2IW4A

Crystal structure of basillus subtilis family ii inorganic pyrophosphatase mutant, h98q, in complex with pnp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
307
structure length
307
Chain Sequence
EKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHQRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQAELEAVISKVVAEKNLDLFLLVITDILENDSLALAIGNEAAKVEKAFNVTLENNTALLKGVVSRKKQVVPVLTDAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Trimetal Site and Substrate Distortion in a Family II Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords MANGANESE-DEPENDENT INORGANIC PYROPHOSPHATASE
total genus 110
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2006-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2iw4A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2iw4A01
2HAWA 1WPPA 1WPMA 2IW4A 2QB6A 2QB8A 1K20A 1WPNA 4LS9A 1I74A 4RPAA 4PY9A 3W5WA 2EB0A 1K23A 2ENXA 2QB7A 3DEVA
chains in the Genus database with same CATH superfamily
1GQZA 2ZXOA 2QB6A 4LB0A 5H2YA 5H2GA 4JUUA 2ZVFA 1K23A 2PVZA 4K7GB 5IWEA 1BWZA 1U1WA 3EKMA 2Q9JA 4Q2HA 5ANPA 5GKXA 2GKJA 1YM5A 3G7KA 4LG3A 4K8LA 1SDJA 1XUAA 1IR6A 4JD7A 2AZPA 3FVEA 2QB8A 3EDNA 2OTNA 3IGHX 2KPTA 4JCIA 1WPMA 3G98A 2ZXPA 1U1XA 2H9FA 1QYAA 1K20A 1TM0A 3PTJA 4J9WA 2Q9HA 5GL3A 4GL6A 4IJZA 2PW0A 1I74A 3WQZA 2MPBA 5GL4A 1S7JA 2ZXRA 4DUNA 2ENXA 1WPNA 4RPAA 5M47A 4Q60A 3PW9A 4FC5A 2LT2A 5HA4A 3PVHA 2QB7A 3W5WA 1XUBA 2IW4A 3ICJA 4PY9A 3EJXA 4OA3A 2GKEA 4J9XA 4DWZA 2KW7A 2YMAA 4LS9A 1U1VA 4IK0A 1W61A 1WPPA 4K7XA 2EB0A 5GL2A 1W62A 3DEVA 1T6KA 2HAWA 4JBDA 1U0KA 1QY9A
chains in the Genus database with same CATH topology
1GQZA 2ZXOA 2QB6A 4LB0A 5H2YA 5H2GA 4JUUA 2ZVFA 1K23A 2PVZA 4K7GB 5IWEA 1BWZA 1U1WA 3EKMA 2Q9JA 4Q2HA 5ANPA 5GKXA 2GKJA 1YM5A 3G7KA 4LG3A 4K8LA 1SDJA 1XUAA 1IR6A 4JD7A 2AZPA 3FVEA 2QB8A 3EDNA 2OTNA 3IGHX 2KPTA 4JCIA 1WPMA 3G98A 2ZXPA 1U1XA 2H9FA 1QYAA 1K20A 1TM0A 3PTJA 4J9WA 2Q9HA 5GL3A 4GL6A 4IJZA 2PW0A 1I74A 3WQZA 2MPBA 5GL4A 1S7JA 2ZXRA 4DUNA 2ENXA 1WPNA 4RPAA 5M47A 4Q60A 3PW9A 4FC5A 2LT2A 5HA4A 3PVHA 2QB7A 3W5WA 1XUBA 2IW4A 3ICJA 4PY9A 3EJXA 4OA3A 2GKEA 4J9XA 4DWZA 2KW7A 2YMAA 4LS9A 1U1VA 4IK0A 1W61A 1WPPA 4K7XA 2EB0A 5GL2A 1W62A 3DEVA 1T6KA 2HAWA 4JBDA 1U0KA 1QY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HAW A;  1WPP A;  1WPM A;  2IW4 A;  2QB6 A;  2QB8 A;  1K20 A;  1WPN A;  4LS9 A;  1I74 A;  4RPA A;  4PY9 A;  3W5W A;  2EB0 A;  1K23 A;  2ENX A;  2QB7 A;  3DEV A; 
#chains in the Genus database with same CATH topology
 1GQZ A;  2ZXO A;  2QB6 A;  4LB0 A;  5H2Y A;  5H2G A;  4JUU A;  2ZVF A;  1K23 A;  2PVZ A;  4K7G B;  5IWE A;  1BWZ A;  1U1W A;  3EKM A;  2Q9J A;  4Q2H A;  5ANP A;  5GKX A;  2GKJ A;  1YM5 A;  3G7K A;  4LG3 A;  4K8L A;  1SDJ A;  1XUA A;  1IR6 A;  4JD7 A;  2AZP A;  3FVE A;  2QB8 A;  3EDN A;  2OTN A;  3IGH X;  2KPT A;  4JCI A;  1WPM A;  3G98 A;  2ZXP A;  1U1X A;  2H9F A;  1QYA A;  1K20 A;  1TM0 A;  3PTJ A;  4J9W A;  2Q9H A;  5GL3 A;  4GL6 A;  4IJZ A;  2PW0 A;  1I74 A;  3WQZ A;  2MPB A;  5GL4 A;  1S7J A;  2ZXR A;  4DUN A;  2ENX A;  1WPN A;  4RPA A;  5M47 A;  4Q60 A;  3PW9 A;  4FC5 A;  2LT2 A;  5HA4 A;  3PVH A;  2QB7 A;  3W5W A;  1XUB A;  2IW4 A;  3ICJ A;  4PY9 A;  3EJX A;  4OA3 A;  2GKE A;  4J9X A;  4DWZ A;  2KW7 A;  2YMA A;  4LS9 A;  1U1V A;  4IK0 A;  1W61 A;  1WPP A;  4K7X A;  2EB0 A;  5GL2 A;  1W62 A;  3DEV A;  1T6K A;  2HAW A;  4JBD A;  1U0K A;  1QY9 A; 
#chains in the Genus database with same CATH homology
 1GQZ A;  2ZXO A;  2QB6 A;  4LB0 A;  5H2Y A;  5H2G A;  4JUU A;  2ZVF A;  1K23 A;  2PVZ A;  4K7G B;  5IWE A;  1BWZ A;  1U1W A;  3EKM A;  2Q9J A;  4Q2H A;  5ANP A;  5GKX A;  2GKJ A;  1YM5 A;  3G7K A;  4LG3 A;  4K8L A;  1SDJ A;  1XUA A;  1IR6 A;  4JD7 A;  2AZP A;  3FVE A;  2QB8 A;  3EDN A;  2OTN A;  3IGH X;  2KPT A;  4JCI A;  1WPM A;  3G98 A;  2ZXP A;  1U1X A;  2H9F A;  1QYA A;  1K20 A;  1TM0 A;  3PTJ A;  4J9W A;  2Q9H A;  5GL3 A;  4GL6 A;  4IJZ A;  2PW0 A;  1I74 A;  3WQZ A;  2MPB A;  5GL4 A;  1S7J A;  2ZXR A;  4DUN A;  2ENX A;  1WPN A;  4RPA A;  5M47 A;  4Q60 A;  3PW9 A;  4FC5 A;  2LT2 A;  5HA4 A;  3PVH A;  2QB7 A;  3W5W A;  1XUB A;  2IW4 A;  3ICJ A;  4PY9 A;  3EJX A;  4OA3 A;  2GKE A;  4J9X A;  4DWZ A;  2KW7 A;  2YMA A;  4LS9 A;  1U1V A;  4IK0 A;  1W61 A;  1WPP A;  4K7X A;  2EB0 A;  5GL2 A;  1W62 A;  3DEV A;  1T6K A;  2HAW A;  4JBD A;  1U0K A;  1QY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...