2IVWA

The solution structure of a domain from the neisseria meningitidis pilp pilot protein.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
113
structure length
113
Chain Sequence
ETDKKGENAPDTKRIKETLEKFSLENMRYVGILKSGQKVSGFIEAEGYVYTVGVGNYLGQNYGRIESITDDSIVLNELIEDSTGNWVSRKAELLLNSSDKNTEQAAAPAAEQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PILP PILOT PROTEIN
publication title The solution structure of a domain from the Neisseria meningitidis lipoprotein PilP reveals a new beta-sandwich fold.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Lipoprotein
total genus 9
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.830 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ivwA01
2LNVA 2IVWA 3OSSC 2Y4YA 2LC4A 2Y4XA
chains in the Genus database with same CATH superfamily
1SKUB 2MMPA 5GANd 1X6OA 5FWBA 3CCLQ 1I81A 4HA8A 4L6V5 3EG9A 2KYBA 2EWNA 1I0CA 3NGPA 1WHJA 1FMWA 2M16A 1NJIR 1D0YA 1UEBA 1C6VX 2XMFA 2EJ9A 4VUBA 2ESWA 5HCKA 2DXCA 1Q7YC 1JJ2P 4F7UA 1VQKQ 1Y96A 4C5EA 3I5RA 3CPWA 4BACA 1WLPB 2AT1B 1QCOA 4M77A 1UHFA 4BB7A 1SRLA 1VQ9A 3S6WA 2FVUA 3JCMJ 3OMGA 2QDLA 2AZVA 2QEXA 4M7AA 4RCCA 4KUDK 3HTRA 1TTHB 1PSEA 3QKJA 2X35A 4C92A 1D1BA 4J9FA 1XNIA 2E6ZA 4JZ4A 2CP2A 1M1FA 3JCMh 3CC7T 2VXFA 5KYXA 1X69A 2PQWA 2E12A 1X6BA 3OYEA 4Z88A 3OW2A 2K5LA 4P5NA 3I55A 4DA4A 5LJ5f 3HRTA 3CCMQ 3CMEQ 2OTLQ 2RMOA 3CCRA 1B7TA 2LTOA 1EFNA 3PNWC 2DK3A 2KBTA 1VQ5Q 4WTOB 2LNVA 3RMQA 4XQ3A 2YUQA 3C4SA 2Z0WA 4IIOA 4EMHA 5GAN7 5A0GA 2DBMA 2LNHB 4J9EA 1BK2A 2QQRA 5FLXE 3CCQT 3AT1B 5CK9A 5KCHA 2ECZA 1VYTA 4CC4B 4E7SA 1VQ8T 2KRNA 3LWHA 2GTOA 2RI5A 4NOYA 4DBRA 1M1KC 3KUFA 3VS2A 2ENMA 2DD4A 2LX9A 1JRIA 3VKIA 2KT8A 1PD0A 3DLLA 2PVOB 5LJ5d 3X25B 3CC4T 3P8BB 2A08A 2JOYA 1D1AA 3CEYA 3VJPA 3G6ET 1Q81C 1WNLA 2LQKA 1O9SA 3OMCA 2QTVA 4HCZA 1Q95G 2DMOA 3CCUQ 1VIEA 1YJ9Q 2RI2A 4AT1B 4PFPA 1K73U 3OA6A 4PJNA 4QVDA 3BE3A 3EGDB 4JJNK 1Q86U 2HBPA 2M02A 3OYBA 2ED1A 3FB9A 4HVUA 3OB9A 4N0AC 4R56A 5J39A 1E7OA 3PMTA 4B9XA 3CXCS 3JSCA 3JB9F 1Y0MA 2EAYA 1YIJQ 3TEEA 2X3WD 4MZPA 3HL8A 1C1AA 2KEAA 2DX1A 2ROLA 2ZCFB 4LDXA 3L2WA 3V8JA 5J26A 1VYVA 1SSFA 2GTJA 1JB0E 1KQSA 3CC7A 3SB2A 3E19A 3ZBDA 3SWNB 3OYGA 1A0NB 2DTOA 4E2FB 1U5SA 1K0XA 5KH6A 3OQ5A 3VV0A 2JMCA 2JW4A 2RA2A 3JAME 1SHFA 2EW3A 2HKQB 4BY6B 1WZOA 1GRIA 2CP0A 4F7UE 2HQXA 1WX6A 1RAEB 4E47A 4BDYA 1UGVA 4M77E 3EGDA 4PJJA 3QIIA 2HQEA 3CCET 2K6DA 4DOWA 1LNXA 2XI9A 3CD6T 5GAOq 4OMMA 2F2VA 2DL4A 1QVGP 3CCQA 3H6ZA 1K0SA 1W2BS 2FO0A 4FW2A 1K73R 2VKNA 4XTXA 4OGEA 3JCMc 1VQLQ 3VS6A 1Q86R 3OSVA 4M7AE 4FT4A 7AT1B 3G71T 3ZFJA 2KK4A 1WA7A 2EYXA 4OGCA 3RERA 1KC8C 4M77D 1N27A 3CC4A 3G6EA 1PRLC 4RTTA 1ZQ1A 3CC2Q 3MCAB 3JB9H 3SWNA 1JBMA 1C0MA 1KHIA 3H0HA 1RABB 2NUPB 2EBPA 5LJ3j 2JTEA 3CBOA 4A4FA 1G83A 4M7AD 2HKNA 1B07A 4FYVB 2L8DA 2DRMA 1LPLA 2LRQA 5CQYA 5ECAA 5IN1A 3E9GA 4PK4A 2DEQA 3OYMA 5IHNA 3SFMA 4RG2A 1VQNT 4RTXA 2WSCE 3M55A 2CDTA 1ZLMA 2L2PA 5LJ3g 1V1CA 3OYKA 3CCJT 1K8AC 4QQGA 2YRDA 4PNOA 2KAFA 2DM1A 4Q5WA 3VYGA 2DZ9A 1TUCA 4N4HA 4XU1A 1MHNA 2EKHA 1YCSB 1EZZB 1FYNA 2L0AA 1YNZA 4MZTA 2ZZDA 4HCKA 1V29B 2CUBA 1M8MA 4C0GA 3FLGA 1VYUA 5KE2A 1MV3A 4DEYA 3PGGA 2ZPGB 1JEGA 2BZXA 4EMKB 2DIGA 4LDUA 3RNJA 2RO0A 4J8OA 4D8DA 4KGXB 2ZPFB 1AD5A 1SHGA 3LYIA 1WIEA 2O2OA 2YUOA 2NUPA 1NLOC 4M7DC 1FX7A 3PE0A 3UDCA 2BUDA 1YJNQ 2QXFA 3CMAQ 2A37A 1TWBA 3U23A 2ZGWA 3EGUA 3I56T 3CCEA 4DBQA 1IXDA 3BFMA 3CD6A 2PZ1A 1UDLA 3IQLA 2DXUA 3JCMW 2EQMA 4F7UG 1YWPA 2YHTA 1ZBJA 4CC7A 3MKDA 1FMVA 3X24B 4J5YA 2QQBA 3G71A 4M77G 2XG8D 2DO3A 4QW2A 1H3HA 4M77F 2RHUA 2SRCA 2LX7A 4J9CA 1R0CB 3UT1A 2J6OA 1QVPA 1N9RA 2AK5A 3UWNA 1PC0A 4RMOA 5LJ3e 4M7AG 5J3BA 1OX8A 2LJ3A 1T3LA 1U06A 1OEBA 4J7FA 2FRYA 5CCAA 4EMKA 1ZSZC 1N8RU 3OYYA 4RTWA 5GANh 4N4IA 4C0DC 5I2MA 3M54A 1VQNA 2X3XD 3M57A 2JS0A 2Y4XA 1X75C 1ZBXA 5CKBA 2YLBA 2QDYB 4O5VA 4PFZA 3CCJA 3LW5E 1RAFB 3GLXA 5GAMf 4RTUA 1VQMT 3UPUA 1NG2A 1D3BB 1VQ4T 1KJWA 2DXTA 2GFAA 1FXXA 1MNEA 2RHZA 5CKEA 1H92A 1I5OB 1VA7A 2QQ9A 4A53A 4F17A 2XD0A 4Y28E 2SEMA 2C0TA 4RUGA 4ZGEB 3NMZC 2FPDA 3NTHA 3X28B 4QT7A 1KSWA 2LZ6B 1SRMA 2COYA 2GQIA 1GBQA 2X4JA 1W70A 3OS1A 2YRVA 2O88A 3EAEA 4KRTA 5C0MA 1K9MC 3TU4K 5KYUB 4EPCA 3I56A 5GAMd 2HD0A 4AMCA 2E3HA 2DA9A 4LN2A 1YI2Q 1I1JA 2XDPA 1AWXA 3L42A 2QA4Q 1SSHA 3MP8A 2HSPA 3V7SA 2GNCA 3D7SB 1N8RR 3R6NA 2CT4A 3BW1A 4NL2A 1D0ZA 3RMSA 3JCMe 1VQ7Q 4IKFA 2HQHA 1D3BA 4F16A 1S72T 2D6FA 1BBZA 1YBYA 2LCCA 6AT1B 1QVFS 4OB2B 2O9SA 2XHCA 2K7AA 4BE1A 1M90C 3A8MB 3C94A 1E6HA 3PTAA 4M7DE 1X2QA 3DB3A 1M2VB 2YT6A 3I35A 8ATCB 1OOTA 4FM4B 3V8KA 2K79A 1WQ7A 4AFUC 1VQ6Q 5GJWB 4PJOE 2FHDA 4J9HA 3JB9J 3META 2OTJQ 2J06A 5LJ5h 2YRCA 4PJMA 4KT0E 2X4YA 2RHXA 4XTVA 3GF5A 1VQPT 2WSFE 2MIOA 3G4SQ 5KYUA 2MPXC 4E6RA 3JCMQ 1VQMA 2A36A 1K1ZA 3G1JA 1FWZA 1N6AA 1YJWQ 4C8QC 1VQ4A 1QKXA 3ZL7C 1QCFA 3ASKA 4JLIA 4KBMB 2CP3A 4M75C 1I8FA 4PJOD 5A0DA 2WSEE 2CGHA 1J3TA 2LP5A 5L8RE 3VU3C 1UGSB 2F1LA 2L3SA 2P0KA 4ZTJA 2COZA 2FPEA 3JB9D 1SPKA 1HXDA 3CXCA 1EIFA 5GAN4 1ARKA 1KG1A 1ZA1B 1JJ2S 2KI7A 3WXMB 1SF9A 2HSEB 3UA6A 3X20B 2E41A 1WDXA 3ME9A 3CCST 1M2VA 3L1AA 4M78C 2G3RA 3QBYA 2LCSA 2P4RA 1D09B 1CSKA 2K4YA 1NBEB 1YHQQ 2EVRA 1OYXA 2B86A 2M0YA 4L59A 4Z02A 1TXQA 4KUIA 1X27A 3S3MA 1H641 1RL2A 1TH7A 1TS9A 3MO8A 2CP6A 3TQ7P 1Q82C 3OSSC 3TVTA 5KYWB 5DLQE 1CKAA 1BYMA 5IAYA 1WHKA 4ZN3A 2C0OA 3M53A 3MP6A 2X51A 4LXCA 4ZN1A 3OS2A 2RK2A 3AHUA 1S72A 4C92C 4YTLA 2KXDA 1BCOA 1TUDA 1ZUUA 3A8HB 3UA7A 5I21A 2ATCB 4BE0A 1NZ9A 4J6YA 1M3CA 2HDAA 2VXEA 2O9VA 4OMOA 3M0SA 4GLKA 2K3XA 2HAXA 2EGCA 4DBFA 2YWWA 2JVVA 2G6FX 2PVDB 2GF7A 1W2BA 1M27C 1M4ZA 2BTTA 1M30A 1OQKA 2EGEA 1VQOT 3CPWP 2DL8A 3QXEB 1VQPA 3NTKA 1M8VA 3OBYA 3UATA 1ABQA 2HEQA 4M7DF 2GGRA 3OYCA 4KGZB 2ED0A 2LT1A 2RN8A 2FRWA 1M5Q1 1O75A 3RESA 2JJ9A 4XK8E 3CCVQ 2BZYA 4QQ6A 5CKFA 5C6SA 3EH2A 4PJOF 3CXCP 2W10A 3QO3A 3EFRA 3EG1A 2H8HA 1NE8A 5KYWA 2CH4A 1G3SA 3F70A 4OB3B 1LCKA 5IHIA 2QYZA 4L5GA 4AFZC 3H41A 3JB9G 2GFUA 1PKTA 5DY9A 4JLGA 4PL6A 2JUFA 2R58A 2VB6A 3M58A 1KD1C 1MMNA 4HXJA 5FROA 1N9SA 3OW2P 4XU2A 1VQ9Q 5AYFA 3CCSA 3WVEB 1BIBA 4AFSC 2DYBA 3BDUA 2RPNA 5AT1B 2YUPA 4OF1A 2C0IA 1AWOA 3CQTA 2OJ2A 4ELYC 4C0ZA 2LVMA 1AWWA 4BI3A 4C8QE 2QEXQ 4QQDA 2VGMA 2JMAA 3H0FA 2EFIA 1QP2A 3S3OA 5D6XA 5CO7A 4F14A 1GFCA 2VWFA 1YP5A 2CS7A 4JPBW 3MEVA 2KT1A 4OMQA 1TU0B 1IZ6A 2QAZA 2YLCA 3P8HA 3QWXX 3A98A 3NFCA 4HKEA 1UHCA 2CYZB 1G3YA 2MWOA 5EG2A 4C5HA 2JNGA 4A63B 4KH1B 3OS5A 3NTIA 3I55Q 1OX9A 1NJIC 1TG0A 3CCRQ 1KFZA 2VYTA 2BKDN 4RCBA 2DD5A 4N4GA 1VQ8A 2E6NA 3VUZA 2NUTB 1AOJA 3VUBA 5FRMA 3HHTB 1WHMA 1EX4A 1VQOA 4E7JA 3H9NA 2DYIA 4XTUA 2AZSA 1QKWA 2V26A 2M9UA 4M7DB 5GAN5 4DBHA 1UGPB 4FIBA 3L2RA 2MOXA 2E70A 2XKOC 2FPFA 3VS4A 4XTYA 1QVGS 5GAOn 1Q7YU 1QP3A 4PJOB 2VV5A 3HRUA 3THKA 5GAOl 2CZ7B 4ORZA 4LD9K 2A3LA 4B9WA 2EPDA 3FRNA 2EJGA 2VC8A 1YJ9T 1K9AA 4IUPA 2WACA 1KQ2A 2DIQA 2F2XA 3CCLT 1HSQA 2BE7D 3KBGA 3G4ST 3PVLA 1KQSP 1K76A 1NEGA 3SWNC 3ER0A 3GNFB 3WVDB 2I2LA 1VQKT 2HZYA 5CIUA 2BIVA 5FU7C 5GANe 2IVWA 5GMKj 1BU1A 5GAN2 2IG0A 3EHQA 3HP9A 5LJ5j 3FJPA 1WHGA 1ZSZB 2FZGB 2NUTA 2RM4A 2L3QA 1U8RA 1CKBA 2JM8A 4C0DB 4LNPA 3JV3A 2M0OA 1ACMB 1GXIE 1Z9ZA 2XU8A 4GLMA 1WPYA 4M7DA 3FJ5A 2D0QB 3TREA 4LUEA 1GCPA 3A8GB 2QI2A 4CC2A 2KNBB 1YCYA 2RH2A 1PKSA 3CC7Q 5LJ5g 4PJOA 2DBKA 2LMJA 5FRNA 3TCJA 4PLLA 3MEAA 5KCOA 2RB6A 2JTMA 5M9OA 4GBQA 4C8QF 5GAMh 1YN8A 3HKSA 3C95A 2LJ1A 2RJFA 4PLIA 5L23A 5GMKl 4M75F 4XTZA 4WCIA 1Q7YR 2MCNA 1QCNA 1B34B 3O5ZA 3CCMT 4OB0B 3EFSA 3CMET 1MNDA 2OTLT 3VS7A 4FYXB 2FZKB 1SG5A 2YUNA 2GQVA 3I9QA 3R6OA 4X9DA 1M1KU 1VQ5T 1BI3A 2XDBA 4II1A 1LJOA 2QASA 3PVQA 1Q81U 5IH2A 1TUGB 3CCQQ 2KGTA 4IUTA 4KULA 1QQJA 4ATOA 3M4GA 2FEIA 5D7UA 1ZSZA 2E65A 4M78F 3REBB 1MMDA 2DF6A 3QHSA 1OZ3A 1PWTA 1QVFA 3T9NA 2CZ0B 2EJFA 3HRSA 4JRIA 1NPRA 3HFOA 2MI6A 1RACB 1YJ9A 3JCMg 3CC4Q 4NL3A 4RTZA 2RQUA 5D6YA 3QWYA 3CCLA 3EGXB 3G6EQ 4IUUA 1ZUYA 1PD1A 3JRZA 3LWIA 2JXBA 4BI8B 4V2SA 1MV0B 2ZPHB 5GAN3 4ZNXA 1KIKA 1LVKA 2LDMA 4FYYB 1IRXA 4E7ZA 1S1NA 2CZ1B 4OMNA 3CCUT 1PHTA 2LQ8A 1VQKA 3JCMV 4HCCA 1IO6A 3OYJA 3MP1A 2O01E 5GMKe 2YSQA 1B34A 3M0QA 1Y07A 3ULRB 2DE0X 1M2OA 4EMKC 4E7HA 4FU6A 5LJ5e 1AZGB 2DPPB 4OB1B 3VS0A 2DJQA 1GCQC 2IIMA 3QJ6A 1P92A 1YIJT 2RJEA 1VIFA 1MMGA 3I5SA 2E5QA 4Y92A 3CPFA 5GAN8 3S3NA 5CKDA 1K73C 4JJCA 2KE9A 3TSWA 1Q86C 1M1KR 1AWJA 2DNUA 4D8KA 3GIBA 2RQRA 1UJYA 5GJVB 2DRKA 1I4K1 2JS2A 4ELZC 2IPOB 3LGFA 2RJDA 4RKUE 4J9DA 2VGNA 4C8QB 4LUDA 3INZA 1UG1A 1JJ2A 4JUVA 2E64A 3QYHB 4E7LA 1Q81R 4A4KA 2EYYA 2ZPIB 4M75B 2CZ6B 2W0ZA 3JCMX 4BE2A 2NUZA 1PNJA 1E6GA 1VUBA 3EGXA 1IREB 1M9SA 2DKGA 2DFUA 3CCMA 3E1SA 4BI4A 3CMEA 2OTLA 4A4EA 1UTIA 3H8ZA 3MHXA 1WXBA 1VQ5A 3RIRA 4RTYA 2JN0A 2RK1A 1KC8U 2HL3A 2KDSA 3CCEQ 2D8HA 3DKMA 2YDLA 1UFFA 3CD6Q 3O8VA 1G2BA 2AKLA 2OAUA 2PTKA 4M78B 1OPLA 4A54A 4IURA 1I5LA 2EYWA 2PUKB 1KK7A 4EIKA 1RADB 4UC4A 2LJ0A 3M4YA 2KYMA 1WGSA 2ZPBB 4FSXA 1BB9A 3J80E 3G71Q 1VQLT 2EQKA 2KR3A 1VOMA 3JB9I 1AEYA 1X6GA 2ZPEB 3V7CA 4BD3A 3OYDA 1GL5A 2E3IA 4DQ2A 2HBWA 2AHJB 4C8QA 3L2ZA 3CC2T 2R5AA 1K8AU 2KRMA 4M75A 2M1HA 3CCUA 2D9TA 4X34A 4M7DD 2QK0A 1W1FA 4ZGDB 4MDXA 1UUEA 4LE9A 3N5BB 2GBQA 4MMKA 2KRSA 3CBMA 3HFNA 3QDRB 1VQNQ 4OMFB 3SDZA 2X9HA 1Y57A 1OU9A 2RF0A 1WI7A 2QQAA 4R0KA 1WHHA 1YIJA 3CCJQ 2K57A 2BZ8A 2RI3A 2CREA 3LLRA 3QZ9B 3URGA 1R0BG 1TOVA 4M78A 2OAWA 2NWMA 3BY7A 1XOVA 3P8DA 1OI1A 4CI0C 2ABLA 4PFOA 4J83A 3M56A 1KC8R 5LJ3f 3PFSA 2X4WA 3VYHB 2CSIA 1ABOA 3KXTA 1PCXA 2LC4A 2V8IA 2EYZA 1TSFA 4A4HA 2COWA 3LH0A 4M77C 2JM9A 3QJYA 5FU6C 1WYXA 4XU0A 4C0FA 3MPUB 1UE9A 2JT4A 1M3AA 4FYWB 3LX7A 3OYFA 1OZ2A 1AZEA 1N5ZA 1K4US 4RG8A 4M7AC 3TSZA 3I56Q 1X43A 3RKXA 4F04B 1YJNT 3CMAT 1ZUKA 2MWPA 3RUXA 1XJWB 3L2QA 1OU8A 1U3OA 5IXBA 1K8AR 3QUIA 1IHVA 2LQNA 2NLUA 4JZ3A 5HY6A 3GP8A 2CT3A 5LJ3d 4PKCC 1VQLA 1BKBA 5CKHA 1G8XA 2CH4W 1KQ1A 2DXBA 1R8OB 1WXTA 3C12A 2Y4YA 3BDLA 4HCBA 2E4HA 5A2QE 2P0PA 1MMAA 4X9CA 4JS5A 3E9FA 3MJXA 4AG1C 5GAMj 2HNIA 3OY9A 4CRIA 1YITQ 3QPHA 3CC2A 5FW9A 1OPKA 2F69A 3G7ZA 4HT9A 2PUOB 4M7DG 2VUBA 4A4GA 1BI1A 2O4XB 3NHNA 2DVJA 3A5ZB 1YFNA 4N0AA 1V76A 5A0LA 1WFWA 5GAOr 4PJOG 3OBWA 2E1HA 2FL7A 1QVGA 4XU3A 3MEUA 5CVIA 5GAMg 4B6MA 3M0UA 3RKYA 2LT4A 2OX7A 1IHWA 1R77A 3RKWA 3CPWS 3JCMf 1AVZC 1VQMQ 2DZCA 4NS5A 4ME7A 1NYFA 1VQ4Q 2K2VA 2QQSA 2DL5A 3VS5A 2Y90A 4JS4A 1N8RC 5GAN6 1WJRA 1BIAA 3L2UA 2E10A 1K9MU 5GANj 3DLMA 2DVEA 4HVVA 4J6XA 1RUWA 1LOJA 2NYSA 1UECA 1BI0A 3M0PA 4QVZA 2D0NA 4JJBA 2P0QA 3QDFA 4Z8AA 1WXUA 4M75E 2MK5A 4J9IA 4KGVB 3OW2S 5GANg 5I2SA 3JCMd 2O4XA 4JRQA 2MAMA 5I22A 2CUDA 1YJNA 4AG2C 3CMAA 5HK0A 5FU7B 1XTDA 1RLQC 2X4XA 3VRYA 4RTVA 1W2BP 1RAGB 1RI0A 1RAHB 4C8QD 1M90U 4R55A 5IT9E 5KYYB 1YI2T 1JU5C 5FWCA 2CSQA 1HK9A 4M75D 2XIDA 1Y7XA 1W4SA 2QA4T 4M78E 2PNIA 3VRZA 4JDSA 1S72Q 2M51A 1Z9QA 4M4ZA 2RHYA 1VQ7T 2EQIA 2K5FA 5GAMe 4GY5A 2PVGB 4EDUA 3SHWA 2H3EB 5DM7R 4ZGJB 2J7IA 3NPFA 1U1SA 2FB7A 1BI2A 4XAXB 1OULA 5IXFA 3A8LB 1B3QA 1WQWA 1HYOA 3FDRA 1UB4A 2RNAA 1OV3A 3A1PA 4M78D 4C92E 5HK3A 4J7IA 5CAIA 3EG2A 1K9MR 2RQWA 1VQ6T 3PIPA 1M1GA 2DTHA 1HD3A 2VVKA 2F5TX 2OTJT 1VQPQ 2V8KA 3M5AA 4FT2A 4AFQC 3LH5A 3EFOB 2KSSA 2EQJA 2R57A 4X1VA 2K5IA 3C0CA 2B8AA 4IUVA 3KFVA 4Y91A 2CP7A 2V1QA 4C92D 1YJWT 1H8KA 2PU9B 5KYYA 4HT8A 4K11A 1PM3A 4ANJA 3DB4A 4BY6C 1JO8A 3LGLA 4JRPA 1G5VA 1JQQA 2XK0A 4JRKA 1NYGA 1M90R 2J05A 2HL5C 3E2UA 2FZCB 1KQSS 5KE3A 1Q82U 2KMTA 3ZEHA 1QLYA 1IB8A 3QSUA 2E5KA 3CCSQ 4OP0A 3VS3A 3QZ5B 2EGAA 2QGGA 1D1CA 2MYSA 5CR2A 2EIFA 4C8QG 3OYLA 1YHQT 1SEMA 1X01A 4C5GA 2DERA 1PG5B 1XQHA 4M75G 4BDZA 2DTIA 1W6XA 1YI2A 2KXCA 3GNGA 3M0TA 2D1XA 4HVWA 3OYAA 5HKCA 3HPWA 2QA4A 1ZX6A 2MF2A 4FSSA 3EFOA 3EH1A 3EG0A 2DILA 3GOXA 2JZ2A 4J6WA 2L3PA 5I11A 4FCYA 4DOVA 4OVAA 1VQ7A 2RQTA 2DETA 4PJOC 3RBBB 2K3BA 2I0NA 4E7IA 1G3TA 4C5IA 2R5MA 4F7UF 4OMPA 2F5KA 2LQWA 1RI9A 4M78G 1VQ8Q 3QYGB 3HSBA 2A28A 4IUQA 1MGQA 4TVRA 3GBQA 4IIMA 3J7AF 1RLPC 1VQ6A 4LDYA 1VQOQ 1QWEA 2OTJA 1PRMC 2QG9B 3REAB 3M0RA 5CQXA 2J6KA 1YITT 2CP5A 3QG1A 1UGQB 1IGQA 2EKOA 3VS1A 2RJCA 3RDVA 3G4SA 4M7AF 4ZTFA 1Q82R 3GPLA 3OYIA 2KY9A 4O6JA 4C92G 1KD1U 2K2MA 4C92F 2JTFA 3OYNA 1QMCA 3PMIA 5EC7A 2DL7A 4D6WA 1YJWA 3OYHA 3H0IA 4BUGA 3CCVT 3V7RA 1GCQA 4WF2A 3A8OB 3M59A 1NM7A 3X26B 2K3YA 3SD4A 4QVCA 2HMAA 3OS0A 2CKKA 2XICA 2VASA 3RR6A 1NLPC 5GAOm 2ZAEA 1UJ0A 2DAQA 1KHCA 1T0JA 2L3RA 2K9GA 4JJDA 2ROTA 3SEMA 3M9QA 2FG0A 2DJZA 4FW1A 1G3WA 2KVQG 3EG3A 3FC3A 8AT1B 2A0FB 1HJDA 1UGRB 2DLPA 4KH0B 3JCMb 2BE9B 1I07A 4DEXA 1PSFA 2DL3A 1VQ9T 1GBRA 2FYKA 2KQWA 1MUZA 3UF4A 1RAIB 2EYQA 2DEUA 1YHQA 1U1TA 1X2KA 5DLOA 3FEOA 1NJIU 3MEWA 1NEBA 2QEXT 1D0XA 1ZHIA 5D6WA 5GAOp 2A7YA 1QW1A 3EG9B 4EMGA 4LDVA 1BCMA 1WJQA 2HCKA 1NPPA 1F1BB 2RQVA 4MZMA 3EHRA 4OMLA 1T3SA 1H3ZA 2QGFB 1YWOA 2L5QA 1QVFP 4F7UB 1WHLA 1Y96B 2V8JA 2RHIA 5GANf 1GFDA 2AIRB 2V1RA 5LL6S 4XTWA 3I55T 1M3BA 1QWFA 2P84A 2F2WA 3L2VA 3CBPA 2XDDA 4LDWA 1KD1R 1ZA2B 4FL6A 3Q1JA 2AKKA 4M77B 5LJ3h 3CCRT 4E7KA 2D8JA 4QKUA 1AT1B 5FU6B 1WJSA 5GMKm 5IHKA 2LCLA 2EQUA 1AHJB 1T0HA 5GMKi 9ATCB 2H3JA 2RD1A 2GCXA 3JCMP 3PT9A 1ZSGA 1RAAB 3V8LA 1DJ7B 4Z89A 2KROA 3PIOA 1YITA 4M7AB 4J9BA 2P4TA 2O31A 1FMKA 5KYNA 4C92B 2OI3A 4PJLA 3J81E 4MDWA 2YXYA 4J9GA 1JXOA 2C06A 4LD6A 1Y71A 4ESRA 3FIFA 1IGUA 2L89A 4MMLA 2QTXA 2J6FA 5GMKh 5KYXB 3CCVA 1JXMA 4CC3A
chains in the Genus database with same CATH topology
2MMPA 3FRNA 4PJOG 3OBWA 2EJGA 1X6OA 2E1HA 2FL7A 3OYYA 5GANd 2VC8A 5GANh 1N8RU 1YJ9T 4N4IA 1QVGA 4XU3A 4IUPA 2WACA 1I81A 3MEUA 4HA8A 4C0DC 4L6V5 1KQ2A 5CVIA 5GAMg 5I2MA 2DIQA 3RKYA 3CCLT 3M54A 2EWNA 1VQNA 3M57A 2LT4A 2Y4XA 2M16A 3RKWA 3CPWS 1X75C 1ZBXA 5CKBA 3JCMf 1UEBA 3KBGA 2YLBA 3G4ST 2QDYB 4O5VA 2DZCA 2EJ9A 4NS5A 4VUBA 3CCJA 3LW5E 3GLXA 4ME7A 2DXCA 5GAMf 1VQMT 4F7UA 1Q7YC 1Y96A 2K2VA 3UPUA 3SWNC 2QQSA 3ER0A 1D3BB 3GNFB 3WVDB 2I2LA 4C5EA 3CPWA 2DXTA 1VQ4T 1VQKT 2GFAA 4BACA 5CIUA 2BIVA 2Y90A 5FU7C 4JS4A 5GANe 2IVWA 1N8RC 5GMKj 5GAN6 1WJRA 1BIAA 4M77A 1FXXA 3L2UA 2E10A 4BB7A 5GAN2 2IG0A 5GANj 1K9MU 2RHZA 1VQ9A 3DLMA 2DVEA 3HP9A 5LJ5j 3FJPA 4J6XA 1LOJA 5CKEA 3S6WA 1BI0A 2FVUA 2RM4A 2QQ9A 4QVZA 1U8RA 4A53A 2XD0A 4C0DB 3JCMJ 3OMGA 4Y28E 4C92E 2P0QA 2QEXA 2M0OA 1GXIE 2XU8A 4ZGEB 1WPYA 4M7DA 3NTHA 3X28B 2D0QB 4M75E 3TREA 4M7AA 4RCCA 3A8GB 4KUDK 2QI2A 1PSEA 3QKJA 2X35A 4C92A 3OW2S 1YCYA 5GANg 5I2SA 2RH2A 1XNIA 2X4JA 3OS1A 2E6ZA 2YRVA 5LJ5g 4PJOA 3JCMd 2O4XA 1M1FA 3JCMh 4JRQA 2MAMA 3EAEA 5C0MA 3CC7T 1K9MC 2VXFA 3TCJA 3TU4K 5FRNA 4PLLA 3MEAA 5KCOA 2RB6A 3OYMA 2PQWA 2JTMA 3CMAA 2E12A 4EPCA 5HK0A 5FU7B 5M9OA 5GAMd 3OYEA 3I56A 4C8QF 5GAMh 2HD0A 3OW2A 1XTDA 2K5LA 2X4XA 3C95A 3HKSA 4P5NA 2RJFA 3I55A 4PLIA 5GMKl 4M75F 4XTZA 1RI0A 4DA4A 1M90U 4C8QD 2XDPA 5LJ5f 3HRTA 4R55A 3CCUA 5IT9E 1YI2T 1B34B 3CCRA 1HK9A 3CCMT 3L42A 4M75D 4OB0B 2LTOA 3EFSA 3CMET 2XIDA 2OTLT 1Y7XA 3MP8A 3PNWC 1W4SA 2DK3A 3V7SA 2QA4T 4M78E 3OYIA 2GQVA 3BW1A 3R6OA 4X9DA 4JDSA 1M1KU 1VQ5T 2LNVA 3RMQA 4NL2A 4XQ3A 1BI3A 3RMSA 3JCMe 4IKFA 2XDBA 4II1A 1LJOA 1D3BA 1S72T 2D6FA 3C4SA 2RHYA 1VQ7T 4EMHA 5GAN7 2K5FA 5A0GA 5GAMe 4GY5A 1Q81U 1YBYA 2LCCA 2PVGB 4EDUA 1QVFS 2QQRA 5FLXE 4OB2B 2XHCA 5DM7R 4ZGJB 4IUTA 4KULA 4BE1A 3M4GA 4ATOA 1M90C 3CCQT 3A8MB 3C94A 5CK9A 2E65A 5KCHA 1U1SA 2FB7A 3PTAA 4M78F 1BI2A 4XAXB 4M7DE 3QHSA 3A8LB 3DB3A 1WQWA 1OZ3A 1VQ8T 3FDRA 1QVFA 3LWHA 1UB4A 2RI5A 4FM4B 4M78D 2CZ0B 2EJFA 4NOYA 3T9NA 3HRSA 3V8KA 1WQ7A 1NPRA 3HFOA 2MI6A 4JRIA 4J7IA 5HK3A 1M1KC 3KUFA 1YJ9A 5CAIA 3JCMg 4PJOE 2FHDA 2DD4A 2LX9A 1JRIA 3META 3VKIA 4NL3A 5D6YA 3PIPA 3DLLA 2PVOB 5LJ5d 3X25B 3CCLA 1M1GA 5LJ5h 2DTHA 3CC4T 3P8BB 2F5TX 4IUUA 2JOYA 2OTJT 3CEYA 4KT0E 2V8KA 3M5AA 3VJPA 3G6ET 1Q81C 1WNLA 2RHXA 2X4YA 2LQKA 3GF5A 1O9SA 3JRZA 4XTVA 4BI8B 5GAN3 2ZPHB 3LWIA 4FT2A 2WSFE 1VQPT 4V2SA 3OMCA 2LDMA 2KSSA 4HCZA 2EQJA 2R57A 1VIEA 3JCMQ 1VQMA 2K5IA 2RI2A 1FWZA 1N6AA 2CZ1B 2B8AA 3CCUT 1K73U 3OA6A 2LQ8A 4IUVA 4C8QC 3JCMV 1VQ4A 4Y91A 4QVDA 1VQKA 4HCCA 4JJNK 3OYJA 3ASKA 3MP1A 4JLIA 2HBPA 2O01E 4KBMB 4C92D 1YJWT 1Q86U 5GMKe 2PU9B 5GMKi 4M75C 3OYBA 3FB9A 4HT8A 3OB9A 1I8FA 1B34A 4PJOD 1Y07A 5A0DA 2WSEE 2CGHA 3X26B 4EMKC 4N0AC 4R56A 5J39A 4B9XA 3PMTA 5L8RE 3CXCS 4FU6A 5LJ5e 4E7HA 3DB4A 3VU3C 2DPPB 1UGSB 3JSCA 4BY6C 3LGLA 4OB1B 3JB9F 4JRPA 2P0KA 4ZTJA 1G5VA 2EAYA 3QJ6A 1P92A 3TEEA 2XK0A 4MZPA 4JRKA 3JB9D 3HL8A 1YIJT 2RJEA 1HXDA 1VIFA 3CXCA 1EIFA 5GAN4 2E5QA 1KG1A 3CPFA 1KQSS 5KE3A 1Q82U 5GAN8 3S3NA 2KMTA 3ZEHA 5CKDA 1K73C 1JJ2S 2ZCFB 4LDXA 3WXMB 3L2WA 3V8JA 1Q86C 3QSUA 3GIBA 5J26A 3X20B 1SSFA 1I4K1 4ELZC 3LGFA 2RJDA 4OP0A 2E41A 3QZ5B 3ME9A 1JB0E 4RKUE 1KQSA 4M7DD 2VGNA 3CC7A 3SB2A 3CCST 4C8QB 3E19A 3L1AA 4M78C 2G3RA 3ZBDA 3SWNB 1YJNA 3QBYA 3INZA 3OYGA 1JJ2A 4JUVA 2DTOA 2E64A 3QYHB 2K4YA 4E7LA 4A4KA 4M75B 2ZPIB 5KH6A 5CR2A 2CZ6B 3OQ5A 3VV0A 2EIFA 4C8QG 3OYLA 1OYXA 2RA2A 3JAME 1YHQT 3JCMX 4BE2A 1X01A 4L59A 4C5GA 4BY6B 1VUBA 1XQHA 4M75G 4BDZA 2DTIA 4Z02A 1IREB 1YI2A 1M9SA 2DKGA 3GNGA 4KUIA 3S3MA 1H641 1RL2A 1TH7A 3E1SA 3MO8A 4BI4A 3CMEA 3CCMA 3OSSC 1Q82C 2OTLA 4A4EA 5DLQE 4F7UE 3OYAA 5HKCA 1BYMA 3HPWA 2HQXA 3H8ZA 5IAYA 2QA4A 3MHXA 4ZN3A 2MF2A 1VQ5A 3M53A 2JZ2A 3MP6A 4J6WA 3GOXA 3RIRA 4ZN1A 2JN0A 2RK1A 3OS2A 2RK2A 4E47A 4BDYA 1S72A 4C92C 2KDSA 4DOVA 1KC8U 4OVAA 4YTLA 4M77E 1VQ7A 3QIIA 3DKMA 4PJOC 2HQEA 3O8VA 3CCET 4DOWA 4E7IA 3A8HB 1LNXA 1G3TA 2XI9A 4C5IA 2OAUA 5I21A 3CD6T 5GAOq 4BE0A 1VQ6T 4M78B 4A54A 4IURA 3CCQA 2R5MA 4F7UF 3H6ZA 1I5LA 1NZ9A 4J6YA 1W2BS 2PUKB 2F5KA 2VXEA 4UC4A 4M78G 4XTXA 4GLKA 3M4YA 2K3XA 4OGEA 1WGSA 3JCMc 2HAXA 2ZPBB 3QYGB 4FSXA 3HSBA 3OSVA 3J80E 4M7AE 1VQLT 4IUQA 1MGQA 4FT4A 4TVRA 2JVVA 2EQKA 2PVDB 2GF7A 3G71T 3J7AF 3ZFJA 2KK4A 1W2BA 3JB9I 1VQ6A 4LDYA 1M4ZA 2ZPEB 3V7CA 4OGCA 4BD3A 3OYDA 4M77D 1KC8C 3RERA 1N27A 3CC4A 1VQOT 3JB9J 2OTJA 4DQ2A 3G6EA 3QXEB 1VQPA 2AHJB 1ZQ1A 5CQXA 1YITT 3MCAB 3QG1A 3JB9H 1UGQB 4C8QA 3NTKA 2EKOA 1M8VA 3L2ZA 3OBYA 3SWNA 3CC2T 4M7DF 1JBMA 1KHIA 2R5AA 2RJCA 3OYCA 3G4SA 4M7AF 1K8AU 2LT1A 4M75A 4ZTFA 3GPLA 1M5Q1 2M1HA 2KY9A 2D9TA 4O6JA 4X34A 1O75A 3RESA 3CBOA 4XK8E 4C92F 4C92G 5LJ3j 1KD1U 4A4FA 2JTFA 4QQ6A 4ZGDB 3PMIA 3OYNA 4M7AD 4D6WA 1YJWA 5CKFA 5C6SA 4MDXA 4PJOF 3OYHA 4BUGA 2L8DA 3CCVT 2LRQA 3QO3A 3V7RA 3EFRA 4WF2A 5CQYA 3N5BB 1NE8A 4MMKA 5IN1A 3E9GA 3A8OB 3CBMA 3HFNA 2DEQA 3M59A 1G3SA 2K3YA 3F70A 3QDRB 4OB3B 4OMFB 3SD4A 3SDZA 4QVCA 3OS0A 2CKKA 3SFMA 4RG2A 2XICA 4L5GA 1VQNT 2WSCE 5GAOm 3JB9G 2QQAA 3M55A 2DAQA 2GFUA 1KHCA 5DY9A 1YIJA 2L3RA 4JLGA 4PL6A 2JUFA 2K57A 5LJ3g 2RI3A 2R58A 3OYKA 3LLRA 3M9QA 3QZ9B 3CCJT 1K8AC 3URGA 4QQGA 2DJZA 3M58A 4PNOA 1G3WA 2KAFA 1KD1C 2KVQG 4Q5WA 3VYGA 2DZ9A 4M78A 1N9SA 5FROA 3BY7A 1XOVA 3P8DA 1OI1A 4CI0C 4N4HA 3FC3A 4XU2A 4XU1A 1UGRB 1MHNA 4J83A 3M56A 3JCMb 5LJ3f 3PFSA 5AYFA 3CCSA 2X4WA 1PSFA 4MZTA 1BIBA 2ZZDA 3VYHB 3BDUA 3WVEB 1VQ9T 3KXTA 1V29B 2FYKA 2LC4A 2V8IA 4OF1A 2KQWA 4A4HA 4C0GA 3FLGA 3LH0A 5KE2A 4M77C 2EYQA 4ELYC 4C0ZA 2LVMA 1YHQA 1U1TA 4BI3A 4C8QE 3FEOA 5DLOA 1NJIU 4QQDA 3PGGA 2VGMA 2ZPGB 3QJYA 4EMKB 2DIGA 4LDUA 5FU6C 3MEWA 2QEXT 2RO0A 2EFIA 4J8OA 4XU0A 3VUZA 4C0FA 1QP2A 3S3OA 5D6XA 5CO7A 2CS7A 2ZPFB 1ZHIA 5D6WA 5GAOp 5GAOr 2A7YA 1QW1A 3MEVA 4EMGA 4LDVA 3LYIA 3LX7A 1WJQA 3OYFA 1IZ6A 1NPPA 1OZ2A 2YLCA 3P8HA 4M7DC 1FX7A 4RG8A 4MZMA 3UDCA 4M7AC 2BUDA 3NFCA 2QXFA 4HKEA 2ZGWA 2CYZB 3RKXA 1YJNT 1H3ZA 3CMAT 1G3YA 2MWOA 2L5QA 5EG2A 4C5HA 3I56T 3CCEA 2JNGA 3OS5A 2MWPA 1Y96B 3NTIA 2V8JA 2RHIA 4F7UB 5GANf 3BFMA 3CD6A 5LL6S 3RUXA 4XTWA 3I55T 1NJIC 3L2QA 2DXUA 3L2VA 3JCMW 2EQMA 3CBPA 3QUIA 2NLUA 4F7UG 2XDDA 5HY6A 4LDWA 3GP8A 2YHTA 5LJ3d 4FL6A 3Q1JA 4M77B 5LJ3h 3CCRT 4E7KA 2VYTA 4PKCC 2BKDN 4RCBA 3X24B 4J5YA 1VQLA 2DD5A 1BKBA 4N4GA 5CKHA 1VQ8A 2E6NA 2QQBA 1WJSA 5FU6B 5GMKm 3AHUA 1KQ1A 3G71A 2LCLA 2DXBA 1AHJB 2DO3A 2EQUA 2XG8D 2RHUA 1R8OB 3C12A 4M77G 4M77F 4QW2A 3VUBA 2H3JA 2Y4YA 2RD1A 2GCXA 3BDLA 3HHTB 4HCBA 5FRMA 3JCMP 3PT9A 5A2QE 2P0PA 4X9CA 1VQOA 3V8LA 4JS5A 4E7JA 4XTUA 3E9FA 1DJ7B 2M9UA 5GAMj 4M7DB 5GAN5 2HNIA 3OY9A 4CRIA 3PIOA 1YITA 5A0LA 4M7AB 1UGPB 3UT1A 2P4TA 4FIBA 3QPHA 3L2RA 1QVPA 2E70A 3CC2A 1N9RA 2XKOC 2F69A 3G7ZA 3UWNA 4C92B 4XTYA 4HT9A 2PUOB 3J81E 2VUBA 4MDWA 4A4GA 1QVGS 5GAOn 4M7DG 1Q7YU 4RMOA 1QP3A 1BI1A 5LJ3e 2C06A 4LD6A 1Y71A 5J3BA 4M7AG 2O4XB 4PJOB 2VV5A 3FIFA 3HRUA 2L89A 4J7FA 4MMLA 2QTXA 3A5ZB 5CCAA 5GAOl 2CZ7B 4EMKA 5GMKh 4N0AA 3CCVA 4LD9K 2A3LA 4B9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNV A;  2IVW A;  3OSS C;  2Y4Y A;  2LC4 A;  2Y4X A; 
#chains in the Genus database with same CATH topology
 1SKU B;  2MMP A;  5GAN d;  1X6O A;  5FWB A;  3CCL Q;  1I81 A;  4HA8 A;  4L6V 5;  3EG9 A;  2KYB A;  2EWN A;  1I0C A;  3NGP A;  1WHJ A;  1FMW A;  2M16 A;  1NJI R;  1D0Y A;  1UEB A;  1C6V X;  2XMF A;  2EJ9 A;  4VUB A;  2ESW A;  5HCK A;  2DXC A;  1Q7Y C;  1JJ2 P;  4F7U A;  1VQK Q;  1Y96 A;  4C5E A;  3I5R A;  3CPW A;  4BAC A;  1WLP B;  2AT1 B;  1QCO A;  4M77 A;  1UHF A;  4BB7 A;  1SRL A;  1VQ9 A;  3S6W A;  2FVU A;  3JCM J;  3OMG A;  2QDL A;  2AZV A;  2QEX A;  4M7A A;  4RCC A;  4KUD K;  3HTR A;  1TTH B;  1PSE A;  3QKJ A;  2X35 A;  4C92 A;  1D1B A;  4J9F A;  1XNI A;  2E6Z A;  4JZ4 A;  2CP2 A;  1M1F A;  3JCM h;  3CC7 T;  2VXF A;  5KYX A;  1X69 A;  2PQW A;  2E12 A;  1X6B A;  3OYE A;  4Z88 A;  3OW2 A;  2K5L A;  4P5N A;  3I55 A;  4DA4 A;  5LJ5 f;  3HRT A;  3CCM Q;  3CME Q;  2OTL Q;  2RMO A;  3CCR A;  1B7T A;  2LTO A;  1EFN A;  3PNW C;  2DK3 A;  2KBT A;  1VQ5 Q;  4WTO B;  2LNV A;  3RMQ A;  4XQ3 A;  2YUQ A;  3C4S A;  2Z0W A;  4IIO A;  4EMH A;  5GAN 7;  5A0G A;  2DBM A;  2LNH B;  4J9E A;  1BK2 A;  2QQR A;  5FLX E;  3CCQ T;  3AT1 B;  5CK9 A;  5KCH A;  2ECZ A;  1VYT A;  4CC4 B;  4E7S A;  1VQ8 T;  2KRN A;  3LWH A;  2GTO A;  2RI5 A;  4NOY A;  4DBR A;  1M1K C;  3KUF A;  3VS2 A;  2ENM A;  2DD4 A;  2LX9 A;  1JRI A;  3VKI A;  2KT8 A;  1PD0 A;  3DLL A;  2PVO B;  5LJ5 d;  3X25 B;  3CC4 T;  3P8B B;  2A08 A;  2JOY A;  1D1A A;  3CEY A;  3VJP A;  3G6E T;  1Q81 C;  1WNL A;  2LQK A;  1O9S A;  3OMC A;  2QTV A;  4HCZ A;  1Q95 G;  2DMO A;  3CCU Q;  1VIE A;  1YJ9 Q;  2RI2 A;  4AT1 B;  4PFP A;  1K73 U;  3OA6 A;  4PJN A;  4QVD A;  3BE3 A;  3EGD B;  4JJN K;  1Q86 U;  2HBP A;  2M02 A;  3OYB A;  2ED1 A;  3FB9 A;  4HVU A;  3OB9 A;  4N0A C;  4R56 A;  5J39 A;  1E7O A;  3PMT A;  4B9X A;  3CXC S;  3JSC A;  3JB9 F;  1Y0M A;  2EAY A;  1YIJ Q;  3TEE A;  2X3W D;  4MZP A;  3HL8 A;  1C1A A;  2KEA A;  2DX1 A;  2ROL A;  2ZCF B;  4LDX A;  3L2W A;  3V8J A;  5J26 A;  1VYV A;  1SSF A;  2GTJ A;  1JB0 E;  1KQS A;  3CC7 A;  3SB2 A;  3E19 A;  3ZBD A;  3SWN B;  3OYG A;  1A0N B;  2DTO A;  4E2F B;  1U5S A;  1K0X A;  5KH6 A;  3OQ5 A;  3VV0 A;  2JMC A;  2JW4 A;  2RA2 A;  3JAM E;  1SHF A;  2EW3 A;  2HKQ B;  4BY6 B;  1WZO A;  1GRI A;  2CP0 A;  4F7U E;  2HQX A;  1WX6 A;  1RAE B;  4E47 A;  4BDY A;  1UGV A;  4M77 E;  3EGD A;  4PJJ A;  3QII A;  2HQE A;  3CCE T;  2K6D A;  4DOW A;  1LNX A;  2XI9 A;  3CD6 T;  5GAO q;  4OMM A;  2F2V A;  2DL4 A;  1QVG P;  3CCQ A;  3H6Z A;  1K0S A;  1W2B S;  2FO0 A;  4FW2 A;  1K73 R;  2VKN A;  4XTX A;  4OGE A;  3JCM c;  1VQL Q;  3VS6 A;  1Q86 R;  3OSV A;  4M7A E;  4FT4 A;  7AT1 B;  3G71 T;  3ZFJ A;  2KK4 A;  1WA7 A;  2EYX A;  4OGC A;  3RER A;  1KC8 C;  4M77 D;  1N27 A;  3CC4 A;  3G6E A;  1PRL C;  4RTT A;  1ZQ1 A;  3CC2 Q;  3MCA B;  3JB9 H;  3SWN A;  1JBM A;  1C0M A;  1KHI A;  3H0H A;  1RAB B;  2NUP B;  2EBP A;  5LJ3 j;  2JTE A;  3CBO A;  4A4F A;  1G83 A;  4M7A D;  2HKN A;  1B07 A;  4FYV B;  2L8D A;  2DRM A;  1LPL A;  2LRQ A;  5CQY A;  5ECA A;  5IN1 A;  3E9G A;  4PK4 A;  2DEQ A;  3OYM A;  5IHN A;  3SFM A;  4RG2 A;  1VQN T;  4RTX A;  2WSC E;  3M55 A;  2CDT A;  1ZLM A;  2L2P A;  5LJ3 g;  1V1C A;  3OYK A;  3CCJ T;  1K8A C;  4QQG A;  2YRD A;  4PNO A;  2KAF A;  2DM1 A;  4Q5W A;  3VYG A;  2DZ9 A;  1TUC A;  4N4H A;  4XU1 A;  1MHN A;  2EKH A;  1YCS B;  1EZZ B;  1FYN A;  2L0A A;  1YNZ A;  4MZT A;  2ZZD A;  4HCK A;  1V29 B;  2CUB A;  1M8M A;  4C0G A;  3FLG A;  1VYU A;  5KE2 A;  1MV3 A;  4DEY A;  3PGG A;  2ZPG B;  1JEG A;  2BZX A;  4EMK B;  2DIG A;  4LDU A;  3RNJ A;  2RO0 A;  4J8O A;  4D8D A;  4KGX B;  2ZPF B;  1AD5 A;  1SHG A;  3LYI A;  1WIE A;  2O2O A;  2YUO A;  2NUP A;  1NLO C;  4M7D C;  1FX7 A;  3PE0 A;  3UDC A;  2BUD A;  1YJN Q;  2QXF A;  3CMA Q;  2A37 A;  1TWB A;  3U23 A;  2ZGW A;  3EGU A;  3I56 T;  3CCE A;  4DBQ A;  1IXD A;  3BFM A;  3CD6 A;  2PZ1 A;  1UDL A;  3IQL A;  2DXU A;  3JCM W;  2EQM A;  4F7U G;  1YWP A;  2YHT A;  1ZBJ A;  4CC7 A;  3MKD A;  1FMV A;  3X24 B;  4J5Y A;  2QQB A;  3G71 A;  4M77 G;  2XG8 D;  2DO3 A;  4QW2 A;  1H3H A;  4M77 F;  2RHU A;  2SRC A;  2LX7 A;  4J9C A;  1R0C B;  3UT1 A;  2J6O A;  1QVP A;  1N9R A;  2AK5 A;  3UWN A;  1PC0 A;  4RMO A;  5LJ3 e;  4M7A G;  5J3B A;  1OX8 A;  2LJ3 A;  1T3L A;  1U06 A;  1OEB A;  4J7F A;  2FRY A;  5CCA A;  4EMK A;  1ZSZ C;  1N8R U;  3OYY A;  4RTW A;  5GAN h;  4N4I A;  4C0D C;  5I2M A;  3M54 A;  1VQN A;  2X3X D;  3M57 A;  2JS0 A;  2Y4X A;  1X75 C;  1ZBX A;  5CKB A;  2YLB A;  2QDY B;  4O5V A;  4PFZ A;  3CCJ A;  3LW5 E;  1RAF B;  3GLX A;  5GAM f;  4RTU A;  1VQM T;  3UPU A;  1NG2 A;  1D3B B;  1VQ4 T;  1KJW A;  2DXT A;  2GFA A;  1FXX A;  1MNE A;  2RHZ A;  5CKE A;  1H92 A;  1I5O B;  1VA7 A;  2QQ9 A;  4A53 A;  4F17 A;  2XD0 A;  4Y28 E;  2SEM A;  2C0T A;  4RUG A;  4ZGE B;  3NMZ C;  2FPD A;  3NTH A;  3X28 B;  4QT7 A;  1KSW A;  2LZ6 B;  1SRM A;  2COY A;  2GQI A;  1GBQ A;  2X4J A;  1W70 A;  3OS1 A;  2YRV A;  2O88 A;  3EAE A;  4KRT A;  5C0M A;  1K9M C;  3TU4 K;  5KYU B;  4EPC A;  3I56 A;  5GAM d;  2HD0 A;  4AMC A;  2E3H A;  2DA9 A;  4LN2 A;  1YI2 Q;  1I1J A;  2XDP A;  1AWX A;  3L42 A;  2QA4 Q;  1SSH A;  3MP8 A;  2HSP A;  3V7S A;  2GNC A;  3D7S B;  1N8R R;  3R6N A;  2CT4 A;  3BW1 A;  4NL2 A;  1D0Z A;  3RMS A;  3JCM e;  1VQ7 Q;  4IKF A;  2HQH A;  1D3B A;  4F16 A;  1S72 T;  2D6F A;  1BBZ A;  1YBY A;  2LCC A;  6AT1 B;  1QVF S;  4OB2 B;  2O9S A;  2XHC A;  2K7A A;  4BE1 A;  1M90 C;  3A8M B;  3C94 A;  1E6H A;  3PTA A;  4M7D E;  1X2Q A;  3DB3 A;  1M2V B;  2YT6 A;  3I35 A;  8ATC B;  1OOT A;  4FM4 B;  3V8K A;  2K79 A;  1WQ7 A;  4AFU C;  1VQ6 Q;  5GJW B;  4PJO E;  2FHD A;  4J9H A;  3JB9 J;  3MET A;  2OTJ Q;  2J06 A;  5LJ5 h;  2YRC A;  4PJM A;  4KT0 E;  2X4Y A;  2RHX A;  4XTV A;  3GF5 A;  1VQP T;  2WSF E;  2MIO A;  3G4S Q;  5KYU A;  2MPX C;  4E6R A;  3JCM Q;  1VQM A;  2A36 A;  1K1Z A;  3G1J A;  1FWZ A;  1N6A A;  1YJW Q;  4C8Q C;  1VQ4 A;  1QKX A;  3ZL7 C;  1QCF A;  3ASK A;  4JLI A;  4KBM B;  2CP3 A;  4M75 C;  1I8F A;  4PJO D;  5A0D A;  2WSE E;  2CGH A;  1J3T A;  2LP5 A;  5L8R E;  3VU3 C;  1UGS B;  2F1L A;  2L3S A;  2P0K A;  4ZTJ A;  2COZ A;  2FPE A;  3JB9 D;  1SPK A;  1HXD A;  3CXC A;  1EIF A;  5GAN 4;  1ARK A;  1KG1 A;  1ZA1 B;  1JJ2 S;  2KI7 A;  3WXM B;  1SF9 A;  2HSE B;  3UA6 A;  3X20 B;  2E41 A;  1WDX A;  3ME9 A;  3CCS T;  1M2V A;  3L1A A;  4M78 C;  2G3R A;  3QBY A;  2LCS A;  2P4R A;  1D09 B;  1CSK A;  2K4Y A;  1NBE B;  1YHQ Q;  2EVR A;  1OYX A;  2B86 A;  2M0Y A;  4L59 A;  4Z02 A;  1TXQ A;  4KUI A;  1X27 A;  3S3M A;  1H64 1;  1RL2 A;  1TH7 A;  1TS9 A;  3MO8 A;  2CP6 A;  3TQ7 P;  1Q82 C;  3OSS C;  3TVT A;  5KYW B;  5DLQ E;  1CKA A;  1BYM A;  5IAY A;  1WHK A;  4ZN3 A;  2C0O A;  3M53 A;  3MP6 A;  2X51 A;  4LXC A;  4ZN1 A;  3OS2 A;  2RK2 A;  3AHU A;  1S72 A;  4C92 C;  4YTL A;  2KXD A;  1BCO A;  1TUD A;  1ZUU A;  3A8H B;  3UA7 A;  5I21 A;  2ATC B;  4BE0 A;  1NZ9 A;  4J6Y A;  1M3C A;  2HDA A;  2VXE A;  2O9V A;  4OMO A;  3M0S A;  4GLK A;  2K3X A;  2HAX A;  2EGC A;  4DBF A;  2YWW A;  2JVV A;  2G6F X;  2PVD B;  2GF7 A;  1W2B A;  1M27 C;  1M4Z A;  2BTT A;  1M30 A;  1OQK A;  2EGE A;  1VQO T;  3CPW P;  2DL8 A;  3QXE B;  1VQP A;  3NTK A;  1M8V A;  3OBY A;  3UAT A;  1ABQ A;  2HEQ A;  4M7D F;  2GGR A;  3OYC A;  4KGZ B;  2ED0 A;  2LT1 A;  2RN8 A;  2FRW A;  1M5Q 1;  1O75 A;  3RES A;  2JJ9 A;  4XK8 E;  3CCV Q;  2BZY A;  4QQ6 A;  5CKF A;  5C6S A;  3EH2 A;  4PJO F;  3CXC P;  2W10 A;  3QO3 A;  3EFR A;  3EG1 A;  2H8H A;  1NE8 A;  5KYW A;  2CH4 A;  1G3S A;  3F70 A;  4OB3 B;  1LCK A;  5IHI A;  2QYZ A;  4L5G A;  4AFZ C;  3H41 A;  3JB9 G;  2GFU A;  1PKT A;  5DY9 A;  4JLG A;  4PL6 A;  2JUF A;  2R58 A;  2VB6 A;  3M58 A;  1KD1 C;  1MMN A;  4HXJ A;  5FRO A;  1N9S A;  3OW2 P;  4XU2 A;  1VQ9 Q;  5AYF A;  3CCS A;  3WVE B;  1BIB A;  4AFS C;  2DYB A;  3BDU A;  2RPN A;  5AT1 B;  2YUP A;  4OF1 A;  2C0I A;  1AWO A;  3CQT A;  2OJ2 A;  4ELY C;  4C0Z A;  2LVM A;  1AWW A;  4BI3 A;  4C8Q E;  2QEX Q;  4QQD A;  2VGM A;  2JMA A;  3H0F A;  2EFI A;  1QP2 A;  3S3O A;  5D6X A;  5CO7 A;  4F14 A;  1GFC A;  2VWF A;  1YP5 A;  2CS7 A;  4JPB W;  3MEV A;  2KT1 A;  4OMQ A;  1TU0 B;  1IZ6 A;  2QAZ A;  2YLC A;  3P8H A;  3QWX X;  3A98 A;  3NFC A;  4HKE A;  1UHC A;  2CYZ B;  1G3Y A;  2MWO A;  5EG2 A;  4C5H A;  2JNG A;  4A63 B;  4KH1 B;  3OS5 A;  3NTI A;  3I55 Q;  1OX9 A;  1NJI C;  1TG0 A;  3CCR Q;  1KFZ A;  2VYT A;  2BKD N;  4RCB A;  2DD5 A;  4N4G A;  1VQ8 A;  2E6N A;  3VUZ A;  2NUT B;  1AOJ A;  3VUB A;  5FRM A;  3HHT B;  1WHM A;  1EX4 A;  1VQO A;  4E7J A;  3H9N A;  2DYI A;  4XTU A;  2AZS A;  1QKW A;  2V26 A;  2M9U A;  4M7D B;  5GAN 5;  4DBH A;  1UGP B;  4FIB A;  3L2R A;  2MOX A;  2E70 A;  2XKO C;  2FPF A;  3VS4 A;  4XTY A;  1QVG S;  5GAO n;  1Q7Y U;  1QP3 A;  4PJO B;  2VV5 A;  3HRU A;  3THK A;  5GAO l;  2CZ7 B;  4ORZ A;  4LD9 K;  2A3L A;  4B9W A;  2EPD A;  3FRN A;  2EJG A;  2VC8 A;  1YJ9 T;  1K9A A;  4IUP A;  2WAC A;  1KQ2 A;  2DIQ A;  2F2X A;  3CCL T;  1HSQ A;  2BE7 D;  3KBG A;  3G4S T;  3PVL A;  1KQS P;  1K76 A;  1NEG A;  3SWN C;  3ER0 A;  3GNF B;  3WVD B;  2I2L A;  1VQK T;  2HZY A;  5CIU A;  2BIV A;  5FU7 C;  5GAN e;  2IVW A;  5GMK j;  1BU1 A;  5GAN 2;  2IG0 A;  3EHQ A;  3HP9 A;  5LJ5 j;  3FJP A;  1WHG A;  1ZSZ B;  2FZG B;  2NUT A;  2RM4 A;  2L3Q A;  1U8R A;  1CKB A;  2JM8 A;  4C0D B;  4LNP A;  3JV3 A;  2M0O A;  1ACM B;  1GXI E;  1Z9Z A;  2XU8 A;  4GLM A;  1WPY A;  4M7D A;  3FJ5 A;  2D0Q B;  3TRE A;  4LUE A;  1GCP A;  3A8G B;  2QI2 A;  4CC2 A;  2KNB B;  1YCY A;  2RH2 A;  1PKS A;  3CC7 Q;  5LJ5 g;  4PJO A;  2DBK A;  2LMJ A;  5FRN A;  3TCJ A;  4PLL A;  3MEA A;  5KCO A;  2RB6 A;  2JTM A;  5M9O A;  4GBQ A;  4C8Q F;  5GAM h;  1YN8 A;  3HKS A;  3C95 A;  2LJ1 A;  2RJF A;  4PLI A;  5L23 A;  5GMK l;  4M75 F;  4XTZ A;  4WCI A;  1Q7Y R;  2MCN A;  1QCN A;  1B34 B;  3O5Z A;  3CCM T;  4OB0 B;  3EFS A;  3CME T;  1MND A;  2OTL T;  3VS7 A;  4FYX B;  2FZK B;  1SG5 A;  2YUN A;  2GQV A;  3I9Q A;  3R6O A;  4X9D A;  1M1K U;  1VQ5 T;  1BI3 A;  2XDB A;  4II1 A;  1LJO A;  2QAS A;  3PVQ A;  1Q81 U;  5IH2 A;  1TUG B;  3CCQ Q;  2KGT A;  4IUT A;  4KUL A;  1QQJ A;  4ATO A;  3M4G A;  2FEI A;  5D7U A;  1ZSZ A;  2E65 A;  4M78 F;  3REB B;  1MMD A;  2DF6 A;  3QHS A;  1OZ3 A;  1PWT A;  1QVF A;  3T9N A;  2CZ0 B;  2EJF A;  3HRS A;  4JRI A;  1NPR A;  3HFO A;  2MI6 A;  1RAC B;  1YJ9 A;  3JCM g;  3CC4 Q;  4NL3 A;  4RTZ A;  2RQU A;  5D6Y A;  3QWY A;  3CCL A;  3EGX B;  3G6E Q;  4IUU A;  1ZUY A;  1PD1 A;  3JRZ A;  3LWI A;  2JXB A;  4BI8 B;  4V2S A;  1MV0 B;  2ZPH B;  5GAN 3;  4ZNX A;  1KIK A;  1LVK A;  2LDM A;  4FYY B;  1IRX A;  4E7Z A;  1S1N A;  2CZ1 B;  4OMN A;  3CCU T;  1PHT A;  2LQ8 A;  1VQK A;  3JCM V;  4HCC A;  1IO6 A;  3OYJ A;  3MP1 A;  2O01 E;  5GMK e;  2YSQ A;  1B34 A;  3M0Q A;  1Y07 A;  3ULR B;  2DE0 X;  1M2O A;  4EMK C;  4E7H A;  4FU6 A;  5LJ5 e;  1AZG B;  2DPP B;  4OB1 B;  3VS0 A;  2DJQ A;  1GCQ C;  2IIM A;  3QJ6 A;  1P92 A;  1YIJ T;  2RJE A;  1VIF A;  1MMG A;  3I5S A;  2E5Q A;  4Y92 A;  3CPF A;  5GAN 8;  3S3N A;  5CKD A;  1K73 C;  4JJC A;  2KE9 A;  3TSW A;  1Q86 C;  1M1K R;  1AWJ A;  2DNU A;  4D8K A;  3GIB A;  2RQR A;  1UJY A;  5GJV B;  2DRK A;  1I4K 1;  2JS2 A;  4ELZ C;  2IPO B;  3LGF A;  2RJD A;  4RKU E;  4J9D A;  2VGN A;  4C8Q B;  4LUD A;  3INZ A;  1UG1 A;  1JJ2 A;  4JUV A;  2E64 A;  3QYH B;  4E7L A;  1Q81 R;  4A4K A;  2EYY A;  2ZPI B;  4M75 B;  2CZ6 B;  2W0Z A;  3JCM X;  4BE2 A;  2NUZ A;  1PNJ A;  1E6G A;  1VUB A;  3EGX A;  1IRE B;  1M9S A;  2DKG A;  2DFU A;  3CCM A;  3E1S A;  4BI4 A;  3CME A;  2OTL A;  4A4E A;  1UTI A;  3H8Z A;  3MHX A;  1WXB A;  1VQ5 A;  3RIR A;  4RTY A;  2JN0 A;  2RK1 A;  1KC8 U;  2HL3 A;  2KDS A;  3CCE Q;  2D8H A;  3DKM A;  2YDL A;  1UFF A;  3CD6 Q;  3O8V A;  1G2B A;  2AKL A;  2OAU A;  2PTK A;  4M78 B;  1OPL A;  4A54 A;  4IUR A;  1I5L A;  2EYW A;  2PUK B;  1KK7 A;  4EIK A;  1RAD B;  4UC4 A;  2LJ0 A;  3M4Y A;  2KYM A;  1WGS A;  2ZPB B;  4FSX A;  1BB9 A;  3J80 E;  3G71 Q;  1VQL T;  2EQK A;  2KR3 A;  1VOM A;  3JB9 I;  1AEY A;  1X6G A;  2ZPE B;  3V7C A;  4BD3 A;  3OYD A;  1GL5 A;  2E3I A;  4DQ2 A;  2HBW A;  2AHJ B;  4C8Q A;  3L2Z A;  3CC2 T;  2R5A A;  1K8A U;  2KRM A;  4M75 A;  2M1H A;  3CCU A;  2D9T A;  4X34 A;  4M7D D;  2QK0 A;  1W1F A;  4ZGD B;  4MDX A;  1UUE A;  4LE9 A;  3N5B B;  2GBQ A;  4MMK A;  2KRS A;  3CBM A;  3HFN A;  3QDR B;  1VQN Q;  4OMF B;  3SDZ A;  2X9H A;  1Y57 A;  1OU9 A;  2RF0 A;  1WI7 A;  2QQA A;  4R0K A;  1WHH A;  1YIJ A;  3CCJ Q;  2K57 A;  2BZ8 A;  2RI3 A;  2CRE A;  3LLR A;  3QZ9 B;  3URG A;  1R0B G;  1TOV A;  4M78 A;  2OAW A;  2NWM A;  3BY7 A;  1XOV A;  3P8D A;  1OI1 A;  4CI0 C;  2ABL A;  4PFO A;  4J83 A;  3M56 A;  1KC8 R;  5LJ3 f;  3PFS A;  2X4W A;  3VYH B;  2CSI A;  1ABO A;  3KXT A;  1PCX A;  2LC4 A;  2V8I A;  2EYZ A;  1TSF A;  4A4H A;  2COW A;  3LH0 A;  4M77 C;  2JM9 A;  3QJY A;  5FU6 C;  1WYX A;  4XU0 A;  4C0F A;  3MPU B;  1UE9 A;  2JT4 A;  1M3A A;  4FYW B;  3LX7 A;  3OYF A;  1OZ2 A;  1AZE A;  1N5Z A;  1K4U S;  4RG8 A;  4M7A C;  3TSZ A;  3I56 Q;  1X43 A;  3RKX A;  4F04 B;  1YJN T;  3CMA T;  1ZUK A;  2MWP A;  3RUX A;  1XJW B;  3L2Q A;  1OU8 A;  1U3O A;  5IXB A;  1K8A R;  3QUI A;  1IHV A;  2LQN A;  2NLU A;  4JZ3 A;  5HY6 A;  3GP8 A;  2CT3 A;  5LJ3 d;  4PKC C;  1VQL A;  1BKB A;  5CKH A;  1G8X A;  2CH4 W;  1KQ1 A;  2DXB A;  1R8O B;  1WXT A;  3C12 A;  2Y4Y A;  3BDL A;  4HCB A;  2E4H A;  5A2Q E;  2P0P A;  1MMA A;  4X9C A;  4JS5 A;  3E9F A;  3MJX A;  4AG1 C;  5GAM j;  2HNI A;  3OY9 A;  4CRI A;  1YIT Q;  3QPH A;  3CC2 A;  5FW9 A;  1OPK A;  2F69 A;  3G7Z A;  4HT9 A;  2PUO B;  4M7D G;  2VUB A;  4A4G A;  1BI1 A;  2O4X B;  3NHN A;  2DVJ A;  3A5Z B;  1YFN A;  4N0A A;  1V76 A;  5A0L A;  1WFW A;  5GAO r;  4PJO G;  3OBW A;  2E1H A;  2FL7 A;  1QVG A;  4XU3 A;  3MEU A;  5CVI A;  5GAM g;  4B6M A;  3M0U A;  3RKY A;  2LT4 A;  2OX7 A;  1IHW A;  1R77 A;  3RKW A;  3CPW S;  3JCM f;  1AVZ C;  1VQM Q;  2DZC A;  4NS5 A;  4ME7 A;  1NYF A;  1VQ4 Q;  2K2V A;  2QQS A;  2DL5 A;  3VS5 A;  2Y90 A;  4JS4 A;  1N8R C;  5GAN 6;  1WJR A;  1BIA A;  3L2U A;  2E10 A;  1K9M U;  5GAN j;  3DLM A;  2DVE A;  4HVV A;  4J6X A;  1RUW A;  1LOJ A;  2NYS A;  1UEC A;  1BI0 A;  3M0P A;  4QVZ A;  2D0N A;  4JJB A;  2P0Q A;  3QDF A;  4Z8A A;  1WXU A;  4M75 E;  2MK5 A;  4J9I A;  4KGV B;  3OW2 S;  5GAN g;  5I2S A;  3JCM d;  2O4X A;  4JRQ A;  2MAM A;  5I22 A;  2CUD A;  1YJN A;  4AG2 C;  3CMA A;  5HK0 A;  5FU7 B;  1XTD A;  1RLQ C;  2X4X A;  3VRY A;  4RTV A;  1W2B P;  1RAG B;  1RI0 A;  1RAH B;  4C8Q D;  1M90 U;  4R55 A;  5IT9 E;  5KYY B;  1YI2 T;  1JU5 C;  5FWC A;  2CSQ A;  1HK9 A;  4M75 D;  2XID A;  1Y7X A;  1W4S A;  2QA4 T;  4M78 E;  2PNI A;  3VRZ A;  4JDS A;  1S72 Q;  2M51 A;  1Z9Q A;  4M4Z A;  2RHY A;  1VQ7 T;  2EQI A;  2K5F A;  5GAM e;  4GY5 A;  2PVG B;  4EDU A;  3SHW A;  2H3E B;  5DM7 R;  4ZGJ B;  2J7I A;  3NPF A;  1U1S A;  2FB7 A;  1BI2 A;  4XAX B;  1OUL A;  5IXF A;  3A8L B;  1B3Q A;  1WQW A;  1HYO A;  3FDR A;  1UB4 A;  2RNA A;  1OV3 A;  3A1P A;  4M78 D;  4C92 E;  5HK3 A;  4J7I A;  5CAI A;  3EG2 A;  1K9M R;  2RQW A;  1VQ6 T;  3PIP A;  1M1G A;  2DTH A;  1HD3 A;  2VVK A;  2F5T X;  2OTJ T;  1VQP Q;  2V8K A;  3M5A A;  4FT2 A;  4AFQ C;  3LH5 A;  3EFO B;  2KSS A;  2EQJ A;  2R57 A;  4X1V A;  2K5I A;  3C0C A;  2B8A A;  4IUV A;  3KFV A;  4Y91 A;  2CP7 A;  2V1Q A;  4C92 D;  1YJW T;  1H8K A;  2PU9 B;  5KYY A;  4HT8 A;  4K11 A;  1PM3 A;  4ANJ A;  3DB4 A;  4BY6 C;  1JO8 A;  3LGL A;  4JRP A;  1G5V A;  1JQQ A;  2XK0 A;  4JRK A;  1NYG A;  1M90 R;  2J05 A;  2HL5 C;  3E2U A;  2FZC B;  1KQS S;  5KE3 A;  1Q82 U;  2KMT A;  3ZEH A;  1QLY A;  1IB8 A;  3QSU A;  2E5K A;  3CCS Q;  4OP0 A;  3VS3 A;  3QZ5 B;  2EGA A;  2QGG A;  1D1C A;  2MYS A;  5CR2 A;  2EIF A;  4C8Q G;  3OYL A;  1YHQ T;  1SEM A;  1X01 A;  4C5G A;  2DER A;  1PG5 B;  1XQH A;  4M75 G;  4BDZ A;  2DTI A;  1W6X A;  1YI2 A;  2KXC A;  3GNG A;  3M0T A;  2D1X A;  4HVW A;  3OYA A;  5HKC A;  3HPW A;  2QA4 A;  1ZX6 A;  2MF2 A;  4FSS A;  3EFO A;  3EH1 A;  3EG0 A;  2DIL A;  3GOX A;  2JZ2 A;  4J6W A;  2L3P A;  5I11 A;  4FCY A;  4DOV A;  4OVA A;  1VQ7 A;  2RQT A;  2DET A;  4PJO C;  3RBB B;  2K3B A;  2I0N A;  4E7I A;  1G3T A;  4C5I A;  2R5M A;  4F7U F;  4OMP A;  2F5K A;  2LQW A;  1RI9 A;  4M78 G;  1VQ8 Q;  3QYG B;  3HSB A;  2A28 A;  4IUQ A;  1MGQ A;  4TVR A;  3GBQ A;  4IIM A;  3J7A F;  1RLP C;  1VQ6 A;  4LDY A;  1VQO Q;  1QWE A;  2OTJ A;  1PRM C;  2QG9 B;  3REA B;  3M0R A;  5CQX A;  2J6K A;  1YIT T;  2CP5 A;  3QG1 A;  1UGQ B;  1IGQ A;  2EKO A;  3VS1 A;  2RJC A;  3RDV A;  3G4S A;  4M7A F;  4ZTF A;  1Q82 R;  3GPL A;  3OYI A;  2KY9 A;  4O6J A;  4C92 G;  1KD1 U;  2K2M A;  4C92 F;  2JTF A;  3OYN A;  1QMC A;  3PMI A;  5EC7 A;  2DL7 A;  4D6W A;  1YJW A;  3OYH A;  3H0I A;  4BUG A;  3CCV T;  3V7R A;  1GCQ A;  4WF2 A;  3A8O B;  3M59 A;  1NM7 A;  3X26 B;  2K3Y A;  3SD4 A;  4QVC A;  2HMA A;  3OS0 A;  2CKK A;  2XIC A;  2VAS A;  3RR6 A;  1NLP C;  5GAO m;  2ZAE A;  1UJ0 A;  2DAQ A;  1KHC A;  1T0J A;  2L3R A;  2K9G A;  4JJD A;  2ROT A;  3SEM A;  3M9Q A;  2FG0 A;  2DJZ A;  4FW1 A;  1G3W A;  2KVQ G;  3EG3 A;  3FC3 A;  8AT1 B;  2A0F B;  1HJD A;  1UGR B;  2DLP A;  4KH0 B;  3JCM b;  2BE9 B;  1I07 A;  4DEX A;  1PSF A;  2DL3 A;  1VQ9 T;  1GBR A;  2FYK A;  2KQW A;  1MUZ A;  3UF4 A;  1RAI B;  2EYQ A;  2DEU A;  1YHQ A;  1U1T A;  1X2K A;  5DLO A;  3FEO A;  1NJI U;  3MEW A;  1NEB A;  2QEX T;  1D0X A;  1ZHI A;  5D6W A;  5GAO p;  2A7Y A;  1QW1 A;  3EG9 B;  4EMG A;  4LDV A;  1BCM A;  1WJQ A;  2HCK A;  1NPP A;  1F1B B;  2RQV A;  4MZM A;  3EHR A;  4OML A;  1T3S A;  1H3Z A;  2QGF B;  1YWO A;  2L5Q A;  1QVF P;  4F7U B;  1WHL A;  1Y96 B;  2V8J A;  2RHI A;  5GAN f;  1GFD A;  2AIR B;  2V1R A;  5LL6 S;  4XTW A;  3I55 T;  1M3B A;  1QWF A;  2P84 A;  2F2W A;  3L2V A;  3CBP A;  2XDD A;  4LDW A;  1KD1 R;  1ZA2 B;  4FL6 A;  3Q1J A;  2AKK A;  4M77 B;  5LJ3 h;  3CCR T;  4E7K A;  2D8J A;  4QKU A;  1AT1 B;  5FU6 B;  1WJS A;  5GMK m;  5IHK A;  2LCL A;  2EQU A;  1AHJ B;  1T0H A;  5GMK i;  9ATC B;  2H3J A;  2RD1 A;  2GCX A;  3JCM P;  3PT9 A;  1ZSG A;  1RAA B;  3V8L A;  1DJ7 B;  4Z89 A;  2KRO A;  3PIO A;  1YIT A;  4M7A B;  4J9B A;  2P4T A;  2O31 A;  1FMK A;  5KYN A;  4C92 B;  2OI3 A;  4PJL A;  3J81 E;  4MDW A;  2YXY A;  4J9G A;  1JXO A;  2C06 A;  4LD6 A;  1Y71 A;  4ESR A;  3FIF A;  1IGU A;  2L89 A;  4MML A;  2QTX A;  2J6F A;  5GMK h;  5KYX B;  3CCV A;  1JXM A;  4CC3 A; 
#chains in the Genus database with same CATH homology
 2MMP A;  3FRN A;  4PJO G;  3OBW A;  2EJG A;  1X6O A;  2E1H A;  2FL7 A;  3OYY A;  5GAN d;  2VC8 A;  5GAN h;  1N8R U;  1YJ9 T;  4N4I A;  1QVG A;  4XU3 A;  4IUP A;  2WAC A;  1I81 A;  3MEU A;  4HA8 A;  4C0D C;  4L6V 5;  1KQ2 A;  5CVI A;  5GAM g;  5I2M A;  2DIQ A;  3RKY A;  3CCL T;  3M54 A;  2EWN A;  1VQN A;  3M57 A;  2LT4 A;  2Y4X A;  2M16 A;  3RKW A;  3CPW S;  1X75 C;  1ZBX A;  5CKB A;  3JCM f;  1UEB A;  3KBG A;  2YLB A;  3G4S T;  2QDY B;  4O5V A;  2DZC A;  2EJ9 A;  4NS5 A;  4VUB A;  3CCJ A;  3LW5 E;  3GLX A;  4ME7 A;  2DXC A;  5GAM f;  1VQM T;  4F7U A;  1Q7Y C;  1Y96 A;  2K2V A;  3UPU A;  3SWN C;  2QQS A;  3ER0 A;  1D3B B;  3GNF B;  3WVD B;  2I2L A;  4C5E A;  3CPW A;  2DXT A;  1VQ4 T;  1VQK T;  2GFA A;  4BAC A;  5CIU A;  2BIV A;  2Y90 A;  5FU7 C;  4JS4 A;  5GAN e;  2IVW A;  1N8R C;  5GMK j;  5GAN 6;  1WJR A;  1BIA A;  4M77 A;  1FXX A;  3L2U A;  2E10 A;  4BB7 A;  5GAN 2;  2IG0 A;  5GAN j;  1K9M U;  2RHZ A;  1VQ9 A;  3DLM A;  2DVE A;  3HP9 A;  5LJ5 j;  3FJP A;  4J6X A;  1LOJ A;  5CKE A;  3S6W A;  1BI0 A;  2FVU A;  2RM4 A;  2QQ9 A;  4QVZ A;  1U8R A;  4A53 A;  2XD0 A;  4C0D B;  3JCM J;  3OMG A;  4Y28 E;  4C92 E;  2P0Q A;  2QEX A;  2M0O A;  1GXI E;  2XU8 A;  4ZGE B;  1WPY A;  4M7D A;  3NTH A;  3X28 B;  2D0Q B;  4M75 E;  3TRE A;  4M7A A;  4RCC A;  3A8G B;  4KUD K;  2QI2 A;  1PSE A;  3QKJ A;  2X35 A;  4C92 A;  3OW2 S;  1YCY A;  5GAN g;  5I2S A;  2RH2 A;  1XNI A;  2X4J A;  3OS1 A;  2E6Z A;  2YRV A;  5LJ5 g;  4PJO A;  3JCM d;  2O4X A;  1M1F A;  3JCM h;  4JRQ A;  2MAM A;  3EAE A;  5C0M A;  3CC7 T;  1K9M C;  2VXF A;  3TCJ A;  3TU4 K;  5FRN A;  4PLL A;  3MEA A;  5KCO A;  2RB6 A;  3OYM A;  2PQW A;  2JTM A;  3CMA A;  2E12 A;  4EPC A;  5HK0 A;  5FU7 B;  5M9O A;  5GAM d;  3OYE A;  3I56 A;  4C8Q F;  5GAM h;  2HD0 A;  3OW2 A;  1XTD A;  2K5L A;  2X4X A;  3C95 A;  3HKS A;  4P5N A;  2RJF A;  3I55 A;  4PLI A;  5GMK l;  4M75 F;  4XTZ A;  1RI0 A;  4DA4 A;  1M90 U;  4C8Q D;  2XDP A;  5LJ5 f;  3HRT A;  4R55 A;  3CCU A;  5IT9 E;  1YI2 T;  1B34 B;  3CCR A;  1HK9 A;  3CCM T;  3L42 A;  4M75 D;  4OB0 B;  2LTO A;  3EFS A;  3CME T;  2XID A;  2OTL T;  1Y7X A;  3MP8 A;  3PNW C;  1W4S A;  2DK3 A;  3V7S A;  2QA4 T;  4M78 E;  3OYI A;  2GQV A;  3BW1 A;  3R6O A;  4X9D A;  4JDS A;  1M1K U;  1VQ5 T;  2LNV A;  3RMQ A;  4NL2 A;  4XQ3 A;  1BI3 A;  3RMS A;  3JCM e;  4IKF A;  2XDB A;  4II1 A;  1LJO A;  1D3B A;  1S72 T;  2D6F A;  3C4S A;  2RHY A;  1VQ7 T;  4EMH A;  5GAN 7;  2K5F A;  5A0G A;  5GAM e;  4GY5 A;  1Q81 U;  1YBY A;  2LCC A;  2PVG B;  4EDU A;  1QVF S;  2QQR A;  5FLX E;  4OB2 B;  2XHC A;  5DM7 R;  4ZGJ B;  4IUT A;  4KUL A;  4BE1 A;  3M4G A;  4ATO A;  1M90 C;  3CCQ T;  3A8M B;  3C94 A;  5CK9 A;  2E65 A;  5KCH A;  1U1S A;  2FB7 A;  3PTA A;  4M78 F;  1BI2 A;  4XAX B;  4M7D E;  3QHS A;  3A8L B;  3DB3 A;  1WQW A;  1OZ3 A;  1VQ8 T;  3FDR A;  1QVF A;  3LWH A;  1UB4 A;  2RI5 A;  4FM4 B;  4M78 D;  2CZ0 B;  2EJF A;  4NOY A;  3T9N A;  3HRS A;  3V8K A;  1WQ7 A;  1NPR A;  3HFO A;  2MI6 A;  4JRI A;  4J7I A;  5HK3 A;  1M1K C;  3KUF A;  1YJ9 A;  5CAI A;  3JCM g;  4PJO E;  2FHD A;  2DD4 A;  2LX9 A;  1JRI A;  3MET A;  3VKI A;  4NL3 A;  5D6Y A;  3PIP A;  3DLL A;  2PVO B;  5LJ5 d;  3X25 B;  3CCL A;  1M1G A;  5LJ5 h;  2DTH A;  3CC4 T;  3P8B B;  2F5T X;  4IUU A;  2JOY A;  2OTJ T;  3CEY A;  4KT0 E;  2V8K A;  3M5A A;  3VJP A;  3G6E T;  1Q81 C;  1WNL A;  2RHX A;  2X4Y A;  2LQK A;  3GF5 A;  1O9S A;  3JRZ A;  4XTV A;  4BI8 B;  5GAN 3;  2ZPH B;  3LWI A;  4FT2 A;  2WSF E;  1VQP T;  4V2S A;  3OMC A;  2LDM A;  2KSS A;  4HCZ A;  2EQJ A;  2R57 A;  1VIE A;  3JCM Q;  1VQM A;  2K5I A;  2RI2 A;  1FWZ A;  1N6A A;  2CZ1 B;  2B8A A;  3CCU T;  1K73 U;  3OA6 A;  2LQ8 A;  4IUV A;  4C8Q C;  3JCM V;  1VQ4 A;  4Y91 A;  4QVD A;  1VQK A;  4HCC A;  4JJN K;  3OYJ A;  3ASK A;  3MP1 A;  4JLI A;  2HBP A;  2O01 E;  4KBM B;  4C92 D;  1YJW T;  1Q86 U;  5GMK e;  2PU9 B;  5GMK i;  4M75 C;  3OYB A;  3FB9 A;  4HT8 A;  3OB9 A;  1I8F A;  1B34 A;  4PJO D;  1Y07 A;  5A0D A;  2WSE E;  2CGH A;  3X26 B;  4EMK C;  4N0A C;  4R56 A;  5J39 A;  4B9X A;  3PMT A;  5L8R E;  3CXC S;  4FU6 A;  5LJ5 e;  4E7H A;  3DB4 A;  3VU3 C;  2DPP B;  1UGS B;  3JSC A;  4BY6 C;  3LGL A;  4OB1 B;  3JB9 F;  4JRP A;  2P0K A;  4ZTJ A;  1G5V A;  2EAY A;  3QJ6 A;  1P92 A;  3TEE A;  2XK0 A;  4MZP A;  4JRK A;  3JB9 D;  3HL8 A;  1YIJ T;  2RJE A;  1HXD A;  1VIF A;  3CXC A;  1EIF A;  5GAN 4;  2E5Q A;  1KG1 A;  3CPF A;  1KQS S;  5KE3 A;  1Q82 U;  5GAN 8;  3S3N A;  2KMT A;  3ZEH A;  5CKD A;  1K73 C;  1JJ2 S;  2ZCF B;  4LDX A;  3WXM B;  3L2W A;  3V8J A;  1Q86 C;  3QSU A;  3GIB A;  5J26 A;  3X20 B;  1SSF A;  1I4K 1;  4ELZ C;  3LGF A;  2RJD A;  4OP0 A;  2E41 A;  3QZ5 B;  3ME9 A;  1JB0 E;  4RKU E;  1KQS A;  4M7D D;  2VGN A;  3CC7 A;  3SB2 A;  3CCS T;  4C8Q B;  3E19 A;  3L1A A;  4M78 C;  2G3R A;  3ZBD A;  3SWN B;  1YJN A;  3QBY A;  3INZ A;  3OYG A;  1JJ2 A;  4JUV A;  2DTO A;  2E64 A;  3QYH B;  2K4Y A;  4E7L A;  4A4K A;  4M75 B;  2ZPI B;  5KH6 A;  5CR2 A;  2CZ6 B;  3OQ5 A;  3VV0 A;  2EIF A;  4C8Q G;  3OYL A;  1OYX A;  2RA2 A;  3JAM E;  1YHQ T;  3JCM X;  4BE2 A;  1X01 A;  4L59 A;  4C5G A;  4BY6 B;  1VUB A;  1XQH A;  4M75 G;  4BDZ A;  2DTI A;  4Z02 A;  1IRE B;  1YI2 A;  1M9S A;  2DKG A;  3GNG A;  4KUI A;  3S3M A;  1H64 1;  1RL2 A;  1TH7 A;  3E1S A;  3MO8 A;  4BI4 A;  3CME A;  3CCM A;  3OSS C;  1Q82 C;  2OTL A;  4A4E A;  5DLQ E;  4F7U E;  3OYA A;  5HKC A;  1BYM A;  3HPW A;  2HQX A;  3H8Z A;  5IAY A;  2QA4 A;  3MHX A;  4ZN3 A;  2MF2 A;  1VQ5 A;  3M53 A;  2JZ2 A;  3MP6 A;  4J6W A;  3GOX A;  3RIR A;  4ZN1 A;  2JN0 A;  2RK1 A;  3OS2 A;  2RK2 A;  4E47 A;  4BDY A;  1S72 A;  4C92 C;  2KDS A;  4DOV A;  1KC8 U;  4OVA A;  4YTL A;  4M77 E;  1VQ7 A;  3QII A;  3DKM A;  4PJO C;  2HQE A;  3O8V A;  3CCE T;  4DOW A;  4E7I A;  3A8H B;  1LNX A;  1G3T A;  2XI9 A;  4C5I A;  2OAU A;  5I21 A;  3CD6 T;  5GAO q;  4BE0 A;  1VQ6 T;  4M78 B;  4A54 A;  4IUR A;  3CCQ A;  2R5M A;  4F7U F;  3H6Z A;  1I5L A;  1NZ9 A;  4J6Y A;  1W2B S;  2PUK B;  2F5K A;  2VXE A;  4UC4 A;  4M78 G;  4XTX A;  4GLK A;  3M4Y A;  2K3X A;  4OGE A;  1WGS A;  3JCM c;  2HAX A;  2ZPB B;  3QYG B;  4FSX A;  3HSB A;  3OSV A;  3J80 E;  4M7A E;  1VQL T;  4IUQ A;  1MGQ A;  4FT4 A;  4TVR A;  2JVV A;  2EQK A;  2PVD B;  2GF7 A;  3G71 T;  3J7A F;  3ZFJ A;  2KK4 A;  1W2B A;  3JB9 I;  1VQ6 A;  4LDY A;  1M4Z A;  2ZPE B;  3V7C A;  4OGC A;  4BD3 A;  3OYD A;  4M77 D;  1KC8 C;  3RER A;  1N27 A;  3CC4 A;  1VQO T;  3JB9 J;  2OTJ A;  4DQ2 A;  3G6E A;  3QXE B;  1VQP A;  2AHJ B;  1ZQ1 A;  5CQX A;  1YIT T;  3MCA B;  3QG1 A;  3JB9 H;  1UGQ B;  4C8Q A;  3NTK A;  2EKO A;  1M8V A;  3L2Z A;  3OBY A;  3SWN A;  3CC2 T;  4M7D F;  1JBM A;  1KHI A;  2R5A A;  2RJC A;  3OYC A;  3G4S A;  4M7A F;  1K8A U;  2LT1 A;  4M75 A;  4ZTF A;  3GPL A;  1M5Q 1;  2M1H A;  2KY9 A;  2D9T A;  4O6J A;  4X34 A;  1O75 A;  3RES A;  3CBO A;  4XK8 E;  4C92 F;  4C92 G;  5LJ3 j;  1KD1 U;  4A4F A;  2JTF A;  4QQ6 A;  4ZGD B;  3PMI A;  3OYN A;  4M7A D;  4D6W A;  1YJW A;  5CKF A;  5C6S A;  4MDX A;  4PJO F;  3OYH A;  4BUG A;  2L8D A;  3CCV T;  2LRQ A;  3QO3 A;  3V7R A;  3EFR A;  4WF2 A;  5CQY A;  3N5B B;  1NE8 A;  4MMK A;  5IN1 A;  3E9G A;  3A8O B;  3CBM A;  3HFN A;  2DEQ A;  3M59 A;  1G3S A;  2K3Y A;  3F70 A;  3QDR B;  4OB3 B;  4OMF B;  3SD4 A;  3SDZ A;  4QVC A;  3OS0 A;  2CKK A;  3SFM A;  4RG2 A;  2XIC A;  4L5G A;  1VQN T;  2WSC E;  5GAO m;  3JB9 G;  2QQA A;  3M55 A;  2DAQ A;  2GFU A;  1KHC A;  5DY9 A;  1YIJ A;  2L3R A;  4JLG A;  4PL6 A;  2JUF A;  2K57 A;  5LJ3 g;  2RI3 A;  2R58 A;  3OYK A;  3LLR A;  3M9Q A;  3QZ9 B;  3CCJ T;  1K8A C;  3URG A;  4QQG A;  2DJZ A;  3M58 A;  4PNO A;  1G3W A;  2KAF A;  1KD1 C;  2KVQ G;  4Q5W A;  3VYG A;  2DZ9 A;  4M78 A;  1N9S A;  5FRO A;  3BY7 A;  1XOV A;  3P8D A;  1OI1 A;  4CI0 C;  4N4H A;  3FC3 A;  4XU2 A;  4XU1 A;  1UGR B;  1MHN A;  4J83 A;  3M56 A;  3JCM b;  5LJ3 f;  3PFS A;  5AYF A;  3CCS A;  2X4W A;  1PSF A;  4MZT A;  1BIB A;  2ZZD A;  3VYH B;  3BDU A;  3WVE B;  1VQ9 T;  3KXT A;  1V29 B;  2FYK A;  2LC4 A;  2V8I A;  4OF1 A;  2KQW A;  4A4H A;  4C0G A;  3FLG A;  3LH0 A;  5KE2 A;  4M77 C;  2EYQ A;  4ELY C;  4C0Z A;  2LVM A;  1YHQ A;  1U1T A;  4BI3 A;  4C8Q E;  3FEO A;  5DLO A;  1NJI U;  4QQD A;  3PGG A;  2VGM A;  2ZPG B;  3QJY A;  4EMK B;  2DIG A;  4LDU A;  5FU6 C;  3MEW A;  2QEX T;  2RO0 A;  2EFI A;  4J8O A;  4XU0 A;  3VUZ A;  4C0F A;  1QP2 A;  3S3O A;  5D6X A;  5CO7 A;  2CS7 A;  2ZPF B;  1ZHI A;  5D6W A;  5GAO p;  5GAO r;  2A7Y A;  1QW1 A;  3MEV A;  4EMG A;  4LDV A;  3LYI A;  3LX7 A;  1WJQ A;  3OYF A;  1IZ6 A;  1NPP A;  1OZ2 A;  2YLC A;  3P8H A;  4M7D C;  1FX7 A;  4RG8 A;  4MZM A;  3UDC A;  4M7A C;  2BUD A;  3NFC A;  2QXF A;  4HKE A;  2ZGW A;  2CYZ B;  3RKX A;  1YJN T;  1H3Z A;  3CMA T;  1G3Y A;  2MWO A;  2L5Q A;  5EG2 A;  4C5H A;  3I56 T;  3CCE A;  2JNG A;  3OS5 A;  2MWP A;  1Y96 B;  3NTI A;  2V8J A;  2RHI A;  4F7U B;  5GAN f;  3BFM A;  3CD6 A;  5LL6 S;  3RUX A;  4XTW A;  3I55 T;  1NJI C;  3L2Q A;  2DXU A;  3L2V A;  3JCM W;  2EQM A;  3CBP A;  3QUI A;  2NLU A;  4F7U G;  2XDD A;  5HY6 A;  4LDW A;  3GP8 A;  2YHT A;  5LJ3 d;  4FL6 A;  3Q1J A;  4M77 B;  5LJ3 h;  3CCR T;  4E7K A;  2VYT A;  4PKC C;  2BKD N;  4RCB A;  3X24 B;  4J5Y A;  1VQL A;  2DD5 A;  1BKB A;  4N4G A;  5CKH A;  1VQ8 A;  2E6N A;  2QQB A;  1WJS A;  5FU6 B;  5GMK m;  3AHU A;  1KQ1 A;  3G71 A;  2LCL A;  2DXB A;  1AHJ B;  2DO3 A;  2EQU A;  2XG8 D;  2RHU A;  1R8O B;  3C12 A;  4M77 G;  4M77 F;  4QW2 A;  3VUB A;  2H3J A;  2Y4Y A;  2RD1 A;  2GCX A;  3BDL A;  3HHT B;  4HCB A;  5FRM A;  3JCM P;  3PT9 A;  5A2Q E;  2P0P A;  4X9C A;  1VQO A;  3V8L A;  4JS5 A;  4E7J A;  4XTU A;  3E9F A;  1DJ7 B;  2M9U A;  5GAM j;  4M7D B;  5GAN 5;  2HNI A;  3OY9 A;  4CRI A;  3PIO A;  1YIT A;  5A0L A;  4M7A B;  1UGP B;  3UT1 A;  2P4T A;  4FIB A;  3QPH A;  3L2R A;  1QVP A;  2E70 A;  3CC2 A;  1N9R A;  2XKO C;  2F69 A;  3G7Z A;  3UWN A;  4C92 B;  4XTY A;  4HT9 A;  2PUO B;  3J81 E;  2VUB A;  4MDW A;  4A4G A;  1QVG S;  5GAO n;  4M7D G;  1Q7Y U;  4RMO A;  1QP3 A;  1BI1 A;  5LJ3 e;  2C06 A;  4LD6 A;  1Y71 A;  5J3B A;  4M7A G;  2O4X B;  4PJO B;  2VV5 A;  3FIF A;  3HRU A;  2L89 A;  4J7F A;  4MML A;  2QTX A;  3A5Z B;  5CCA A;  5GAO l;  2CZ7 B;  4EMK A;  5GMK h;  4N0A A;  3CCV A;  4LD9 K;  2A3L A;  4B9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...