2IW1A

Crystal structure of waag, a glycosyltransferase involved in lipopolysaccharide biosynthesis
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
370
structure length
370
Chain Sequence
IVAFCLYKYFPFGGLQRDFMRIASTVAARGHHVRVYTQSWEGDCPKAFELIQVPVKSHTNHGRNAEYYAWVQNHLKEHPADRVVGFNKMPGLDVYFAADVCYAEKVAQEKGFLYRLTSRYRHYAAFERATFEQGKSTKLMMLTDKQIADFQKHYQTEPERFQILPPGIYPDRKYSEQIPNSREIYRQKNGIKEQQNLLLQVGSDFGRKGVDRSIEALASLPESLRHNTLLFVVGQDKPRKFEALAEKLGVRSNVHFFSGRNDVSELMAAADLLLHPAYQEAAGIVLLEAITAGLPVLTTAVCGYAHYIADANCGTVIAEPFSQEQLNEVLRKALTQSPLRMAWAENARHYADTQDLYSLPEKAADIITGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Synthesis of Lipopolysaccharide and Antibiotics Through the Structures of Two Retaining Glycosyltransferases from Family Gt4
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS PROTEIN RFAG
total genus 142
structure length 370
sequence length 370
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
A PF13439 Glyco_transf_4 Glycosyltransferase Family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2iw1A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2iw1A01
2BGTA 4GYWA 2QN1A 5DU2A 3E3OA 4PQGA 4CTNA 4X6LA 3G2KA 5D01A 3DDSA 4FZRA 1RRVA 1NOIA 3MSCA 3BCSA 3OY7A 1E1YA 3SYRA 3E3LA 4NC9A 3AMVA 3OY2A 3RSCA 2IUYA 1FU7A 4X7RA 2XCUA 5GPBA 1FTYA 1WW2A 2X6RA 3BEOA 1L7XA 1BX3A 3D0RA 2QN3A 4YI5A 5TMBA 4CDRA 3L7BA 2WTXA 2QN7A 3S27A 3HBFA 1C50A 1PYGA 2H1HA 1Z62A 1RZUA 4RENA 4YUAA 3G2JA 1XC7A 2FFRA 1GFZA 1WV1A 1GGNA 1A8IA 1EM6A 3EBOA 2PQ6A 4Z5XA 1LWNA 1UQTA 1H5UA 4BQEA 2X0EA 4AY5A 1K08A 3H4IA 3NB0A 3FROA 3RSZA 2IV7A 1WUYA 3Q3EA 4KQMA 2F3UA 4G2TA 4XI9A 2X6QA 1UZUA 4NESA 1NLMA 4EKYA 4WHMA 1QM5A 3TAXA 1Z6PA 2XMPA 3NPAA 4GYYA 4RIFA 1L5SA 3CEHA 2AV6A 3MT7A 4GZ5A 1NZDA 1GPBA 1FTWA 2QN8A 1L6IA 1NOJA 1F0KA 4MI6A 3E3NA 1GPAA 3RHZA 3CUYA 2C9ZA 2AW3A 4EKEA 2X0DA 2H1FA 1P2BA 2X0FA 3TOVA 1NZFA 2BFWA 4N3BA 1FC0A 3BD6A 2F3PA 2G9UA 1PN3A 3T5TA 4AMGA 3HBNA 3CUTA 4X7MA 3MT9A 2GEJA 2G9QA 2R66A 3TSAA 1KTIA 3OKPA 1GPYA 5BNWA 3Q3IA 5IKOA 1IIRA 5D00A 4RELA 2OFFA 3DDWA 3C4QA 1JG7A 2GPAA 3MT8A 4M60A 2IV3A 1AXRA 3S2UA 4RIEA 1XL1A 2VG8A 3HBJA 2XA9A 3WAGA 3QKWA 2O6LA 2XGSA 2SKEA 2F9FA 2KS6A 5TMDA 1E4OA 5TMEA 1L5QA 3L7DA 4AMBA 1YGPA 1JEJA 4LDPA 3CUVA 2JJMA 3BD7A 4NEQA 2GJ4A 1C8KA 2P6PA 4AY6A 4LEIA 4REMA 2C1ZA 1WW3A 2ZB2A 1V4VA 3MRVA 3VUEA 1SXPA 4BQFA 4F97A 4M83A 4MICA 3L7AA 4L22A 2PRIA 3BDAA 1Y8ZA 4RIGA 3MS4A 4BFCA 5TVGA 1HLFA 2AZDA 2YJNA 3BCUA 2C1XA 3COPA 1XL0A 1WV0A 1RZVA 1ABBA 3OKAA 1GG8A 2QRGA 3MS7A 2XCIA 2HY7A 3VUFA 1Z6QA 3L79A 3O3CA 4WADA 3L01A 2SKCA 4N3AA 4RIIA 2JLBA 1B4DA 4CTOA 3SYMA 2QZSA 3NCHA 1P4HA 2G9VA 4KQ1A 2PYIA 4EL5A 4MI9A 1YA6A 1P4GA 3Q3HA 5C1DA 1FU4A 4W6QA 2GEKA 3OTGA 3WC4A 4KQ2A 4EJ2A 2IYAA 5ENZA 2VSNA 3MBOA 2IEIA 4MRAA 5IKPA 2SKDA 1WUTA 4MI3A 5JTTA 3GUHA 3T3IA 5HXAA 1FS4A 4CTMA 3S0JA 3CUUA 2BGUA 1F6DA 3CUWA 2VCHA 3CEMA 4F96A 4RBNA 3UYLA 3MRXA 8GPBA 4GZ6A 2F3SA 4AN4A 2Q6VA 2ASVA 2QRMA 2QLNA 4N39A 3WADA 4GZ3A 5LQDA 1P29A 1FA9A 3NP9A 5I45A 3L7CA 3ZCSA 2XA2A 2FETA 3G2NA 1VGVA 3EBPA 1GZ5A 2GM9A 2QN9A 3G2LA 3ZCRA 1XV5A 2R68A 3T3HA 3PE4A 1P2DA 2ECPA 2JZCA 2ATIA 1J39A 3QHPA 2XA1A 2QLLA 1L5RA 2XGMA 3DD1A 2G9RA 1O6CA 3D0QA 4RIHA 3MRTA 1P4JA 3NP7A 3ZCUA 1FU8A 4X7PA 3T3DA 2ACWA 1SXQA 4FKZA 1NVKA 3IAAA 3VDNB 2PRJA 3OTHA 1P2GA 3CX4A 3CEJA 3ZCQA 3C48A 3MTBA 1PSWA 2XGOA 3ZCTA 1XOIA 3VDMA 1JIXA 3PE3A 3NAZA 3RT1A 4EL0A 2IYFA 3T7DA 2R4TA 3ZCVA 4YI3A 2QRHA 4N9WA 2C4MA 3S28A 2QN2A 1XKXA 4MHOA 2VSYA 1JG6A 1FTQA 1Y6FA 2PYDA 3H4TA 3UYKA 3T3EA 2AMVA 1K06A 1LWOA 4M7PA 1C8LA 1UQUA 3CV3A 3BD8A 9GPBA 2GPBA 3S29A 3OTIA 3MS2A 2ACVA 1Y6GA 1L5VA 4MHSA 3OKCA 2QRPA 2QNBA 2IW1A 3D1JA 3DZCA 2R4UA 2IEGA 3HBMA 1PNVA 3NC4A 1QKJA 7GPBA 1M5RA 3OT5A 1L5WA 2GPNA 1JIUA 2FF5A 5JTUA 2VCEA 1EXVA 4F9FA 1C3JA 2QRQA 6GPBA 1AHPA 4XIFA 2GT1A 1JIVA 5DXFA 3ZCPA 3T3GA 4BQIA 4QLBA 3C4VA 4GPBA 3G2HA 5DLDA 2QLMA 1Z8DA 3MTAA 3IA7A 2BISA 2R60A 3MTDA 3MQFA 3GPBA 4WACA 1IXYA 3G2IA 4N3CA 2F3QA 1NOKA 4HLNA 3BCRA 4HWGA
chains in the Genus database with same CATH superfamily
2X3YA 1A5AB 1HDCA 2XE7A 4NU0A 4DJEC 4YAUA 5FA8A 2F8TA 3F5SA 3GD5A 1L8LA 5FOVA 1ZH8A 4HGNA 4X1YB 2QM8A 1FIUA 2A5GA 4Q5IA 3WHKA 1WSDA 1T5OA 1WOMA 3PTAA 3ASZA 5TF4A 4B3MB 2IXTA 3H2IA 3OP1A 1BOOA 2Z2XA 3BCSA 3PRKE 4LTMA 1FQJA 3MGCA 3IR6A 3SMVA 1RC8A 1Q1BA 1UODA 1XDBA 3KUXA 4JDPA 4LWQA 2VF7A 4YCAA 5CITA 1XHFA 2MMCA 1EUCB 2BKUA 2OCXA 3HEAA 1X8JA 3PI7A 3AMVA 2OT3B 4DMLA 4Z99A 3TBHA 3E7PA 5ALOA 3KQQA 1GSAA 2IC5A 1D3AA 2EEPA 3N6VA 4ZPXA 3DONA 4M46A 1GLVA 5EXTA 1OGIA 4HWKA 1OFUA 1XJWA 3Q1LA 4ZFNA 1O95D 2I5PO 4KE7A 4G4SP 5AW3A 2XIJA 1JQJC 2FSPA 3GLQA 4R8KA 4FW9A 4PFJA 3RT9A 1M9NA 1NUHA 1GIAA 3ROKA 3W5VA 3AESB 3OH8A 4TGLA 5I4KA 1Z29A 1KQGA 1C3EA 3VMMA 1W5BA 1TEXA 4PC3A 4U2CA 2VWQA 3X43A 2NYUA 3QPBA 4YMHA 4KBFA 4EB6A 5B6IA 3R5HA 1U0TA 1PJAA 1KVUA 5EUQB 2CBGA 2VDUE 4RABA 4CM8A 4KIGA 2KB0A 2BDUA 4DLUA 1R1DA 3PGLA 4ZAZA 2Q3JA 3OIGA 1E3QA 4LF4B 2QRZA 2A7XA 5CM9C 5KSYA 1M72A 1U8CB 3KJQA 5KVSA 3CQ9A 4N6GA 3DMFA 1CDOA 4GKKB 1DARA 1E9CA 1FFBA 1GRCA 1FVFA 1U3GA 1G7TA 1Y1LA 1YDEA 3W5JA 1G5QA 1W2HA 2QTBA 2EKPA 2WE8A 1H93A 2HK7A 4ZZIA 4ND6A 5BN3B 2JI8A 3WO0A 3ZD9A 5E6UA 4EI9A 1TYEB 4MUXA 4UE3S 2ZIXA 3BRQA 1XTSA 1R6XA 3FTQA 1RXYA 1YCHA 2PQ6A 3BJZA 4PM4A 3RRMA 5HKOA 3CTPA 1TB4A 5FUYA 4LXGA 1KSGA 5I9IA 5JMTA 3L6DA 4YPFA 3TMKA 4MW7A 2XMSA 1OBOA 3CF0A 3HVHA 1BA3A 4JZKA 1SRRA 3L8EA 4LISA 5EVJA 4B5LA 3GLFB 3RC1A 4PF1A 1KC1A 1K08A 5EWLB 4KFCA 3ABSB 3HJHA 4W9NC 3VU0A 4R4JA 2H1CA 1SXHA 2QPOA 3FTCA 3UAZA 1USWA 1ZCFA 4Z53A 3OPYA 3U16A 3F5DA 2IT1A 3GLHE 5G0UA 3OHPA 2WI8A 1XDSA 2X6QA 2HNKA 4IQ8A 1SQ0A 4II3A 4ZO7A 1USVA 1PJ8A 2GR9A 2I6UA 2ANBA 2WUEA 1WU8A 3HCBA 3ORQA 4CGYA 4JVLA 4IFEA 3KTFA 1XRPA 3AVYA 2P2NA 3LXXA 1C29B 1W0KA 3HJBA 2BOVA 3PWKA 3O3NB 3TW0A 3U4DA 4AIIA 1GGVA 3T7CA 4AS3A 2FSFA 4PZ9A 1SMKA 2DLDA 5ICCA 2B6HA 1WY5A 3SOPA 1C7ZA 1ZICA 4XR9A 1G3RA 4ECEA 2MR6A 4HAZA 4B2IA 3IDQA 1QRSA 1F9AA 1XWWA 3I42A 4UU0A 3LIIA 3TSYA 3K0HA 4XB2A 4QU9A 2A88A 1Z7BA 3U3KA 4OHBA 5I7WA 2OYSA 4X71A 1XZIA 3NGLA 2F1OA 1CF2O 4ARIA 4E14A 1SUBA 3ZZUA 3A1UA 3EW9A 3QU9A 4YAGA 1O94D 3DM9B 5GAJA 1QIKA 3L6RA 1PEDA 4Y0VA 1DCTA 2VH2A 3LP5A 4BEBA 1PR9A 5JROA 4JQZA 2FEKA 4NG4A 5K8TA 1Y34E 4GE0A 3PQEA 1QGZA 4P7KA 5CBPA 2JJ2D 3V00A 2HT1A 3JQBC 2H57A 1YK0A 5ESXA 4G81A 4Q48A 5DX0A 2OFWA 3TRJA 3U7QB 4BFLA 3ZJVA 2WTAA 5AJUA 5DPMA 1T9KA 3PDIB 2O14A 3JD0A 2AYXA 1IJEA 3F9RA 3LT5A 4BMXA 4ALNA 1Y8QA 3WVNA 3N5KA 4C0SA 1Z45A 1VYUA 1KH1A 5IJAA 2Q1SA 5IKMA 1AQYA 4RW0A 1GRQA 1L5HB 1U5BB 1U7WA 4LQCA 2AJLI 2VBIA 4ZYTA 4C04A 2WKSA 5CTJA 1G0OA 2EP7A 4BGUA 1C1YA 1ZHHA 3DCJA 4MUYA 4HJXA 4P2BA 2QAJA 3R6TA 4MS3B 3KTDA 1ORDA 3EIFA 6REQA 2P4QA 6REQB 1Y7IA 2VSXA 4RM3A 1V3QE 2POQX 1ZMBA 2X19A 3AHHA 5J5VA 3B7PA 3D4OA 4H1WA 4F38A 4DXDA 4UMFA 1BEEA 5CU7A 2ZWOA 5JRDS 4J16A 3REQB 5HKBA 3M81A 4PIPA 5B7GA 4KITB 3K71B 1CP3A 4K9QA 3DNMA 4QUKA 4WQMA 3HA2A 4UFPA 3GRZA 3RWOA 3G0OA 2NU7B 4YCCA 1DIBA 1JW9B 2IYWA 1LK7A 1FSFA 2X3FA 5JAIA 1VHJA 2BMJA 4BBJA 5KHOC 2FK7A 3NPMA 1RYFA 5C31A 3ZDRA 5SV2A 3IL2A 1VB3A 2Q3MA 2XA9A 3D31A 5ABPA 2P1RA 1OIWA 2V8BA 3E22B 4INPA 3QELB 4DRZA 5GADl 4LJ8A 1URPA 3H7AA 3EPJA 2RH9B 1Q1NA 2WJWA 4IEIA 4NCAA 4UAGA 1NLYA 5T3UA 3ETJA 4HDOB 1DKRA 5HSGA 5DTEA 4ID3A 6ADHA 2QDXA 3S1AB 4IIBA 3AVTA 4KVAA 4C7OB 4BU0A 1K8XB 2QXUA 4J2HA 2Q6KA 3TLEA 3SM9A 1JDBC 1EA5A 1GZDA 3QOWA 3RTBA 5ILOA 4JV5B 1Z5WA 1HTWA 2V7WA 4ZRDA 3HB4X 3QYFA 1SAYA 3UTDA 2XQKA 2AF3C 2CDBA 3RU3A 1Q20A 4M83A 3WQBA 1GNRA 1TPYA 1X19A 2PWAA 3CN7A 1CYEA 5MFZA 1WHTB 3SZMA 2VTDA 4QYSA 1T3HA 3TNFA 4HPXB 1ENOA 4LHEA 1R6UA 1JAHA 1Y3FE 1S9HA 3PNVA 4QQRA 5IANA 3W8NA 4CKBB 4CCSA 3K0BA 5A4FS 2G4CA 2X40A 2PUWA 2O0LA 1JDTA 2KMLA 3G5LA 5DFAA 1T9CA 5IP5A 1NLZA 2DY0A 3F8WA 2ZIWB 4HQKA 2C78A 3ENNA 2R7AA 3PQ6A 3HWX1 5THKA 4B4KA 1TVKB 1OUMA 2FZVA 4U0JA 1HM5A 3C85A 4YMIA 3OQPA 5CK4A 1U31A 3OOEA 5EQJB 4KQXA 3EZLA 4ZYZA 5EJ7A 4G0YA 2XZOA 2MYUA 2NVOA 2IU6A 3M5PA 4ZYVA 3VTFA 1G2QA 2CHGA 3DE2X 4GG1A 1FUKA 2AHOA 3VJMA 1KJ9A 3O1HB 4NK5A 1OILA 1ZAKA 4A6EA 4OXYA 2C03A 2C54A 3NETA 4DA8A 4MVJM 4UOZA 4XX0B 3KK0A 1J24A 2NTVA 3I5AA 3LLCA 1XZ8A 4IXWA 5JDCC 5IBPA 3DE1X 3GUYA 4MYTA 2Q3LA 1SUSA 1TO6A 3FCYA 2FR1A 4QBTA 5CCEA 2QSJA 2HQBA 3FBTA 4CLDA 2YVLA 2BSAA 3FOWA 1W47A 1YA6A 1OJLA 3PD0A 2CFIA 5C1DA 4XQ9A 1FU4A 3TOSA 1ZBQA 1OOEA 3E9ZA 2TMDA 1IPEA 1QMPA 1CCWA 1N6KA 2WW8A 1CQZA 3OTGA 3R7NA 2YNMA 3F6PA 3BEDA 5A3SA 2C2MA 1Y80A 3BB1A 2E6UX 3FDJA 5I3ZA 3AVOA 5IAAA 4BLUA 2MINB 3NDJA 3JQAB 3N05A 1PHRA 2IDKA 5L7WA 5CDFA 3STTA 2GAFA 2ZWAA 2FLWA 4BMVA 1E0JA 1N1DA 1UOQA 1K7EB 3QU4A 4TROA 5HKKA 5LMNB 3UJPA 2AJ8A 2HJVA 3L82B 3TZEA 1GVNB 2PNFA 3NUZA 2J3IA 2YJ5A 2HA6A 3CEMA 4DDVA 5AMXA 5CVCA 1VCMA 3WGYA 3U7IA 4A26A 2WYVA 1QVRA 1SIBE 1ZG3A 4Q47A 2X1VA 4DCTA 4QXPA 2F3SA 1J2RA 1NN3A 2W2TA 2ADMA 1SB9A 2AXPA 1QHGA 3F2IA 1L7DA 5FBRB 1K9SA 2QUHA 5D7NA 3ZU2A 1Z6YA 2XXAB 4F60A 2VF4X 4L28A 4EG0A 4D0SA 3ZDCA 3OMXA 3IVGA 2RBEA 2NP6A 1T9ZA 1IUOA 5C8XA 5K6AC 3TI7A 1F17A 2PSFA 2ZB7A 1G3MA 1SGWA 2W8BB 4JKIA 3UAVA 3G2NA 2J5XA 1J9EA 1V9LA 2HD4A 2XSZD 1RI1A 1IMOA 3EGXA 3EBPA 8MHTA 4UNSA 3TCNA 3L77A 5SY6A 3L6EA 4HNQA 1XDWA 1L4KA 5EIAA 4IQGA 3I45A 3OZBA 2O0KA 2WPNA 3UUWA 1DINA 3ABIA 3ZWAA 1XCBA 4YAKA 1R3DA 2MSWA 3V4OA 4M7WA 5ERYA 3Q8MA 4UUMA 1XNQB 4PO9A 4OYRA 1JVNA 1QIHA 3PQ8A 2PRSA 2WF6A 2CB0A 1OWLA 5ITZB 1P62B 3FAKA 4Z0HO 1YK1A 2PVSA 5I7AA 2VQ3A 3QLEA 4YAOA 3AERB 3ZBUA 1TCAA 2QLLA 3E18A 4ZZ0A 1VKJA 4DDKA 4AK9A 5FHRA 4R1PA 1UZAA 4JBLA 1QIIA 1RE1A 2ZBEA 2A7QA 4XUEA 2AFIE 2Q99A 4DT1A 5FDFA 5KEIA 1MZPA 2WG0A 1ADJA 5HUQA 4LJSA 4KXYA 5LLDA 2WD8A 4FKZA 1B2LA 4WZZA 2ERYA 5F52A 1VPVA 3U7HB 1D5CA 1P2GA 2BY4A 4MW2A 4Z6KA 4Z4GA 1E7RA 4NDAA 3WBBA 1GTJ1 2JKYA 4QXRA 4RETA 3O8QB 1AQJA 2IXDA 2XGOA 3PVSA 4K9LA 5CW2A 5FPPA 2D6FA 4IDQA 1E69A 4E31A 2G70A 2RGEA 1SBHA 4KKVA 3VO2A 2Z5LA 5C7IO 5LMUB 1NSTA 1M2HA 3ABOB 1RAAA 2AMLA 3PK0A 5AI0A 3PD7A 1FDTA 1K3FA 4GC9A 4LZOA 4PGHA 2IYFA 2DKNA 4WUVA 3R5SA 1N9GA 5AOAA 3GH3A 1RZRA 3SJZA 4FEGA 2HTFA 4OJYA 3CKYA 1UK8A 1WXIA 4B9EA 4FR5A 2PX5A 4K8RB 3RTGA 1SVMA 1W0CA 1WZCA 3S28A 2JAPA 4ZO8A 4D8TA 3SP1A 4ZV7A 3D9QX 2PGDA 2C3PA 4OXRA 1E66A 5BY2A 1U90A 1ZH2A 5JSZB 3HGTA 3RVRA 3LX4A 3N2EA 1JG6A 4XKJA 1OX4B 1ESCA 1NW3A 2AMVA 3G0IA 5ITWA 4YAWA 1UH5A 3P2MA 4TN1A 3ZHTA 4A1FA 2ZTVA 3KIPA 5ANRB 4QG3A 1X1DA 2XB4A 2R1UA 2BRUC 4CEHA 1YB1A 4UCFA 5EE1A 1N7GA 1DTWB 1ODSA 3SIXA 5IVIA 4EJ6A 1PEAA 2EFCB 5AVVA 3TDKA 3SKYA 4J1TC 1U0JA 3OJEA 3FZNA 3GEIA 1S01A 2JIDA 1N3LA 1K8QA 4Y9DA 3KZCA 4P4NA 4U2EA 4EHJA 5ICEA 2VSFA 1H4TA 2BKVA 2K4MA 1PBNA 3I3SR 4O5AA 1XQVA 1DC6A 2C8KA 1KAGA 3H16A 4HLUA 4PVCA 3RTCA 3TKAA 1M7BA 4TYQA 3AP1A 1E4YA 3ELWA 1N5RA 3GJXC 4PX5A 1W73A 3HP4A 1U4SA 5DGHA 3TSCA 1K7XB 1ZXLA 2PV7A 3Q5EA 4MV3A 4D46A 3I9LA 3L0IB 4HNTA 5CXQA 2XOXA 5GIPE 3INRA 2WAAA 3PNOA 2ZE6A 2Z30A 3U48A 3FYSA 1UDWA 3D8TA 1RHJA 3H5OA 2LCQA 4B8WA 4CT4B 5JTUA 2EV9A 2PS9A 2OK7A 3KLNA 2P3QA 3EIUA 3P2IA 5IJ9B 5IK2D 5IX8A 4H0CA 4OGWA 5JFGA 2XB9A 1NAHA 5ECGC 4CR8A 1E1RA 2X4DA 4WY2A 3A9CA 1QSGA 4JJAA 4IKEA 3UT6A 2BCGY 1QQAA 3N2IA 1MQSA 4RADA 4CEJA 1H0KA 2AC2A 5MN5A 2DSNA 3ZCPA 4MDFA 1JJ7A 4CMJA 4BQQA 3KQLA 4PRLA 2M32A 3O4GA 3NJRA 1R4ZA 3RADC 2Y93A 1ZGJA 2E5WA 3PNKA 4MLCA 1ODJA 5AOBA 3PQCA 4QTZA 1ZMTA 2YFQA 1UBEA 4N0MA 4BB0A 2AYYA 4JYPA 3DV2A 4MRMB 2PL9A 1W87A 2BISA 4JCOA 3ICWA 3K9FC 1H5NA 1P73A 2F55A 1QDUA 3EGVA 3EYWA 4HGRA 4WXRA 3IE0A 4DLSA 1T1EA 2IY9A 4RTLA 1QGOA 1QK3A 2OHVA 3CH4B 3G5AA 4FJ0A 1E9VA 1E89A 3FOAA 2ZJ2A 1E3JA 3EVCA 3W6OA 1PGNA 2B37A 2IEYA 4LC0A 4QPNA 4LRQA 4G2NA 1UFKA 3FCEA 4HLDA 2MMGA 4PQGA 3UA4A 5LKRA 1HT2E 4A15A 5KNCH 2Q4BA 3TBKA 4DQKA 2PXCA 3N2NA 1KK0A 1ZS9A 3PXEA 2PUDA 3A6GA 2G07A 2WSMA 2W2LD 1FYVA 1EWQA 2WYWA 1M1YA 3E3MA 4MROA 4DEYA 1LLUA 3EPLA 3HU3A 2ORYA 5AHWA 3DOCA 4INAA 4DARA 3IURA 3RNOA 1OXKB 1I9GA 3RYIA 1Z0SA 3A4YA 3DEZA 3KR2A 2DBYA 3WK9A 5EHZA 2PGJA 4GX1A 4NBVA 3I8OA 4NMWA 4D9MA 4ETIA 1VL5A 4ZQGA 2I4TA 1LZLA 3KDSE 3WLJA 2PX8A 3ZK9A 5JD6A 4JBIA 4YRJA 4NBWA 3C16C 4TWRA 2LIVA 5K6TA 4RTJA 4N1AA 1K92A 3C8MA 2QN3A 1SK8A 4QWWA 4RZ3A 5AK4A 1HT3A 2ZBPA 2WSLA 1DBRA 3KSMA 2HJ9A 1R0WA 3E1GA 4QSHA 1N6PA 2GO1A 4I08A 2XXJA 1I2DA 3U7EB 3WIDA 1TCBA 3B53X 1OI7A 4GX2A 4P38A 3VC1A 2Q3EA 3WLMA 1F0YA 1HDGO 3G88A 1RWWA 4DABA 4B43A 2PRYA 4RJJA 3KSAC 3N2KB 1B74A 1BFKA 5ERXA 2DG2A 2V7XA 4OA5A 2XYVA 4ISCA 2JGJA 3G2JA 2DPGA 3EEQA 3P9KA 2OXFA 2DFKB 1FVXA 1O94A 1U8XX 3GLHB 4KNWA 1BE0A 4TQAA 5HEKA 5IDVA 3A2NA 5HNKA 4UBMA 5JVDA 1XEXA 1SB8A 1R9GA 5IUJC 2QGZA 2G08A 1EM6A 1R0RE 2OCGA 2VHCA 4GI5A 5JG7A 3VOBA 3X3HA 5IVDA 3UCFA 4CLXA 2V3VA 3MWGA 3UKDA 5KWSA 3LQQA 2ZBRA 1MABB 2NUTB 2QGNA 1LWNA 3BTSA 4R6WA 3RTAA 3ZXSA 4RKQA 2YY6A 1NBEA 5AVJA 4QUDA 2YRFA 4PZCA 3F6CA 2MTBA 3ACDA 1CUHA 5LOVF 5AJTA 5A0TA 5COQA 2GF0A 1CY0A 1ZD3A 5E0KB 3AW9A 1AQ6A 1H05A 2G83A 3P45A 3N5CA 4AYWA 2DFVA 2EJTA 4U8GA 5IKXA 3LW8A 2QV0A 3L43A 5JCJA 3COSA 1NLMA 2XJ4A 3MQ4A 4GL4A 4LV6A 3BZUA 2R6DA 3FCSB 1CJTC 2UXCB 3CVOA 2V58A 4ECAA 2DBQA 4WZBE 1C3OA 1TKBA 3U7JA 2BZ0A 1E2UA 5HDQA 2HYDA 2P2GA 2IPOA 2FP4B 2FOIA 1MB2A 2TMKA 1DPFA 5FH9A 9ABPA 2P2LA 4NU6A 1T4GA 5BW8A 1H94A 1JHAA 1QIJA 2AV6A 2IHYA 2WJ4A 3EYAA 2FJUA 4BRSA 1ZOIA 3CF4A 2YBEA 3E15A 4JC4A 4RYDA 4XUDA 3U60B 5KNCD 2F90A 5BR4A 3CLRD 5EP1A 3GNLA 4BBZA 5F1PA 2AG1A 4HGOA 3DFZA 3HKCA 1OLXA 3LLVA 4M1MA 4C6TA 4I2NA 5J2TA 1XWFA 1GLNA 3KSRA 3FD8A 1BD3A 1ND5A 4MI6A 3W04A 1TAHA 4OJQA 4L27A 3P0HA 1QHIA 1Q3KA 1FX1A 1Z8NA 1ZISA 3RRXA 1KAQA 2WKPA 2Z5FA 4ASUA 1OU0A 4RSHA 2O19A 4G65A 4YQZA 3ICOA 4N3GA 3JD3A 3GJSA 1A0OA 2CUNA 2W00A 2B8NA 4Q9AA 1UC4B 5ALGA 5FCDA 3LC0A 4G01B 4WA7A 4XIJA 1YFKA 2RGNC 3CLUD 1J5XA 2AFRA 2OUKA 2VJPA 3GJQA 3K0AB 4KZKA 4X84A 4A7PA 2B35A 3D6JA 4IJKA 4EJSC 4D8WA 4I8DA 5JOQA 2X23A 4RZSA 3WLSA 1BW9B 3LCJA 2NZYA 2UVDA 5IFKA 1ULHA 1WP9A 2CJYA 2PKQO 4TXJA 4ZN6A 4B3BA 4NZOA 4FYIA 2QD3A 4EW1A 1L3IA 1ONNA 3B9RA 3A6PC 4DJTA 2INGX 4K9OA 1DO0A 1F48A 2GNAA 3KKMA 1XMVA 1R0ZA 2VXCA 1QZ3A 5C32A 1YJAA 1PU2A 1P2SA 1X7WA 2FPMA 4PG6A 4C3VA 4DQXA 1KEPA 1WXGA 5IM4F 2JI7A 3EZ2A 1E3WA 2IE0A 1GZSA 2ISSD 3UKJA 4DMUB 4I9GA 1XG5A 2EG9A 2C4WA 2VUHB 4IQFA 4UM8B 3UJ3X 2AMYA 4BFWA 3TPFA 4Z86A 1DAGA 3TX6A 4RORA 4UDXX 1A5BB 3SY8A 1EQAA 3RR2A 2P1ZA 1P5ZB 1ZK0A 4JFRA 1UFOA 1BFUA 3SSAA 4AVYA 3U81A 9ATCA 3NHMA 2UYOA 1O89A 2V03A 2BP7A 1XL1A 1ZOLA 2Y2UA 2FZKA 3L7NA 4EENA 1T5LA 5SY9A 3VPCA 3OEYA 4YUYA 1E79A 3GFVA 1GZ3A 2I3ZA 4HY3A 1FBNA 1OWPA 1UKYA 2NUAA 4CM1A 5A3QA 1HOXA 4DAEA 2JIOA 2E87A 3PFNA 4I4IA 5B1EA 2XITA 2JLAA 3JARA 1M3SA 1SIUA 5C9ZA 1XTRA 4ZT3A 1F2UB 2AOXA 3C0KA 2R1VB 2WSYB 1NMSA 1KO8A 2AR7A 3HDQA 1O0BA 1C8KA 2R8ZA 2EFYA 4B48A 4FW8A 3ADDA 2MSDB 5DM4A 3MN1A 1X70A 5T5QA 2H7XA 1E3IA 4OYLA 4IMPA 3NX4A 2IWHA 3LTEA 5JPCA 3EC1A 1US8B 3IPAA 3CNEA 3QXHA 1HWYA 2B82A 4CRWB 1UDAA 2EF1A 3QKIA 4V0MA 3BA1A 3EIHA 3CFYA 5HBGA 3ZLBA 1TZBA 2O7SA 1JPVA 2GSDA 5MGNA 3V97A 4AG3A 4K6KA 6YASA 5TE9A 2CWDA 4Q39A 4KQCA 4XJVA 1BXGA 4R6XA 1R9JA 1LFDB 3FBWA 4P4TA 2HMSA 3S2FA 4MDHA 1OKKD 4XYGA 1PDWA 1VXOA 5MGBA 2G88A 1LTKA 1GNLA 1CS0B 4H1HA 4QC2A 1JALA 3T9DA 1KTVA 3I2JA 2FZGA 1O96A 4WFJA 3U4MA 3RJ5A 3OZSA 2LGJA 2I1VB 5JPDA 1ONSA 3ZI0A 1KPHA 4CWAA 1E1RD 1S1MA 2AD1A 2O8BA 4HAVA 3ZC3A 3DTVD 4ZDJA 2QUAA 4ENSA 1T5SA 2XYGA 3IUNA 2P27A 2UVQA 3MQ2A 3AY6A 3ZV5A 3WGOA 1E1CA 1P2TA 3E4DA 4BRWA 3RRJA 4AZWA 1SOVA 1ORIA 4MP6A 4JZYA 2E89A 3KETA 2QYSA 2Q49A 4L8LA 3IHTA 4PS0A 4PHGA 4PYKA 5IKEA 2VQEB 2ENUA 5THQA 1FXUA 1SHZA 2ODQA 2RH4A 1H1LB 5AM4A 4IVPA 5JI2E 1CQIB 1TK3A 1U8FO 1YU6A 2QLTA 4FFMA 4BFUA 2QF7A 1NNUA 3D8UA 4HT3B 3NHBA 1Y42X 1I6WA 3RDPA 3ZTTA 3IVMA 3P9CA 4ZCSA 1FX0B 3N2GB 4IDNA 5DBGA 1WVIA 2OQ2A 1NKTA 1ZIDA 4W5NA 2CE7A 1AUOA 1Y8RB 3HYTA 3OF3A 4ND4A 2Q28A 3AKZA 2ZE5A 1HFKA 1G20B 4XWYA 5HVNA 3L41A 1PW7A 1UMBB 2PD4A 3A1TA 3TTYA 3HPQA 1E9EA 3F9IA 3DV9A 2CJPA 4FYKA 2ZT6A 1KK3A 2GJ9A 2WSSD 2O2CA 4QGGA 3T61A 3NIGB 1V6AA 4NDZA 3EUFA 3RRBA 3MWJA 4CM7A 3ANLA 2PCLA 4M1ZA 2JIQA 1MENA 1OR8A 2SKDA 3DXZA 2IX3A 3O03A 2VT3A 3Q8XB 4EUFA 3LTNC 2QTMA 3MMSA 2PPLA 2BGUA 1E18A 3JYPA 2XMBA 4PZLA 3KVOA 2O9JA 3GDHA 4J8PA 3DPUA 2I7CA 3QK7A 2F9MA 3UYLA 1IZ0A 1YVDA 2CZCA 4H3HB 5A1JA 1R4MB 3T3PB 1E7WA 1EWVA 3HJRA 5ETJA 4ZT2A 3ZW7A 2XYHA 1XMQB 3HWRA 2RGXA 1NGSA 4QOHA 3RUEA 3U9TA 1XUOA 2QRMA 1ISFA 4KHZA 4N39A 4PYRA 1YZGA 3NZEA 1IPHA 3A36A 4OJNA 4EPWA 1WXXA 1KEUA 1RHRA 2YX1A 5IJ0A 1R0CA 3MWEA 4KVGA 1Y3BE 1A8HA 4QAJA 1IC6A 1U1GA 3QSYA 2GBFA 4X1IB 1L4UA 2EQBA 2W90A 4P81A 4EF4A 4MP8A 4UXJA 1KVRA 4Q18A 3IIEA 4EHDA 1RAEA 1T8YA 1UWVA 2X9VA 2QN9A 2V65A 3LPLA 4U4AA 4HEHA 1YH3A 3H2ZA 5E9QA 2CVOA 5K1ZA 5BYAA 4OOFA 5B2ZA 1GRNA 4FX5A 3DBRA 3PEWA 3E61A 1GZUA 3H86A 1HL7A 3IVRA 4NOJA 1T4CA 2EU8A 5IH7A 3BG5A 2PKRA 2FLVA 3CNBA 3KLPX 4IF4A 4HUTA 2ZR7A 4KRGA 1APBA 4A2CA 4PLHA 2AW5A 1RYEA 2ZSDA 5CB4F 2P9CA 3A06A 2UUOA 5T6BA 1V11B 3RSHA 2BMAA 2Q41A 5LIRA 2O3SA 3RANA 4R8VA 3VR3D 1CWUA 3D7KA 1OLSB 3C5EA 5DHRA 3WK6A 6Q21A 1O6CA 1E8NA 1L4HA 4BGEA 3S81A 3M4ZA 4J07A 4A9AA 2J7PA 4PICA 3I5XA 2BKXA 2OLJA 4O33A 3ZCUA 4B71A 4BX8A 4DOMA 8OHMA 3NTVA 2BGNA 2LR0A 3B1YA 1EEXB 1KSHA 3QOXA 4QEZA 4DZRA 4EKIA 4ND8B 2R4QA 5JHHB 2FFQA 4UPDA 2LRHA 2G5PA 3GLRA 3ZZ1A 5JQWA 2J45A 1ZESA 3HJFA 3SYTA 2GK7A 1TIKA 3MTBA 2M6KA 3NTRA 4BZQA 2ZIAA 3OU6A 4CZ2A 4L76A 4DCNA 4EGCB 3FYUB 3OU2A 3W7BA 2KM1A 2D0PB 2VLBA 2F59A 2F8MA 5FV7A 3UWSA 1SKUA 1PUIA 1DS6A 3RT1A 1GTMA 3KX2A 3DA8A 3GFTA 4UC0A 1XP5A 1CF9A 2A8YA 2DCMA 2Q6OA 2PS3A 4MINA 3VPDA 1HGXA 1JR2A 5FYDA 5K0BA 4F5ZA 4F3NA 4IDBA 4D0RA 4L95C 4LF8B 1KYXA 1L4MA 1Y6ZA 2DTXA 4R2KA 5EP4A 1Q0TA 3R3YA 2HJRA 3WQQA 3U5ZB 3E8XA 1FNMA 4G23A 1UP6A 1M2FA 2UKDA 1GQSA 2VSYA 2W2QA 3L9XA 2JGNA 4POAA 1CY2A 2Y0EA 4MKRA 5CJ2A 4L4SA 4IHJB 4N12A 3WL6A 2CSUA 2XVZA 5C35A 2FSIA 5EMNA 1ESNA 3EAFA 1HY3A 1C80A 1I2CA 4U9UA 3ZZNA 2AI1A 4UTZA 2YIMA 3X1YA 3LBNA 1KMIY 1PS8A 2R79A 4FMDF 4M9RA 4P4LA 1UBRS 2XMCA 4OYHA 1RS0A 3QE0A 2AS0A 4HK4A 1YB2A 2ACKA 1DU4A 3B3FA 4M3NA 4YIKA 4DBLC 5DGXA 4CBVA 2QW8A 3FDZB 4KJZA 3DOEA 3FYCA 1CUUA 4RPCA 1R64A 3DWGA 5ALEA 3RQIA 2PV0A 3CKLA 3O83A 4Y2RA 4GBED 5LYJF 4I1SA 4C5BA 4E2XA 1IATA 2IH5A 1LS6A 1JWAB 2QNBA 3BMCA 3I9FA 4L16A 5FLEX 3RD5A 3GA7A 3KSBC 4DMFA 4F4FA 1V43A 1XQ9A 3CRW1 1CUEA 1D07A 3TB4A 1SD5A 4TLLB 2FHPA 4P82A 5DHFA 3UKOA 4AT1A 1Z6TA 5I7RA 4GUDA 2WHXA 3SNHA 4IDCA 1R6VA 3WSWA 2W6CX 1B76A 3JYOA 2IOHA 4O2AB 1AY0A 4G67A 3ZDEA 3UF0A 4E4YA 1JIUA 1I14A 3CG0A 1UJNA 3MBKA 3BJIC 2ZTHA 1LPMA 4ZZ3A 5D5PA 2PMBA 4JLJA 3AHCA 1FXSA 2C2OA 2FJ0A 2VXOA 3R2JA 4JYCA 4Y7DA 3RVNA 3PZBA 5LSAA 2QL7A 4DB2A 1Q3TA 2GSWA 2RKBA 2VPTA 4IIYA 1JG1A 2W4QA 2PSJA 4QOEA 3SZLA 1OLUA 3H2JA 5JZBA 1WHSA 1E63A 1FY2A 2CFRA 3WL4A 1BO6A 2RB5A 4C4XA 5EZ5A 1FE8A 5JZMA 4D8YA 2GBIA 1U6JA 3JQFC 1NX9A 4LSMA 2QP4A 2XNHA 4BP9A 3DM5A 2W4MA 1ZXBA 4KL8S 1KKUA 1H3NA 1CY4A 2C1EA 3I52A 3P9PA 4PAWA 2OC4A 3PJFA 5E3HA 2RBKA 4TQ9A 4N7RA 3S40A 3QRWA 3C5WP 5F7OA 2YWRA 4DADA 5J4LA 1TU0A 4IGIA 4RNDB 1E1NA 4EI2A 3UC9A 4S04A 2WICA 3SIWA 4GUAA 1ZK1A 4AY3A 2VDWA 3M6MD 4Y1RA 1NOKA 4CQMB 4EMBA 1LBHA 4CF5A 2O2YA 4DG8A 1R16A 5AK6A 3P5SA 4MV0A 1SBQA 5HDBB 2Y1OA 3NTQA 5H70A 4W9RA 3PJRA 2EYUA 5AKJA 2IA5A 5EWMA 3E3OA 3PDUA 3TEMA 4UNNA 1YDGA 2VZ8A 3MGGA 2MINA 4MR7A 3LL7A 1I4EB 3GCGA 2CJWA 2HQOA 2B2CA 2CJWB 3AHJA 1E59A 2VK1A 4O8ZA 5E6RB 5HFAA 3NMUF 3WRYC 4HFMA 1TPZA 3LQFA 4Y6QA 2FEMA 1QKIA 4OD0A 2PT6A 4I14A 2DR2A 3CZPA 2WF8A 2QPTA 4FGKA 3DHYA 4PIMA 3THWB 3Q40A 4OEHA 4DUZB 2A9KA 4U00A 4PN7A 3DQZA 2D54A 5EZSA 4J2OA 2I3DA 1C7QA 1PYOA 2CKDA 4LTDA 4W6ZA 2V98A 3RYFA 3EUWA 3FYDA 4AZVA 2ORED 1NYTA 1W9HA 2B7CA 1H2EA 2E82A 3CO5A 5GPBA 1N2BA 3ROTA 1KO1A 4NHOA 1D09A 1DO8A 2O1XA 3GT0A 4JB0A 3H2KA 4CI9A 2OTCA 1EMDA 3D0RA 2F43B 2XXAA 4R05A 2UYGA 2G1JA 3B36A 4MGEA 4YI5A 5LCXA 3SFVA 3QVSA 1MKYA 2I87A 5TB5A 4IO0A 1EP2B 2BR4A 4H4EA 3E82A 4HH1A 4QHSA 4AP9A 4PQRA 1XVLA 3S1AA 1Z2EA 3I23A 4MNTA 4PLFA 4BOYA 5IHXA 3SVTA 4DM3A 5BORA 3X1WA 3CGWA 4YXWD 1IHDA 1I33A 3KSZO 3ZXYA 3CVXA 4Z3OA 2QN7A 1TCUA 1X9HA 1QHNA 2G7MC 2Z2KA 3L46A 3SMQA 1RWMA 1RXIA 4KHPB 1ABFA 1E5TA 4G8DA 4U8HA 2ZEJA 3M5DA 4GMGA 4LRUA 4RENA 1B93A 2G04A 1X87A 1OJ7A 2PKEA 2VQSA 4OQLA 1D04A 2J4DA 1ADBA 3VPSA 4D3XA 4KOEC 3FB4A 1QPGA 3EVAA 1QU3A 2PZFA 1IU9A 4RD4A 1ZBDA 5ICMA 4F3TA 4BQEA 2QQ5A 1HPLA 5DK4A 2IYYA 1UIMA 2JAQA 3DL4A 2WC1A 3T1YB 2J08A 3K09A 3VO1A 4EVIA 5L51A 3WJ7A 2X14A 1L8AA 3V6LA 3HUEA 2HMUA 1BCSA 2QUJA 2I2XB 3EIXA 3FROA 1QAOA 4OBXA 2OXTA 4CIWA 3LT0A 2V0GA 5G4LA 3TFWA 2C99A 2CFCA 4F6RA 2F8LA 4FE4A 4DLXA 1NMEA 4HPWA 4CT5A 2DSTA 1X94A 4ZVSA 2C29D 2V8OA 2V4UA 2NTYC 2V5AA 3C3BA 3GMDA 4RJKA 4ZVPA 1MB9A 3PFBA 1XTZA 4NABA 3B1WA 3ZGVA 4JGGA 1NQ5A 3IOEA 4TYMA 1G9SA 3OJWA 2M2IA 3QLUC 1VA4A 5IDYA 1N4AA 5FTLA 4NHEA 4C4TA 3NXSA 5DNUA 3Q7PA 3S8EA 4CV2A 1HYEA 4D57A 4EGFA 4RL6A 2JHGA 2J85A 1CZKA 1R8XA 2H1WA 3SS8A 2Y9PB 1JG4A 4URFA 4KR6A 1NJ2A 3A9SA 2AD5A 4A36A 3UFXB 1I80A 4NENB 5B37A 3OHMA 4FJ2A 3VR3A 3N70A 4F6CA 1BVHA 1PG0A 4E08A 5MDHA 1W88B 3QPAA 3K15A 4RGQA 3BGIA 1OPRA 4IH1A 2IYVA 2IHVA 3NAQA 1CR0A 3SXJA 1VHDA 3RUCA 1E6KA 2P40A 1R5NA 3QF4B 4QT0A 3B48A 3FX2A 1QZXA 2YZGA 3BK2A 3KZOA 5KKAA 1S1CA 1HQCA 4GNKA 1BDBA 2CMHA 1TA0A 3Q6NA 2XNDD 4EW2A 5B3AA 5JY6A 1JB1A 2BZGA 1G5IA 1W30A 2OCYC 5K8JB 4QDOA 1GPAA 3LX5A 4NYMR 2AXEA 2C9ZA 3CGGA 4TLEA 4M36A 1F2TB 2R1TB 3TE7A 2GK4A 1QQTA 1P2BA 4ROSA 3OE1A 3EG9B 3FMPB 1V71A 4ENRA 1U3DA 3F9CA 2ZQ5A 2PT7A 3EXEB 3SWWA 5LXTA 4JVOA 2GKOA 5JDCA 1WLSA 1CY1A 1KOFA 3ABZA 3EOBI 3R5KA 3AFOA 2B8TA 3EG5A 1VSBA 1ATIA 3EZYA 3N8DA 5ALZA 4AMVA 2YV5A 2XJ9A 3ETNA 2IUTA 2VJMB 1ZVKA 2GPSA 1ZW6A 2J4FA 2V6GA 4L74A 3RLIA 4E21A 5BN5A 3WB0A 1NVBA 2GEJA 2VAXA 4RPLA 3R76A 3NV9A 3OLXA 1MA3A 1OFGA 1V1RA 1UDBA 1RJWA 2WHEA 4BNDB 3GFFA 1FUUA 1HLDA 5IKOA 5A1TA 3FUTA 4O4HF 4OBBA 5DT9A 3F46A 3LGAA 1Y9JA 4JC8A 5JAQA 4X1KB 4JYZA 4IWYA 4NE2A 5TV2A 2VR1A 2A3RA 5CIWA 5KTRA 1MU0A 5CVJA 2PN1A 5BUQA 2PUBA 3AETA 1JZSA 4G89A 4EGAA 4KUGA 4NBRA 4ZI7A 3AR7A 3X1DA 3GEPA 4ONEA 2XRFA 3OIFA 1E1QD 5JYBA 2EX4A 3O3MB 1OSNA 3D8NA 3LQ2A 4DSOA 2OAP1 2C9MA 3KD2A 5ITVA 3TL2A 4J9VA 5C5EA 2JGRA 4JEMA 3TLAA 4RA6A 5KYNA 3JTMA 4C2AA 4O4HA 3IDFA 3N86A 4LDJA 3L04A 5K3FB 3OE4A 1GCUA 2O5CA 4JJIA 4N65A 5IDXA 1CEEA 3LK7A 2NU9A 1LTHR 1RRPA 2NNLD 2RK6A 4K81B 3I6YA 4KMRA 4QYTA 1U2EA 5D6OA 5E4FA 2J3DA 4RTPA 5JJKA 3DH0A 3IPXA 3RS0A 4A5OA 2DUWA 3NTLA 1S96A 4B2YA 3MRVA 4KDEA 3VUEA 3H5NA 2PRZA 4A0SA 3SFTA 4ZHQB 4WBXC 4MW1A 4F97A 2PWYA 3L6UA 1A9OA 1O6BA 1RXEA 3ZE8A 2PUGA 3R9XB 5EJAA 1MOPA 3FVRA 3EQZA 3FHTA 3NWPA 2C0PA 4MWSA 2G1PA 3TS1A 4LYHA 3ZU4A 4DV7B 1ZIYA 4QNRA 5TVGA 1UEIA 4BGIA 3SEFA 3N6RA 4J3FA 2K6GA 3HCAA 3I1YA 4OHXA 1EFPB 1EH5A 1NJSA 3H7IA 4PYNA 4XFKA 3ND6A 1G7RA 3OQHA 2X1HA 2JGKA 4XUCA 1FLDA 2BFDB 5D3QA 2NV0A 1PEKE 4HRAA 4HWOA 4DQVA 5F9MA 3ZGZA 1G8YA 2EKBA 4MVJP 1IOWA 2BL4A 3W6UA 2GCOB 3STXA 3WSVA 2GBGA 1UWLA 1WXHA 1LW6E 3H84A 5BMOA 1YHZA 1YMQA 3R8CA 1P5JA 3EH1A 4MZXA 1U3CA 4QPPA 3SF8B 3TI9A 4LRYA 2PA3A 3GCXA 3KHKA 2W6JD 1OLXB 1M8JA 1DJQA 4M0MA 2N46A 1GGHA 1ZN9A 4HNAB 3H1TA 4MJLA 3WGGA 2DM6A 2HCTA 2UYHA 1UAYA 2RI1A 3FDXA 3PV0A 1U7DA 1B43A 1V9CA 1X92A 2FPRA 2NTJA 2FN3A 2GXUA 2I2CA 4LV8B 2IYEA 2H5IA 3H0KA 3ZI7A 4F11A 1TIBA 1UC9A 3QU2A 5AJVB 5KYGA 5J4YA 4H7KA 5BVGA 3V2GA 1OFUX 2CFTA 5CNMA 3DNFA 3AVQA 4KE6A 2H06A 1I3LA 2JCVA 5ALFA 5BSGA 1IOVA 1WBBA 2FG5A 2ST1A 3GJRA 3GXBA 2NT4A 4FEYA 4V02A 4XYLA 1Z2NX 2Q3HA 3IESA 1TOAA 2NGRA 2BW0A 3BH6A 1YB5A 4E1AA 4Z0PA 1ZJZA 1B6SA 1D2RA 2VT6A 3A1WA 3GOQA 2C7PA 3D3QA 1E62A 3IAEA 3NUQA 5TJ9A 2OC9A 3M4JA 1BVUA 5JBNA 4R81A 5JW6A 1WE2A 1CQWA 3FNIA 1M6YA 1I36A 5C4IA 3E3AA 1NVUQ 4LBWA 3RVKA 3E05A 4GRIA 1DOAA 1WUHS 2XNCA 1QQBA 4QHYA 3U4QB 1VLZA 2AUTA 1S2IA 1E99A 3NEJA 2X5NA 2HF7A 2AKEA 2PL5A 1XRSB 2Q46A 4YQFA 1OF1A 3AZOA 5CDFE 4YRFA 2HA5A 3O26A 3W8FA 4E6EA 2GO7A 3P4YA 4FKBA 1TK9A 1CIPA 3T4UA 2QZPA 4HUJA 1OXBB 1ZD8A 5JTTA 4BBPA 3HBAA 3CWZA 3GLGB 4M6WB 1J6UA 3CT6A 2GUGA 1RJGA 4GGPA 1M66A 1QGYA 4KH0A 4Q1DA 1S4QA 2HLNA 2GVZC 2MJLA 2R7NA 1IWPB 2NUPA 2WJJA 3DBOB 2ZJ1A 5EZQA 4DKXA 4YP5A 4EYOA 1VPDA 5LUAA 2HI0A 1BDMA 5CFLA 2O2GA 5ADHA 2NM0A 1EHYA 5EUMA 3H4MA 5DNDA 4M0LA 3SQDA 4RFSA 2ASVA 4GR9A 2O3RA 1M1NB 4E3WA 4LF6B 4X8LA 3VKGA 1G19A 2OESA 1ZW1A 2X77A 3NIBA 1K9VF 2Q0HA 5K8IA 1A1VA 5AXAA 1HDIA 2YC4C 2WMYA 3FPCA 3UXMA 4Y6OA 3KJFA 4WFQA 4YWJA 4FFPA 5KO2A 4ODIA 2GM9A 4OGFA 1GPJA 1J0CA 3E48A 2BV3A 3KAKA 2QMHA 4O4LF 1JMKC 1US8A 3VFDA 1A9RA 3WHPA 1JXMA 3E9CA 1ML4A 2A1TR 2EZ8A 3MIZA 3SBEA 1GKLA 1ZDMA 3GMTA 2AOTA 1H4VB 3GLVA 4HQLA 4O02B 4TT8A 2O1WA 1G5PA 2Y77A 5ICFA 4RK1A 4WOPA 3M6XA 4IIXA 1PWYE 3F74A 3T15A 3H65A 4ALLA 1RRFA 2HAEA 3BWCA 1PZNA 4H7PA 2JGEA 3DXXA 4B6SA 1SUPA 1FF9A 1SUAA 1TU3A 4KDRA 2Q8PA 1FSPA 3QW4B 3ZWBA 4KRXA 3IEKA 3NDIA 1UDXA 3O73A 4PZEA 1BDJA 4XLTA 4ZZ1A 3O5AA 2IP4A 2F64A 1GNTA 3OQ6A 4J3NA 5CDYA 1GTVA 2AFVA 2JFQA 2YWXA 5KTMA 4QPDA 3GJ6A 5CLJA 5BWOA 4PWYA 5EJEA 1AHHA 3U56A 1J2TA 1W2GA 4X62B 1S8AA 1TMOA 2YUTA 4GI2A 5I4CA 3H18A 1FYXA 1XVAA 4I1VA 4AC9A 5K3OA 5HKAA 2FZLA 2ZBUA 3FW1A 1X39A 1WY7A 3R9WA 2XRMA 3UCXA 1FTSA 3NVAA 1PQPA 2OQVA 1X74A 2WWVD 2GLTA 3SSMA 2D62A 1T2UA 3MILA 3UMGA 4DLLA 1A2QA 3HU1A 4GSLA 3SSOA 1K89A 1NXSA 3NAZA 3ASVA 1IXZA 3QZUA 2F2TA 4D9GA 1U8YA 2FN4A 2P67A 4X6XA 4E32A 5J4KA 3NHLA 4B3HA 4F5EA 2R4TA 3LZ6A 3HM2A 1ISMA 2FX5A 3VOAA 1RBMA 2OFOA 3M4XA 4D3FA 5D3KA 1C1DA 1QS0A 1CEQA 3TE6A 1EFAA 3AUTA 4BJ3A 4ENPA 3A1NA 1CXZA 4KO4S 1Z16A 2GM3A 5KYKA 2AWOA 4C0JA 3IDOA 4DV5B 2DVMA 4LOLA 3KB1A 1PG2A 4QQNA 4DCGA 3WXBA 3G23A 1A50B 3I0ZA 1YZHA 2GYYA 4EF6A 1J2YA 1U1CA 3PHIA 1B26A 1Z5GA 5FV4A 4N0DA 2IYZA 1NX6A 2RC5A 2W83A 3KZVA 3T35A 4AKHA 3PJGA 4GOJA 4WN9A 5A0FA 3SBXA 3EDQA 2Z95A 1PW5A 3DE7X 3AHDA 4C88A 3DAPA 3DFFA 2VXYA 2AOWA 4B6PA 2EW8A 3HFJA 1SRQA 2ZJ6A 1NXQA 2IVFA 1I32A 1O1YA 1OHHA 2GPBA 1LEHA 1ZJ4A 2VDMB 3BCHA 2ZI6A 1BG6A 2HREA 4R0MA 4QJIA 4E46A 2OCKA 3JRNA 3H99A 3GAZA 3OPVA 4G07A 4F5WA 5KQPA 3VA7A 3OIYA 1FP4A 5HKLA 3EFBA 2GDZA 3FN4A 3SLRA 4DV3B 5ADVA 1CU1A 2YC2C 3PCRB 1COWA 1Z5OA 2FUEA 2YVAA 3FDFA 1AS2A 2AE2A 3S6JA 1G2PA 4GS5A 1SKYB 3WDKA 3BDVA 2PUAA 3DZCA 1NJ8A 3OWOA 5H4HA 1DJOA 2D7JA 3DD5A 1SXJE 5KWEA 4FR2A 4JUCA 1QG2A 4CG2A 5HX7A 3M6LA 3PIDA 4YJ2A 2VJBA 1IY1A 1NVGA 3PXCX 4Z4HA 521PA 5BV0A 1XEWX 4M1WA 2HM7A 3BTUA 5AUPB 3JR7A 2NYRA 1ZNWA 4J7UA 1GG5A 2PXAA 2ZE7A 3ZKWA 3K9LA 1IRXA 4TS4A 4A2PA 2EOAA 2WJAA 2XZTA 2F1RA 5KQMA 2JLYA 5CLLA 2G71A 2ZAGA 2O8BB 1Z5VA 3DHWC 5JS6A 5IVPA 4BVFA 2YV2A 1D2CA 1TCCA 4M0FA 3ZWDA 2BF4A 3KBBA 3V9AA 4DB4A 3W3AA 1CERA 4MJ7A 1HK7A 3QBEA 2R6R1 1K7YA 4QLBA 3SLKA 4PR0A 1Y9DA 1XAJA 3F97A 3NBFA 4IAOA 3KTOA 3P19A 4Y9TA 1M2VB 4FFBB 1JT2A 1PP4A 1XZHA 3P9SA 4MUNA 2XTAA 2CXSA 1CJCA 1T6YA 2IHBA 1CNEA 2VA9A 2QEQA 3EQ6A 4R9RA 4AF7A 1XTUA 1PVOA 3GARA 4MPDA 3MELA 1ZZEA 3TGPA 3KOUA 3G2IA 2WT9A 3DPSA 1WA5A 3RYIB 1DQSA 4XE5A 3UV6A 5F98A 3MFYA 4FE7A 3HL4A 4OYYA 5AI6A 5DDIP 3BSSA 3WGIA 1LBEA 4NMHA 5TT0A 1X1EA 3QXJA 2I71A 2ZI3A 1JQDA 3E6AA 4LI0A 2G1AA 1H0RA 1Q44A 4JYAB 3EXHC 1QFYA 1ZA2A 1YCGA 1YS4A 2R8PA 1RRVA 1NOIA 4MLPA 4UEWA 1OYVA 3OMLA 4PXAA 3VX3A 2CNKA 4CFYA 4DVGA 3J81A 4LF7B 3HC7A 5DN9A 1KHHA 4BWYA 3M3PA 3QUQA 1PJ2A 3VV2A 5IJWA 4ZAFA 3MJ4A 2HJWA 1TW3A 2YXNA 4NC9A 2DXIA 3LSTA 2YYYA 3GEHA 1J00A 3IE2A 1FX0A 3N2GA 2O2ZA 4NOLA 4JSRA 3LIPA 3ZU6A 1A9TA 2ZDGA 3M89A 3GA5A 4RX1A 4WK0B 4GPD1 4XWTA 5CFNA 1DIRA 2QX8A 4K6FA 4HNVA 4OQZA 4Y18A 3RIHA 4JLMA 2JRCA 4TXMA 4F06A 3AG6A 1BYIA 4V38A 1RMTA 2XF8A 3PZRA 1FTYA 1V6CA 1WW2A 1BKYA 3ID6C 3L93A 4E51A 2DHCA 3T9EA 4TLBA 4HCJA 3I4LA 5JAPA 3UJ8A 2ZKLA 5IAOA 3OCUA 3FUXA 2E5LB 3OSZA 4YJ2B 2VJCA 621PA 2NXJA 4Y0AA 4NAUA 3LUBA 1E5DA 2VHTA 4RKRA 1OW3B 3MJEA 4MVYA 4MQFB 1ZHOA 2EKZA 5K2OA 2ZJZA 1SHJA 3O4HA 2J5BA 2KHZA 4ER3A 1W1UA 4DN6A 1Z83A 5EJ9A 4FC7A 2GLUA 3IP9A 4A8PA 2B3DA 2CLLB 3HVUA 1G21B 2FRVA 1KMQA 1L6RA 1O58A 1G63A 1TM2A 1RZUA 3O94A 1T8SA 4MIEA 3THRA 1W35A 3LY5A 1SCJA 1N2IA 4ZK6A 1Q50A 1GN9A 4KXLA 1E9FA 3GVPA 3OQJA 1RM3A 4WNAA 2DULA 4WNAB 2CDAA 1DV1A 2BKAA 2RAFA 3ADKA 1FXWF 1DVRA 2X8BA 1GGFA 4EHFA 5CAEA 1A8IA 4X20A 1JXAA 1NF2A 1Q95A 1PAUA 1QFJA 1KRHA 2B4KA 2Z3WA 4HO1X 4L57A 5AM5A 1FSSA 3UZUA 4EX6A 4HB3A 4W9MC 2V7PA 3TMAA 1Q5PA 2BEUA 2JHCA 3CUEF 5L3SA 1OLSA 3IMEA 1JE1A 1XTIA 1RLMA 4P98A 4A2QA 3ND5A 1UK9A 4BCDA 4ZPJA 2IUEA 3H9UA 4WKBA 3FPAA 4BFXA 3PF8A 2N0SA 3B6ZA 4HDNB 3UMVA 1A2OA 4EZEA 3K53A 4NQZA 5EGNA 2WSIA 4XB1A 3P26A 3GDGA 2J4CA 1VJTA 1CIJA 3NC1C 3V8NA 3IAM1 3FRIA 1RYBA 3K09C 1T0JB 5U4XA 3U3ZA 3LZDA 1LDMA 3DUWA 2ZCJA 3RI3A 1XTBA 4YT5A 4HGYA 4JI4B 5HZKA 2JPDA 1EXWA 1F4PA 4EW6A 2PAAA 4BLTA 3TIXB 2HPVA 3LKDA 5AXDA 1PQWA 3KXDA 1AGNA 3E8SA 4ZOAA 1YWGO 5M29A 3ONWA 1L5SA 1RHKA 2JFHA 1REQA 2RG7A 4XUGB 1D03A 1DXOA 1M73E 4GZ5A 4HQFA 1TJ5A 1KOJA 4M1SA 4M1QA 3WTBA 4ZYWA 3CLVA 1XNJA 4LZWA 1JJBA 2IDMA 4P08A 4YECA 1ZIOA 2QSUA 3HY3A 2GX6A 2R5WA 3MAGA 1UBSB 2FEPA 1L3CA 4ZCIA 3VR4D 1DT3A 4OSEA 1KZ7B 3QPCA 1KO7A 2JBHA 2Q2NA 1E1QA 3MTJA 1NDUA 1YBFA 4RAQA 3A4VA 1G20E 1DXHA 1OT5A 1JJFA 1YR2A 2PHZA 3FF4A 4J9UE 4KX5A 5IBQA 3HCWA 3KQSA 5ILGA 2ZBFA 4RHTA 5AT1A 3L0BA 4L5JA 2HB6A 3KO8A 4I55F 3UAOA 2HDNB 4OQPA 5HS4A 3GZNB 4LHYA 2D2VA 3KAQA 4WOJA 4Y6GB 4UOEA 2RGRA 2QJFA 3FCCA 3W4JA 2J0EA 5FWNA 2G4VA 3GYGA 2I33A 4IIJF 4JNKA 1WDLA 3HN7A 5DH9A 4BCCA 4DYHA 3AIKA 3FVQA 3LCVB 2VS1A 1U3TA 1Y3CE 3C70A 5D3ZA 4CF7A 4KDCA 4O2BA 3DE3X 3BD6A 1NYRA 3CEPB 5JXHA 1VP3A 2F3PA 3LLUA 4HQ6A 2HNBA 4HYTA 1GL6A 5LQJA 5HQJA 1CLEA 2X4LA 3KFVA 3MWDA 4LSZA 4ND1A 3DKVA 3T5TA 5HGXA 1CRLA 1UF9A 1G21E 1U7UA 3MB8A 1Q2XA 1X42A 4MIKA 4M0EA 5B7PA 5BUSA 1PR3A 4PHHA 1AHNA 1GPYA 4DSNA 2WJGA 3HRKA 3GUCA 1OE0A 2D3TA 2OORA 5L45A 2QD4A 3G7SA 4FZVA 4YPOA 3MJHA 1WD5A 2AR9A 3JTEA 1JYFA 1NFQA 3IMFA 3ZD7A 1C3XA 2HKIA 1YQGA 5TPWB 3GLFE 3A4LA 4II7A 4TM7A 2H4JA 4ZICA 4NAHA 2PKWA 3KWFA 4OBEA 4D5GA 3AXTA 2XNKA 3OOWA 3UQYS 3AOEA 3QSGA 4FI3F 2DUUA 3VO8A 2IBSA 1VBKA 4U7GA 1SHKA 4G0UA 2FP3A 4TYPA 5KQGA 3IP8A 4TVBA 3UT5B 1R6DA 4Q05A 5TQ0A 1L5QA 4HAIA 1RVDA 4BX2A 4LDPA 1GDDA 1PJCA 2BHRA 1Q0SA 5JH7A 4PRZA 3TXXA 1AB5A 3GN2A 5L3SB 2QTWB 1VL1A 4F2HA 3WDLA 2K7ZA 1E3SA 5EMKA 1MTOA 1NBOA 1GZ7A 2AXQA 2PLNA 1JPJA 1U04A 4I99A 4TSFD 2V7GA 5K20A 3OWHA 4B0OA 1P6XA 5KJCA 4F4JA 1LQ2A 2QL5A 3DV0A 1MNAA 1RWVA 2ATXA 2C4VA 2W6NA 1IY0A 4JODA 4Y6SA 1SXJB 1P4SA 1RLJA 5LBTA 1GXSB 3ZLTA 4BJ6A 5KS2A 4K6GA 3HJGA 4CMCA 1RAGA 1Q22A 3UB2A 5JCXA 1WD7A 5CA0F 4JOCA 2F1JA 2O8FB 3OE5A 5I4BA 3ZY3A 2P9TA 2WJ6A 4LE2A 3I04A 4FQ8A 2CXTA 3DMHA 3OURA 3H5VA 1NONA 1NNI1 3K6RA 4RLQA 1Y63A 2R1ZA 3OIVA 1SCQA 3FWNA 4IIJA 4QG7A 4U6NA 5P8WA 3HJTA 3T0IA 1XALA 3NHWA 3VNUA 3V6MA 3Q4GA 1QCCA 2PM8A 2VC2B 3DZ8A 2G9NA 3T7JA 3F4BA 3D0KA 5E6SB 1Z2PX 2EX1A 4UTOA 3SQMA 3VZQA 3GP8A 2C8JA 1MC1A 4GOOD 4MMZB 3BE6A 3CLRC 3H5LA 3S5UA 4E4TA 4Q6WA 2XY4A 4X61A 3MWDB 1DJNA 7REQA 4AWAA 3QFTA 3QBJA 3WV4A 3LDGA 1W8DA 1I3NA 3DAOA 4LA4A 4LJYA 1K75A 5AW6A 1TZJA 1UINA 4IF6A 4QOFA 2CXHA 3JX9A 4DJJA 1H2BA 1V96A 2A5DA 1T0BA 3H19A 4KTVE 4O25A 3FCXA 2B3TA 4M38A 3U31A 3ZHXA 2CHVA 8ADHA 4ZJZA 2ZI9A 4HRYA 2X8WA 4HX2A 3VDQA 4BNNA 3LUHA 2D1FA 4XWWA 1JHYA 3PKIA 1L4GA 1VPEA 1N6NA 2FW1A 3EB9A 3G3EA 1HE2A 4GEGA 5FL7A 1EXNA 2Q4OA 4PZUA 1EVEA 4DCCA 3IV6A 3PG5A 3FWYA 4IGFA 1XPOA 2Q62A 1DKQA 3TQCA 4LOHA 5ECDA 1N9KA 4DIMA 1N7IA 2QENA 2CDNA 4W6QA 1E2EA 3T7TA 4DBLE 1VJCA 4IMRA 1J9GA 4ZI2A 2R47A 1OH7A 1YRHA 3DE0X 4EY5A 3G59A 4ZIRB 2VSNA 4J0KA 1JEOA 1YZUA 1S0UA 1OAKA 2YQ4A 1DGQA 4X5OA 2HO4A 2R7MA 5AHOA 3AEZA 3ZWVA 1JEYB 4GSKA 2J07A 3I2HA 3H2YA 1ML3A 1NXPA 3LLMA 4DA9A 3KR0A 3K0AA 4KQFA 1UT8A 2X7HA 3H9EO 4H6XA 4QGSA 1MJFA 4TM8A 1Y5IA 4KQKA 3U1TA 1JR4A 5BR8B 2V4MA 4U2GA 5LQSA 3LUKA 3SEAA 2WJVA 2ZZMA 3GJ3A 3FRJA 4J0DA 4EUHA 3YASA 1ODCA 1S2MA 4QUJA 5I4IA 4ZU3A 3SFZA 2WB2A 4GZ6A 3IIMA 3G6WA 2PX0A 4OMFG 5JD5A 3F3YA 2R8YA 4EJFA 4TWZA 5JU6A 1U63A 4LJAA 4S3MA 4KR7A 2B1RA 4NFSA 1XFDA 1CJUC 3OZWA 2V97A 1P0FA 3AXSA 2JGDA 3BILA 3KU1A 4QDUA 4B32A 1N34B 1FFCA 3DKPA 3LO5A 1GG9A 1LTQA 3E8MA 1WNFA 4HDRB 4LYFA 3UHPA 1U0LA 1POXA 5IYZA 1T24A 1E94E 3SK0A 3CX7A 4F4DA 3QPUA 1YE3A 5GJWC 5KZMB 2VK2A 3VNAA 5EKUA 5FLXA 3NBUA 2GCPA 1JLSA 1ISJA 2J6BA 4GPEA 4WLOA 1I3CA 4RNCA 1LX6A 5KQLA 2Q1XA 1QVAA 3M9LA 5DOZA 1VGVA 4D9CA 3RFTA 1BW9A 3R6DA 4L7VA 3HPRA 1QG0A 2AVNA 3RFFA 5GZ3A 3TNYA 3DV0B 4ZQFA 2HQ1A 4JAVC 4OATA 4WTOA 4F45A 3TQOA 5EIBD 4WT7A 5ALVA 1FFAA 2O3UA 2XTNA 1FDVA 3UMRA 5K0TA 3L4KA 3IOMA 1OBFO 4HADA 3WRWA 2RJNA 1IVYA 3K5WA 2QMZA 2PSEA 3KJEA 3NHUA 4MGZR 1U65A 1RQLA 4R8LA 1NVVR 1RHMA 3QYAA 4GDMA 1TCVA 2RKWA 2EC5A 4XCXA 2IXFA 1AO3A 3WWYA 1BXRB 3PGJA 3GRCA 2J48A 5CDUA 2Z0MA 3L4JA 1GT6A 3TG2A 2IZ5A 3HVIA 1NXVA 2H52A 2P7HA 4QRIA 3NYWA 3O2NA 2XYQA 1Q1EA 2OSVA 2YASA 3GC6A 4FGZA 4M21A 4UM9B 1MRNA 4C01A 1T2EA 4CMIB 5C8DA 1NWHA 2GFHA 3OZXA 2YV3A 5DM70 3N07A 1B1CA 4Q7EA 4UVHA 1FCJA 3DMPA 4N5MA 2D13A 3CEJA 3FPJA 3AUSA 2CLIB 2ZR8A 3C48A 1EDBA 4X90A 4Z9YA 2X0KA 5L3QB 4X95A 1GA4A 3CZRA 1W9MA 3PE3A 4JB2A 1C9YA 4DW8A 1MGOA 2CLHB 5EQDA 3FPFA 1G9TA 1V7QA 2SCUA 3NBMA 2ZBQA 1VLLA 2XV1A 1XQWA 1HF3A 3O0DA 2EARA 3TJMA 2YXPX 2BE7A 4I6JA 4N9WA 3TYXA 3GV0A 4RVHA 1O4WA 1E61A 4LKOA 1KMNA 4MHOA 2DKFA 3AETB 1EZ4A 1JX6A 4KQGA 4GR5A 2QG6A 5ALLA 3JR3A 2J67A 5C3UA 2NPOA 1C14A 2V5VA 2I6SA 4UNPA 1X9IA 4X1YA 5J47A 2ZIZA 4B0PA 2ZCUA 2H51A 3U19A 4WBNA 4LYAA 4N5DA 1P91A 1OB5A 1VFPA 1VYVA 4HG2A 4IEEA 4XSHA 3VSBA 4YRBA 2CLSA 4NJEB 3HNOA 1T15A 2ORVA 3A27A 4GMXA 4EBBA 1OASA 2FK8A 4IV8A 5KYYB 1KVTA 1Z0DA 5AJZA 1KE2A 2HIAA 4K6MA 4EGSA 4C2BA 3RKSA 4M55A 1R15A 4WLFA 4EPXA 1KRXA 3JZMA 2EF0A 1Y6RA 3FHCB 1KP3A 3BE5A 4JP5A 4MQEA 1JYSA 1USIA 2ATVA 3QPDA 4CLRB 2Y0CA 4L0CA 4AJNA 1GSHA 1T8UA 3OTWA 3IPCA 3OPYB 4QARA 4X8OA 1EJBA 2Q0QA 5DIFA 4CLHA 1E2GA 4KZPA 5HFJA 1V8BA 4PLTA 1DRVA 1JE0A 5TMPA 1XK7A 3G89A 3HBMA 3CIOA 1PNVA 2Y1DA 4TOIA 1E3TA 1USKA 2X9QA 3KOXA 4UTXA 4OBWA 2KSQA 2VTKA 3FVVA 5BSUA 1NBWB 4GPAA 5DNVA 4J4BA 4EEKA 5A02A 2V96A 2W2MA 2JA2A 4PZAA 5GJVC 4HOYA 1SUCA 4L8YA 3RU9A 1PLKA 2ISCA 3MJRA 1L7MA 1JBQA 3ZXUB 5L8VA 4WKGA 1IAQA 4Y2VA 4Z0NA 1SD1A 2QD1A 3P9RA 4EQ6A 3LD9A 3WWPA 2Y68A 2EBFX 4HPJB 4U7PB 2LWIA 4DMMA 2PX3A 4XIFA 1SZCA 2I9PA 1WKCA 4A16A 4AI6A 3HXPA 5F5LA 3W3AH 5LWQA 4FDTA 1VYTA 5I8WA 2OE2A 1BWQA 5SZJA 3KZNA 4K28A 2AG6A 3NKVA 3TLZA 1TEHA 2ZS8A 3ICVA 1E5LA 1NR5A 2JFYA 2QYHA 3AJ8A 4KIUA 2DY1A 2DTEA 2N42A 3FYUC 3KQMA 3P0FA 4CM4A 5E6RA 4BFVA 1U0EA 2PX6A 3BL6A 3FDIA 1V5FA 3HZHA 1YRWA 4MRSA 5JSYA 1G2OA 1S3GA 2IUFA 3R7WB 4NR0A 2I4RA 2ZCVA 2KBEA 2QY6A 3EAGA 1ZL2A 4JL5A 3G5UA 3KKKA 3PQ4A 2DT5A 3I2IA 1WZNA 2O23A 2EFHB 4MKHA 2IH2A 4N3CA 2O07A 4B09A 2ROQA 1II0A 1TTHA 2I4NA 5EPEA 1XLTA 2BGTA 3OOHA 1DUVG 3ZK8A 5IXSA 4G0QA 5K99A 4QU8A 3AUYA 1Z68A 5CD1A 3FFBA 4WCDA 1AXEA 1KERA 4X6LA 5IBCA 1N2SA 5AM2A 2GBPA 2ZJ4A 2CYAA 4U9IS 4GQAA 1OIVA 1NM5C 4ZAXA 1UT6A 4I3GA 3G7UA 3ROMA 5BW5A 3G7NA 3QXGA 1QYXA 4YROA 2D1TA 4DXAA 2HLDA 1NBHA 2AGVA 2EKLA 4LG1A 4WIAA 4KPFC 4B7AA 3K3PA 4MVJI 5B36A 1DAIA 1FU7A 3MWYW 1V8ZA 3BAZA 3QIAA 9LDBA 1TZMA 2I99A 2Q0XA 3ZDZB 1BE1A 3ZWQA 3A4IA 3TNDA 3MAAC 3SYLA 2GRAA 4EO9A 1RQPA 4LFAB 5TQ2B 1W1WA 1I6LA 3RROA 1YDHA 1KQOA 3V8QA 1VG0B 1SBTA 2G25A 2QT9A 2ZUVA 4FYPA 4NYJR 1R18A 2R8RA 4R2IA 3D5TA 3WX0A 1L5FA 2Q1TA 1C4OA 3EZ7A 4ND5A 1VBNA 2B7BA 2V0CA 1KOGA 2CFSA 1OZAA 4QBKA 1XQ6A 2C5EA 3QNUA 4J4HA 4PG8A 4MS1B 2X9NA 3SX0A 1CK4A 1TVKA 4J1TA 2OD2A 3W5IA 3T0GA 3KKOA 4R0NA 5DHAA 4CLRA 1G7CA 3UOGA 3D1VA 4L0DA 1TJYA 5IC6A 3HBFA 1KORA 4OUDA 3CH7A 5LA6B 2H29A 3MPUA 4QFDA 4ES6A 4X6YA 4NYIQ 4R9VA 3EVEA 2Y67A 1GZHB 2YR0A 1MCZA 5JR3A 1IDN1 1NUTA 2VWPA 1XRRA 4DLRA 3I9MA 3OZUA 1K8ZB 2LKDA 1TRKA 4N01A 2G63A 3TBFA 4DPMA 4MHTA 1YCFA 3OLZA 3N0WA 1JHPA 2XH8A 4X3PA 4DR2B 3O4FA 4QICA 2J6HA 3KV1A 3IV7A 2VRBA 5EERA 1MAWA 3CLKA 4ZVVA 1T10A 1EGAA 2XQFA 2NQ2C 1OX6A 3L3BA 3IIKA 4XRRA 1YTUA 5BSEA 2OGUA 1E2PA 4MS1A 3NB0A 2Q3FA 5K45A 1G38A 2WM2A 2GESA 5EP2A 1JQBA 1HRDA 2J3JA 5EKXA 3WMEA 4JVNA 3KJZA 1PFGA 3NWOA 2B1QA 3G8BA 4G2TA 4UMEA 2ZE8A 2O50A 1LPPA 3G5MA 4G41A 4RVFA 2VOJA 1NQVA 3TFQA 4EKYA 4LDQA 1T43A 3GVIA 1ZRSA 4TZ0A 1W4RA 5JNVA 4XTRA 1J0BA 2JCXA 5BN3A 1W48A 1Z5PA 3I62A 4BKPA 4D79A 5F7XA 2WHPA 2ZBDA 2XUZA 1DAKA 3GEMA 3O95A 2ZZNA 3JQ9A 2W2VA 5KPDA 3A37A 3INNA 1YVRA 5DHTA 3Q10A 1V1JA 5LU8A 3A4MA 1WO8A 2DWCA 1AK1A 3MA0A 2PFGA 1JECA 3W05A 4EY7A 5BN1A 5EHIA 1I51A 4Z4IA 3J7AC 1NZDA 2J7KA 4UW9A 3H3JA 3IOCA 2CEKA 5EGSA 2QN8A 2K2QB 4EIWA 3CJTA 2R65A 5JEDA 4BJ1A 1VFNA 5TEVA 1O77A 2MSEB 1F0KA 2I7XA 3UGKA 4URYR 2I6QA 1U80A 4BB9A 4N3NA 1XMSA 4P4GA 1B8PA 4B3FX 2WVHA 2YXDA 5TQ2A 2FW7A 2WOJA 4FUQA 3HKBA 3KT3A 1MVLA 1UJ5A 2FNAA 2JK1A 4LBZA 3TDNA 4P5PA 3VYVA 5J4HA 4GXQA 4BMCA 1O97C 2D3WA 5DW0A 3IT1A 5K3BA 1J70A 4Y9SA 4JELA 4RPKA 1Y8QB 1N5DA 1HYBA 4KJXA 5LOVA 1BS2A 16PKA 4DMCA 3DLTA 4BNZA 1JIJA 4KQHA 2QKYA 4N3BA 1QJCA 2FPKA 4WH0A 2FN8A 5AFSA 3N87A 2SNIE 2DBRA 2RGDA 2NNWB 2QX9A 1DIAA 4A0RA 3OPQA 3EBLA 4AUMA 3ZQKA 1PT9A 1KMHB 2WF7A 2DF8A 4ZT6A 4DIUA 5LJIA 4CMGA 2A9RA 5HQTA 1LNSA 3KSUA 1AUXA 4N5IX 5FTKA 5L3VA 5TRTA 4IV0A 3JALA 5DVZA 1ECLA 4YJHA 3ENZA 5FI5A 2ADOA 4F84A 4US1R 4WBNF 3MWLA 2BR5A 3VJLA 1XA0A 2WHQA 3IBTA 5B4VA 3UICA 1KZ1A 4DLWA 2D00A 5ITZA 4EW3A 1GITA 3O82A 1DIGA 4MCHA 3F78A 2LPMA 2IHKA 2O5VA 1M1ZA 4E70A 1A7JA 4FIZA 3OO0A 5YASA 1M2OA 5GVSA 4I1UA 4UBLA 5P21A 4J0GA 2FRDA 4OV6B 2WEKA 3V32A 3VZSA 1EFVA 4LF9B 3JQ8B 1QLWA 1Q15A 1EFVB 2CNDA 5B1IA 2V6FA 1JAXA 2O6LA 4G8JA 2BM9A 2QTVA 2G0AA 2C7QA 3BKXA 4GVLA 4IHJA 2GPWA 3R23A 1A4RA 1QZZA 3GN1A 1JDNA 4M22A 4KR2A 3BYZA 2ZZKA 1EVLA 5EPOA 1XD9A 4JUAA 1JAYA 4AJ9A 3BF7A 3FPSA 1BJTA 3GJ4A 3JASB 4YJGA 2HMVA 4XDGA 5DK6A 4ZOLF 2AC7A 3FDZA 4IY1A 4NBLA 2C7BA 4X0EA 1YA8A 3I0MA 3HH8A 5DHPA 1ZPDA 1WKVA 2V7EA 3VDRA 1N1GA 3H5WA 1LNQA 2CZQA 4MQ4A 4IJWA 2AT1A 2A67A 4HTAA 4R7TA 1WG8A 5EIBC 5JWHA 3H1FA 3HS3A 4TKZA 2JLRA 4JU8A 3CF4G 1PUXA 5EEGA 1ZA1A 1UANA 1JFFB 1TUBB 4KGXA 4OSOA 5JZOA 2AX4A 1U6KA 4MRVA 3SZGA 1UJCA 4Q34A 3HKBB 5KVQA 1E6LA 4C87A 4MTCA 2NAFA 4FFBA 2JLSA 2PUFA 3CINA 3WZMA 1SC4A 2HMYB 3LUJA 4BNWA 4CKEA 4HRVA 1JHXA 4JXJA 4BECA 2FG7C 1CNFA 2OXEA 1Z6AA 3D2AA 2RBGA 1WV0A 4B17A 1EP9A 3X2FA 3T5MA 3RAJA 2PT5A 2CXOA 3H6GA 2FUG6 4IFIA 3ILHA 2VH5R 5H83A 3WIVA 3C3MA 1QDLB 1XEWY 2ZXUA 1JEQB 2QG4A 3LH5A 2QS9A 4HXGA 4ZQIA 1C41A 2APJA 4LOIA 1JLLB 3FSEA 4BO9A 1VMAA 3HP7A 4DLPA 4E5UA 2POCA 3F49S 3NLLA 4MEJA 5DBFA 4CUJA 3E9YA 2ZYGA 4Q3LA 3QBTA 1KY3A 3I3OA 3WL7A 2FX3A 2YUIA 2OBYA 2XECA 3OBIA 4H3KB 2BSQA 2ZAYA 3T4XA 3FUCA 3QV1A 1QH9A 1KKLA 3FCAA 1U5CA 4GI7A 2HV9A 1YRLA 5A7FA 4N76A 3QVWA 1BMDA 2I6GA 3C39A 4C5CA 1N2JA 4FLMA 3EIOA 2VAWA 1Z6XA 1MV8A 3K2EA 4B79A 2CXPA 5B3LA 2QP3A 4MUHA 4PZPA 5AKXA 5HG0A 1HE4A 3WNDA 2J7PD 4D43A 3DHNA 5FTJA 4XDZA 2DKOA 3RU2A 3D81A 2YY5A 2VWHA 4HEA1 1JMVA 2EQ5A 5KI6A 3ZXXA 3ELDA 4DG5A 4ERNA 3AP3A 3KE9A 3MINA 4IBOA 2OWDA 1LLFA 3PDCA 3PICA 4Y8VA 5E7IA 1I1HA 4DKJA 1LNZA 2QIOA 1X7GA 3WISA 1K68A 1P81A 1JILA 3BE4A 3G79A 3N2ZB 2C31A 2NG1A 3BS4A 4MGHA 1QV6A 3D8SA 5I7UA 3CMCO 4GM4A 1DEAA 1M34B 1V6SA 2J9XB 2JF0A 3EXHB 4QYMA 2QRVA 2XD9A 4M99A 4RMJA 3AKYA 5IZCA 3U4CA 3JSAA 3LYUA 1JRLA 1QRDA 4WUTA 1R10A 4YS6A 1F1BA 1TJ3A 3CU5A 2GJ8A 5LD2C 1XQYA 1E6MA 4EUSA 3ROZA 4KXFB 4KVZA 1SBCA 1MC4A 5ALIA 3FJ1A 4HVCA 2BJVA 2ZIEA 3CUWA 4OUKX 4AJPA 1WZ2A 4CFSA 2ON6A 4YRIA 5EZYA 5DYTA 4MCIA 1BGXT 1TQ8A 3TLYA 1RACA 3FNHA 4PXYA 3K7EA 4I9HA 2ZB4A 1XKQA 3PL5A 3E1SA 3USZA 1HEYA 1T26A 2QM7A 3CPJB 3N7AA 1CSEE 3O74A 1S5PA 4GBGA 1B2RA 3SEQA 4JH0A 3TIIA 1K5DA 3BFKA 3EPPA 5DSXA 5DM60 1YKGA 4FMDB 2HRDA 3IP3A 1BU8A 4PYQA 1SUWA 4W1PA 3G6KA 3H11A 5TS2A 3PUVA 1I7LA 1KXJA 1AKEA 1OAAA 1TF7A 1KF0A 3AI7A 3C1UA 3GRPA 2W6IA 4HUQB 3D4LA 3ER8A 3OQIA 4R1TA 1NI3A 2BFDA 3DGEC 4D25A 4Y2QA 2IBMA 1AZSC 2FQYA 1L8XA 3LI2A 3U80A 5B2EA 5FUMA 3O8OB 3RF6A 3RLFA 1FJXA 4GBMA 1YR9A 4XLZA 1PGJA 2WLSA 4N47A 4XSGA 3GLTA 3KP1A 3UJNA 1JTFA 2Y8EA 2O59A 1CZRA 3O8DA 5FQNA 3KEFA 3A26A 3GGJA 1ZAYA 3GAMA 5KJFA 4LBYA 3H1GA 1M8KA 1P2DA 3D6VA 4IGKA 4WCFB 1TMYA 1NW4A 1MO2A 1ZUWA 1KDVA 2CT8A 2IYPA 1UJ2A 2NTEA 2HZ7A 4G5QA 3SF0A 2LZ0A 3GHHA 2ATIA 4NBTA 1GL9B 4LY6A 3FLEA 4I4TF 2GTPA 4CF3A 4N41A 3QWIA 1D2AA 5IZCC 3PQ3A 5A71A 1BHQ1 2HHLA 5K6RA 4KMMA 2P5UA 1ZRNA 5UKDA 3M6IA 4D9HA 4P7BA 2JCYA 4YREA 1K6JA 4RQUA 1EVKA 1TC1A 4FQ5A 2LDXA 5HS6A 5BNZA 1FNCA 2YH2A 1FOEB 2IL1A 1O03A 3WIOA 5CB4B 1X15A 3BHNA 2WWWA 4AD8A 4B4UA 4F2GA 4OY3A 1LY1A 1VE7A 2D0OB 1RJDA 1Q2UA 1XMXA 3FBGA 3G0GA 4YRAA 1TGYA 2W70A 3RT7A 1VCIA 5HUJA 5ALPA 2FV8A 5TIIA 1OZHA 3IJEB 3THSA 5C1BA 3P27A 3V1LA 4HNRA 2G80A 3NHAA 1DQPA 1K5GA 2PSSA 2WFAA 2OQRA 1FMFA 4FNOA 4DCOA 1M34E 3GHYA 2A1IA 4UCQA 4OPMA 1NV9A 2DX7A 3K9QO 1QYWA 3UANA 1J09A 4IV5A 4IIUA 1OV4A 3BPSA 4J1NA 4QLAA 1K5HA 5DCUA 3STYA 4YMVA 1VCNA 3DOJA 4LYYA 1GKYA 4BWVA 1W88A 2IHNA 2M6RA 1I7DA 4W7HA 1QYDA 3PCTA 3F1LA 3V1KA 1AZWA 5HMMA 1X1TA 4XVHA 3ITKA 4C14A 2WMOB 3TR5A 2CYBA 1Y6QA 3L0SA 5KVVA 1CUSA 1FTQA 4BC1A 4NS4A 4S1VA 1B3BA 4DANA 5CLIA 4BDSA 1QFXA 4QEDA 3FAZA 4ZT4A 1GU7A 1VG8A 5ELMA 4MV5A 5C4MA 4QNMA 1XXLA 1EGHA 2OCLA 5FULA 3V1YA 2NSJA 2R2GA 5H4GA 2GERA 3NFRA 5L4SA 2AC4A 3C3PA 3K72B 2QTFA 5KYTA 3H11B 3C7KA 3IVXA 3E2MA 3JQGA 1F2TA 2R1TA 3K1YA 4TSFA 1MOZA 2SBTA 4H7EA 4CN9A 2OQIA 4XQGA 2DTDA 3I12A 3GVXA 1DBIA 2C58A 2WUFA 3MUFA 5F73A 1HDEA 1PFKA 4BVLA 2RHOA 2ZBGA 3OOSA 1IEQA 3EQ9A 2RCNA 3E58A 3LL4A 4NBUA 3R9IA 5DI9A 1EYZA 1XIVA 1DZIA 2NIPA 2EJWA 1PS0A 4C4YA 4OI4A 2W9XA 4CQLB 5JS7A 3ZZ0A 1I2AA 1YACA 2BHTA 5LQUA 2JAXA 1UBJS 1UBGA 2IEGA 4RKEA 3CF6R 1EFDN 4HXYA 2E18A 2O8FA 1YR3A 2E85A 2PUHA 4XDHA 2FUG1 1TW2A 2CSXA 4B3DA 2C2HA 2QD5A 5BVGB 3K96A 4HXFB 1KRWA 4UREA 2JH9A 2EAUA 4QJ4A 4CPDA