A;  1XOV A;  3OYY A;  3DLL A;  2X35 A;  3OQ5 A;  4N0A A;  3PGG A;  3WVE B;  2E5Q A;  4BY6 B;  4C92 D;  5HKC A;  3I56 A;  2ZPE B;  2V8I A;  3H6Z A;  4DOV A;  2D0Q B;  1Q86 U;  4IUV A;  3L2Z A;  1YHQ T;  2Y4X A;  1G3T A;  3MP6 A;  4KUL A;  4V2S A;  4NS5 A;  2VUB A;  2AHJ B;  4HCC A;  1FX7 A;  4C8Q F;  4ZGJ B;  4OB3 B;  5GAN h;  3SWN C;  1BI0 A;  2K3Y A;  3CBP A;  4M77 D;  5IAY A;  4II1 A;  3NTI A;  2XG8 D;  2EQJ A;  4E7J A;  1WPY A;  2WAC A;  3JCM g;  3FDR A;  1VQM T;  5EG2 A;  4OMF B;  2XK0 A;  4PNO A;  4ZTF A;  1H3Z A;  3QXE B;  4Y91 A;  5KCH A;  4J83 A;  3CCU T;  3QJ6 A;  2DEQ A;  1UEB A;  2V8K A;  5GAN d;  2DAQ A;  4GLK A;  2RHU A;  3ER0 A;  1Q81 C;  2RJD A;  5GAN 7;  2EIF A;  4M75 F;  3GLX A;  3CCE T;  4OGC A;  5CKF A;  3JCM c;  3J81 E;  1X01 A;  1M9S A;  3OYD A;  3OB9 A;  3J80 E;  2BIV A;  3CME T;  4N4I A;  2EYQ A;  4OGE A;  3C4S A;  3CCV A;  1YIT A;  2X4X A;  3OA6 A;  3G7Z A;  5CK9 A;  4C0G A;  1VQK T;  1Q7Y C;  2VYT A;  5GAN 5;  4HKE A;  1YI2 T;  1RI0 A;  3RES A;  4O5V A;  2PUK B;  2E6Z A;  3OSS C;  3QKJ A;  3G4S A;  3FLG A;  3VYG A;  1UGR B;  2CZ7 B;  5FRO A;  3PIO A;  2YHT A;  4PKC C;  5A2Q E;  4JRP A;  4J6W A;  3H8Z A;  2MWP A;  5I21 A;  2OTL T;  3CC7 A;  3MHX A;  5GMK l;  4XK8 E;  3G71 T;  2KDS A;  1DJ7 B;  1M1F A;  5KH6 A;  3I55 A;  4J8O A;  3UDC A;  3PMI A;  2MMP A;  4IUP A;  3JCM X;  3HPW A;  4F7U A;  4C8Q C;  2QEX A;  2K4Y A;  4Q5W A;  5GAO p;  4M78 E;  1QVF A;  2ZGW A;  3P8D A;  2QDY B;  4QQ6 A;  3MP1 A;  3MEA A;  4M75 E;  2CKK A;  3M53 A;  4OP0 A;  5CO7 A;  5FU7 B;  3SD4 A;  3X25 B;  3PIP A;  3A8M B;  4RG2 A;  2FYK A;  2M16 A;  4C0F A;  2RI2 A;  5IN1 A;  1I81 A;  2R58 A;  3GP8 A;  2O4X A;  2L8D A;  3ME9 A;  1U8R A;  1M4Z A;  2DXB A;  1BI2 A;  5M9O A;  2LCL A;  3DLM A;  1BIB A;  2GFU A;  4FIB A;  3OYF A;  4M78 D;  1OI1 A;  2RM4 A;  2F5K A;  1WQ7 A;  3RER A;  3BY7 A;  3LGF A;  4JLG A;  4OF1 A;  3CCQ T;  2Y4Y A;  1M1K C;  3TCJ A;  4M78 B;  4M77 G;  4R56 A;  5GAM g;  1Q82 U;  4FT2 A;  1BKB A;  3MEV A;  2DKG A;  4M77 C;  3BFM A;  1Q86 C;  5CIU A;  3Q1J A;  4XTU A;  2L89 A;  4N4G A;  3HKS A;  1WQW A;  3JCM h;  4JJN K;  4C0D C;  2GF7 A;  5GMK i;  4OVA A;  4F7U B;  2RA2 A;  3OS5 A;  1N8R C;  1D3B A;  3FRN A;  1MGQ A;  2BUD A;  5DLQ E;  3UPU A;  2C06 A;  3F70 A;  3DKM A;  4J7F A;  3EFS A;  3HFN A;  2FHD A;  3JCM P;  1KG1 A;  3LWH A;  4C92 C;  2RO0 A;  4A4F A;  2M0O A;  2KAF A;  2JTM A;  3BW1 A;  3L1A A;  5GAO m;  2RB6 A;  3URG A;  1QVG S;  2X4Y A;  4F7U G;  3JCM W;  5CKD A;  1JBM A;  2EKO A;  3PT9 A;  1QW1 A;  3QYH B;  3AHU A;  2HQX A;  1QP3 A;  2OAU A;  4XTW A;  5CKB A;  4QVD A;  4PL6 A;  3RKY A;  2R57 A;  3V8L A;  3RIR A;  3OYM A;  1H64 1;  3JB9 G;  4M7A A;  1YJN A;  3GNG A;  4OB1 B;  3QPH A;  2PVG B;  5LJ5 f;  2LNV A;  5L8R E;  4FT4 A;  3FB9 A;  3C94 A;  2KQW A;  3G4S T;  3OW2 S;  1MHN A;  1BI1 A;  1YIT T;  1KQS S;  3CC2 T;  1IZ6 A;  3VKI A;  2XDD A;  3OY9 A;  3JSC A;  1VIE A;  2E41 A;  5KCO A;  4FSX A;  4BUG A;  2OTL A;  1OYX A;  1OZ2 A;  2WSE E;  3OBW A;  3L2Q A;  2VXE A;  4JS4 A;  1W4S A;  1YIJ T;  4KUI A;  4UC4 A;  3OYB A;  3SFM A;  5DLO A;  1I4K 1;  3JCM Q;  3FC3 A;  2IG0 A;  2P0P A;  3M59 A;  4F7U E;  4A54 A;  4M75 G;  4PJO F;  3JCM b;  3L2R A;  3CC4 A;  5A0L A;  2DTI A;  1SSF A;  5CR2 A;  5HY6 A;  1NZ9 A;  4E7I A;  2QI2 A;  1VQ8 T;  1XNI A;  5GAM e;  3A5Z B;  4P5N A;  4HT9 A;  4PJO C;  2KVQ G;  1VQ9 A;  1X75 C;  3CPW S;  5GAN 2;  2LRQ A;  3E9F A;  4M75 B;  3UWN A;  4MZM A;  5J26 A;  4TVR A;  2MI6 A;  5GAN g;  4C8Q G;  1RL2 A;  4L59 A;  4ZTJ A;  4EMK C;  3RKW A;  3CCJ A;  1YJW T;  1JJ2 A;  1JB0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...