2IW4A

Crystal structure of basillus subtilis family ii inorganic pyrophosphatase mutant, h98q, in complex with pnp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
307
structure length
307
Chain Sequence
b'EKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHQRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQAELEAVISKVVAEKNLDLFLLVITDILENDSLALAIGNEAAKVEKAFNVTLENNTALLKGVVSRKKQVVPVLTDAMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE-DEPENDENT INORGANIC PYROPHOSPHATASE
publication title A Trimetal Site and Substrate Distortion in a Family II Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 110
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2006-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2iw4A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2iw4A01
3DEVA 1K20A 1I74A 2QB7A 2IW4A 4PY9A 3W5WA 4LS9A 1WPNA 1WPPA 1K23A 4RPAA 1WPMA 2QB6A 2QB8A 2ENXA 2EB0A 2HAWA
chains in the Genus database with same CATH superfamily
4LS9A 5H2YA 3EJXA 1U1XA 5GL4A 2YMAA 2Q9JA 1WPPA 2LT2A 1W62A 5ANPA 2GKEA 2ENXA 2HAWA 3FVEA 2AZPA 4K8LA 1XUBA 5GL2A 5M47A 1U1VA 2QB7A 2H9FA 5GL3A 4GL6A 3W5WA 1T6KA 3ICJA 4LG3A 1K23A 1WPMA 4Q60A 1YM5A 2ZVFA 3PTJA 4PY9A 3EKMA 1QYAA 1TM0A 4JUUA 4RPAA 3EDNA 1QY9A 3G7KA 2IW4A 1WPNA 2MPBA 1I74A 4J9WA 1GQZA 2KW7A 2ZXPA 5GKXA 2GKJA 3WQZA 2QB8A 1W61A 5IWEA 1XUAA 2EB0A 2ZXRA 4K7GB 4LB0A 4FC5A 4DWZA 2QB6A 2KPTA 4IK0A 5HA4A 4OA3A 3DEVA 1IR6A 4JBDA 1S7JA 3PW9A 4JD7A 2Q9HA 4K7XA 5H2GA 4J9XA 1BWZA 3PVHA 1U1WA 4JCIA 4DUNA 2ZXOA 4IJZA 2PVZA 4Q2HA 3IGHX 2OTNA 1K20A 1SDJA 1U0KA 3G98A 2PW0A
chains in the Genus database with same CATH topology
4LS9A 5H2YA 3EJXA 1U1XA 5GL4A 2YMAA 2Q9JA 1WPPA 2LT2A 1W62A 5ANPA 2GKEA 2ENXA 2HAWA 3FVEA 2AZPA 4K8LA 1XUBA 5GL2A 5M47A 1U1VA 2QB7A 2H9FA 5GL3A 4GL6A 3W5WA 1T6KA 3ICJA 4LG3A 1K23A 1WPMA 4Q60A 1YM5A 2ZVFA 3PTJA 4PY9A 3EKMA 1QYAA 1TM0A 4JUUA 4RPAA 3EDNA 1QY9A 3G7KA 2IW4A 1WPNA 2MPBA 1I74A 4J9WA 1GQZA 2KW7A 2ZXPA 5GKXA 2GKJA 3WQZA 2QB8A 1W61A 5IWEA 1XUAA 2EB0A 2ZXRA 4K7GB 4LB0A 4FC5A 4DWZA 2QB6A 2KPTA 4IK0A 5HA4A 4OA3A 3DEVA 1IR6A 4JBDA 1S7JA 3PW9A 4JD7A 2Q9HA 4K7XA 5H2GA 4J9XA 1BWZA 3PVHA 1U1WA 4JCIA 4DUNA 2ZXOA 4IJZA 2PVZA 4Q2HA 3IGHX 2OTNA 1K20A 1SDJA 1U0KA 3G98A 2PW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEV A;  1K20 A;  1I74 A;  2QB7 A;  2IW4 A;  4PY9 A;  3W5W A;  4LS9 A;  1WPN A;  1WPP A;  1K23 A;  4RPA A;  1WPM A;  2QB6 A;  2QB8 A;  2ENX A;  2EB0 A;  2HAW A; 
#chains in the Genus database with same CATH topology
 4LS9 A;  5H2Y A;  3EJX A;  1U1X A;  5GL4 A;  2YMA A;  2Q9J A;  1WPP A;  2LT2 A;  1W62 A;  5ANP A;  2GKE A;  2ENX A;  2HAW A;  3FVE A;  2AZP A;  4K8L A;  1XUB A;  5GL2 A;  5M47 A;  1U1V A;  2QB7 A;  2H9F A;  5GL3 A;  4GL6 A;  3W5W A;  1T6K A;  3ICJ A;  4LG3 A;  1K23 A;  1WPM A;  4Q60 A;  1YM5 A;  2ZVF A;  3PTJ A;  4PY9 A;  3EKM A;  1QYA A;  1TM0 A;  4JUU A;  4RPA A;  3EDN A;  1QY9 A;  3G7K A;  2IW4 A;  1WPN A;  2MPB A;  1I74 A;  4J9W A;  1GQZ A;  2KW7 A;  2ZXP A;  5GKX A;  2GKJ A;  3WQZ A;  2QB8 A;  1W61 A;  5IWE A;  1XUA A;  2EB0 A;  2ZXR A;  4K7G B;  4LB0 A;  4FC5 A;  4DWZ A;  2QB6 A;  2KPT A;  4IK0 A;  5HA4 A;  4OA3 A;  3DEV A;  1IR6 A;  4JBD A;  1S7J A;  3PW9 A;  4JD7 A;  2Q9H A;  4K7X A;  5H2G A;  4J9X A;  1BWZ A;  3PVH A;  1U1W A;  4JCI A;  4DUN A;  2ZXO A;  4IJZ A;  2PVZ A;  4Q2H A;  3IGH X;  2OTN A;  1K20 A;  1SDJ A;  1U0K A;  3G98 A;  2PW0 A; 
#chains in the Genus database with same CATH homology
 4LS9 A;  5H2Y A;  3EJX A;  1U1X A;  5GL4 A;  2YMA A;  2Q9J A;  1WPP A;  2LT2 A;  1W62 A;  5ANP A;  2GKE A;  2ENX A;  2HAW A;  3FVE A;  2AZP A;  4K8L A;  1XUB A;  5GL2 A;  5M47 A;  1U1V A;  2QB7 A;  2H9F A;  5GL3 A;  4GL6 A;  3W5W A;  1T6K A;  3ICJ A;  4LG3 A;  1K23 A;  1WPM A;  4Q60 A;  1YM5 A;  2ZVF A;  3PTJ A;  4PY9 A;  3EKM A;  1QYA A;  1TM0 A;  4JUU A;  4RPA A;  3EDN A;  1QY9 A;  3G7K A;  2IW4 A;  1WPN A;  2MPB A;  1I74 A;  4J9W A;  1GQZ A;  2KW7 A;  2ZXP A;  5GKX A;  2GKJ A;  3WQZ A;  2QB8 A;  1W61 A;  5IWE A;  1XUA A;  2EB0 A;  2ZXR A;  4K7G B;  4LB0 A;  4FC5 A;  4DWZ A;  2QB6 A;  2KPT A;  4IK0 A;  5HA4 A;  4OA3 A;  3DEV A;  1IR6 A;  4JBD A;  1S7J A;  3PW9 A;  4JD7 A;  2Q9H A;  4K7X A;  5H2G A;  4J9X A;  1BWZ A;  3PVH A;  1U1W A;  4JCI A;  4DUN A;  2ZXO A;  4IJZ A;  2PVZ A;  4Q2H A;  3IGH X;  2OTN A;  1K20 A;  1SDJ A;  1U0K A;  3G98 A;  2PW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...