2IVWA

The solution structure of a domain from the neisseria meningitidis pilp pilot protein.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
113
structure length
113
Chain Sequence
ETDKKGENAPDTKRIKETLEKFSLENMRYVGILKSGQKVSGFIEAEGYVYTVGVGNYLGQNYGRIESITDDSIVLNELIEDSTGNWVSRKAELLLNSSDKNTEQAAAPAAEQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PILP PILOT PROTEIN
publication title The solution structure of a domain from the Neisseria meningitidis lipoprotein PilP reveals a new beta-sandwich fold.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Lipoprotein
total genus 9
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.830 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ivwA01
3OSSC 2IVWA 2LNVA 2LC4A 2Y4YA 2Y4XA
chains in the Genus database with same CATH superfamily
1H92A 4J6YA 4QVZA 1LPLA 3M0PA 3OS5A 4AMCA 2XDPA 4XU2A 2PUOB 3G4ST 2QA4T 2O9SA 3CBPA 1SSFA 2DO3A 3GNFB 5GAN4 5KYUB 1RABB 1X6OA 1LJOA 1X69A 2E6ZA 4AFZC 1UJ0A 4RMOA 3CCRA 1QKWA 1NZ9A 4FU6A 5GMKi 2DF6A 1C1AA 2HSEB 2EYWA 2DD5A 2Y90A 2HAXA 2RJFA 4KRTA 1D0ZA 2VXEA 3CCJA 4C92C 4EMGA 1OU9A 1UGRB 3CC7T 1YJ9T 5C6SA 5LJ5g 3L2UA 3GNGA 4JDSA 1OYXA 4PJOG 3O8VA 1AWXA 1KC8C 1T3LA 1MHNA 1YWOA 5FW9A 1VIEA 4PJOA 2HL5C 2F2XA 4XTVA 8ATCB 3RIRA 3KXTA 3UDCA 1VQ8A 2ECZA 3M0QA 4M7AF 1Y57A 1I1JA 1SG5A 4MZMA 4QQ6A 4HKEA 2ZPIB 2OX7A 4JJNK 1Q82U 2OTJT 1M2OA 3MP8A 4MMKA 4AT1B 4PJOE 4J5YA 4OGCA 4J6WA 1VQ7T 1YHQA 1WHHA 3CC7Q 1YJ9Q 2CP2A 1NJIC 5ECAA 1CKAA 1OZ3A 5D6WA 3CBOA 2KGTA 2QK0A 1WHJA 3ZL7C 1ZBJA 4RTTA 1XQHA 3ZEHA 1PD1A 1TH7A 2LDMA 3OYFA 3THKA 2V1QA 5KCHA 3QIIA 2XDDA 5LJ5j 1GBRA 3PNWC 2RJDA 5CCAA 1Q95G 2G6FX 3CCUT 3CC2A 3CC4Q 3EG0A 2F2VA 1WNLA 1G2BA 1WIEA 2CP6A 5GAMd 1VQ7Q 2DE0X 5GAMh 4F7UG 2A36A 2DJZA 4J6XA 2BE7D 2DVEA 2C06A 2P4RA 4ANJA 4DQ2A 4HXJA 4F7UA 3I5RA 1K73C 3LWIA 3CEYA 1YJWA 4OMFB 3META 3X24B 1WQWA 2PZ1A 5IHIA 2DXBA 1B3QA 2RPNA 1QCOA 4EMHA 1D1CA 2L3QA 4C0DB 2XG8D 4PFZA 2CKKA 4M7AD 1T0JA 5I21A 4ORZA 2DZ9A 1Q82R 1VQNT 2XK0A 4F7UE 1AHJB 2L5QA 2COZA 1Y7XA 3OMCA 1IB8A 1E7OA 2DYBA 2A08A 3CCSQ 5DLQE 2EQUA 2OI3A 2RHZA 5A0LA 2DEQA 2YUQA 3EH1A 4BDZA 1U3OA 1UGQB 3C4SA 1M8MA 3QXEB 2FL7A 1KD1U 3EFSA 2E6NA 3MEWA 5GAN8 3EG2A 4Y92A 2QDLA 1OPKA 2RO0A 4KGVB 4ZTJA 4M77C 4ZGEB 2QQBA 3GF5A 2B86A 1PKSA 1M3CA 2ZGWA 3ER0A 3OBYA 3VRZA 2M1HA 1PD0A 4A53A 2KRSA 1VQNQ 2RH2A 4HCKA 3S3OA 4XTUA 3LH5A 4UC4A 1H641 3G6ET 1LVKA 2XD0A 5CKDA 1ZSZA 4BI4A 1UDLA 3CMEQ 1HYOA 1SSHA 2O4XA 4M75G 2VYTA 1T0HA 2FYKA 1JQQA 2FEIA 2DTHA 4PLLA 1Q7YU 2X3XD 3VS4A 1VQPT 4M75A 1VYVA 2MIOA 3SWNB 3L2VA 2OJ2A 5GANe 4LNPA 1Y07A 2MWOA 2XU8A 1B34A 1HSQA 1JB0E 2CZ6B 5KYXB 4J7IA 3VS0A 2RQWA 3S6WA 3CC4A 2ROLA 4M75E 3VS2A 1G3WA 1JXOA 3FJPA 2XIDA 1AWJA 2X9HA 3T9NA 4ZNXA 2RJCA 3G6EQ 4FM4B 1WDXA 3URGA 1WJSA 1N5ZA 1Q81C 1YITT 1M90C 3EHRA 3NPFA 2J6FA 3U23A 1KSWA 2KQWA 3MCAB 5C0MA 3V7SA 1SHGA 2GTOA 1PSFA 1NLOC 5KYWA 2EGAA 2QTXA 2HD0A 1YI2T 4IUVA 1BIBA 1KC8U 4Z88A 3UF4A 1K0SA 3CCSA 2COYA 3JV3A 3ME9A 2X4JA 2RK2A 1RAAB 5GMKj 5GJVB 5KYYB 1VQOQ 3ASKA 3A1PA 1IGQA 2DL7A 4FSXA 3V8LA 3QYGB 5HY6A 1Q7YR 1OX8A 1YITQ 2XHCA 4M7DF 1KJWA 2JZ2A 2K3BA 4JS4A 2F5KA 3HKSA 5FROA 5FLXE 3REBB 5GJWB 2QG9B 1VQLT 5IAYA 4J7FA 4XQ3A 1N9RA 3LLRA 4YTLA 2NUTA 4LDVA 2QQRA 4M77G 5DY9A 2J7IA 1U1TA 3CCET 4MMLA 2L3RA 5D6XA 2QAZA 2RHIA 4C8QB 2KNBB 2DL5A 4RCCA 1X75C 4EPCA 5CQYA 1IGUA 3CMEA 1TUCA 2JS2A 1UG1A 2P0QA 4NOYA 3VUBA 2NUZA 2NYSA 3QO3A 1MMGA 1G3SA 1YFNA 4XTYA 2C0IA 3JB9J 3A8MB 1K9AA 2AHJB 5FRNA 4LDYA 2MYSA 4C0ZA 2LCSA 2JMCA 2JT4A 3JCMQ 4LN2A 3OW2P 4C92F 4HT8A 2WSEE 4M78B 2LTOA 2Y4YA 3HSBA 5CVIA 1NPRA 2OAWA 1OZ2A 4OGEA 4C8QC 2ZPFB 1KC8R 2RK1A 3HFOA 5CKEA 3CCEQ 1W2BS 3PIPA 1ZA1B 4R0KA 2ABLA 2FRYA 1AWWA 1WHMA 3EG9B 5J39A 1VIFA 1MV0B 5GAOl 1KQSP 1GCQC 2HQXA 2DAQA 3JRZA 3OYKA 2DVJA 3A98A 2RI2A 4LDXA 1CKBA 3V8JA 5J26A 2E5QA 2LJ0A 3CCRT 4OMPA 4M7DD 4C5IA 4N4HA 2KVQG 4OB2B 1BU1A 2V8IA 3S3NA 3CCJT 1OI1A 1GFDA 4Z89A 2VV5A 4J9GA 1NLPC 3PE0A 1UHCA 4M7AG 3RKWA 1N6AA 1M2VA 4KH0B 4M7AA 4Y91A 4FYYB 1I81A 1WXTA 1C0MA 2BZYA 1I5OB 1VQ8T 2DLPA 2P0PA 4F14A 1TTHB 4HT9A 4NL2A 1BI3A 1PWTA 4JJDA 1NG2A 4KUIA 5GAOp 5GAOm 3ZBDA 3LW5E 4BY6C 2EYXA 2EYYA 4M7AE 3CPWS 2NUPA 5CK9A 2KI7A 4C92D 3OS1A 4ZN1A 3SEMA 3BE3A 1YHQT 2KYBA 1Y0MA 4DBRA 5GANg 1ARKA 1WHLA 5I2SA 3D7SB 2CYZB 2CP7A 3HRTA 3ULRB 1VQMQ 4OB1B 2WSCE 4OMNA 2DXCA 4ELZC 3GP8A 5L23A 2D0QB 1W2BA 2CUBA 2EYZA 2QTVA 1VQ8Q 4E47A 2J05A 2YLBA 3CC2T 2P0KA 3RESA 5DM7R 2YRVA 2RD1A 1UECA 2YUPA 3G7ZA 3TSZA 2K2VA 1VYUA 4BUGA 2YRDA 2KY9A 1NPPA 2GCXA 3M55A 3M58A 1Q81U 1JXMA 5A0GA 4N0AA 5FU6B 1HXDA 3NFCA 3L2QA 2JMAA 1GFCA 3CPFA 3L2WA 3OYEA 4LUDA 1YJWT 3X28B 1OV3A 1JO8A 1QWFA 3E19A 3G1JA 2FRWA 2ED0A 4M77F 1Q86C 1R8OB 3QSUA 5FRMA 1TSFA 2P84A 5GMKl 3JCMb 1G3YA 5GANj 1K1ZA 2QXFA 4F7UB 1VQ4Q 3EGDB 4IUTA 2BTTA 1X2KA 2FB7A 4JRQA 1IO6A 1OOTA 1PHTA 3OYIA 4QVDA 1PKTA 1PM3A 3R6NA 3VUZA 4JRPA 2KEAA 2EVRA 2DXTA 2IVWA 4DEYA 1MMNA 3DLMA 1R0BG 4A4EA 2DPPB 1WQ7A 1K9MC 2YUOA 2Y4XA 1OEBA 3OYJA 3CPWA 3PFSA 2YRCA 1QCFA 4EMKA 1ZUYA 4OB0B 3WVDB 2JW4A 1YJWQ 1A0NB 3H6ZA 1E6HA 4EIKA 1FX7A 4B6MA 2JVVA 2O88A 9ATCB 4DBQA 3QDFA 2HKQB 3GPLA 1U5SA 3OSVA 3QG1A 2JN0A 1AEYA 1ZUUA 4A4KA 1M3BA 4PJLA 1RAHB 1MUZA 3HHTB 5GMKm 3REAB 4HVWA 3M9QA 3PTAA 5FWCA 4OMQA 2BZ8A 1M30A 1KG1A 2DRMA 1XJWB 3AT1B 3H41A 1X6BA 1WPYA 1VQMA 2FVUA 3JB9G 4Z02A 1RAFB 1ZSZB 1VQ6A 2B8AA 2BE9B 4FW2A 2LX9A 1Z9ZA 2L3PA 2O4XB 2L0AA 1G5VA 4WCIA 4BE2A 4M77D 1UJYA 4A54A 4M75B 1V76A 3I9QA 5I2MA 3UT1A 2PVGB 4LE9A 3CC4T 1G8XA 1M1KU 4FYWB 3JCMc 3PMIA 2MAMA 1YIJA 1AD5A 4MZPA 2ED1A 4QVCA 1QWEA 1TG0A 4DEXA 5DLOA 3RMQA 4X9DA 2D9TA 2ZPGB 2RJEA 3QPHA 4ZTFA 1VOMA 3C12A 1JJ2S 4HVUA 1VQ4A 4C0GA 6AT1B 3JCMf 4II1A 1Z9QA 3L2RA 2X51A 1U1SA 4M7DG 1KHCA 2ZPBB 2HQEA 4KT0E 3OYGA 5GAMf 2LVMA 1WHKA 3CCST 1AZGB 1QVFP 1QP3A 2HMAA 4M7DA 1VQ5A 4ME7A 5KYWB 1RL2A 2LJ3A 3CCLA 2EQKA 2LCCA 2RQRA 3I56A 2AT1B 2CS7A 4X1VA 3UA6A 1F1BB 2DERA 3RR6A 2MOXA 3OYYA 2O31A 4PJJA 1ABQA 2C0OA 2C0TA 2ROTA 2FPEA 3E2UA 5LJ3f 2HBWA 4BD3A 4C8QF 1FXXA 2NLUA 2KE9A 2R57A 2Z0WA 3TQ7P 1M1KR 1MNDA 3P8HA 3V7RA 2QQSA 1LCKA 1KK7A 4OP0A 3X20B 1ZLMA 3I55A 2A7YA 1JRIA 3CMET 5AT1B 1K8AC 4C92G 1Y96A 1HD3A 3OYMA 2QQAA 2EJGA 1QQJA 3CXCS 1PCXA 2PUKB 3QWXX 3QHSA 4C92A 4R55A 2DEUA 3LX7A 3OY9A 3EFOB 2AIRB 1UHFA 2DL3A 4C0DC 5GAN5 1QKXA 3BFMA 4RUGA 3WXMB 3V7CA 4JRIA 2AKKA 2OAUA 8AT1B 1GL5A 3SDZA 2JXBA 1WJQA 3JAME 1ZA2B 4C92E 2ESWA 1JJ2A 2MWPA 5IXFA 1VQ9Q 2HKNA 5J3BA 1AOJA 4A4FA 2KK4A 4FYXB 2QEXQ 1JEGA 1WX6A 2M0YA 4ELYC 5GANd 5GANh 3E9GA 2EQIA 1FMVA 2M16A 1Q86U 2E1HA 3FJ5A 3NGPA 2QQ9A 4IURA 2MMPA 1ZX6A 2DTIA 2DILA 1OPLA 4BE0A 4J9IA 2KRMA 1SPKA 2YWWA 1R77A 2HBPA 1YJNA 2K79A 2A3LA 1YNZA 2GFUA 2VKNA 1D3BA 4RG8A 4BE1A 2ATCB 2RB6A 4WTOB 2EPDA 2J6KA 4C8QD 1N8RU 4AG2C 2M02A 3Q1JA 1K9MU 1BKBA 5KE2A 3JB9F 3GLXA 3EGUA 2KXDA 4BI3A 2DETA 4JPBW 3J80E 3UATA 4E2FB 2HDAA 1KIKA 1S72Q 1K4US 1VQOT 3H0HA 2RI5A 4JRKA 2HSPA 3SWNC 1I07A 4DBFA 1ZBXA 4E7HA 2E70A 2LC4A 4FCYA 2X4YA 1M9SA 2A28A 3BW1A 3V8KA 4M7AB 2OTLQ 1KD1R 4LDWA 2PNIA 3IQLA 1JBMA 4R56A 3CXCA 3FIFA 3CMAQ 3UWNA 1IRXA 3OMGA 2LMJA 2GTJA 4N4GA 1NEBA 2GNCA 1VA7A 3VV0A 1YBYA 3CD6Q 3PT9A 4QW2A 1TS9A 1SRMA 2VB6A 2LCLA 3MEAA 2RQVA 1W1FA 4ESRA 2EQMA 2GBQA 3MEUA 2RI3A 2GFAA 4V2SA 1X43A 1OU8A 4IUUA 4RTVA 4X34A 3P8DA 1D09B 3TCJA 2DNUA 3MJXA 2VXFA 2K2MA 2X4WA 4BI8B 1NJIU 1N8RR 3M57A 3ZFJA 1K9MR 4O6JA 4CI0C 2DIQA 4M77A 1VQ9A 3JB9D 5LJ5f 4RTWA 2QEXA 3EFRA 4J9EA 1QW1A 1X6GA 1QMCA 2L89A 2LNVA 1C6VX 1D1BA 2CT3A 3CCVQ 1V1CA 1IREB 1RLPC 4A63B 2CUDA 2BKDN 4RTUA 4M77E 2EJ9A 3DKMA 4J9DA 2AZVA 1VUBA 3EG3A 2LX7A 2K9GA 1SKUB 5CIUA 2LQ8A 1K0XA 1WA7A 1JU5C 1HK9A 2GQVA 1BI0A 3PIOA 4BDYA 2JTMA 1UTIA 3SFMA 1K73U 2V26A 1S72A 3VS5A 2BZXA 3OQ5A 3CCQQ 4C5HA 4XK8E 4C0FA 1QP2A 3J7AF 2K5FA 2CH4A 1RADB 4ZGDB 3QZ9B 3CBMA 4F16A 1O75A 2MK5A 2OTLA 4CC3A 1WYXA 1Q82C 2D6FA 5EC7A 4O5VA 3E1SA 4Z8AA 2E65A 1EX4A 4M78C 2F5TX 2K3XA 3JCMW 4FL6A 3L1AA 3CMAA 4Q5WA 4KGZB 5IT9E 3FDRA 3QYHB 1BCMA 3INZA 4LUEA 4HCCA 1NJIR 1RUWA 3H9NA 1U8RA 3HRSA 2AZSA 3GIBA 1MV3A 1VQKA 2RQUA 2W0ZA 2CREA 2KMTA 5KYXA 4HCZA 3CD6A 2FG0A 1I8FA 2E41A 1VQMT 1QVGS 3HFNA 3RMSA 1KQ1A 1MMAA 3VYHB 1VQ6T 4PK4A 3RBBB 2K6DA 2PQWA 1UB4A 3C94A 1LOJA 1W6XA 4PJOB 3QJ6A 4PKCC 3MHXA 1GCPA 3HTRA 4F04B 2MI6A 3DB3A 1Y71A 3MKDA 4GY5A 4J8OA 1YIJT 3JCMX 2D0NA 2KBTA 2DYIA 3PVLA 5KE3A 1GBQA 3QKJA 2EYQA 2VC8A 2DMOA 2DIGA 2E10A 1K73R 2HL3A 2I2LA 3BY7A 2VGNA 4VUBA 2D1XA 2FZKB 2K4YA 1BB9A 1VQ6Q 2A0FB 1FMWA 3OYBA 3A8OB 3CCVA 1OULA 2ENMA 5M9OA 1VQ4T 4PJOC 5IHNA 4JJCA 3DLLA 5A0DA 1WI7A 2DX1A 2KXCA 4J9FA 1M4ZA 1TUDA 4CC4B 4XU0A 5D6YA 1O9SA 1TUGB 4FW1A 1VQ5T 3NTIA 1BK2A 1AVZC 2FPDA 1YIJQ 2ZPHB 1RAIB 1RACB 4NS5A 3CCLT 1M90U 2IIMA 1H8KA 4C8QG 4FIBA 3I56T 1KQSS 4HCBA 2K5LA 2DL4A 2DRKA 3JCMV 4HA8A 1QLYA 1H3HA 4C8QA 1BI1A 5IXBA 4AG1C 3CCQA 4E6RA 3OYLA 2V8JA 5CKBA 5CO7A 2EQJA 1QVGA 3X26B 1GCQA 2HCKA 3OB9A 3LWHA 4KULA 1TU0B 2LP5A 3BDUA 4LD9K 1MNEA 2H3JA 2CDTA 2DKGA 2COWA 2BUDA 2YDLA 2H3EB 2DBKA 4M78G 2F1LA 4C8QE 2CGHA 4A4HA 3I55T 1X01A 5FU6C 1VQ5Q 2EIFA 1ABOA 1D0XA 1B7TA 5AYFA 1YWPA 3NHNA 3GOXA 3CCLQ 1Q7YC 3I56Q 4JLGA 2JJ9A 3MP1A 2LNHB 5GAOr 2ZPEB 2YUNA 3LH0A 1IZ6A 2QGFB 2YLCA 4C5GA 1BIAA 1PC0A 2QYZA 2KR3A 3CCMQ 3OA6A 2YHTA 4LD6A 3EHQA 3EG1A 4E7KA 3TU4K 1V29B 3VS6A 1G83A 4FYVB 3I55Q 3OW2A 3H0FA 4RTZA 1Q81R 1W70A 1M90R 2LQWA 2VGMA 4EDUA 3CQTA 2JTEA 4A4GA 1IXDA 3QZ5B 3M0UA 3LYIA 4L59A 1YJNT 2MPXC 4D6WA 4OMMA 1KQSA 3I35A 2NWMA 4IUPA 4AFSC 3EGXA 2XI9A 2FO0A 1RI0A 4E7ZA 3JSCA 3RNJA 3VS7A 4AFQC 2DM1A 4CC7A 2RMOA 5KYNA 3CXCP 1PSEA 3M59A 3GBQA 3G4SQ 2QA4Q 1AZEA 3C95A 1YN8A 5L8RE 1B34B 1D3BB 2E64A 4N4IA 1WLPB 3JB9H 1WJRA 4B9WA 5I11A 1ZSZC 1NBEB 1I0CA 3G71A 2R58A 2X35A 2MF2A 2EW3A 2JS0A 1RAEB 2JM8A 4LDUA 4X9CA 4XTXA 4M75C 1YJNQ 5HKCA 2L2PA 4Y28E 1YCSB 5HK0A 1R0CB 4BB7A 1I4K1 1FWZA 1W4SA 4PNOA 4CRIA 3N5BB 2G3RA 3VKIA 2GQIA 5FU7B 2AKLA 1HJDA 2DD4A 4MZTA 1LNXA 2QDYB 4C5EA 4DA4A 3BDLA 2XDBA 2OTJQ 2V1RA 3NMZC 3JCMd 4OVAA 3JCMh 4ZGJB 1N9SA 4HVVA 1ACMB 2RN8A 5D7UA 4M7DE 2YXYA 2JM9A 2O2OA 3CCMA 3JCMe 3M0SA 3EGDA 5FU7C 1WXBA 4JLIA 4XU3A 2ZZDA 5GAMe 1VQ9T 1DJ7B 1D0YA 1EIFA 5GAOq 2QASA 2NUTB 2QEXT 4DOWA 3UA7A 4L6V5 2BIVA 1IHWA 2WACA 1TXQA 4L5GA 4PJNA 1M5Q1 4M77B 3FLGA 5LJ3d 4D8DA 5LJ3h 2E3HA 3CCUQ 4M78F 1ZHIA 3FEOA 1BBZA 1UGVA 2KT8A 3E9FA 4GLKA 5LJ3e 1H3ZA 2DK3A 5KYUA 3X25B 1UE9A 2CP5A 3QUIA 4KH1B 2P4TA 4TVRA 5GANf 3I5SA 3G4SA 2QA4A 5GAN7 1KQ2A 3O5ZA 1S72T 3A8HB 3EH2A 3M53A 3MPUB 3H0IA 3OS2A 2JNGA 2KAFA 2EKHA 2DA9A 3FB9A 2DJQA 1WHGA 4KBMB 5FWBA 2RHYA 1AWOA 2OTLT 2XICA 3H8ZA 4RKUE 4B9XA 3P8BB 5CKHA 3TVTA 3A8LB 1BI2A 1VYTA 3L2ZA 3CMAT 1D1AA 2CSIA 3CC7A 1YJ9A 4F17A 2PVDB 1KHIA 4JUVA 1M1GA 4KUDK 1VQKT 3OS0A 4WF2A 3JB9I 3CD6T 2LJ1A 1QVFS 3M5AA 4FT2A 2IG0A 2K3YA 4XTZA 3JCMJ 2CT4A 3SB2A 1QCNA 1K76A 3SD4A 1SEMA 2FZCB 2M9UA 4PJOF 2KDSA 1RLQC 4QQDA 3M54A 3QJYA 1M2VB 2OTJA 4E7SA 3HL8A 3C0CA 2EJFA 1M27C 4M78D 2J06A 4QT7A 1E6GA 1W2BP 1VQ7A 3RDVA 2KSSA 1IHVA 1EZZB 3EAEA 2EGCA 2I0NA 1RI9A 3JCMP 2X4XA 2CP3A 1RAGB 3RUXA 1VQPQ 4JZ3A 2GGRA 1VQKQ 2DBMA 2QGGA 3M0TA 4OMLA 3TSWA 2NUPB 3OYDA 2D8HA 1SHFA 2RNAA 1Q86R 4PFOA 2RM4A 2EBPA 2M51A 3CCVT 4J9HA 2AK5A 4M7AC 2K7AA 2XMFA 4JJBA 2H8HA 2CH4W 4JZ4A 4NL3A 3CCUA 2LT1A 4LXCA 2YSQA 5IH2A 4RTYA 3OYAA 2EFIA 1N27A 1QVGP 1M8VA 2JUFA 1ZSGA 3QBYA 1U06A 1MGQA 2VWFA 3WVEB 5GAOn 1BCOA 4K11A 2ZCFB 2RA2A 4GBQA 2HZYA 1NM7A 4ZN3A 2SRCA 3PMTA 2CZ0B 2FZGB 2L8DA 2VVKA 4J83A 1OX9A 4DBHA 1WXUA 4JS5A 2D8JA 2KRNA 5I22A 3CCQT 1J3TA 4F7UF 5EG2A 4PL6A 2X3WD 5CQXA 2V8KA 3CPWP 1QVFA 3OSSC 2W10A 5CR2A 2XKOC 3KUFA 1CSKA 4PJOD 3VRYA 1TOVA 1YI2Q 1VQNA 5LL6S 4CC2A 1OQKA 3KFVA 2VASA 4E7LA 2EWNA 3EFOA 1KFZA 4RG2A 2A37A 5LJ5d 5LJ5h 1UGPB 2EAYA 2MCNA 1G3TA 1SRLA 4PJMA 4ATOA 1UFFA 1PRLC 1UEBA 5KCOA 3R6OA 2RF0A 1NEGA 5LJ5e 5IN1A 1VQLQ 1X2QA 1S1NA 3KBGA 1EFNA 2R5AA 4N0AC 3JCMg 3J81E 2L3SA 2JTFA 2YT6A 2F2WA 2M0OA 2DTOA 1PNJA 4IIOA 5GAMg 2QI2A 2E4HA 2DXUA 2HNIA 2F69A 4PFPA 2RHUA 1M1KC 3SWNA 4EMKB 4J9CA 3G6EA 2DL8A 3MEVA 3MP6A 4IIMA 1I5LA 1K8AU 1WFWA 3RERA 2O01E 1VQPA 2GF7A 3FC3A 2LZ6B 3OBWA 1PRMC 2E12A 2LQKA 3FRNA 5LJ3g 3NTKA 1X27A 1UGSB 3VS3A 4M75F 4FT4A 4RCBA 4BY6B 2HQHA 2PVOB 3HRUA 4D8KA 4AFUC 1XOVA 4OB3B 1M1FA 3RKXA 3NTHA 5KH6A 4QQGA 4EMKC 4J9BA 2EGEA 3HP9A 2RQTA 4XAXB 2VUBA 1M3AA 7AT1B 1UUEA 3OYNA 4RTXA 1SF9A 3QDRB 1T3SA 4XTWA 1VQOA 1PG5B 1NYGA 3EGXB 4XU1A 3M4YA 1YITA 5GAMj 5IHKA 2WSFE 4GLMA 4IKFA 4MDWA 1ZUKA 3LGLA 3CCRQ 1NE8A 5GAN2 2CZ1B 2PTKA 5A2QE 4OMOA 3G71T 3M4GA 1BYMA 2LQNA 1GRIA 3AHUA 3DB4A 2HEQA 3CCJQ 3A8GB 5KYYA 1B07A 1FMKA 5GAN3 4E7JA 1YI2A 3SHWA 2KT1A 5CKFA 2KROA 4KGXB 1YP5A 3OW2S 1XNIA 3F70A 5LJ3j 3M56A 5HCKA 1YCYA 1ZQ1A 2SEMA 5GAN6 3OYHA 1K8AR 3M0RA 2DFUA 1QVPA 2FPFA 4QKUA 3UPUA 4OF1A 3RKYA 2DZCA 1VQLA 5CAIA 2FHDA 3PVQA 1KD1C 3G71Q 4M7DB 4PLIA 1WGSA 2CP0A 4M75D 1TWBA 4E7IA 1WZOA 1FYNA 1YHQQ 2O9VA 4MDXA 2CZ7B 3CCEA 3CCMT 1NYFA 3VU3C 4DOVA 2JOYA 3TEEA 3MO8A 1MMDA 1XTDA 2PU9B 4P5NA 2E5KA 2IPOB 3OYCA 2K5IA 5HK3A 4BACA 4IUQA 2J6OA 2EKOA 3VS1A 4M78A 3VYGA 1GXIE 2CSQA 1JJ2P 3L42A 1AT1B 2LT4A 4M7DC 3QWYA 3CC2Q 1P92A 3S3MA 5GMKh 3EG9A 4FSSA 1Y96B 2KYMA 2RHXA 3LGFA 2K57A 2ZAEA 4M4ZA 4C92B 2E3IA 4M78E 3HPWA 2R5MA 3A5ZB 5GMKe 1N8RC 3TREA 3VJPA 3PGGA 2LRQA
chains in the Genus database with same CATH topology
1N6AA 4J6YA 5FU7C 4QVZA 1YBYA 3VV0A 4XU3A 3PT9A 4JLIA 2ZZDA 3OS5A 4QW2A 1DJ7B 2XDPA 1EIFA 4XU2A 4Y91A 5GAOq 2LCLA 2PUOB 3MEAA 4M7AA 1I81A 3G4ST 2QA4T 2QEXT 4DOWA 3CBPA 2EQMA 1SSFA 2BIVA 3MEUA 4L6V5 2DO3A 3GNFB 5GAN4 2RI3A 2GFAA 4V2SA 1VQ8T 1X6OA 1LJOA 2P0PA 2E6ZA 4RMOA 4HT9A 2WACA 4NL2A 4L5GA 1BI3A 1NZ9A 4FU6A 3CCRA 1M5Q1 4IUUA 4M77B 5GMKi 3FLGA 5LJ3d 5LJ3h 4KUIA 2DD5A 2Y90A 5GAOp 4X34A 3P8DA 2HAXA 4M78F 5GAOm 3ZBDA 1ZHIA 2RJFA 3FEOA 3LW5E 3TCJA 4BY6C 4M7AE 3CPWS 5CK9A 2VXEA 3CCJA 3E9FA 4C92C 4C92D 4GLKA 3OS1A 2VXFA 4EMGA 1UGRB 4ZN1A 3CC7T 1YJ9T 1YHQT 5LJ3e 1H3ZA 2X4WA 5C6SA 5GANg 4BI8B 5LJ5g 3L2UA 2DK3A 3GNGA 1NJIU 4JDSA 3M57A 1OYXA 3ZFJA 4PJOG 3X25B 5I2SA 3O8VA 2CYZB 4O6JA 1KC8C 3QUIA 2DIQA 4CI0C 4M77A 2P4TA 1MHNA 4TVRA 3JB9D 1VQ9A 3HRTA 5GANf 1VIEA 5LJ5f 3G4SA 4OB1B 5GAN7 2WSCE 2QA4A 2QEXA 1KQ2A 4PJOA 1S72T 2DXCA 3EFRA 4ELZC 1QW1A 3GP8A 4XTVA 3A8HB 3M53A 3RIRA 3KXTA 2L89A 3UDCA 2LNVA 3OS2A 2D0QB 2JNGA 2KAFA 1W2BA 1VQ8A 4M7AF 3FB9A 4E47A 4KBMB 1IREB 4MZMA 2RHYA 4QQ6A 4HKEA 2ZPIB 4JJNK 2OTLT 2XICA 2YLBA 3H8ZA 4RKUE 1Q82U 4B9XA 3CC2T 2BKDN 3P8BB 5CKHA 4M77E 2OTJT 2EJ9A 2P0KA 3DKMA 3A8LB 3MP8A 2YRVA 2RD1A 3G7ZA 4MMKA 1BI2A 3RESA 5DM7R 1VUBA 3L2ZA 4J5YA 4PJOE 2K2VA 4OGCA 3CMAT 4J6WA 5CIUA 3CC7A 1YJ9A 1VQ7T 1YHQA 4BUGA 2LQ8A 2KY9A 2PVDB 1KHIA 1HK9A 1NPPA 1BI0A 2GCXA 2GQVA 3M55A 3M58A 3PIOA 4JUVA 1Q81U 1NJIC 1M1GA 5A0GA 1OZ3A 4N0AA 5FU6B 1VQKT 1HXDA 4KUDK 5D6WA 3CBOA 3NFCA 3OS0A 2JTMA 3L2QA 4WF2A 3SFMA 3JB9I 4BDYA 3CD6T 3CPFA 3L2WA 3M5AA 1K73U 1QVFS 4FT2A 2IG0A 3OYEA 1S72A 1YJWT 3X28B 1XQHA 2K3YA 3E19A 4XTZA 3OQ5A 3ZEHA 3JCMJ 1TH7A 2LDMA 4M77F 4C5HA 3SB2A 5KCHA 3OYFA 1R8OB 3QIIA 1Q86C 3QSUA 4XK8E 4C0FA 1QP2A 5GMKl 5FRMA 3JCMb 2XDDA 3SD4A 2M9UA 2K5FA 1G3YA 4PJOF 5GANj 4ZGDB 2KDSA 3J7AF 5LJ5j 3QZ9B 2QXFA 3CBMA 3PNWC 4QQDA 4F7UB 2RJDA 3M54A 1O75A 4IUTA 2OTLA 2FB7A 3QJYA 5CCAA 4JRQA 3CCUT 1Q82C 3CC2A 2D6FA 2OTJA 4O5VA 3E1SA 3HL8A 2E65A 2EJFA 4M78C 4M78D 2F5TX 3OYIA 2K3XA 3JCMW 1WNLA 4FL6A 3L1AA 3CMAA 1VQ7A 4QVDA 4Q5WA 3VUZA 2KSSA 5IT9E 5GAMd 3EAEA 5GAMh 3FDRA 4F7UG 3QYHB 4JRPA 3INZA 2DJZA 4HCCA 4J6XA 2DXTA 1U8RA 3GIBA 3HRSA 2DVEA 2C06A 2IVWA 4DQ2A 1VQKA 3JCMP 2X4XA 3RUXA 3DLMA 4A4EA 2DPPB 1WQ7A 2KMTA 1K9MC 2Y4XA 4HCZA 4F7UA 3OYJA 3CPWA 3CD6A 1I8FA 3PFSA 2E41A 1VQMT 1QVGS 1K73C 3HFNA 3LWIA 3CEYA 3RMSA 1KQ1A 4EMKA 1YJWA 4OMFB 3OYDA 4OB0B 3WVDB 3META 3X24B 3VYHB 1VQ6T 1WQWA 3H6ZA 2DXBA 4EMHA 4C0DB 2RM4A 2XG8D 3CCVT 1FX7A 2PQWA 4M7AC 2CKKA 1UB4A 4M7AD 5I21A 2JVVA 3C94A 4NL3A 1LOJA 3CCUA 2DZ9A 1VQNT 2LT1A 2XK0A 3GPLA 4F7UE 1AHJB 5GAMe 4PJOB 3QJ6A 3OSVA 2L5QA 3QG1A 4PKCC 3MHXA 1Y7XA 3OMCA 2JN0A 3OYAA 2EFIA 4A4KA 1N27A 2MI6A 5DLQE 1M8VA 2JUFA 3QBYA 5GAOn 1MGQA 3DB3A 1Y71A 2EQUA 2RHZA 3HHTB 4GY5A 4J8OA 3WVEB 5A0LA 5GMKm 3JCMX 2ZCFB 3M9QA 3PTAA 2DEQA 2RA2A 1KG1A 4BDZA 5KE3A 3QKJA 2EYQA 1UGQB 2VC8A 3C4SA 4ZN3A 1WPYA 2DIGA 2E10A 2I2LA 3PMTA 1VQMA 3QXEB 2CZ0B 2FVUA 2L8DA 2FL7A 3JB9G 3BY7A 4J83A 2VGNA 4VUBA 4JS5A 4Z02A 3EFSA 1KD1U 2E6NA 3MEWA 1VQ6A 2B8AA 2K4YA 3CCQT 5GAN8 2LX9A 2O4XB 4F7UF 1G5VA 2RO0A 4PL6A 5EG2A 5CQXA 3OYBA 4M77C 4BE2A 4ZTJA 4M77D 3A8OB 3CCVA 2V8KA 5M9OA 1QVFA 4ZGEB 3OSSC 5CR2A 4A54A 1VQ4T 2XKOC 3KUFA 2QQBA 3GF5A 4M75B 5I2MA 4PJOC 3UT1A 2ZGWA 4PJOD 3ER0A 3OBYA 2PVGB 3DLLA 1VQNA 5A0DA 2M1HA 5LL6S 3CC4T 1M4ZA 4A53A 1M1KU 2RH2A 3S3OA 4XTUA 3JCMc 4UC4A 1H641 4E7LA 3PMIA 3G6ET 2EWNA 4XU0A 2XD0A 5D6YA 2MAMA 5CKDA 1O9SA 4BI4A 1YIJA 4MZPA 1VQ5T 3NTIA 4M75G 2O4XA 4RG2A 5LJ5d 2VYTA 4QVCA 5LJ5h 1UGPB 2EAYA 2ZPHB 1G3TA 2FYKA 4NS5A 3CCLT 4ATOA 1Q7YU 2DTHA 4PLLA 1M90U 1VQPT 4M75A 4C8QG 4FIBA 3RMQA 5DLOA 1UEBA 3I56T 3SWNB 1KQSS 5KCOA 3L2VA 3R6OA 2K5LA 4HCBA 4X9DA 2D9TA 5GANe 2ZPGB 3JCMV 4HA8A 5LJ5e 5IN1A 4C8QA 1BI1A 2RJEA 3QPHA 3CCQA 4ZTFA 1Y07A 3KBGA 3JCMg 2R5AA 2MWOA 4N0AC 3OYLA 2V8JA 3C12A 3J81E 1JJ2S 2JTFA 5CKBA 2M0OA 2DTOA 1B34A 2EQJA 2XU8A 5CO7A 5GAMg 1VQ4A 1QVGA 1JB0E 3X26B 2QI2A 3OB9A 2CZ6B 4KULA 4C0GA 4J7IA 3BDUA 3LWHA 4LD9K 3S6WA 4II1A 2DXUA 2HNIA 3JCMf 3CC4A 2F69A 3L2RA 2H3JA 4M75E 1U1SA 1G3WA 2RHUA 1M1KC 3SWNA 1KHCA 2DKGA 2HQEA 2ZPBB 4KT0E 4EMKB 3FJPA 3OYGA 2XIDA 5GAMf 3G6EA 2BUDA 3T9NA 2LVMA 4M78G 2RJCA 3CCST 4C8QE 3MEVA 3MP6A 1I5LA 1QP3A 2CGHA 4FM4B 1VQ5A 4M7DA 4A4HA 3I55T 4ME7A 1K8AU 1X01A 3URGA 5FU6C 1RL2A 2EIFA 3CCLA 2EQKA 3RERA 1WJSA 2LCCA 1Q81C 2O01E 5AYFA 1VQPA 3GOXA 1YITT 2GF7A 1Q7YC 3FC3A 1M90C 3I56A 3OBWA 2CS7A 4JLGA 2E12A 2LQKA 3FRNA 5LJ3g 3NTKA 3MP1A 2KQWA 3MCAB 5C0MA 1UGSB 3OYYA 3V7SA 5GAOr 2ZPEB 4M75F 3LH0A 4FT4A 1IZ6A 4RCBA 4BY6B 2PVOB 3HRUA 1PSFA 2YLCA 1XOVA 5LJ3f 4OB3B 1BIAA 1M1FA 3RKXA 4C5GA 3NTHA 5KH6A 2QTXA 4BD3A 2HD0A 4QQGA 4C8QF 4EMKC 1FXXA 1YIJT 1YI2T 2NLUA 2R57A 3HP9A 4IUVA 3OA6A 1BIBA 1KC8U 4XAXB 2VUBA 2YHTA 4LD6A 3P8HA 3OYNA 3V7RA 2QQSA 4OP0A 3QDRB 3CCSA 3ME9A 4XTWA 2X4JA 3X20B 2RK2A 4E7KA 1VQOA 3TU4K 1V29B 3I55A 2A7YA 1JRIA 5GMKj 3CMET 3ASKA 1K8AC 4C92G 1Y96A 3OW2A 4FSXA 4XU1A 3V8LA 3M4YA 3OYMA 1YITA 2QQAA 3QYGB 5HY6A 5GAMj 2EJGA 3CXCS 2PUKB 2WSFE 4IKFA 3QHSA 2XHCA 4MDWA 4C92A 4R55A 4M7DF 2VGMA 4EDUA 3LGLA 1NE8A 2JZ2A 4JS4A 3LX7A 2F5KA 5GAN2 3HKSA 5FROA 5FLXE 3OY9A 4A4GA 1VQLT 2CZ1B 5IAYA 4J7FA 4XQ3A 5A2QE 3G71T 3QZ5B 3M4GA 1BYMA 1N9RA 4C0DC 3LLRA 4YTLA 3LYIA 4L59A 5GAN5 1YJNT 3AHUA 3BFMA 4D6WA 3DB4A 3WXMB 3V7CA 1KQSA 4LDVA 4JRIA 3A8GB 2QQRA 4IUPA 2OAUA 4M77G 5GAN3 3SDZA 4E7JA 1YI2A 2XI9A 5DY9A 1RI0A 1U1TA 5CKFA 3CCET 1WJQA 4MMLA 3JAME 3JSCA 2L3RA 4C92E 5D6XA 3OW2S 1JJ2A 2MWPA 1XNIA 2RHIA 3F70A 4C8QB 1PSEA 3M59A 5LJ3j 3M56A 4RCCA 1YCYA 1X75C 5J3BA 4EPCA 5CQYA 1ZQ1A 4A4FA 2KK4A 5GAN6 3OYHA 3CMEA 3C95A 5L8RE 4ELYC 5GANd 5GANh 1B34B 2M16A 3E9GA 1D3BB 1Q86U 2P0QA 2E1HA 4NOYA 3VUBA 2E64A 2QQ9A 1QVPA 3QO3A 4N4IA 3JB9H 1G3SA 4IURA 1WJRA 4XTYA 4B9WA 3JB9J 2MMPA 3A8MB 3UPUA 2AHJB 5FRNA 2DTIA 4LDYA 4OF1A 3RKYA 2DZCA 1VQLA 4C0ZA 3G71A 4BE0A 2R58A 2X35A 5CAIA 2FHDA 2MF2A 1KD1C 3JCMQ 4M7DB 2HBPA 1YJNA 4C92F 4LDUA 4PLIA 4X9CA 4HT8A 4XTXA 1WGSA 4M75C 4M75D 2WSEE 2A3LA 4M78B 2LTOA 4E7IA 2Y4YA 3HSBA 5CVIA 5HKCA 1NPRA 2GFUA 1OZ2A 1D3BA 4RG8A 4OGEA 4BE1A 4MDXA 4Y28E 2RB6A 1VQ9T 4C8QC 2CZ7B 4C8QD 3CCEA 3CCMT 1N8RU 2ZPFB 5HK0A 3Q1JA 1K9MU 3VU3C 1BKBA 4BB7A 2RK1A 3HFOA 2JOYA 5CKEA 4DOVA 5KE2A 1I4K1 1FWZA 1W4SA 3PIPA 1W2BS 3JB9F 3GLXA 4BI3A 3TEEA 4PNOA 4CRIA 3MO8A 5J39A 1VIFA 1XTDA 5GAOl 3J80E 2PU9B 3N5BB 4P5NA 2G3RA 3OYCA 2K5IA 3VKIA 2HQXA 2DAQA 5FU7B 5HK3A 4BACA 1VQOT 4IUQA 3JRZA 3OYKA 2RI5A 4JRKA 2RI2A 2EKOA 4LDXA 2DD4A 3SWNC 4M78A 3VYGA 3V8JA 1ZBXA 1GXIE 4E7HA 2E70A 2LC4A 4MZTA 2X4YA 5J26A 2E5QA 3L42A 1M9SA 3CCRT 1LNXA 2QDYB 2LT4A 4C5EA 4M7DC 4M7DD 4C5IA 3BW1A 3V8KA 4DA4A 4N4HA 4M7AB 3BDLA 2XDBA 4M7DG 2KVQG 1P92A 4OB2B 4LDWA 3JCMd 4OVAA 3JCMh 5GMKh 3S3MA 4ZGJB 2V8IA 1JBMA 1N9SA 4R56A 3CXCA 3S3NA 1Y96B 3FIFA 3CCJT 1OI1A 2RHXA 3LGFA 2K57A 3UWNA 2VV5A 4M7DE 4C92B 3OMGA 4M78E 3HPWA 3CCMA 2R5MA 3A5ZB 5GMKe 3JCMe 1N8RC 4M7AG 3TREA 3RKWA 3VJPA 4N4GA 3PGGA 2LRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSS C;  2IVW A;  2LNV A;  2LC4 A;  2Y4Y A;  2Y4X A; 
#chains in the Genus database with same CATH topology
 1H92 A;  4J6Y A;  4QVZ A;  1LPL A;  3M0P A;  3OS5 A;  4AMC A;  2XDP A;  4XU2 A;  2PUO B;  3G4S T;  2QA4 T;  2O9S A;  3CBP A;  1SSF A;  2DO3 A;  3GNF B;  5GAN 4;  5KYU B;  1RAB B;  1X6O A;  1LJO A;  1X69 A;  2E6Z A;  4AFZ C;  1UJ0 A;  4RMO A;  3CCR A;  1QKW A;  1NZ9 A;  4FU6 A;  5GMK i;  2DF6 A;  1C1A A;  2HSE B;  2EYW A;  2DD5 A;  2Y90 A;  2HAX A;  2RJF A;  4KRT A;  1D0Z A;  2VXE A;  3CCJ A;  4C92 C;  4EMG A;  1OU9 A;  1UGR B;  3CC7 T;  1YJ9 T;  5C6S A;  5LJ5 g;  3L2U A;  3GNG A;  4JDS A;  1OYX A;  4PJO G;  3O8V A;  1AWX A;  1KC8 C;  1T3L A;  1MHN A;  1YWO A;  5FW9 A;  1VIE A;  4PJO A;  2HL5 C;  2F2X A;  4XTV A;  8ATC B;  3RIR A;  3KXT A;  3UDC A;  1VQ8 A;  2ECZ A;  3M0Q A;  4M7A F;  1Y57 A;  1I1J A;  1SG5 A;  4MZM A;  4QQ6 A;  4HKE A;  2ZPI B;  2OX7 A;  4JJN K;  1Q82 U;  2OTJ T;  1M2O A;  3MP8 A;  4MMK A;  4AT1 B;  4PJO E;  4J5Y A;  4OGC A;  4J6W A;  1VQ7 T;  1YHQ A;  1WHH A;  3CC7 Q;  1YJ9 Q;  2CP2 A;  1NJI C;  5ECA A;  1CKA A;  1OZ3 A;  5D6W A;  3CBO A;  2KGT A;  2QK0 A;  1WHJ A;  3ZL7 C;  1ZBJ A;  4RTT A;  1XQH A;  3ZEH A;  1PD1 A;  1TH7 A;  2LDM A;  3OYF A;  3THK A;  2V1Q A;  5KCH A;  3QII A;  2XDD A;  5LJ5 j;  1GBR A;  3PNW C;  2RJD A;  5CCA A;  1Q95 G;  2G6F X;  3CCU T;  3CC2 A;  3CC4 Q;  3EG0 A;  2F2V A;  1WNL A;  1G2B A;  1WIE A;  2CP6 A;  5GAM d;  1VQ7 Q;  2DE0 X;  5GAM h;  4F7U G;  2A36 A;  2DJZ A;  4J6X A;  2BE7 D;  2DVE A;  2C06 A;  2P4R A;  4ANJ A;  4DQ2 A;  4HXJ A;  4F7U A;  3I5R A;  1K73 C;  3LWI A;  3CEY A;  1YJW A;  4OMF B;  3MET A;  3X24 B;  1WQW A;  2PZ1 A;  5IHI A;  2DXB A;  1B3Q A;  2RPN A;  1QCO A;  4EMH A;  1D1C A;  2L3Q A;  4C0D B;  2XG8 D;  4PFZ A;  2CKK A;  4M7A D;  1T0J A;  5I21 A;  4ORZ A;  2DZ9 A;  1Q82 R;  1VQN T;  2XK0 A;  4F7U E;  1AHJ B;  2L5Q A;  2COZ A;  1Y7X A;  3OMC A;  1IB8 A;  1E7O A;  2DYB A;  2A08 A;  3CCS Q;  5DLQ E;  2EQU A;  2OI3 A;  2RHZ A;  5A0L A;  2DEQ A;  2YUQ A;  3EH1 A;  4BDZ A;  1U3O A;  1UGQ B;  3C4S A;  1M8M A;  3QXE B;  2FL7 A;  1KD1 U;  3EFS A;  2E6N A;  3MEW A;  5GAN 8;  3EG2 A;  4Y92 A;  2QDL A;  1OPK A;  2RO0 A;  4KGV B;  4ZTJ A;  4M77 C;  4ZGE B;  2QQB A;  3GF5 A;  2B86 A;  1PKS A;  1M3C A;  2ZGW A;  3ER0 A;  3OBY A;  3VRZ A;  2M1H A;  1PD0 A;  4A53 A;  2KRS A;  1VQN Q;  2RH2 A;  4HCK A;  3S3O A;  4XTU A;  3LH5 A;  4UC4 A;  1H64 1;  3G6E T;  1LVK A;  2XD0 A;  5CKD A;  1ZSZ A;  4BI4 A;  1UDL A;  3CME Q;  1HYO A;  1SSH A;  2O4X A;  4M75 G;  2VYT A;  1T0H A;  2FYK A;  1JQQ A;  2FEI A;  2DTH A;  4PLL A;  1Q7Y U;  2X3X D;  3VS4 A;  1VQP T;  4M75 A;  1VYV A;  2MIO A;  3SWN B;  3L2V A;  2OJ2 A;  5GAN e;  4LNP A;  1Y07 A;  2MWO A;  2XU8 A;  1B34 A;  1HSQ A;  1JB0 E;  2CZ6 B;  5KYX B;  4J7I A;  3VS0 A;  2RQW A;  3S6W A;  3CC4 A;  2ROL A;  4M75 E;  3VS2 A;  1G3W A;  1JXO A;  3FJP A;  2XID A;  1AWJ A;  2X9H A;  3T9N A;  4ZNX A;  2RJC A;  3G6E Q;  4FM4 B;  1WDX A;  3URG A;  1WJS A;  1N5Z A;  1Q81 C;  1YIT T;  1M90 C;  3EHR A;  3NPF A;  2J6F A;  3U23 A;  1KSW A;  2KQW A;  3MCA B;  5C0M A;  3V7S A;  1SHG A;  2GTO A;  1PSF A;  1NLO C;  5KYW A;  2EGA A;  2QTX A;  2HD0 A;  1YI2 T;  4IUV A;  1BIB A;  1KC8 U;  4Z88 A;  3UF4 A;  1K0S A;  3CCS A;  2COY A;  3JV3 A;  3ME9 A;  2X4J A;  2RK2 A;  1RAA B;  5GMK j;  5GJV B;  5KYY B;  1VQO Q;  3ASK A;  3A1P A;  1IGQ A;  2DL7 A;  4FSX A;  3V8L A;  3QYG B;  5HY6 A;  1Q7Y R;  1OX8 A;  1YIT Q;  2XHC A;  4M7D F;  1KJW A;  2JZ2 A;  2K3B A;  4JS4 A;  2F5K A;  3HKS A;  5FRO A;  5FLX E;  3REB B;  5GJW B;  2QG9 B;  1VQL T;  5IAY A;  4J7F A;  4XQ3 A;  1N9R A;  3LLR A;  4YTL A;  2NUT A;  4LDV A;  2QQR A;  4M77 G;  5DY9 A;  2J7I A;  1U1T A;  3CCE T;  4MML A;  2L3R A;  5D6X A;  2QAZ A;  2RHI A;  4C8Q B;  2KNB B;  2DL5 A;  4RCC A;  1X75 C;  4EPC A;  5CQY A;  1IGU A;  3CME A;  1TUC A;  2JS2 A;  1UG1 A;  2P0Q A;  4NOY A;  3VUB A;  2NUZ A;  2NYS A;  3QO3 A;  1MMG A;  1G3S A;  1YFN A;  4XTY A;  2C0I A;  3JB9 J;  3A8M B;  1K9A A;  2AHJ B;  5FRN A;  4LDY A;  2MYS A;  4C0Z A;  2LCS A;  2JMC A;  2JT4 A;  3JCM Q;  4LN2 A;  3OW2 P;  4C92 F;  4HT8 A;  2WSE E;  4M78 B;  2LTO A;  2Y4Y A;  3HSB A;  5CVI A;  1NPR A;  2OAW A;  1OZ2 A;  4OGE A;  4C8Q C;  2ZPF B;  1KC8 R;  2RK1 A;  3HFO A;  5CKE A;  3CCE Q;  1W2B S;  3PIP A;  1ZA1 B;  4R0K A;  2ABL A;  2FRY A;  1AWW A;  1WHM A;  3EG9 B;  5J39 A;  1VIF A;  1MV0 B;  5GAO l;  1KQS P;  1GCQ C;  2HQX A;  2DAQ A;  3JRZ A;  3OYK A;  2DVJ A;  3A98 A;  2RI2 A;  4LDX A;  1CKB A;  3V8J A;  5J26 A;  2E5Q A;  2LJ0 A;  3CCR T;  4OMP A;  4M7D D;  4C5I A;  4N4H A;  2KVQ G;  4OB2 B;  1BU1 A;  2V8I A;  3S3N A;  3CCJ T;  1OI1 A;  1GFD A;  4Z89 A;  2VV5 A;  4J9G A;  1NLP C;  3PE0 A;  1UHC A;  4M7A G;  3RKW A;  1N6A A;  1M2V A;  4KH0 B;  4M7A A;  4Y91 A;  4FYY B;  1I81 A;  1WXT A;  1C0M A;  2BZY A;  1I5O B;  1VQ8 T;  2DLP A;  2P0P A;  4F14 A;  1TTH B;  4HT9 A;  4NL2 A;  1BI3 A;  1PWT A;  4JJD A;  1NG2 A;  4KUI A;  5GAO p;  5GAO m;  3ZBD A;  3LW5 E;  4BY6 C;  2EYX A;  2EYY A;  4M7A E;  3CPW S;  2NUP A;  5CK9 A;  2KI7 A;  4C92 D;  3OS1 A;  4ZN1 A;  3SEM A;  3BE3 A;  1YHQ T;  2KYB A;  1Y0M A;  4DBR A;  5GAN g;  1ARK A;  1WHL A;  5I2S A;  3D7S B;  2CYZ B;  2CP7 A;  3HRT A;  3ULR B;  1VQM Q;  4OB1 B;  2WSC E;  4OMN A;  2DXC A;  4ELZ C;  3GP8 A;  5L23 A;  2D0Q B;  1W2B A;  2CUB A;  2EYZ A;  2QTV A;  1VQ8 Q;  4E47 A;  2J05 A;  2YLB A;  3CC2 T;  2P0K A;  3RES A;  5DM7 R;  2YRV A;  2RD1 A;  1UEC A;  2YUP A;  3G7Z A;  3TSZ A;  2K2V A;  1VYU A;  4BUG A;  2YRD A;  2KY9 A;  1NPP A;  2GCX A;  3M55 A;  3M58 A;  1Q81 U;  1JXM A;  5A0G A;  4N0A A;  5FU6 B;  1HXD A;  3NFC A;  3L2Q A;  2JMA A;  1GFC A;  3CPF A;  3L2W A;  3OYE A;  4LUD A;  1YJW T;  3X28 B;  1OV3 A;  1JO8 A;  1QWF A;  3E19 A;  3G1J A;  2FRW A;  2ED0 A;  4M77 F;  1Q86 C;  1R8O B;  3QSU A;  5FRM A;  1TSF A;  2P84 A;  5GMK l;  3JCM b;  1G3Y A;  5GAN j;  1K1Z A;  2QXF A;  4F7U B;  1VQ4 Q;  3EGD B;  4IUT A;  2BTT A;  1X2K A;  2FB7 A;  4JRQ A;  1IO6 A;  1OOT A;  1PHT A;  3OYI A;  4QVD A;  1PKT A;  1PM3 A;  3R6N A;  3VUZ A;  4JRP A;  2KEA A;  2EVR A;  2DXT A;  2IVW A;  4DEY A;  1MMN A;  3DLM A;  1R0B G;  4A4E A;  2DPP B;  1WQ7 A;  1K9M C;  2YUO A;  2Y4X A;  1OEB A;  3OYJ A;  3CPW A;  3PFS A;  2YRC A;  1QCF A;  4EMK A;  1ZUY A;  4OB0 B;  3WVD B;  2JW4 A;  1YJW Q;  1A0N B;  3H6Z A;  1E6H A;  4EIK A;  1FX7 A;  4B6M A;  2JVV A;  2O88 A;  9ATC B;  4DBQ A;  3QDF A;  2HKQ B;  3GPL A;  1U5S A;  3OSV A;  3QG1 A;  2JN0 A;  1AEY A;  1ZUU A;  4A4K A;  1M3B A;  4PJL A;  1RAH B;  1MUZ A;  3HHT B;  5GMK m;  3REA B;  4HVW A;  3M9Q A;  3PTA A;  5FWC A;  4OMQ A;  2BZ8 A;  1M30 A;  1KG1 A;  2DRM A;  1XJW B;  3AT1 B;  3H41 A;  1X6B A;  1WPY A;  1VQM A;  2FVU A;  3JB9 G;  4Z02 A;  1RAF B;  1ZSZ B;  1VQ6 A;  2B8A A;  2BE9 B;  4FW2 A;  2LX9 A;  1Z9Z A;  2L3P A;  2O4X B;  2L0A A;  1G5V A;  4WCI A;  4BE2 A;  4M77 D;  1UJY A;  4A54 A;  4M75 B;  1V76 A;  3I9Q A;  5I2M A;  3UT1 A;  2PVG B;  4LE9 A;  3CC4 T;  1G8X A;  1M1K U;  4FYW B;  3JCM c;  3PMI A;  2MAM A;  1YIJ A;  1AD5 A;  4MZP A;  2ED1 A;  4QVC A;  1QWE A;  1TG0 A;  4DEX A;  5DLO A;  3RMQ A;  4X9D A;  2D9T A;  2ZPG B;  2RJE A;  3QPH A;  4ZTF A;  1VOM A;  3C12 A;  1JJ2 S;  4HVU A;  1VQ4 A;  4C0G A;  6AT1 B;  3JCM f;  4II1 A;  1Z9Q A;  3L2R A;  2X51 A;  1U1S A;  4M7D G;  1KHC A;  2ZPB B;  2HQE A;  4KT0 E;  3OYG A;  5GAM f;  2LVM A;  1WHK A;  3CCS T;  1AZG B;  1QVF P;  1QP3 A;  2HMA A;  4M7D A;  1VQ5 A;  4ME7 A;  5KYW B;  1RL2 A;  2LJ3 A;  3CCL A;  2EQK A;  2LCC A;  2RQR A;  3I56 A;  2AT1 B;  2CS7 A;  4X1V A;  3UA6 A;  1F1B B;  2DER A;  3RR6 A;  2MOX A;  3OYY A;  2O31 A;  4PJJ A;  1ABQ A;  2C0O A;  2C0T A;  2ROT A;  2FPE A;  3E2U A;  5LJ3 f;  2HBW A;  4BD3 A;  4C8Q F;  1FXX A;  2NLU A;  2KE9 A;  2R57 A;  2Z0W A;  3TQ7 P;  1M1K R;  1MND A;  3P8H A;  3V7R A;  2QQS A;  1LCK A;  1KK7 A;  4OP0 A;  3X20 B;  1ZLM A;  3I55 A;  2A7Y A;  1JRI A;  3CME T;  5AT1 B;  1K8A C;  4C92 G;  1Y96 A;  1HD3 A;  3OYM A;  2QQA A;  2EJG A;  1QQJ A;  3CXC S;  1PCX A;  2PUK B;  3QWX X;  3QHS A;  4C92 A;  4R55 A;  2DEU A;  3LX7 A;  3OY9 A;  3EFO B;  2AIR B;  1UHF A;  2DL3 A;  4C0D C;  5GAN 5;  1QKX A;  3BFM A;  4RUG A;  3WXM B;  3V7C A;  4JRI A;  2AKK A;  2OAU A;  8AT1 B;  1GL5 A;  3SDZ A;  2JXB A;  1WJQ A;  3JAM E;  1ZA2 B;  4C92 E;  2ESW A;  1JJ2 A;  2MWP A;  5IXF A;  1VQ9 Q;  2HKN A;  5J3B A;  1AOJ A;  4A4F A;  2KK4 A;  4FYX B;  2QEX Q;  1JEG A;  1WX6 A;  2M0Y A;  4ELY C;  5GAN d;  5GAN h;  3E9G A;  2EQI A;  1FMV A;  2M16 A;  1Q86 U;  2E1H A;  3FJ5 A;  3NGP A;  2QQ9 A;  4IUR A;  2MMP A;  1ZX6 A;  2DTI A;  2DIL A;  1OPL A;  4BE0 A;  4J9I A;  2KRM A;  1SPK A;  2YWW A;  1R77 A;  2HBP A;  1YJN A;  2K79 A;  2A3L A;  1YNZ A;  2GFU A;  2VKN A;  1D3B A;  4RG8 A;  4BE1 A;  2ATC B;  2RB6 A;  4WTO B;  2EPD A;  2J6K A;  4C8Q D;  1N8R U;  4AG2 C;  2M02 A;  3Q1J A;  1K9M U;  1BKB A;  5KE2 A;  3JB9 F;  3GLX A;  3EGU A;  2KXD A;  4BI3 A;  2DET A;  4JPB W;  3J80 E;  3UAT A;  4E2F B;  2HDA A;  1KIK A;  1S72 Q;  1K4U S;  1VQO T;  3H0H A;  2RI5 A;  4JRK A;  2HSP A;  3SWN C;  1I07 A;  4DBF A;  1ZBX A;  4E7H A;  2E70 A;  2LC4 A;  4FCY A;  2X4Y A;  1M9S A;  2A28 A;  3BW1 A;  3V8K A;  4M7A B;  2OTL Q;  1KD1 R;  4LDW A;  2PNI A;  3IQL A;  1JBM A;  4R56 A;  3CXC A;  3FIF A;  3CMA Q;  3UWN A;  1IRX A;  3OMG A;  2LMJ A;  2GTJ A;  4N4G A;  1NEB A;  2GNC A;  1VA7 A;  3VV0 A;  1YBY A;  3CD6 Q;  3PT9 A;  4QW2 A;  1TS9 A;  1SRM A;  2VB6 A;  2LCL A;  3MEA A;  2RQV A;  1W1F A;  4ESR A;  2EQM A;  2GBQ A;  3MEU A;  2RI3 A;  2GFA A;  4V2S A;  1X43 A;  1OU8 A;  4IUU A;  4RTV A;  4X34 A;  3P8D A;  1D09 B;  3TCJ A;  2DNU A;  3MJX A;  2VXF A;  2K2M A;  2X4W A;  4BI8 B;  1NJI U;  1N8R R;  3M57 A;  3ZFJ A;  1K9M R;  4O6J A;  4CI0 C;  2DIQ A;  4M77 A;  1VQ9 A;  3JB9 D;  5LJ5 f;  4RTW A;  2QEX A;  3EFR A;  4J9E A;  1QW1 A;  1X6G A;  1QMC A;  2L89 A;  2LNV A;  1C6V X;  1D1B A;  2CT3 A;  3CCV Q;  1V1C A;  1IRE B;  1RLP C;  4A63 B;  2CUD A;  2BKD N;  4RTU A;  4M77 E;  2EJ9 A;  3DKM A;  4J9D A;  2AZV A;  1VUB A;  3EG3 A;  2LX7 A;  2K9G A;  1SKU B;  5CIU A;  2LQ8 A;  1K0X A;  1WA7 A;  1JU5 C;  1HK9 A;  2GQV A;  1BI0 A;  3PIO A;  4BDY A;  2JTM A;  1UTI A;  3SFM A;  1K73 U;  2V26 A;  1S72 A;  3VS5 A;  2BZX A;  3OQ5 A;  3CCQ Q;  4C5H A;  4XK8 E;  4C0F A;  1QP2 A;  3J7A F;  2K5F A;  2CH4 A;  1RAD B;  4ZGD B;  3QZ9 B;  3CBM A;  4F16 A;  1O75 A;  2MK5 A;  2OTL A;  4CC3 A;  1WYX A;  1Q82 C;  2D6F A;  5EC7 A;  4O5V A;  3E1S A;  4Z8A A;  2E65 A;  1EX4 A;  4M78 C;  2F5T X;  2K3X A;  3JCM W;  4FL6 A;  3L1A A;  3CMA A;  4Q5W A;  4KGZ B;  5IT9 E;  3FDR A;  3QYH B;  1BCM A;  3INZ A;  4LUE A;  4HCC A;  1NJI R;  1RUW A;  3H9N A;  1U8R A;  3HRS A;  2AZS A;  3GIB A;  1MV3 A;  1VQK A;  2RQU A;  2W0Z A;  2CRE A;  2KMT A;  5KYX A;  4HCZ A;  3CD6 A;  2FG0 A;  1I8F A;  2E41 A;  1VQM T;  1QVG S;  3HFN A;  3RMS A;  1KQ1 A;  1MMA A;  3VYH B;  1VQ6 T;  4PK4 A;  3RBB B;  2K6D A;  2PQW A;  1UB4 A;  3C94 A;  1LOJ A;  1W6X A;  4PJO B;  3QJ6 A;  4PKC C;  3MHX A;  1GCP A;  3HTR A;  4F04 B;  2MI6 A;  3DB3 A;  1Y71 A;  3MKD A;  4GY5 A;  4J8O A;  1YIJ T;  3JCM X;  2D0N A;  2KBT A;  2DYI A;  3PVL A;  5KE3 A;  1GBQ A;  3QKJ A;  2EYQ A;  2VC8 A;  2DMO A;  2DIG A;  2E10 A;  1K73 R;  2HL3 A;  2I2L A;  3BY7 A;  2VGN A;  4VUB A;  2D1X A;  2FZK B;  2K4Y A;  1BB9 A;  1VQ6 Q;  2A0F B;  1FMW A;  3OYB A;  3A8O B;  3CCV A;  1OUL A;  2ENM A;  5M9O A;  1VQ4 T;  4PJO C;  5IHN A;  4JJC A;  3DLL A;  5A0D A;  1WI7 A;  2DX1 A;  2KXC A;  4J9F A;  1M4Z A;  1TUD A;  4CC4 B;  4XU0 A;  5D6Y A;  1O9S A;  1TUG B;  4FW1 A;  1VQ5 T;  3NTI A;  1BK2 A;  1AVZ C;  2FPD A;  1YIJ Q;  2ZPH B;  1RAI B;  1RAC B;  4NS5 A;  3CCL T;  1M90 U;  2IIM A;  1H8K A;  4C8Q G;  4FIB A;  3I56 T;  1KQS S;  4HCB A;  2K5L A;  2DL4 A;  2DRK A;  3JCM V;  4HA8 A;  1QLY A;  1H3H A;  4C8Q A;  1BI1 A;  5IXB A;  4AG1 C;  3CCQ A;  4E6R A;  3OYL A;  2V8J A;  5CKB A;  5CO7 A;  2EQJ A;  1QVG A;  3X26 B;  1GCQ A;  2HCK A;  3OB9 A;  3LWH A;  4KUL A;  1TU0 B;  2LP5 A;  3BDU A;  4LD9 K;  1MNE A;  2H3J A;  2CDT A;  2DKG A;  2COW A;  2BUD A;  2YDL A;  2H3E B;  2DBK A;  4M78 G;  2F1L A;  4C8Q E;  2CGH A;  4A4H A;  3I55 T;  1X01 A;  5FU6 C;  1VQ5 Q;  2EIF A;  1ABO A;  1D0X A;  1B7T A;  5AYF A;  1YWP A;  3NHN A;  3GOX A;  3CCL Q;  1Q7Y C;  3I56 Q;  4JLG A;  2JJ9 A;  3MP1 A;  2LNH B;  5GAO r;  2ZPE B;  2YUN A;  3LH0 A;  1IZ6 A;  2QGF B;  2YLC A;  4C5G A;  1BIA A;  1PC0 A;  2QYZ A;  2KR3 A;  3CCM Q;  3OA6 A;  2YHT A;  4LD6 A;  3EHQ A;  3EG1 A;  4E7K A;  3TU4 K;  1V29 B;  3VS6 A;  1G83 A;  4FYV B;  3I55 Q;  3OW2 A;  3H0F A;  4RTZ A;  1Q81 R;  1W70 A;  1M90 R;  2LQW A;  2VGM A;  4EDU A;  3CQT A;  2JTE A;  4A4G A;  1IXD A;  3QZ5 B;  3M0U A;  3LYI A;  4L59 A;  1YJN T;  2MPX C;  4D6W A;  4OMM A;  1KQS A;  3I35 A;  2NWM A;  4IUP A;  4AFS C;  3EGX A;  2XI9 A;  2FO0 A;  1RI0 A;  4E7Z A;  3JSC A;  3RNJ A;  3VS7 A;  4AFQ C;  2DM1 A;  4CC7 A;  2RMO A;  5KYN A;  3CXC P;  1PSE A;  3M59 A;  3GBQ A;  3G4S Q;  2QA4 Q;  1AZE A;  3C95 A;  1YN8 A;  5L8R E;  1B34 B;  1D3B B;  2E64 A;  4N4I A;  1WLP B;  3JB9 H;  1WJR A;  4B9W A;  5I11 A;  1ZSZ C;  1NBE B;  1I0C A;  3G71 A;  2R58 A;  2X35 A;  2MF2 A;  2EW3 A;  2JS0 A;  1RAE B;  2JM8 A;  4LDU A;  4X9C A;  4XTX A;  4M75 C;  1YJN Q;  5HKC A;  2L2P A;  4Y28 E;  1YCS B;  5HK0 A;  1R0C B;  4BB7 A;  1I4K 1;  1FWZ A;  1W4S A;  4PNO A;  4CRI A;  3N5B B;  2G3R A;  3VKI A;  2GQI A;  5FU7 B;  2AKL A;  1HJD A;  2DD4 A;  4MZT A;  1LNX A;  2QDY B;  4C5E A;  4DA4 A;  3BDL A;  2XDB A;  2OTJ Q;  2V1R A;  3NMZ C;  3JCM d;  4OVA A;  3JCM h;  4ZGJ B;  1N9S A;  4HVV A;  1ACM B;  2RN8 A;  5D7U A;  4M7D E;  2YXY A;  2JM9 A;  2O2O A;  3CCM A;  3JCM e;  3M0S A;  3EGD A;  5FU7 C;  1WXB A;  4JLI A;  4XU3 A;  2ZZD A;  5GAM e;  1VQ9 T;  1DJ7 B;  1D0Y A;  1EIF A;  5GAO q;  2QAS A;  2NUT B;  2QEX T;  4DOW A;  3UA7 A;  4L6V 5;  2BIV A;  1IHW A;  2WAC A;  1TXQ A;  4L5G A;  4PJN A;  1M5Q 1;  4M77 B;  3FLG A;  5LJ3 d;  4D8D A;  5LJ3 h;  2E3H A;  3CCU Q;  4M78 F;  1ZHI A;  3FEO A;  1BBZ A;  1UGV A;  2KT8 A;  3E9F A;  4GLK A;  5LJ3 e;  1H3Z A;  2DK3 A;  5KYU A;  3X25 B;  1UE9 A;  2CP5 A;  3QUI A;  4KH1 B;  2P4T A;  4TVR A;  5GAN f;  3I5S A;  3G4S A;  2QA4 A;  5GAN 7;  1KQ2 A;  3O5Z A;  1S72 T;  3A8H B;  3EH2 A;  3M53 A;  3MPU B;  3H0I A;  3OS2 A;  2JNG A;  2KAF A;  2EKH A;  2DA9 A;  3FB9 A;  2DJQ A;  1WHG A;  4KBM B;  5FWB A;  2RHY A;  1AWO A;  2OTL T;  2XIC A;  3H8Z A;  4RKU E;  4B9X A;  3P8B B;  5CKH A;  3TVT A;  3A8L B;  1BI2 A;  1VYT A;  3L2Z A;  3CMA T;  1D1A A;  2CSI A;  3CC7 A;  1YJ9 A;  4F17 A;  2PVD B;  1KHI A;  4JUV A;  1M1G A;  4KUD K;  1VQK T;  3OS0 A;  4WF2 A;  3JB9 I;  3CD6 T;  2LJ1 A;  1QVF S;  3M5A A;  4FT2 A;  2IG0 A;  2K3Y A;  4XTZ A;  3JCM J;  2CT4 A;  3SB2 A;  1QCN A;  1K76 A;  3SD4 A;  1SEM A;  2FZC B;  2M9U A;  4PJO F;  2KDS A;  1RLQ C;  4QQD A;  3M54 A;  3QJY A;  1M2V B;  2OTJ A;  4E7S A;  3HL8 A;  3C0C A;  2EJF A;  1M27 C;  4M78 D;  2J06 A;  4QT7 A;  1E6G A;  1W2B P;  1VQ7 A;  3RDV A;  2KSS A;  1IHV A;  1EZZ B;  3EAE A;  2EGC A;  2I0N A;  1RI9 A;  3JCM P;  2X4X A;  2CP3 A;  1RAG B;  3RUX A;  1VQP Q;  4JZ3 A;  2GGR A;  1VQK Q;  2DBM A;  2QGG A;  3M0T A;  4OML A;  3TSW A;  2NUP B;  3OYD A;  2D8H A;  1SHF A;  2RNA A;  1Q86 R;  4PFO A;  2RM4 A;  2EBP A;  2M51 A;  3CCV T;  4J9H A;  2AK5 A;  4M7A C;  2K7A A;  2XMF A;  4JJB A;  2H8H A;  2CH4 W;  4JZ4 A;  4NL3 A;  3CCU A;  2LT1 A;  4LXC A;  2YSQ A;  5IH2 A;  4RTY A;  3OYA A;  2EFI A;  1N27 A;  1QVG P;  1M8V A;  2JUF A;  1ZSG A;  3QBY A;  1U06 A;  1MGQ A;  2VWF A;  3WVE B;  5GAO n;  1BCO A;  4K11 A;  2ZCF B;  2RA2 A;  4GBQ A;  2HZY A;  1NM7 A;  4ZN3 A;  2SRC A;  3PMT A;  2CZ0 B;  2FZG B;  2L8D A;  2VVK A;  4J83 A;  1OX9 A;  4DBH A;  1WXU A;  4JS5 A;  2D8J A;  2KRN A;  5I22 A;  3CCQ T;  1J3T A;  4F7U F;  5EG2 A;  4PL6 A;  2X3W D;  5CQX A;  2V8K A;  3CPW P;  1QVF A;  3OSS C;  2W10 A;  5CR2 A;  2XKO C;  3KUF A;  1CSK A;  4PJO D;  3VRY A;  1TOV A;  1YI2 Q;  1VQN A;  5LL6 S;  4CC2 A;  1OQK A;  3KFV A;  2VAS A;  4E7L A;  2EWN A;  3EFO A;  1KFZ A;  4RG2 A;  2A37 A;  5LJ5 d;  5LJ5 h;  1UGP B;  2EAY A;  2MCN A;  1G3T A;  1SRL A;  4PJM A;  4ATO A;  1UFF A;  1PRL C;  1UEB A;  5KCO A;  3R6O A;  2RF0 A;  1NEG A;  5LJ5 e;  5IN1 A;  1VQL Q;  1X2Q A;  1S1N A;  3KBG A;  1EFN A;  2R5A A;  4N0A C;  3JCM g;  3J81 E;  2L3S A;  2JTF A;  2YT6 A;  2F2W A;  2M0O A;  2DTO A;  1PNJ A;  4IIO A;  5GAM g;  2QI2 A;  2E4H A;  2DXU A;  2HNI A;  2F69 A;  4PFP A;  2RHU A;  1M1K C;  3SWN A;  4EMK B;  4J9C A;  3G6E A;  2DL8 A;  3MEV A;  3MP6 A;  4IIM A;  1I5L A;  1K8A U;  1WFW A;  3RER A;  2O01 E;  1VQP A;  2GF7 A;  3FC3 A;  2LZ6 B;  3OBW A;  1PRM C;  2E12 A;  2LQK A;  3FRN A;  5LJ3 g;  3NTK A;  1X27 A;  1UGS B;  3VS3 A;  4M75 F;  4FT4 A;  4RCB A;  4BY6 B;  2HQH A;  2PVO B;  3HRU A;  4D8K A;  4AFU C;  1XOV A;  4OB3 B;  1M1F A;  3RKX A;  3NTH A;  5KH6 A;  4QQG A;  4EMK C;  4J9B A;  2EGE A;  3HP9 A;  2RQT A;  4XAX B;  2VUB A;  1M3A A;  7AT1 B;  1UUE A;  3OYN A;  4RTX A;  1SF9 A;  3QDR B;  1T3S A;  4XTW A;  1VQO A;  1PG5 B;  1NYG A;  3EGX B;  4XU1 A;  3M4Y A;  1YIT A;  5GAM j;  5IHK A;  2WSF E;  4GLM A;  4IKF A;  4MDW A;  1ZUK A;  3LGL A;  3CCR Q;  1NE8 A;  5GAN 2;  2CZ1 B;  2PTK A;  5A2Q E;  4OMO A;  3G71 T;  3M4G A;  1BYM A;  2LQN A;  1GRI A;  3AHU A;  3DB4 A;  2HEQ A;  3CCJ Q;  3A8G B;  5KYY A;  1B07 A;  1FMK A;  5GAN 3;  4E7J A;  1YI2 A;  3SHW A;  2KT1 A;  5CKF A;  2KRO A;  4KGX B;  1YP5 A;  3OW2 S;  1XNI A;  3F70 A;  5LJ3 j;  3M56 A;  5HCK A;  1YCY A;  1ZQ1 A;  2SEM A;  5GAN 6;  3OYH A;  1K8A R;  3M0R A;  2DFU A;  1QVP A;  2FPF A;  4QKU A;  3UPU A;  4OF1 A;  3RKY A;  2DZC A;  1VQL A;  5CAI A;  2FHD A;  3PVQ A;  1KD1 C;  3G71 Q;  4M7D B;  4PLI A;  1WGS A;  2CP0 A;  4M75 D;  1TWB A;  4E7I A;  1WZO A;  1FYN A;  1YHQ Q;  2O9V A;  4MDX A;  2CZ7 B;  3CCE A;  3CCM T;  1NYF A;  3VU3 C;  4DOV A;  2JOY A;  3TEE A;  3MO8 A;  1MMD A;  1XTD A;  2PU9 B;  4P5N A;  2E5K A;  2IPO B;  3OYC A;  2K5I A;  5HK3 A;  4BAC A;  4IUQ A;  2J6O A;  2EKO A;  3VS1 A;  4M78 A;  3VYG A;  1GXI E;  2CSQ A;  1JJ2 P;  3L42 A;  1AT1 B;  2LT4 A;  4M7D C;  3QWY A;  3CC2 Q;  1P92 A;  3S3M A;  5GMK h;  3EG9 A;  4FSS A;  1Y96 B;  2KYM A;  2RHX A;  3LGF A;  2K57 A;  2ZAE A;  4M4Z A;  4C92 B;  2E3I A;  4M78 E;  3HPW A;  2R5M A;  3A5Z B;  5GMK e;  1N8R C;  3TRE A;  3VJP A;  3PGG A;  2LRQ A; 
#chains in the Genus database with same CATH homology
 1N6A A;  4J6Y A;  5FU7 C;  4QVZ A;  1YBY A;  3VV0 A;  4XU3 A;  3PT9 A;  4JLI A;  2ZZD A;  3OS5 A;  4QW2 A;  1DJ7 B;  2XDP A;  1EIF A;  4XU2 A;  4Y91 A;  5GAO q;  2LCL A;  2PUO B;  3MEA A;  4M7A A;  1I81 A;  3G4S T;  2QA4 T;  2QEX T;  4DOW A;  3CBP A;  2EQM A;  1SSF A;  2BIV A;  3MEU A;  4L6V 5;  2DO3 A;  3GNF B;  5GAN 4;  2RI3 A;  2GFA A;  4V2S A;  1VQ8 T;  1X6O A;  1LJO A;  2P0P A;  2E6Z A;  4RMO A;  4HT9 A;  2WAC A;  4NL2 A;  4L5G A;  1BI3 A;  1NZ9 A;  4FU6 A;  3CCR A;  1M5Q 1;  4IUU A;  4M77 B;  5GMK i;  3FLG A;  5LJ3 d;  5LJ3 h;  4KUI A;  2DD5 A;  2Y90 A;  5GAO p;  4X34 A;  3P8D A;  2HAX A;  4M78 F;  5GAO m;  3ZBD A;  1ZHI A;  2RJF A;  3FEO A;  3LW5 E;  3TCJ A;  4BY6 C;  4M7A E;  3CPW S;  5CK9 A;  2VXE A;  3CCJ A;  3E9F A;  4C92 C;  4C92 D;  4GLK A;  3OS1 A;  2VXF A;  4EMG A;  1UGR B;  4ZN1 A;  3CC7 T;  1YJ9 T;  1YHQ T;  5LJ3 e;  1H3Z A;  2X4W A;  5C6S A;  5GAN g;  4BI8 B;  5LJ5 g;  3L2U A;  2DK3 A;  3GNG A;  1NJI U;  4JDS A;  3M57 A;  1OYX A;  3ZFJ A;  4PJO G;  3X25 B;  5I2S A;  3O8V A;  2CYZ B;  4O6J A;  1KC8 C;  3QUI A;  2DIQ A;  4CI0 C;  4M77 A;  2P4T A;  1MHN A;  4TVR A;  3JB9 D;  1VQ9 A;  3HRT A;  5GAN f;  1VIE A;  5LJ5 f;  3G4S A;  4OB1 B;  5GAN 7;  2WSC E;  2QA4 A;  2QEX A;  1KQ2 A;  4PJO A;  1S72 T;  2DXC A;  3EFR A;  4ELZ C;  1QW1 A;  3GP8 A;  4XTV A;  3A8H B;  3M53 A;  3RIR A;  3KXT A;  2L89 A;  3UDC A;  2LNV A;  3OS2 A;  2D0Q B;  2JNG A;  2KAF A;  1W2B A;  1VQ8 A;  4M7A F;  3FB9 A;  4E47 A;  4KBM B;  1IRE B;  4MZM A;  2RHY A;  4QQ6 A;  4HKE A;  2ZPI B;  4JJN K;  2OTL T;  2XIC A;  2YLB A;  3H8Z A;  4RKU E;  1Q82 U;  4B9X A;  3CC2 T;  2BKD N;  3P8B B;  5CKH A;  4M77 E;  2OTJ T;  2EJ9 A;  2P0K A;  3DKM A;  3A8L B;  3MP8 A;  2YRV A;  2RD1 A;  3G7Z A;  4MMK A;  1BI2 A;  3RES A;  5DM7 R;  1VUB A;  3L2Z A;  4J5Y A;  4PJO E;  2K2V A;  4OGC A;  3CMA T;  4J6W A;  5CIU A;  3CC7 A;  1YJ9 A;  1VQ7 T;  1YHQ A;  4BUG A;  2LQ8 A;  2KY9 A;  2PVD B;  1KHI A;  1HK9 A;  1NPP A;  1BI0 A;  2GCX A;  2GQV A;  3M55 A;  3M58 A;  3PIO A;  4JUV A;  1Q81 U;  1NJI C;  1M1G A;  5A0G A;  1OZ3 A;  4N0A A;  5FU6 B;  1VQK T;  1HXD A;  4KUD K;  5D6W A;  3CBO A;  3NFC A;  3OS0 A;  2JTM A;  3L2Q A;  4WF2 A;  3SFM A;  3JB9 I;  4BDY A;  3CD6 T;  3CPF A;  3L2W A;  3M5A A;  1K73 U;  1QVF S;  4FT2 A;  2IG0 A;  3OYE A;  1S72 A;  1YJW T;  3X28 B;  1XQH A;  2K3Y A;  3E19 A;  4XTZ A;  3OQ5 A;  3ZEH A;  3JCM J;  1TH7 A;  2LDM A;  4M77 F;  4C5H A;  3SB2 A;  5KCH A;  3OYF A;  1R8O B;  3QII A;  1Q86 C;  3QSU A;  4XK8 E;  4C0F A;  1QP2 A;  5GMK l;  5FRM A;  3JCM b;  2XDD A;  3SD4 A;  2M9U A;  2K5F A;  1G3Y A;  4PJO F;  5GAN j;  4ZGD B;  2KDS A;  3J7A F;  5LJ5 j;  3QZ9 B;  2QXF A;  3CBM A;  3PNW C;  4QQD A;  4F7U B;  2RJD A;  3M54 A;  1O75 A;  4IUT A;  2OTL A;  2FB7 A;  3QJY A;  5CCA A;  4JRQ A;  3CCU T;  1Q82 C;  3CC2 A;  2D6F A;  2OTJ A;  4O5V A;  3E1S A;  3HL8 A;  2E65 A;  2EJF A;  4M78 C;  4M78 D;  2F5T X;  3OYI A;  2K3X A;  3JCM W;  1WNL A;  4FL6 A;  3L1A A;  3CMA A;  1VQ7 A;  4QVD A;  4Q5W A;  3VUZ A;  2KSS A;  5IT9 E;  5GAM d;  3EAE A;  5GAM h;  3FDR A;  4F7U G;  3QYH B;  4JRP A;  3INZ A;  2DJZ A;  4HCC A;  4J6X A;  2DXT A;  1U8R A;  3GIB A;  3HRS A;  2DVE A;  2C06 A;  2IVW A;  4DQ2 A;  1VQK A;  3JCM P;  2X4X A;  3RUX A;  3DLM A;  4A4E A;  2DPP B;  1WQ7 A;  2KMT A;  1K9M C;  2Y4X A;  4HCZ A;  4F7U A;  3OYJ A;  3CPW A;  3CD6 A;  1I8F A;  3PFS A;  2E41 A;  1VQM T;  1QVG S;  1K73 C;  3HFN A;  3LWI A;  3CEY A;  3RMS A;  1KQ1 A;  4EMK A;  1YJW A;  4OMF B;  3OYD A;  4OB0 B;  3WVD B;  3MET A;  3X24 B;  3VYH B;  1VQ6 T;  1WQW A;  3H6Z A;  2DXB A;  4EMH A;  4C0D B;  2RM4 A;  2XG8 D;  3CCV T;  1FX7 A;  2PQW A;  4M7A C;  2CKK A;  1UB4 A;  4M7A D;  5I21 A;  2JVV A;  3C94 A;  4NL3 A;  1LOJ A;  3CCU A;  2DZ9 A;  1VQN T;  2LT1 A;  2XK0 A;  3GPL A;  4F7U E;  1AHJ B;  5GAM e;  4PJO B;  3QJ6 A;  3OSV A;  2L5Q A;  3QG1 A;  4PKC C;  3MHX A;  1Y7X A;  3OMC A;  2JN0 A;  3OYA A;  2EFI A;  4A4K A;  1N27 A;  2MI6 A;  5DLQ E;  1M8V A;  2JUF A;  3QBY A;  5GAO n;  1MGQ A;  3DB3 A;  1Y71 A;  2EQU A;  2RHZ A;  3HHT B;  4GY5 A;  4J8O A;  3WVE B;  5A0L A;  5GMK m;  3JCM X;  2ZCF B;  3M9Q A;  3PTA A;  2DEQ A;  2RA2 A;  1KG1 A;  4BDZ A;  5KE3 A;  3QKJ A;  2EYQ A;  1UGQ B;  2VC8 A;  3C4S A;  4ZN3 A;  1WPY A;  2DIG A;  2E10 A;  2I2L A;  3PMT A;  1VQM A;  3QXE B;  2CZ0 B;  2FVU A;  2L8D A;  2FL7 A;  3JB9 G;  3BY7 A;  4J83 A;  2VGN A;  4VUB A;  4JS5 A;  4Z02 A;  3EFS A;  1KD1 U;  2E6N A;  3MEW A;  1VQ6 A;  2B8A A;  2K4Y A;  3CCQ T;  5GAN 8;  2LX9 A;  2O4X B;  4F7U F;  1G5V A;  2RO0 A;  4PL6 A;  5EG2 A;  5CQX A;  3OYB A;  4M77 C;  4BE2 A;  4ZTJ A;  4M77 D;  3A8O B;  3CCV A;  2V8K A;  5M9O A;  1QVF A;  4ZGE B;  3OSS C;  5CR2 A;  4A54 A;  1VQ4 T;  2XKO C;  3KUF A;  2QQB A;  3GF5 A;  4M75 B;  5I2M A;  4PJO C;  3UT1 A;  2ZGW A;  4PJO D;  3ER0 A;  3OBY A;  2PVG B;  3DLL A;  1VQN A;  5A0D A;  2M1H A;  5LL6 S;  3CC4 T;  1M4Z A;  4A53 A;  1M1K U;  2RH2 A;  3S3O A;  4XTU A;  3JCM c;  4UC4 A;  1H64 1;  4E7L A;  3PMI A;  3G6E T;  2EWN A;  4XU0 A;  2XD0 A;  5D6Y A;  2MAM A;  5CKD A;  1O9S A;  4BI4 A;  1YIJ A;  4MZP A;  1VQ5 T;  3NTI A;  4M75 G;  2O4X A;  4RG2 A;  5LJ5 d;  2VYT A;  4QVC A;  5LJ5 h;  1UGP B;  2EAY A;  2ZPH B;  1G3T A;  2FYK A;  4NS5 A;  3CCL T;  4ATO A;  1Q7Y U;  2DTH A;  4PLL A;  1M90 U;  1VQP T;  4M75 A;  4C8Q G;  4FIB A;  3RMQ A;  5DLO A;  1UEB A;  3I56 T;  3SWN B;  1KQS S;  5KCO A;  3L2V A;  3R6O A;  2K5L A;  4HCB A;  4X9D A;  2D9T A;  5GAN e;  2ZPG B;  3JCM V;  4HA8 A;  5LJ5 e;  5IN1 A;  4C8Q A;  1BI1 A;  2RJE A;  3QPH A;  3CCQ A;  4ZTF A;  1Y07 A;  3KBG A;  3JCM g;  2R5A A;  2MWO A;  4N0A C;  3OYL A;  2V8J A;  3C12 A;  3J81 E;  1JJ2 S;  2JTF A;  5CKB A;  2M0O A;  2DTO A;  1B34 A;  2EQJ A;  2XU8 A;  5CO7 A;  5GAM g;  1VQ4 A;  1QVG A;  1JB0 E;  3X26 B;  2QI2 A;  3OB9 A;  2CZ6 B;  4KUL A;  4C0G A;  4J7I A;  3BDU A;  3LWH A;  4LD9 K;  3S6W A;  4II1 A;  2DXU A;  2HNI A;  3JCM f;  3CC4 A;  2F69 A;  3L2R A;  2H3J A;  4M75 E;  1U1S A;  1G3W A;  2RHU A;  1M1K C;  3SWN A;  1KHC A;  2DKG A;  2HQE A;  2ZPB B;  4KT0 E;  4EMK B;  3FJP A;  3OYG A;  2XID A;  5GAM f;  3G6E A;  2BUD A;  3T9N A;  2LVM A;  4M78 G;  2RJC A;  3CCS T;  4C8Q E;  3MEV A;  3MP6 A;  1I5L A;  1QP3 A;  2CGH A;  4FM4 B;  1VQ5 A;  4M7D A;  4A4H A;  3I55 T;  4ME7 A;  1K8A U;  1X01 A;  3URG A;  5FU6 C;  1RL2 A;  2EIF A;  3CCL A;  2EQK A;  3RER A;  1WJS A;  2LCC A;  1Q81 C;  2O01 E;  5AYF A;  1VQP A;  3GOX A;  1YIT T;  2GF7 A;  1Q7Y C;  3FC3 A;  1M90 C;  3I56 A;  3OBW A;  2CS7 A;  4JLG A;  2E12 A;  2LQK A;  3FRN A;  5LJ3 g;  3NTK A;  3MP1 A;  2KQW A;  3MCA B;  5C0M A;  1UGS B;  3OYY A;  3V7S A;  5GAO r;  2ZPE B;  4M75 F;  3LH0 A;  4FT4 A;  1IZ6 A;  4RCB A;  4BY6 B;  2PVO B;  3HRU A;  1PSF A;  2YLC A;  1XOV A;  5LJ3 f;  4OB3 B;  1BIA A;  1M1F A;  3RKX A;  4C5G A;  3NTH A;  5KH6 A;  2QTX A;  4BD3 A;  2HD0 A;  4QQG A;  4C8Q F;  4EMK C;  1FXX A;  1YIJ T;  1YI2 T;  2NLU A;  2R57 A;  3HP9 A;  4IUV A;  3OA6 A;  1BIB A;  1KC8 U;  4XAX B;  2VUB A;  2YHT A;  4LD6 A;  3P8H A;  3OYN A;  3V7R A;  2QQS A;  4OP0 A;  3QDR B;  3CCS A;  3ME9 A;  4XTW A;  2X4J A;  3X20 B;  2RK2 A;  4E7K A;  1VQO A;  3TU4 K;  1V29 B;  3I55 A;  2A7Y A;  1JRI A;  5GMK j;  3CME T;  3ASK A;  1K8A C;  4C92 G;  1Y96 A;  3OW2 A;  4FSX A;  4XU1 A;  3V8L A;  3M4Y A;  3OYM A;  1YIT A;  2QQA A;  3QYG B;  5HY6 A;  5GAM j;  2EJG A;  3CXC S;  2PUK B;  2WSF E;  4IKF A;  3QHS A;  2XHC A;  4MDW A;  4C92 A;  4R55 A;  4M7D F;  2VGM A;  4EDU A;  3LGL A;  1NE8 A;  2JZ2 A;  4JS4 A;  3LX7 A;  2F5K A;  5GAN 2;  3HKS A;  5FRO A;  5FLX E;  3OY9 A;  4A4G A;  1VQL T;  2CZ1 B;  5IAY A;  4J7F A;  4XQ3 A;  5A2Q E;  3G71 T;  3QZ5 B;  3M4G A;  1BYM A;  1N9R A;  4C0D C;  3LLR A;  4YTL A;  3LYI A;  4L59 A;  5GAN 5;  1YJN T;  3AHU A;  3BFM A;  4D6W A;  3DB4 A;  3WXM B;  3V7C A;  1KQS A;  4LDV A;  4JRI A;  3A8G B;  2QQR A;  4IUP A;  2OAU A;  4M77 G;  5GAN 3;  3SDZ A;  4E7J A;  1YI2 A;  2XI9 A;  5DY9 A;  1RI0 A;  1U1T A;  5CKF A;  3CCE T;  1WJQ A;  4MML A;  3JAM E;  3JSC A;  2L3R A;  4C92 E;  5D6X A;  3OW2 S;  1JJ2 A;  2MWP A;  1XNI A;  2RHI A;  3F70 A;  4C8Q B;  1PSE A;  3M59 A;  5LJ3 j;  3M56 A;  4RCC A;  1YCY A;  1X75 C;  5J3B A;  4EPC A;  5CQY A;  1ZQ1 A;  4A4F A;  2KK4 A;  5GAN 6;  3OYH A;  3CME A;  3C95 A;  5L8R E;  4ELY C;  5GAN d;  5GAN h;  1B34 B;  2M16 A;  3E9G A;  1D3B B;  1Q86 U;  2P0Q A;  2E1H A;  4NOY A;  3VUB A;  2E64 A;  2QQ9 A;  1QVP A;  3QO3 A;  4N4I A;  3JB9 H;  1G3S A;  4IUR A;  1WJR A;  4XTY A;  4B9W A;  3JB9 J;  2MMP A;  3A8M B;  3UPU A;  2AHJ B;  5FRN A;  2DTI A;  4LDY A;  4OF1 A;  3RKY A;  2DZC A;  1VQL A;  4C0Z A;  3G71 A;  4BE0 A;  2R58 A;  2X35 A;  5CAI A;  2FHD A;  2MF2 A;  1KD1 C;  3JCM Q;  4M7D B;  2HBP A;  1YJN A;  4C92 F;  4LDU A;  4PLI A;  4X9C A;  4HT8 A;  4XTX A;  1WGS A;  4M75 C;  4M75 D;  2WSE E;  2A3L A;  4M78 B;  2LTO A;  4E7I A;  2Y4Y A;  3HSB A;  5CVI A;  5HKC A;  1NPR A;  2GFU A;  1OZ2 A;  1D3B A;  4RG8 A;  4OGE A;  4BE1 A;  4MDX A;  4Y28 E;  2RB6 A;  1VQ9 T;  4C8Q C;  2CZ7 B;  4C8Q D;  3CCE A;  3CCM T;  1N8R U;  2ZPF B;  5HK0 A;  3Q1J A;  1K9M U;  3VU3 C;  1BKB A;  4BB7 A;  2RK1 A;  3HFO A;  2JOY A;  5CKE A;  4DOV A;  5KE2 A;  1I4K 1;  1FWZ A;  1W4S A;  3PIP A;  1W2B S;  3JB9 F;  3GLX A;  4BI3 A;  3TEE A;  4PNO A;  4CRI A;  3MO8 A;  5J39 A;  1VIF A;  1XTD A;  5GAO l;  3J80 E;  2PU9 B;  3N5B B;  4P5N A;  2G3R A;  3OYC A;  2K5I A;  3VKI A;  2HQX A;  2DAQ A;  5FU7 B;  5HK3 A;  4BAC A;  1VQO T;  4IUQ A;  3JRZ A;  3OYK A;  2RI5 A;  4JRK A;  2RI2 A;  2EKO A;  4LDX A;  2DD4 A;  3SWN C;  4M78 A;  3VYG A;  3V8J A;  1ZBX A;  1GXI E;  4E7H A;  2E70 A;  2LC4 A;  4MZT A;  2X4Y A;  5J26 A;  2E5Q A;  3L42 A;  1M9S A;  3CCR T;  1LNX A;  2QDY B;  2LT4 A;  4C5E A;  4M7D C;  4M7D D;  4C5I A;  3BW1 A;  3V8K A;  4DA4 A;  4N4H A;  4M7A B;  3BDL A;  2XDB A;  4M7D G;  2KVQ G;  1P92 A;  4OB2 B;  4LDW A;  3JCM d;  4OVA A;  3JCM h;  5GMK h;  3S3M A;  4ZGJ B;  2V8I A;  1JBM A;  1N9S A;  4R56 A;  3CXC A;  3S3N A;  1Y96 B;  3FIF A;  3CCJ T;  1OI1 A;  2RHX A;  3LGF A;  2K57 A;  3UWN A;  2VV5 A;  4M7D E;  4C92 B;  3OMG A;  4M78 E;  3HPW A;  3CCM A;  2R5M A;  3A5Z B;  5GMK e;  3JCM e;  1N8R C;  4M7A G;  3TRE A;  3RKW A;  3VJP A;  4N4G A;  3PGG A;  2LRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...