2IW4A

Crystal structure of basillus subtilis family ii inorganic pyrophosphatase mutant, h98q, in complex with pnp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
307
structure length
307
Chain Sequence
EKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHQRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQAELEAVISKVVAEKNLDLFLLVITDILENDSLALAIGNEAAKVEKAFNVTLENNTALLKGVVSRKKQVVPVLTDAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Trimetal Site and Substrate Distortion in a Family II Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords MANGANESE-DEPENDENT INORGANIC PYROPHOSPHATASE
total genus 110
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2006-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2iw4A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2iw4A01
4RPAA 2QB8A 1WPNA 1K23A 2QB6A 3W5WA 2QB7A 1K20A 1I74A 1WPMA 2IW4A 3DEVA 4PY9A 2EB0A 2HAWA 2ENXA 1WPPA 4LS9A
chains in the Genus database with same CATH superfamily
1U0KA 1IR6A 1WPNA 2PVZA 4JUUA 2ZXRA 1SDJA 3WQZA 1W62A 4JBDA 4K7GB 4DWZA 4GL6A 1K20A 2OTNA 1QY9A 4LS9A 1QYAA 4K8LA 2GKEA 3EDNA 2Q9HA 4IJZA 2QB6A 2MPBA 2AZPA 2ZVFA 5M47A 4RPAA 2H9FA 5GL4A 1T6KA 2GKJA 2IW4A 3G7KA 2Q9JA 5H2GA 5GL2A 5ANPA 5H2YA 1WPMA 2YMAA 1GQZA 2LT2A 1XUAA 2QB8A 1TM0A 5GL3A 1WPPA 1K23A 4J9WA 4JCIA 4JD7A 4DUNA 4FC5A 1BWZA 2HAWA 3EJXA 3PW9A 1I74A 3DEVA 2EB0A 2ENXA 3PTJA 4LB0A 4IK0A 4K7XA 1XUBA 5HA4A 1S7JA 1U1XA 4LG3A 3FVEA 2ZXPA 4Q2HA 2QB7A 1W61A 2PW0A 2KW7A 3IGHX 3EKMA 3ICJA 3PVHA 1YM5A 4PY9A 1U1VA 1U1WA 2KPTA 2ZXOA 4Q60A 4OA3A 4J9XA 5IWEA 5GKXA 3W5WA 3G98A
chains in the Genus database with same CATH topology
1U0KA 1IR6A 1WPNA 2PVZA 4JUUA 2ZXRA 1SDJA 3WQZA 1W62A 4JBDA 4K7GB 4DWZA 4GL6A 1K20A 2OTNA 1QY9A 4LS9A 1QYAA 4K8LA 2GKEA 3EDNA 2Q9HA 4IJZA 2QB6A 2MPBA 2AZPA 2ZVFA 5M47A 4RPAA 2H9FA 5GL4A 1T6KA 2GKJA 2IW4A 3G7KA 2Q9JA 5H2GA 5GL2A 5ANPA 5H2YA 1WPMA 2YMAA 1GQZA 2LT2A 1XUAA 2QB8A 1TM0A 5GL3A 1WPPA 1K23A 4J9WA 4JCIA 4JD7A 4DUNA 4FC5A 1BWZA 2HAWA 3EJXA 3PW9A 1I74A 3DEVA 2EB0A 2ENXA 3PTJA 4LB0A 4IK0A 4K7XA 1XUBA 5HA4A 1S7JA 1U1XA 4LG3A 3FVEA 2ZXPA 4Q2HA 2QB7A 1W61A 2PW0A 2KW7A 3IGHX 3EKMA 3ICJA 3PVHA 1YM5A 4PY9A 1U1VA 1U1WA 2KPTA 2ZXOA 4Q60A 4OA3A 4J9XA 5IWEA 5GKXA 3W5WA 3G98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPA A;  2QB8 A;  1WPN A;  1K23 A;  2QB6 A;  3W5W A;  2QB7 A;  1K20 A;  1I74 A;  1WPM A;  2IW4 A;  3DEV A;  4PY9 A;  2EB0 A;  2HAW A;  2ENX A;  1WPP A;  4LS9 A; 
#chains in the Genus database with same CATH topology
 1U0K A;  1IR6 A;  1WPN A;  2PVZ A;  4JUU A;  2ZXR A;  1SDJ A;  3WQZ A;  1W62 A;  4JBD A;  4K7G B;  4DWZ A;  4GL6 A;  1K20 A;  2OTN A;  1QY9 A;  4LS9 A;  1QYA A;  4K8L A;  2GKE A;  3EDN A;  2Q9H A;  4IJZ A;  2QB6 A;  2MPB A;  2AZP A;  2ZVF A;  5M47 A;  4RPA A;  2H9F A;  5GL4 A;  1T6K A;  2GKJ A;  2IW4 A;  3G7K A;  2Q9J A;  5H2G A;  5GL2 A;  5ANP A;  5H2Y A;  1WPM A;  2YMA A;  1GQZ A;  2LT2 A;  1XUA A;  2QB8 A;  1TM0 A;  5GL3 A;  1WPP A;  1K23 A;  4J9W A;  4JCI A;  4JD7 A;  4DUN A;  4FC5 A;  1BWZ A;  2HAW A;  3EJX A;  3PW9 A;  1I74 A;  3DEV A;  2EB0 A;  2ENX A;  3PTJ A;  4LB0 A;  4IK0 A;  4K7X A;  1XUB A;  5HA4 A;  1S7J A;  1U1X A;  4LG3 A;  3FVE A;  2ZXP A;  4Q2H A;  2QB7 A;  1W61 A;  2PW0 A;  2KW7 A;  3IGH X;  3EKM A;  3ICJ A;  3PVH A;  1YM5 A;  4PY9 A;  1U1V A;  1U1W A;  2KPT A;  2ZXO A;  4Q60 A;  4OA3 A;  4J9X A;  5IWE A;  5GKX A;  3W5W A;  3G98 A; 
#chains in the Genus database with same CATH homology
 1U0K A;  1IR6 A;  1WPN A;  2PVZ A;  4JUU A;  2ZXR A;  1SDJ A;  3WQZ A;  1W62 A;  4JBD A;  4K7G B;  4DWZ A;  4GL6 A;  1K20 A;  2OTN A;  1QY9 A;  4LS9 A;  1QYA A;  4K8L A;  2GKE A;  3EDN A;  2Q9H A;  4IJZ A;  2QB6 A;  2MPB A;  2AZP A;  2ZVF A;  5M47 A;  4RPA A;  2H9F A;  5GL4 A;  1T6K A;  2GKJ A;  2IW4 A;  3G7K A;  2Q9J A;  5H2G A;  5GL2 A;  5ANP A;  5H2Y A;  1WPM A;  2YMA A;  1GQZ A;  2LT2 A;  1XUA A;  2QB8 A;  1TM0 A;  5GL3 A;  1WPP A;  1K23 A;  4J9W A;  4JCI A;  4JD7 A;  4DUN A;  4FC5 A;  1BWZ A;  2HAW A;  3EJX A;  3PW9 A;  1I74 A;  3DEV A;  2EB0 A;  2ENX A;  3PTJ A;  4LB0 A;  4IK0 A;  4K7X A;  1XUB A;  5HA4 A;  1S7J A;  1U1X A;  4LG3 A;  3FVE A;  2ZXP A;  4Q2H A;  2QB7 A;  1W61 A;  2PW0 A;  2KW7 A;  3IGH X;  3EKM A;  3ICJ A;  3PVH A;  1YM5 A;  4PY9 A;  1U1V A;  1U1W A;  2KPT A;  2ZXO A;  4Q60 A;  4OA3 A;  4J9X A;  5IWE A;  5GKX A;  3W5W A;  3G98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...