2IWBA

Mecr1 unbound extracellular antibiotic-sensor domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
246
Chain Sequence
DKYETNVSYKKLNQLAPYFKGFDGSFVLYNEREQAYSIYNEPESKQRYSPNSTYKIYLALMAFDQNLLSLNHTEQQWDKHQYPFKEWNQDQNLNSSMKYSVNWYYENLNKHLRQDEVKSYLDLIEYGNEEISGNENYWNESSLKISAIEQVNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEANGWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unbound and Acylated Structures of the Mecr1 Extracellular Antibiotic-Sensor Domain Provide Insights Into the Signal-Transduction System that Triggers Methicillin Resistance.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic resistance
molecule keywords METHICILLIN RESISTANCE MECR1 PROTEIN
total genus 90
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2006-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2iwbA00
1BLHA 4WMCA 1S6RA 3Q81A 4OOMA 2PU4A 3GSGA 5EVLA 4S2LA 2CC1A 3IWQA 3VOZA 4WZ5A 5FQKA 3ZG0A 3M2JA 1K57C 4K91A 4OONA 4NK3A 2Y2MA 4OQIA 3VOYA 1BLPA 3IXGA 4GD6A 3GR2A 1BLCA 3IXDA 1M40A 4RVAA 1CI8A 2V20A 1YLJA 4GD8A 4DE1A 3BYDA 4ZJ3A 1L0DA 1GA9A 3OPHA 3IF6B 2VGJA 3A3FA 4B88A 3IXHA 1YT4A 4P6BA 5GHXA 3HLFA 1JWPA 1ALQA 4K0XA 4KZ8A 3DWKA 2FFYA 4PM9A 1K6RA 4WELA 4ZJ1A 2RL3A 3SS3A 3WS4A 3VFHA 3UN7A 2EX6A 1NZOA 2OLVA 2ZQ7A 1K4EA 1M6KA 2XFTA 3BLSA 2Y55A 3N8RA 3W8KA 4X55A 5E2HA 3TOIA 2XK1A 4NETA 4C3QA 1FSWA 4LV0A 5FI2A 1W8YA 5EVIB 1EI5A 3WRTA 1EROA 1K55A 3UDFA 2G2UA 3A3IA 2JC7A 4DKIA 3LY3A 2DCFA 3ZHHA 1E25A 4ZDXA 4A5RA 3VP4A 4CPKA 4DDSA 1H8YA 1ZC2A 2WKEA 3BECA 4MNRA 4WZ5C 4GZBA 5EOEA 4KG5A 1WE4A 5E43A 5G18A 1ZKJA 1ERMA 2EXAA 2Z2LB 3IHAA 3Q07A 3WS5A 1PZOA 5BOHA 2XR0A 3FZCA 5CTNA 3MXSA 4UHUA 1IYOA 4KZ7A 3WS1A 3NCKA 3NIAA 3TSGA 4QU3A 2HDSA 3HLDA 5JYPA 4OOLA 3VMAA 3EQUA 4N1HA 5U47A 5TFQA 1DJAA 4K0WA 3SH9A 3IH8A 1N9BA 1SDEA 1LI9A 3BLMA 4DE0A 3G4PA 3P09A 3LY4A 3UNWA 1SHVA 2Y2PA 4U3TA 3V39A 2ZC6B 2JE5A 3G2ZA 1K55C 3SH7A 3HREA 4H8RA 1I2SA 2WGWB 3CZDA 5CRFA 5FQQA 3ZVTA 5D3OA 5FASA 1JWVA 2XF3A 1LHYA 3SOIA 5GHZA 4EUZA 4WBGA 4S2NC 5FAPA 3UE0A 2ZC7A 3M6BA 4R23A 4GDBA 5A91A 3UE3A 3ZNYA 3RXXA 3Q82A 2PBYA 1JTGA 1XA1A 3P98A 1MY8A 3MBZA 4FH2A 2BLSA 5FDHA 3C4OA 3RXWA 1SDNA 2GDNA 5JYOA 2ZQAA 3ISGA 4GDNA 1E3UA 4KQOA 4EBNA 2E8IA 1G68A 3ZVWA 5DTKA 4ZTKA 1MWTA 4C75A 2QMIA 5E2FA 1O7EA 4KZ6A 1KGGA 2WGIA 3Q7ZA 1E3UD 1SCWA 1H5XA 4ZAMA 4JLFA 3PBNA 1BSGA 1BUEA 4JXSA 4P87A 1K56A 2HDQA 3PAGA 4E3LA 3ZFZA 1XP4A 1BT5A 1PWDA 4MBFA 4GKUA 3GQZA 5CGWA 2X71A 5AQAA 4MLLA 4OQ0A 1NZUA 2ZJ9A 1GA0A 5HAIA 1YLWA 1TDLA 4GOGA 1LI0A 1MWRA 4R0QA 4E3IA 2IWDA 2Y2JA 3G35A 4RX3A 2P9VB 3TG9A 3O88A 3DW0A 1Y54A 5EECA 3S1YA 1KE4A 4QY6A 3VP1A 1YMSA 3PBSA 1GHMA 3OC2A 3QNCA 4XUZA 2Y2HA 4LENA 5CECA 4WM9A 2Y2LA 1NYYA 1W8QA 1K4FA 4LCMA 2HPBA 3BM6A 3HLEA 3IQAA 5DF8A 1KDWA 4BD0A 5KZHA 2XGNA 3ZG8B 3W4PA 3FKWA 1W5DA 1JWZA 4KZAA 3UDXA 4C6YA 4L0LA 1PYYA 5KMWA 2H5SA 2R9XA 4Y0UA 1XGJA 4U0TA 1IELA 2XD5A 3VFFA 3BRMA 4RA7A 5GLCA 1PI5A 1XKZA 2Q9NA 5FSRA 1FQGA 3DTMA 4MEZA 3V5MA 3WS2A 4E3OA 3VP3A 2DNSA 1BULA 2G2WA 3UDIA 2QZ6A 3NBLA 3AGFA 4BENA 1FR1A 3QNBA 5GLAA 5EVIC 5GHYA 4N92A 2A3UA 3ZG5A 4B4XA 4CJNA 4DDYA 3BFDA 3AGDA 3OZHA 5HARA 3V3SA 1HD8A 2OV5A 3UPOA 2XDMA 2ZQCA 3HUNA 1IYPA 2C6WB 3GVBA 3A3JA 3QHYA 4D2OA 1KE0A 1IKIA 2Y91A 1YLPA 1K38A 4S2KA 2VGKA 5FQIA 1FOFA 3MZEA 3ITBA 4GNUA 4JKTA 1JVJA 4BD1A 2IWCA 1ES2A 2H0YA 1WYBA 3PBRA 4JXVA 4N1XA 3G32A 5DF9A 1XXMA 4N9KA 1YLTA 2XFSA 2HP5A 5A90A 3HL9A 4UAAA 4WYYA 5FQ9A 4UA7A 2Y2NA 4DF6A 1PW8A 4EBPA 3VP0A 4E3JA 5CGSA 2ZC3B 4XXRA 3G30A 5HAPA 4UA6A 4S2PA 5GL9A 3WWXA 1Q2PA 4KG2A 4X53A 2WK0A 1QMFA 4OLDA 4FSFA 2B5RA 3DWZA 2XQZA 2HP9A 4N9LA 1DY6A 1DJBA 1TEMA 1L0FA 4E3NA 3C5AA 3LO7A 4UA9A 5E2GA 2PU2A 3HLBA 1GHIA 4PM6A 1PWCA 2H0TA 2Z2MB 1OMEA 4X69A 1FR6A 2WADA 4HBTA 3NI9A 2WUQA 3E2KA 3OCLA 1ZG4A 5HW3A 5EE8A 3BFFA 5CEBA 4EQIA 1Z6FA 1C3BA 1CEFA 4X6TA 4OPQA 4RYEA 1PWGA 4PPRA 2EX9A 1HVBA 1ES4A 5FATA 1E4DA 1MBLA 2J8YA 5EOOA 1DJCA 1MKIA 3HUMA 5AQ7A 4EWFA 5M18A 1K54A 5FQJA 2EX8A 3ZG7B 4OKPA 2WAFA 3HBRA 5HFOA 1VM1A 3VSKA 5EVID 2ZQ9A 4FD8A 4IBRA 3N8LA 4MBHA 5DF7A 2EX2A 3V50A 1HZOA 2Y2QA 4HESA 3HLWA 4KG6A 1YMXA 1HTZA 2ZQDA 4E3MA 1NRFA 4BL3A 2C5WB 3ZDJA 1RP5A 4HEFA 3BEBA 5DVAA 2ZC4B 3IH9A 1BTLA 3OPLA 4F94A 3AGEA 2HP6A 3ZCZA 2V2FF 2JCHA 2WYXA 4QY5A 4JPMA 1KE3A 1PIOA 3N6IA 3HLCA 3IF5A 3O3VA 4KZBA 5AQBA 5M19A 1XPBA 1FCNA 1MWUA 5CHMA 2Y59A 3GMWA 3PAEA 4YFMA 1J9MA 1TVFA 5F82A 1SKFA 4MBKA 3ZNTA 1H8ZA 1ZG6A 4OP5A 3S22A 4OOYA 4S2IA 3D4FA 4OLGA 1L0GA 2FFFB 1CI9A 1K54C 3Q1FA 4R4SA 1KGFA 3HVFA 3PBTA 5GLBA 4YINA 2X01A 1K6SA 4GB7A 1RCJA 4IEDA 5FI6A 4M3KA 3OCNA 1MPLA 4Q8IA 3UE1A 1PW1A 3G34A 4BQMA 4EBLA 1RGYA 4Y7PA 1IYSA 1MWSA 3FYZA 1NJ4A 3W4QA 3WRZA 4HBUA 2WZXA 1KVLA 2V1ZA 2ZD8A 5CHJA 4U0XA 4FH4A 2P74A 2RCXA 4B4ZA 1QMEA 3A3DA 4S2JA 3UPNA 2ZM2A 1AXBA 3GRJA 1G6AA 1IYQA 3G2YA 3UO9A 3M2KA 3V3RA 3UPPA 1W79A 4LV2A 1BLSA 3NC8A 4OP8A 4S2OA 5L2FA 1I2WA 3B3XA 3BFCA 1LL5A 2ZQ8A 1KGEA 1NY0A 3NDEA 1EWZA 4BL2A 4PM5A 4OPZA 2JBFA 3PTEA 2BG1A 2DRWA 2J7VA 1YQSA 4JF6A 4OVDA 3S4XA 4WEJA 1PI4A 5HAQA 1LL9A 4KZ9A 3IT9A 3O87A 1PZPA 4OPYA 2R9WA 4Y0TA 4OH0A 4BLMA 2J9OA 4WEKA 3ITAA 5F83A 3G31A 4OQHA 3FWLA 1ERQA 4XUXA 2OSUA 3IHBA 4X56A 4LV1A 4O7DA 3SH8A 2EFXA 3N8SA 4DE2A 5J8XA 3A3EA 1XGIA 1ONHA 5KSHA 3MKFA 2UWXA 5CERA 4LCLA 5CXWA 4IVKA 4KZ3A 5TR7A 3NDGA 4IBXA 5I94A 1Q2QA 5FA7A 5EUAA 1RGZA 5GLDA 1YLZA 1BZAA 3FKVA 4BJPA 5CEDA 4OQGA 2Y2KA 4E6WA 5DTSA 2EFUA 5FI7A 3ZGAB 4PM8A 4RX2A 4QD4A 1FCMA 3MKEA 3FV7A 1K25A 2X02A 5EVIA 4E3KA 4E6XA 4R3JA 2WGVA 4OPRA 4DXCA 4PMAA 1ONGA 3N7WA 3IF6C 1JTDA 5CHUA 2HDRA 1ESUA 1MXOA 4JXGA 3HUOA 4R4RA 3GTCA 3N4IA 3Q7VB 4KENB 4S2NA 3W4OA 3OPPA 2A49A 3C4PA 3Q7VA 4WZ4A 4ZBEA 2Y2OA 3MZDA 2J9PA 2ZC5B 3SS4A 3IXBA 3NY4A 1KVMA 4P0MA 4IVIA 5M1AA 3WS0A 2I72A 1K56D 1ESIA 4ZJ2A 3PBOA 2WAEA 2HDUA 3EQVA 5FAOA 5A93A 1ES5A 2Q9MA 4JBFA 1N4OA 5FQMA 5CGXA 5FAQA 3GV9A 5F1FA 2XEPA 1TDGA 1LLBA 5DTTA 4QJGA 1CK3A 1L2SA 1YLYA 4FCFA 4KZ4A 5KSCA 3C7VA 1ES3A 3PBQA 4ID4A 1FSYA 2P9VA 2WZZA 2XD1A 2XLNA 4PM7A 1U60A 3I7JA 1S0WA 1IEMA 5TGFA 4JF4A 3MZFA 3UY6A 1W7FA 2OLUA 2WKHA 1NYMA 1O07A 3IF6A 4JF5A 1IKGA 3BFEA 2H10A 1KDSA 4KZ5A 3IWOA 1NXYA 5HX9A 4QB8A 1I5QA 5AQ9A 3BFGA 2Y2IA 3OPRA 3MFDA 3VSLA 1K57A 4JXWA 2Y4AA 3HLGA 2ZMAA 3JYIA 5CTMA 4Z9QA 2IWBA 4R3BA 4Y0OA 2XH9A 4DRTA 2ZLYA 4X68A 1CEGA 3O86A 1WYCA 1XX2A 3CJMA 5HL1A 5A92A 2EXBA 3MXRA 4DE3A 3CMZA 2QPNA 4LV3A 4R1GA 4EV4A 3CG5A 3IWIA 3ZG9B 3LCEA 2Y2GA 4DXBA 5F1GA 1YM1A 3VP2A 3E2LA 4P85A 1XA7A 1FCOA 2ZM8A 1GCEA 4GN2A 4WMCD 1L0EA 5EPHA 2WGWA 1VQQA 1GHPA 3LEZA 3C7UA 2WKIA 3RJUA 2ZM0A 3M6HA 3SS5A 4KQQA 5E2EA 4QHCA 4S2MA 4KQRA 5IHVA
chains in the Genus database with same CATH superfamily
1S6RA 3Q81A 4IUHA 2CC1A 1K57C 1OTAA 2QWSA 3QP1A 1BLPA 4GD6A 3IXDA 4H6JA 2V20A 1YLJA 4DE1A 1DRMA 1S67L 3MXQA 2PAVP 4PM9A 2FFYA 4WELA 2PR5A 3WS4A 2EX6A 2OLVA 2ZQ7A 2XFTA 3N8RA 3EGXC 1S66L 3TOIA 4C3QA 1FSWA 4CQHA 5EVIB 1EROA 1K55A 3A3IA 3ZHHA 3W2ZA 4A5RA 4CLCA 3T1XA 2HJ9C 1J3WA 1TS6A 3T50A 5F68A 1ZKJA 1ERMA 2Z2LB 3GDIA 1PZOA 2XR0A 5FEFA 4ETXA 3WS1A 2HDSA 3EQUA 2JKRI 5TFQA 5HWVA 1N9BA 3S7NA 1LI9A 1P0ZA 4I3AA 3G4PA 2VX8A 3P09A 3T1SA 3UNWA 2Y2PA 3MR0A 1K55C 4G3WA 3HREA 4IUKA 4XT2B 2ACGA 3CZDA 5CRFA 4EEPA 1W63Q 4EUZA 1BYWA 5FAPA 4R23A 5A91A 1LSVA 4L9EA 2BLSA 3C4OA 5JYOA 1S4RA 4KQOA 4PKYG 2W0NA 1GSWA 4RQ9A 5E2FA 3Q7ZA 1L3LA 1NRJA 4JXSA 3CUEA 1LT0A 3VE3A 1PWDA 3GQZA 2X71A 5AQAA 1Y28A 1NZUA 4GOGA 3LR0A 4E3IA 2Y2JA 4GS9B 1F2KA 5EECA 4G3KA 3S1YA 4GJ4A 3IS2A 3QP6A 1VHMA 2Y2HA 1ZHHB 4B9OA 4DMZA 2Y2LA 1NYYA 4BD0A 3BM6A 3RFBA 4WUJA 1W5DA 2Y79A 3UDXA 4L0LA 2VEAA 3VFFA 3BRMA 5GLCA 3LIEA 4E3OA 3VP3A 4GCZA 3CUEC 2XROA 2A3UA 4CJNA 4LFUA 3AGDA 2VV6A 5HARA 3UPOA 3T4JA 2ZQCA 3SW1A 3A3JA 1KE0A 3CPTA 4WN5A 2Y91A 4KQDA 4LPZA 3MZEA 2W27A 2IWCA 2PR6A 2O9CA 4N1XA 1OPXA 3G32A 5DF9A 1TS0A 3NOUC 2XFSA 2HP5A 1IFQA 5A90A 4WYYA 3CPTB 2Y2NA 4DF6A 2ZC3B 5HAPA 3G30A 5AVEA 4S2PA 1Z09A 1Q2PA 1IOUA 4QPRA 4OLDA 3PHYA 2GJ3A 3DWZA 4N9LA 1DJBA 2VV7A 4PM6A 5DFXA 2H0TA 2Z2MB 1FR6A 3S7QA 3L9KA 1Z6FA 1C3BA 4X6TA 2YKFA 1PWGA 5FATA 1DJCA 1MKIA 5FQJA 3VSKA 1VM1A 5DF7A 1PNEA 2EX2A 1HZOA 1YMXA 2ZQDA 1NRFA 4GS9A 4FUWA 4GLQA 2FH5A 3UB5P 5J3WA 3OPLA 4F94A 3AGEA 5M19A 1PIOA 3O3VA 3HLCA 5AQBA 2ZMFA 1XPBA 3SZTA 1MWUA 4HJ4A 3U2AA 3B33A 1H8ZA 3S22A 2BTFP 3QP5A 1L0GA 1CI9A 3DTIA 3HVFA 5HPIA 4IEDA 3UB7A 4M3KA 3MFXA 3OCNA 4BQMA 1RGYA 4Y7PA 2WZXA 2V1ZA 4FH4A 1WA9A 2A24B 4I39A 2M7VA 2ZM2A 3GRJA 3UMDA 1IYQA 3UO9A 3NC8A 5L2FA 1I2WA 3BFCA 2V0UA 2ZQ8A 1KGEA 2W1TB 3NDEA 2PYPA 1XJ4A 4D60A 3MQQA 4WEJA 1PI4A 1PZPA 4HJ6A 5TBMB 5F83A 3G31A 3FWLA 4X56A 3C38A 4DE2A 4NXBA 4R6LA 4PHTA 5KSHA 4KZ3A 5TR7A 2M7UA 4UEYA 1H0MA 2OWJA 3JVVA 2J80A 3NOPC 2W3GA 2Z6CA 2XA7M 2KX6A 3FV7A 5EVIA 3ICYA 4E3KA 4E6XA 3LI9A 4OPRA 2JN7A 3IF6C 5CHUA 1D7EA 1UWNX 3N4IA 4NEED 2A49A 2Y2OA 4M4XA 2J9PA 3IXBA 1KVMA 1DP9A 4IVIA 4NG2A 4ZJ2A 3PBOA 1ES5A 2Q9MA 4JBFA 4P6ZS 4QJGA 4ME4A 4DJ3A 2WZZA 3IBJA 4PM7A 1S0WA 3MZFA 1NYMA 3IF6A 3A0RA 3IWOA 3OLOA 3MS6A 2OOLA 3MFDA 2Y4AA 3EEHA 4Y0OA 2XH9A 5J7EA 1G6OA 3O86A 2K7SA 1XX2A 5HL1A 5A92A 4LV3A 3QP2A 2VV8A 1CQAA 5F1GA 3VP2A 4LRZE 5EPHA 2GX5A 1L0EA 2Y8HA 2WGWA 3KSFA 3RJUA 2ZM0A 3NULA 3SS5A 4QHCA 3BW6A 3D72A 3M2JA 4OONA 4OQIA 3VOYA 3FG8A 3GR2A 4RVAA 5DJTA 4GD8A 4ZJ3A 1L0DA 1GA9A 3LIBA 4B88A 2V9AA 2B18A 5TBMA 4HH2A 2INWA 3LUQA 3UN7A 3W8KA 1M6KA 3BLSA 3T12B 4GW9A 5FI2A 1EI5A 1VB6A 2G2UA 2JC7A 3R4KA 2DCFA 1E25A 3DTEA 4DDSA 1ZC2A 2WKEA 5EM1A 3BECA 2NUTC 4KG5A 3LIFA 1N9NA 4UHUA 5LBRA 3NCKA 4IHQA 3TSGA 3KYQA 4LGWA 3HLDA 1DJAA 4K0WA 4EESA 3E4QA 3IH8A 2VGLS 1SDEA 1XJ2A 2LB9A 5AVFA 4U3TA 4UQIS 2ZL1B 4MN7A 4JGOA 4H8RA 1I2SA 1JNUA 2WGWB 3ZVTA 2XF3A 3SOIA 4WBGA 1MZUA 1YKDA 5DJUA 2VK3A 4Y3IA 3UE3A 1XA1A 3P98A 3U4LP 3R7WA 1SDNA 2ZQAA 4GDNA 1G68A 1MWTA 4C75A 4L9FA 2VGLM 1YPRA 4KZ6A 4ZAMA 1BSGA 3E4OA 3K2NA 2HDQA 3PAGA 4E3LA 4O8GA 5G4ZA 4MLLA 4ETZA 2K2NA 1GA0A 1MWRA 4R0QA 3O88A 3DW0A 1Y54A 1KE4A 1DP6A 3PBSA 5MC7A 1FILA 4WM9A 3TW8A 4LCMA 1W8QA 5KZHA 2XGNA 5HPFA 2JKTI 1JWZA 4C6YA 1N9LA 2H5SA 2R9XA 3CITA 2NUPC 1XGJA 1IELA 4RA7A 2Q9NA 4MEZA 3V5MA 1UWPX 2QZ6A 3NBLA 3IBRA 2K31A 2KLIA 3ZG5A 4HOIA 1HD8A 1IYPA 1ZTUA 3QHYA 2YKHA 5EVEA 2V8FA 3QP4A 1P9RA 4O0PA 5FQIA 1ES2A 5DKKA 5FQ9A 4UA6A 3RTYA 1QMFA 4E04A 1DY6A 3A0SA 1TEMA 5HDDA 2VZWA 3LO7A 4MCWA 2PU2A 3HLBA 4Y13A 2B02A 3V67A 1OMEA 4HBTA 3FPVA 3E2KA 1H3QA 3H9WA 4HJ3A 5HD5A 1ES4A 2O9AA 5AQ7A 1K54A 2EX8A 4OKPA 3HBRA 3NJAA 3V50A 2PT7A 4HESA 3HLWA 1HTZA 2XRNA 4BL3A 5FL3A 2AVXA 1RP5A 3BEBA 4HH3A 3IH9A 1BTLA 2JCHA 2WYXA 2D01A 1KE3A 3N6IA 3IF5A 2O0YA 1FCNA 3GMWA 3F1PB 4YFMA 1J9MA 4X1MA 5F82A 3F1OA 2BASA 1TF1A 3F1NB 1XJ3A 4OP5A 4OOYA 1K54C 3Q1FA 4YINA 1K6SA 4EEUA 3FPWA 2QYBA 4HY8A 1MPLA 3FYZA 1NJ4A 3W4QA 1T1CA 1KVLA 4BBUA 2VLGA 5CHJA 2J3WA 2RCXA 3D9YA 3DBAA 4S2JA 2E8JA 1AXBA 1ACFA 5J8XA 3G2YA 3LEQA 3M2KA 3V3RA 1W79A 3B3XA 1LL5A 2QJ5A 1OTEA 1NY0A 2DRWA 1T19A 4R70A 3O87A 4OH0A 4LV1A 4O7DA 4LRXC 3G6OA 5CXWA 4Y2FA 5I94A 4HP4A 1YLZA 1BZAA 4Y17A 5CEDA 4R38A 2Y2KA 5DTSA 2MJ6A 3ZGAB 4PM8A 2QKPA 4QD4A 3MKEA 1ONGA 3N7WA 4O01A 1ESUA 4JXGA 3GTCA 4KENB 5A8BA 4EERA 3C4PA 4WZ4A 4ZBEA 3MZDA 2ZC5B 3SS4A 3LYXA 2L1MA 4WF0A 3NY4A 4P0MA 3WS0A 1K56D 2WAEA 2HDUA 3LR3A 1N4OA 3LFVA 5FAQA 1YLYA 2D02A 1ES3A 3PBQA 4ID4A 4CLCE 2O99A 2XLNA 3KSHA 3TRCA 5F5YA 3I7JA 5TGFA 2OLUA 1IKGA 1KDSA 3VV4A 3T4SA 3BFGA 2Y2IA 5IU1A 4JXWA 3HLGA 2ZMAA 3UE6A 3JYIA 1T1BA 3H82B 2ZLYA 3H82A 4IJGA 2EXBA 3T4TA 4R1GA 2KDKA 3IWIA 4DXBA 1YM1A 3S7PA 3E2LA 1GCEA 2P7JA 4QWOA 1P97A 4XT2A 2WKIA 1NWZA 3LGOA 1BLHA 4WMCA 4OOMA 3GSGA 5EVLA 4S2LA 3KSGA 3B47A 3VOZA 3ZG0A 2A2LA 1LSWA 4MN6A 3IXGA 1M40A 3BYDA 2VGJA 3A3FA 4P6BA 3QP8A 1JWPA 4KZ8A 3DWKA 3SS3A 4FOFA 3VFHA 1NZOA 3BJNA 1PRQA 4X55A 5E2HA 5L10A 4NETA 4LV0A 3PYPA 3WRTA 2OAQ1 3UDFA 3UB8A 5DKLA 2J3TC 4GHIB 3VP4A 1SKOB 1H8YA 4MNRA 4HQAA 5EOEA 4GZBA 1WE4A 2EXAA 5BOHA 5CTNA 2G7UA 4KZ7A 2JHEA 2WKRA 2DMWA 3EOIA 5JYPA 2PD8A 3OOVA 4JGQA 3VMAA 4N1HA 3SH9A 3E98A 3BLMA 4DE0A 3LY4A 2JKRM 4I5SA 3BY9A 4ZRRA 3V39A 2ZC6B 4EU0A 2JE5A 1OT6A 3G2ZA 1X0OA 3ZYTA 1LSXA 5FASA 1LHYA 5GHZA 4S2NC 3HJKA 2KOIA 2ZC7A 2ZMVA 3ZNYA 3RXXA 3PR6A 3Q82A 2PBYA 1JTGA 1MY8A 3MBZA 4FH2A 4EBNA 4ARZA 3ZVWA 4ZTKA 3TJZC 1O7EA 2WGIA 3F1NA 1E3UD 1SCWA 1H5XA 1K56A 3ZFZA 1XP4A 4MBFA 5CGWA 1OTBA 4OQ0A 5HAIA 2ZJ9A 1YLWA 1GSXA 3EWKA 1LI0A 2IWDA 3G35A 4RX3A 2P9VB 4LRYC 2L0WA 4EQ1A 1G5UA 2O9BA 3VP1A 3OC2A 3S7OA 3QNCA 4XUZA 4LENA 3HLEA 5DF8A 1D1JA 4PKYA 4KZAA 5KMWA 4Y0UA 4U0TA 2XD5A 3WS2A 5FSRA 4I38A 1FQGA 2DNSA 2G2WA 3AGFA 5GLAA 5EVIC 5GHYA 3BFDA 4EXOA 2OV5A 3HUNA 3LICA 2C6WB 1XFQA 1V9YA 1IKIA 1K38A 2VGKA 3KYEA 4GNUA 4JKTA 4B93A 1W63M 2H0YA 3T4KA 1WYBA 4JXVA 5HD3A 3T1RA 1XXMA 1CF0A 1TS7A 3KO6A 1YLTA 3HL9A 3LR5A 2JKTM 1PW8A 3H7WB 5CGSA 5GL9A 4KG2A 3A0VA 4FSFA 4AFIA 2XQZA 1SZVA 4E3NA 1L0FA 5E2GA 4UA9A 1GHIA 1PWCA 1OJGA 5I5LA 2A24A 3CLOA 4X1LA 3LIDA 3OCLA 1ZG4A 2OWHA 4CLCD 5EE8A 3BFFA 4EQIA 1CEFA 4RYEA 4OPQA 1HVBA 1E4DA 4I3JA 3ZG7B 3IX4A 2WAFA 3T1QB 1K0KA 4FD8A 4MBHA 4IBRA 2QHKA 2Y2QA 4KG6A 3F1OB 1NLZA 1YSPA 3BQAA 4MN5A 5EV0A 1VEUB 5FEGA 3ZDJA 1OT9A 4HEFA 4EETB 2ZC4B 3MSHA 2GZAA 3ZCZA 4QY5A 3NHQA 4JPMA 4ESPA 5CHMA 2Y59A 4MBKA 3ZNTA 2ZBBA 4KUOA 3D4FA 4OLGA 2FFFB 4R4SA 2X01A 5AJGA 2QJ7A 4GB7A 3EEAA 2P08A 4BBVA 1RCJA 5FI6A 4Q8IA 4EBLA 1MWSA 3WRZA 4HBUA 2W3HA 5C5KA 4U0XA 4B4ZA 3A3DA 4BWIA 1G6AA 4LV2A 1YSQA 4OP8A 3CWFA 4PM5A 1EWZA 3PTEA 3O5YA 4OVDA 3IS2B 2J3TD 5HAQA 1F9IA 3IT9A 3VOLA 4Y0TA 4BLMA 2J9OA 2PD7A 2Z6DA 3ITAA 4Z1WA 5F69A 4OQHA 4XUXA 5K5BA 2OSUA 4NXFA 3N8SA 1XGIA 1ONHA 3MKFA 2UWXA 5CERA 4LCLA 4IBXA 1Q2QA 5FA7A 5EUAA 5GLDA 2XA7S 3FKVA 3E0YA 4OQGA 2JKFA 2B95A 4E6WA 5FI7A 1FCMA 3ULFA 2X02A 2WGVA 1JTDA 2HDRA 3T4LA 1MXOA 1XFNA 4NKPA 3MMHA 3CHWP 3HCYA 1S1YA 4CLCB 3UB9A 1ESIA 3TE8A 5A93A 3PXPA 5FQMA 5CGXA 1TDGA 1LLBA 4Y5FA 2WKQA 2IA2A 1CK3A 4FCFA 5KSCA 3C7VA 1FSYA 2HZ5A 2P9VA 2XD1A 3KX0X 3L7HA 4JF4A 3UY6A 1W7FA 2I9VA 2VA0A 3P7NA 4KZ5A 5EFWA 1NXYA 5HX9A 1A0KA 5DFYA 3UMEA 4Q0JA 3E4PA 3NECA 2IWBA 3P01A 2V0WA 2HJEA 4DRTA 4X68A 1CEGA 3CAXA 1WYCA 4Q0HA 3MXRA 4DE3A 4EV4A 2EA9A 3BY8A 2HF6A 1FCOA 2ZM8A 4G3VA 4K08A 1GHPA 3C7UA 3ZQ5A 4BBTA 4HI4A 3M6HA 4KQQA 5E2EA 4KQRA 2PU4A 1ODVA 2Q0OA 3IWQA 4WZ5A 5FQKA 4GHIA 4K91A 2UV0E 1OJ5A 1P9WA 4NK3A 2Y2MA 4DN0A 1BLCA 2JKGA 1CI8A 3H7WA 3OPHA 3IF6B 3IXHA 1YT4A 5GHXA 3HLFA 3T4QA 1ALQA 4K0XA 4ZJ1A 1K6RA 3EGDC 5L09A 2RL3A 3C2WA 4P6ZM 1K4EA 3C8CA 2Y55A 5HZHA 4MMNA 2XK1A 1W8YA 3LI8A 4DKIA 1CJFA 3LY3A 4ZDXA 4CPKA 4NXGA 4WZ5C 1N9OA 3CI6A 2EWWA 5E43A 5G18A 3IHAA 3Q07A 1T1AA 3WS5A 3FZCA 3MXSA 4L9GA 1IYOA 5HDSA 3NIAA 4HP9A 4QU3A 4OOLA 5U47A 4BMWA 2XSSA 1SHVA 5HDCA 3SH7A 3GECA 2PYRA 2VJWA 5FQQA 5D3OA 4PAUA 1JWVA 3MJQA 1EW0A 3UE0A 3M6BA 2GNXA 3MQOA 4GDBA 1D06A 2VKSA 3C30A 1MC0A 5FDHA 3RXWA 2GDNA 3ISGA 4R3AA 1E3UA 2E8IA 5DTKA 3JPUA 4UQIM 5L07A 2QMIA 5J4EA 1KGGA 1VETB 3PBNA 4JLFA 1BUEA 4P87A 1BT5A 4GKUA 5IT5A 3K3DA 2EWVA 2W3DA 1TDLA 2H28A 3TG9A 4EUVA 4QY6A 1YMSA 4YNRA 1GHMA 5FDSA 5CECA 4D2OA 1K4FA 2HPBA 3IQAA 1KDWA 3D3OA 1S4SA 3ZG8B 3W4PA 3FKWA 3FC7A 5HL6A 2ZOIA 2PRFA 1PYYA 4MDZA 3NOTC 4Y15A 2W1RA 1PI5A 1XKZA 3DTMA 4HHDA 3KSIA 1BULA 3UDIA 3RH8B 4BENA 5HWTA 1FR1A 3DAVA 3QNBA 4II7A 4N92A 4B4XA 4DDYA 3OZHA 3V3SA 2XDMA 3GVBA 1OTDA 1YLPA 4S2KA 1FOFA 3ITBA 1JVJA 5G4YA 4BD1A 3F1PA 2W3EA 3PBRA 4KUKA 1AWIA 2W3FA 4N9KA 1V9ZA 4UAAA 4UA7A 4EBPA 3T4OA 5F6AA 4H6JB 3VP0A 4E3JA 1UGUA 4XXRA 4JGPA 1VEUA 3WWXA 1PFLA 4WLAA 4X53A 2WK0A 2B5RA 2HP9A 5TJJA 3C5AA 1NLYA 4X69A 2WADA 3NI9A 2WUQA 5HW3A 5CEBA 3OBFA 1F5MA 2EX9A 4PPRA 1MBLA 2J8YA 2M1CA 5EOOA 3HUMA 4EWFA 5M18A 2W1TA 1G28A 4ARZB 5HFOA 5EVID 2L4RA 2ZQ9A 3HJIA 3N8LA 2V1AA 1FIKA 2PHYA 4E3MA 2C5WB 2CMNA 1TS8A 3LR4A 5DVAA 2PBDP 2HP6A 2V2FF 5HSQA 2WKPA 1XJ6A 4KZBA 1VETA 3PAEA 1TVFA 1F98A 3UB6A 1SKFA 4YWZA 5EM0A 1ZG6A 4S2IA 2P04A 4Q0IA 5GLBA 1KGFA 3PBTA 2OAP1 4F3LA 5L8MA 3UE1A 1PW1A 3G34A 1IYSA 2ZD8A 1STZA 2P74A 1QMEA 1HLUP 3UPNA 2LB5A 2ZL1A 4S2OA 1Y4OA 1BLSA 3UPPA 4BL2A 4OPZA 3S4XA 2JBFA 2BG1A 2J7VA 1YQSA 4JF6A 2R78A 3VE4A 1LL9A 2FZ0A 4KZ9A 2HGVA 4FTXA 4OPYA 2R9WA 4WEKA 3K3CA 1ERQA 3IHBA 3SH8A 2EFXA 3A3EA 3KYZA 4IVKA 3NDGA 4BJPA 1RGZA 1H8MA 5HWWA 2EFUA 3IX8A 2HV1A 4RX2A 1K25A 4R3JA 4DXCA 4PMAA 1S1ZA 4R4RA 3HUOA 1T18A 3Q7VB 4S2NA 3W4OA 1OTIA 3OPPA 5CX7A 3Q7VA 4I3IA 4NXEA 3LIAA 4LLOB 1LL8A 5M1AA 2I72A 2V8CA 3IX3A 3EQVA 5FAOA 3GV9A 5F1FA 2XEPA 5DTTA 2PDRA 1L2SA 4KZ4A 3BQ8A 4YOFA 1YAXA 1U60A 1IEMA 3DTKA 4JGRA 4DJ2A 2WKHA 4JF5A 4X25A 1O07A 3BFEA 1GSVA 2H10A 3B42A 4QB8A 1I5QA 5KIZA 5AQ9A 3OPRA 3VSLA 1K57A 3JVUA 5CTMA 4Z9QA 4R3BA 1SKOA 3R7WB 1KOUA 1MKMA 3CJMA 3CMZA 4WL9A 2QPNA 3BWLA 2ZOHA 1TD5A 4HNBA 3CG5A 3ZG9B 3LCEA 2Y2GA 1DP8A 4F3LB 5IS1A 2V1BA 4P85A 1XA7A 4WMCD 4GN2A 3MQ0A 4HIAA 1VQQA 4EW7A 3LEZA 3MF0A 4S2MA 4CLCC 5IHVA
chains in the Genus database with same CATH topology
1BLHA 4WMCA 1S6RA 3Q81A 4OOMA 2PU4A 3GSGA 5EVLA 4S2LA 2CC1A 3IWQA 3VOZA 4WZ5A 5FQKA 3ZG0A 3M2JA 1K57C 4K91A 4OONA 4NK3A 2Y2MA 4OQIA 3VOYA 1BLPA 3IXGA 4GD6A 3GR2A 1BLCA 3IXDA 1M40A 4RVAA 1CI8A 2V20A 1YLJA 4GD8A 4DE1A 3BYDA 4ZJ3A 1L0DA 1GA9A 3OPHA 3IF6B 2VGJA 3A3FA 4B88A 3IXHA 1YT4A 4P6BA 5GHXA 3HLFA 1JWPA 1ALQA 4K0XA 4KZ8A 3DWKA 2FFYA 4PM9A 1K6RA 4WELA 4ZJ1A 2RL3A 3SS3A 3WS4A 3VFHA 3UN7A 2EX6A 1NZOA 2OLVA 2ZQ7A 1K4EA 1M6KA 2XFTA 3BLSA 2Y55A 3N8RA 3W8KA 4X55A 5E2HA 3TOIA 2XK1A 4NETA 4C3QA 1FSWA 4LV0A 5FI2A 1W8YA 5EVIB 1EI5A 3WRTA 1EROA 1K55A 3UDFA 2G2UA 3A3IA 2JC7A 4DKIA 3LY3A 2DCFA 3ZHHA 1E25A 4ZDXA 4A5RA 3VP4A 4CPKA 4DDSA 1H8YA 1ZC2A 2WKEA 3BECA 4MNRA 4WZ5C 4GZBA 5EOEA 4KG5A 1WE4A 5E43A 5G18A 1ZKJA 1ERMA 2EXAA 2Z2LB 3IHAA 3Q07A 3WS5A 1PZOA 5BOHA 2XR0A 3FZCA 5CTNA 3MXSA 4UHUA 1IYOA 4KZ7A 3WS1A 3NCKA 3NIAA 3TSGA 4QU3A 2HDSA 3HLDA 5JYPA 4OOLA 3VMAA 3EQUA 4N1HA 5U47A 5TFQA 1DJAA 4K0WA 3SH9A 3IH8A 1N9BA 1SDEA 1LI9A 3BLMA 4DE0A 3G4PA 3P09A 3LY4A 3UNWA 1SHVA 2Y2PA 4U3TA 3V39A 2ZC6B 2JE5A 3G2ZA 1K55C 3SH7A 3HREA 4H8RA 1I2SA 2WGWB 3CZDA 5CRFA 5FQQA 3ZVTA 5D3OA 5FASA 1JWVA 2XF3A 1LHYA 3SOIA 5GHZA 4EUZA 4WBGA 4S2NC 5FAPA 3UE0A 2ZC7A 3M6BA 4R23A 4GDBA 5A91A 3UE3A 3ZNYA 3RXXA 3Q82A 2PBYA 1JTGA 1XA1A 3P98A 1MY8A 3MBZA 4FH2A 2BLSA 5FDHA 3C4OA 3RXWA 1SDNA 2GDNA 5JYOA 2ZQAA 3ISGA 4GDNA 1E3UA 4KQOA 4EBNA 2E8IA 1G68A 3ZVWA 5DTKA 4ZTKA 1MWTA 4C75A 2QMIA 5E2FA 1O7EA 4KZ6A 1KGGA 2WGIA 3Q7ZA 1E3UD 1SCWA 1H5XA 4ZAMA 4JLFA 3PBNA 1BSGA 1BUEA 4JXSA 4P87A 1K56A 2HDQA 3PAGA 4E3LA 3ZFZA 1XP4A 1BT5A 1PWDA 4MBFA 4GKUA 3GQZA 5CGWA 2X71A 5AQAA 4MLLA 4OQ0A 1NZUA 2ZJ9A 1GA0A 5HAIA 1YLWA 1TDLA 4GOGA 1LI0A 1MWRA 4R0QA 4E3IA 2IWDA 2Y2JA 3G35A 4RX3A 2P9VB 3TG9A 3O88A 3DW0A 1Y54A 5EECA 3S1YA 1KE4A 4QY6A 3VP1A 1YMSA 3PBSA 1GHMA 3OC2A 3QNCA 4XUZA 2Y2HA 4LENA 5CECA 4WM9A 2Y2LA 1NYYA 1W8QA 1K4FA 4LCMA 2HPBA 3BM6A 3HLEA 3IQAA 5DF8A 1KDWA 4BD0A 5KZHA 2XGNA 3ZG8B 3W4PA 3FKWA 1W5DA 1JWZA 4KZAA 3UDXA 4C6YA 4L0LA 1PYYA 5KMWA 2H5SA 2R9XA 4Y0UA 1XGJA 4U0TA 1IELA 2XD5A 3VFFA 3BRMA 4RA7A 5GLCA 1PI5A 1XKZA 2Q9NA 5FSRA 1FQGA 3DTMA 4MEZA 3V5MA 3WS2A 4E3OA 3VP3A 2DNSA 1BULA 2G2WA 3UDIA 2QZ6A 3NBLA 3AGFA 4BENA 1FR1A 3QNBA 5GLAA 5EVIC 5GHYA 4N92A 2A3UA 3ZG5A 4B4XA 4CJNA 4DDYA 3BFDA 3AGDA 3OZHA 5HARA 3V3SA 1HD8A 2OV5A 3UPOA 2XDMA 2ZQCA 3HUNA 1IYPA 2C6WB 3GVBA 3A3JA 3QHYA 4D2OA 1KE0A 1IKIA 2Y91A 1YLPA 1K38A 4S2KA 2VGKA 5FQIA 1FOFA 3MZEA 3ITBA 4GNUA 4JKTA 1JVJA 4BD1A 2IWCA 1ES2A 2H0YA 1WYBA 3PBRA 4JXVA 4N1XA 3G32A 5DF9A 1XXMA 4N9KA 1YLTA 2XFSA 2HP5A 5A90A 3HL9A 4UAAA 4WYYA 5FQ9A 4UA7A 2Y2NA 4DF6A 1PW8A 4EBPA 3VP0A 4E3JA 5CGSA 2ZC3B 4XXRA 3G30A 5HAPA 4UA6A 4S2PA 5GL9A 3WWXA 1Q2PA 4KG2A 4X53A 2WK0A 1QMFA 4OLDA 4FSFA 2B5RA 3DWZA 2XQZA 2HP9A 4N9LA 1DY6A 1DJBA 1TEMA 1L0FA 4E3NA 3C5AA 3LO7A 4UA9A 5E2GA 2PU2A 3HLBA 1GHIA 4PM6A 1PWCA 2H0TA 2Z2MB 1OMEA 4X69A 1FR6A 2WADA 4HBTA 3NI9A 2WUQA 3E2KA 3OCLA 1ZG4A 5HW3A 5EE8A 3BFFA 5CEBA 4EQIA 1Z6FA 1C3BA 1CEFA 4X6TA 4OPQA 4RYEA 1PWGA 4PPRA 2EX9A 1HVBA 1ES4A 5FATA 1E4DA 1MBLA 2J8YA 5EOOA 1DJCA 1MKIA 3HUMA 5AQ7A 4EWFA 5M18A 1K54A 5FQJA 2EX8A 3ZG7B 4OKPA 2WAFA 3HBRA 5HFOA 1VM1A 3VSKA 5EVID 2ZQ9A 4FD8A 4IBRA 3N8LA 4MBHA 5DF7A 2EX2A 3V50A 1HZOA 2Y2QA 4HESA 3HLWA 4KG6A 1YMXA 1HTZA 2ZQDA 4E3MA 1NRFA 4BL3A 2C5WB 3ZDJA 1RP5A 4HEFA 3BEBA 5DVAA 2ZC4B 3IH9A 1BTLA 3OPLA 4F94A 3AGEA 2HP6A 3ZCZA 2V2FF 2JCHA 2WYXA 4QY5A 4JPMA 1KE3A 1PIOA 3N6IA 3HLCA 3IF5A 3O3VA 4KZBA 5AQBA 5M19A 1XPBA 1FCNA 1MWUA 5CHMA 2Y59A 3GMWA 3PAEA 4YFMA 1J9MA 1TVFA 5F82A 1SKFA 4MBKA 3ZNTA 1H8ZA 1ZG6A 4OP5A 3S22A 4OOYA 4S2IA 3D4FA 4OLGA 1L0GA 2FFFB 1CI9A 1K54C 3Q1FA 4R4SA 1KGFA 3HVFA 3PBTA 5GLBA 4YINA 2X01A 1K6SA 4GB7A 1RCJA 4IEDA 5FI6A 4M3KA 3OCNA 1MPLA 4Q8IA 3UE1A 1PW1A 3G34A 4BQMA 4EBLA 1RGYA 4Y7PA 1IYSA 1MWSA 3FYZA 1NJ4A 3W4QA 3WRZA 4HBUA 2WZXA 1KVLA 2V1ZA 2ZD8A 5CHJA 4U0XA 4FH4A 2P74A 2RCXA 4B4ZA 1QMEA 3A3DA 4S2JA 3UPNA 2ZM2A 1AXBA 3GRJA 1G6AA 1IYQA 3G2YA 3UO9A 3M2KA 3V3RA 3UPPA 1W79A 4LV2A 1BLSA 3NC8A 4OP8A 4S2OA 5L2FA 1I2WA 3B3XA 3BFCA 1LL5A 2ZQ8A 1KGEA 1NY0A 3NDEA 1EWZA 4BL2A 4PM5A 4OPZA 2JBFA 3PTEA 2BG1A 2DRWA 2J7VA 1YQSA 4JF6A 4OVDA 3S4XA 4WEJA 1PI4A 5HAQA 1LL9A 4KZ9A 3IT9A 3O87A 1PZPA 4OPYA 2R9WA 4Y0TA 4OH0A 4BLMA 2J9OA 4WEKA 3ITAA 5F83A 3G31A 4OQHA 3FWLA 1ERQA 4XUXA 2OSUA 3IHBA 4X56A 4LV1A 4O7DA 3SH8A 2EFXA 3N8SA 4DE2A 5J8XA 3A3EA 1XGIA 1ONHA 5KSHA 3MKFA 2UWXA 5CERA 4LCLA 5CXWA 4IVKA 4KZ3A 5TR7A 3NDGA 4IBXA 5I94A 1Q2QA 5FA7A 5EUAA 1RGZA 5GLDA 1YLZA 1BZAA 3FKVA 4BJPA 5CEDA 4OQGA 2Y2KA 4E6WA 5DTSA 2EFUA 5FI7A 3ZGAB 4PM8A 4RX2A 4QD4A 1FCMA 3MKEA 3FV7A 1K25A 2X02A 5EVIA 4E3KA 4E6XA 4R3JA 2WGVA 4OPRA 4DXCA 4PMAA 1ONGA 3N7WA 3IF6C 1JTDA 5CHUA 2HDRA 1ESUA 1MXOA 4JXGA 3HUOA 4R4RA 3GTCA 3N4IA 3Q7VB 4KENB 4S2NA 3W4OA 3OPPA 2A49A 3C4PA 3Q7VA 4WZ4A 4ZBEA 2Y2OA 3MZDA 2J9PA 2ZC5B 3SS4A 3IXBA 3NY4A 1KVMA 4P0MA 4IVIA 5M1AA 3WS0A 2I72A 1K56D 1ESIA 4ZJ2A 3PBOA 2WAEA 2HDUA 3EQVA 5FAOA 5A93A 1ES5A 2Q9MA 4JBFA 1N4OA 5FQMA 5CGXA 5FAQA 3GV9A 5F1FA 2XEPA 1TDGA 1LLBA 5DTTA 4QJGA 1CK3A 1L2SA 1YLYA 4FCFA 4KZ4A 5KSCA 3C7VA 1ES3A 3PBQA 4ID4A 1FSYA 2P9VA 2WZZA 2XD1A 2XLNA 4PM7A 1U60A 3I7JA 1S0WA 1IEMA 5TGFA 4JF4A 3MZFA 3UY6A 1W7FA 2OLUA 2WKHA 1NYMA 1O07A 3IF6A 4JF5A 1IKGA 3BFEA 2H10A 1KDSA 4KZ5A 3IWOA 1NXYA 5HX9A 4QB8A 1I5QA 5AQ9A 3BFGA 2Y2IA 3OPRA 3MFDA 3VSLA 1K57A 4JXWA 2Y4AA 3HLGA 2ZMAA 3JYIA 5CTMA 4Z9QA 2IWBA 4R3BA 4Y0OA 2XH9A 4DRTA 2ZLYA 4X68A 1CEGA 3O86A 1WYCA 1XX2A 3CJMA 5HL1A 5A92A 2EXBA 3MXRA 4DE3A 3CMZA 2QPNA 4LV3A 4R1GA 4EV4A 3CG5A 3IWIA 3ZG9B 3LCEA 2Y2GA 4DXBA 5F1GA 1YM1A 3VP2A 3E2LA 4P85A 1XA7A 1FCOA 2ZM8A 1GCEA 4GN2A 4WMCD 1L0EA 5EPHA 2WGWA 1VQQA 1GHPA 3LEZA 3C7UA 2WKIA 3RJUA 2ZM0A 3M6HA 3SS5A 4KQQA 5E2EA 4QHCA 4S2MA 4KQRA 5IHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLH A;  4WMC A;  1S6R A;  3Q81 A;  4OOM A;  2PU4 A;  3GSG A;  5EVL A;  4S2L A;  2CC1 A;  3IWQ A;  3VOZ A;  4WZ5 A;  5FQK A;  3ZG0 A;  3M2J A;  1K57 C;  4K91 A;  4OON A;  4NK3 A;  2Y2M A;  4OQI A;  3VOY A;  1BLP A;  3IXG A;  4GD6 A;  3GR2 A;  1BLC A;  3IXD A;  1M40 A;  4RVA A;  1CI8 A;  2V20 A;  1YLJ A;  4GD8 A;  4DE1 A;  3BYD A;  4ZJ3 A;  1L0D A;  1GA9 A;  3OPH A;  3IF6 B;  2VGJ A;  3A3F A;  4B88 A;  3IXH A;  1YT4 A;  4P6B A;  5GHX A;  3HLF A;  1JWP A;  1ALQ A;  4K0X A;  4KZ8 A;  3DWK A;  2FFY A;  4PM9 A;  1K6R A;  4WEL A;  4ZJ1 A;  2RL3 A;  3SS3 A;  3WS4 A;  3VFH A;  3UN7 A;  2EX6 A;  1NZO A;  2OLV A;  2ZQ7 A;  1K4E A;  1M6K A;  2XFT A;  3BLS A;  2Y55 A;  3N8R A;  3W8K A;  4X55 A;  5E2H A;  3TOI A;  2XK1 A;  4NET A;  4C3Q A;  1FSW A;  4LV0 A;  5FI2 A;  1W8Y A;  5EVI B;  1EI5 A;  3WRT A;  1ERO A;  1K55 A;  3UDF A;  2G2U A;  3A3I A;  2JC7 A;  4DKI A;  3LY3 A;  2DCF A;  3ZHH A;  1E25 A;  4ZDX A;  4A5R A;  3VP4 A;  4CPK A;  4DDS A;  1H8Y A;  1ZC2 A;  2WKE A;  3BEC A;  4MNR A;  4WZ5 C;  4GZB A;  5EOE A;  4KG5 A;  1WE4 A;  5E43 A;  5G18 A;  1ZKJ A;  1ERM A;  2EXA A;  2Z2L B;  3IHA A;  3Q07 A;  3WS5 A;  1PZO A;  5BOH A;  2XR0 A;  3FZC A;  5CTN A;  3MXS A;  4UHU A;  1IYO A;  4KZ7 A;  3WS1 A;  3NCK A;  3NIA A;  3TSG A;  4QU3 A;  2HDS A;  3HLD A;  5JYP A;  4OOL A;  3VMA A;  3EQU A;  4N1H A;  5U47 A;  5TFQ A;  1DJA A;  4K0W A;  3SH9 A;  3IH8 A;  1N9B A;  1SDE A;  1LI9 A;  3BLM A;  4DE0 A;  3G4P A;  3P09 A;  3LY4 A;  3UNW A;  1SHV A;  2Y2P A;  4U3T A;  3V39 A;  2ZC6 B;  2JE5 A;  3G2Z A;  1K55 C;  3SH7 A;  3HRE A;  4H8R A;  1I2S A;  2WGW B;  3CZD A;  5CRF A;  5FQQ A;  3ZVT A;  5D3O A;  5FAS A;  1JWV A;  2XF3 A;  1LHY A;  3SOI A;  5GHZ A;  4EUZ A;  4WBG A;  4S2N C;  5FAP A;  3UE0 A;  2ZC7 A;  3M6B A;  4R23 A;  4GDB A;  5A91 A;  3UE3 A;  3ZNY A;  3RXX A;  3Q82 A;  2PBY A;  1JTG A;  1XA1 A;  3P98 A;  1MY8 A;  3MBZ A;  4FH2 A;  2BLS A;  5FDH A;  3C4O A;  3RXW A;  1SDN A;  2GDN A;  5JYO A;  2ZQA A;  3ISG A;  4GDN A;  1E3U A;  4KQO A;  4EBN A;  2E8I A;  1G68 A;  3ZVW A;  5DTK A;  4ZTK A;  1MWT A;  4C75 A;  2QMI A;  5E2F A;  1O7E A;  4KZ6 A;  1KGG A;  2WGI A;  3Q7Z A;  1E3U D;  1SCW A;  1H5X A;  4ZAM A;  4JLF A;  3PBN A;  1BSG A;  1BUE A;  4JXS A;  4P87 A;  1K56 A;  2HDQ A;  3PAG A;  4E3L A;  3ZFZ A;  1XP4 A;  1BT5 A;  1PWD A;  4MBF A;  4GKU A;  3GQZ A;  5CGW A;  2X71 A;  5AQA A;  4MLL A;  4OQ0 A;  1NZU A;  2ZJ9 A;  1GA0 A;  5HAI A;  1YLW A;  1TDL A;  4GOG A;  1LI0 A;  1MWR A;  4R0Q A;  4E3I A;  2IWD A;  2Y2J A;  3G35 A;  4RX3 A;  2P9V B;  3TG9 A;  3O88 A;  3DW0 A;  1Y54 A;  5EEC A;  3S1Y A;  1KE4 A;  4QY6 A;  3VP1 A;  1YMS A;  3PBS A;  1GHM A;  3OC2 A;  3QNC A;  4XUZ A;  2Y2H A;  4LEN A;  5CEC A;  4WM9 A;  2Y2L A;  1NYY A;  1W8Q A;  1K4F A;  4LCM A;  2HPB A;  3BM6 A;  3HLE A;  3IQA A;  5DF8 A;  1KDW A;  4BD0 A;  5KZH A;  2XGN A;  3ZG8 B;  3W4P A;  3FKW A;  1W5D A;  1JWZ A;  4KZA A;  3UDX A;  4C6Y A;  4L0L A;  1PYY A;  5KMW A;  2H5S A;  2R9X A;  4Y0U A;  1XGJ A;  4U0T A;  1IEL A;  2XD5 A;  3VFF A;  3BRM A;  4RA7 A;  5GLC A;  1PI5 A;  1XKZ A;  2Q9N A;  5FSR A;  1FQG A;  3DTM A;  4MEZ A;  3V5M A;  3WS2 A;  4E3O A;  3VP3 A;  2DNS A;  1BUL A;  2G2W A;  3UDI A;  2QZ6 A;  3NBL A;  3AGF A;  4BEN A;  1FR1 A;  3QNB A;  5GLA A;  5EVI C;  5GHY A;  4N92 A;  2A3U A;  3ZG5 A;  4B4X A;  4CJN A;  4DDY A;  3BFD A;  3AGD A;  3OZH A;  5HAR A;  3V3S A;  1HD8 A;  2OV5 A;  3UPO A;  2XDM A;  2ZQC A;  3HUN A;  1IYP A;  2C6W B;  3GVB A;  3A3J A;  3QHY A;  4D2O A;  1KE0 A;  1IKI A;  2Y91 A;  1YLP A;  1K38 A;  4S2K A;  2VGK A;  5FQI A;  1FOF A;  3MZE A;  3ITB A;  4GNU A;  4JKT A;  1JVJ A;  4BD1 A;  2IWC A;  1ES2 A;  2H0Y A;  1WYB A;  3PBR A;  4JXV A;  4N1X A;  3G32 A;  5DF9 A;  1XXM A;  4N9K A;  1YLT A;  2XFS A;  2HP5 A;  5A90 A;  3HL9 A;  4UAA A;  4WYY A;  5FQ9 A;  4UA7 A;  2Y2N A;  4DF6 A;  1PW8 A;  4EBP A;  3VP0 A;  4E3J A;  5CGS A;  2ZC3 B;  4XXR A;  3G30 A;  5HAP A;  4UA6 A;  4S2P A;  5GL9 A;  3WWX A;  1Q2P A;  4KG2 A;  4X53 A;  2WK0 A;  1QMF A;  4OLD A;  4FSF A;  2B5R A;  3DWZ A;  2XQZ A;  2HP9 A;  4N9L A;  1DY6 A;  1DJB A;  1TEM A;  1L0F A;  4E3N A;  3C5A A;  3LO7 A;  4UA9 A;  5E2G A;  2PU2 A;  3HLB A;  1GHI A;  4PM6 A;  1PWC A;  2H0T A;  2Z2M B;  1OME A;  4X69 A;  1FR6 A;  2WAD A;  4HBT A;  3NI9 A;  2WUQ A;  3E2K A;  3OCL A;  1ZG4 A;  5HW3 A;  5EE8 A;  3BFF A;  5CEB A;  4EQI A;  1Z6F A;  1C3B A;  1CEF A;  4X6T A;  4OPQ A;  4RYE A;  1PWG A;  4PPR A;  2EX9 A;  1HVB A;  1ES4 A;  5FAT A;  1E4D A;  1MBL A;  2J8Y A;  5EOO A;  1DJC A;  1MKI A;  3HUM A;  5AQ7 A;  4EWF A;  5M18 A;  1K54 A;  5FQJ A;  2EX8 A;  3ZG7 B;  4OKP A;  2WAF A;  3HBR A;  5HFO A;  1VM1 A;  3VSK A;  5EVI D;  2ZQ9 A;  4FD8 A;  4IBR A;  3N8L A;  4MBH A;  5DF7 A;  2EX2 A;  3V50 A;  1HZO A;  2Y2Q A;  4HES A;  3HLW A;  4KG6 A;  1YMX A;  1HTZ A;  2ZQD A;  4E3M A;  1NRF A;  4BL3 A;  2C5W B;  3ZDJ A;  1RP5 A;  4HEF A;  3BEB A;  5DVA A;  2ZC4 B;  3IH9 A;  1BTL A;  3OPL A;  4F94 A;  3AGE A;  2HP6 A;  3ZCZ A;  2V2F F;  2JCH A;  2WYX A;  4QY5 A;  4JPM A;  1KE3 A;  1PIO A;  3N6I A;  3HLC A;  3IF5 A;  3O3V A;  4KZB A;  5AQB A;  5M19 A;  1XPB A;  1FCN A;  1MWU A;  5CHM A;  2Y59 A;  3GMW A;  3PAE A;  4YFM A;  1J9M A;  1TVF A;  5F82 A;  1SKF A;  4MBK A;  3ZNT A;  1H8Z A;  1ZG6 A;  4OP5 A;  3S22 A;  4OOY A;  4S2I A;  3D4F A;  4OLG A;  1L0G A;  2FFF B;  1CI9 A;  1K54 C;  3Q1F A;  4R4S A;  1KGF A;  3HVF A;  3PBT A;  5GLB A;  4YIN A;  2X01 A;  1K6S A;  4GB7 A;  1RCJ A;  4IED A;  5FI6 A;  4M3K A;  3OCN A;  1MPL A;  4Q8I A;  3UE1 A;  1PW1 A;  3G34 A;  4BQM A;  4EBL A;  1RGY A;  4Y7P A;  1IYS A;  1MWS A;  3FYZ A;  1NJ4 A;  3W4Q A;  3WRZ A;  4HBU A;  2WZX A;  1KVL A;  2V1Z A;  2ZD8 A;  5CHJ A;  4U0X A;  4FH4 A;  2P74 A;  2RCX A;  4B4Z A;  1QME A;  3A3D A;  4S2J A;  3UPN A;  2ZM2 A;  1AXB A;  3GRJ A;  1G6A A;  1IYQ A;  3G2Y A;  3UO9 A;  3M2K A;  3V3R A;  3UPP A;  1W79 A;  4LV2 A;  1BLS A;  3NC8 A;  4OP8 A;  4S2O A;  5L2F A;  1I2W A;  3B3X A;  3BFC A;  1LL5 A;  2ZQ8 A;  1KGE A;  1NY0 A;  3NDE A;  1EWZ A;  4BL2 A;  4PM5 A;  4OPZ A;  2JBF A;  3PTE A;  2BG1 A;  2DRW A;  2J7V A;  1YQS A;  4JF6 A;  4OVD A;  3S4X A;  4WEJ A;  1PI4 A;  5HAQ A;  1LL9 A;  4KZ9 A;  3IT9 A;  3O87 A;  1PZP A;  4OPY A;  2R9W A;  4Y0T A;  4OH0 A;  4BLM A;  2J9O A;  4WEK A;  3ITA A;  5F83 A;  3G31 A;  4OQH A;  3FWL A;  1ERQ A;  4XUX A;  2OSU A;  3IHB A;  4X56 A;  4LV1 A;  4O7D A;  3SH8 A;  2EFX A;  3N8S A;  4DE2 A;  5J8X A;  3A3E A;  1XGI A;  1ONH A;  5KSH A;  3MKF A;  2UWX A;  5CER A;  4LCL A;  5CXW A;  4IVK A;  4KZ3 A;  5TR7 A;  3NDG A;  4IBX A;  5I94 A;  1Q2Q A;  5FA7 A;  5EUA A;  1RGZ A;  5GLD A;  1YLZ A;  1BZA A;  3FKV A;  4BJP A;  5CED A;  4OQG A;  2Y2K A;  4E6W A;  5DTS A;  2EFU A;  5FI7 A;  3ZGA B;  4PM8 A;  4RX2 A;  4QD4 A;  1FCM A;  3MKE A;  3FV7 A;  1K25 A;  2X02 A;  5EVI A;  4E3K A;  4E6X A;  4R3J A;  2WGV A;  4OPR A;  4DXC A;  4PMA A;  1ONG A;  3N7W A;  3IF6 C;  1JTD A;  5CHU A;  2HDR A;  1ESU A;  1MXO A;  4JXG A;  3HUO A;  4R4R A;  3GTC A;  3N4I A;  3Q7V B;  4KEN B;  4S2N A;  3W4O A;  3OPP A;  2A49 A;  3C4P A;  3Q7V A;  4WZ4 A;  4ZBE A;  2Y2O A;  3MZD A;  2J9P A;  2ZC5 B;  3SS4 A;  3IXB A;  3NY4 A;  1KVM A;  4P0M A;  4IVI A;  5M1A A;  3WS0 A;  2I72 A;  1K56 D;  1ESI A;  4ZJ2 A;  3PBO A;  2WAE A;  2HDU A;  3EQV A;  5FAO A;  5A93 A;  1ES5 A;  2Q9M A;  4JBF A;  1N4O A;  5FQM A;  5CGX A;  5FAQ A;  3GV9 A;  5F1F A;  2XEP A;  1TDG A;  1LLB A;  5DTT A;  4QJG A;  1CK3 A;  1L2S A;  1YLY A;  4FCF A;  4KZ4 A;  5KSC A;  3C7V A;  1ES3 A;  3PBQ A;  4ID4 A;  1FSY A;  2P9V A;  2WZZ A;  2XD1 A;  2XLN A;  4PM7 A;  1U60 A;  3I7J A;  1S0W A;  1IEM A;  5TGF A;  4JF4 A;  3MZF A;  3UY6 A;  1W7F A;  2OLU A;  2WKH A;  1NYM A;  1O07 A;  3IF6 A;  4JF5 A;  1IKG A;  3BFE A;  2H10 A;  1KDS A;  4KZ5 A;  3IWO A;  1NXY A;  5HX9 A;  4QB8 A;  1I5Q A;  5AQ9 A;  3BFG A;  2Y2I A;  3OPR A;  3MFD A;  3VSL A;  1K57 A;  4JXW A;  2Y4A A;  3HLG A;  2ZMA A;  3JYI A;  5CTM A;  4Z9Q A;  2IWB A;  4R3B A;  4Y0O A;  2XH9 A;  4DRT A;  2ZLY A;  4X68 A;  1CEG A;  3O86 A;  1WYC A;  1XX2 A;  3CJM A;  5HL1 A;  5A92 A;  2EXB A;  3MXR A;  4DE3 A;  3CMZ A;  2QPN A;  4LV3 A;  4R1G A;  4EV4 A;  3CG5 A;  3IWI A;  3ZG9 B;  3LCE A;  2Y2G A;  4DXB A;  5F1G A;  1YM1 A;  3VP2 A;  3E2L A;  4P85 A;  1XA7 A;  1FCO A;  2ZM8 A;  1GCE A;  4GN2 A;  4WMC D;  1L0E A;  5EPH A;  2WGW A;  1VQQ A;  1GHP A;  3LEZ A;  3C7U A;  2WKI A;  3RJU A;  2ZM0 A;  3M6H A;  3SS5 A;  4KQQ A;  5E2E A;  4QHC A;  4S2M A;  4KQR A;  5IHV A; 
#chains in the Genus database with same CATH topology
 1S6R A;  3Q81 A;  4IUH A;  2CC1 A;  1K57 C;  1OTA A;  2QWS A;  3QP1 A;  1BLP A;  4GD6 A;  3IXD A;  4H6J A;  2V20 A;  1YLJ A;  4DE1 A;  1DRM A;  1S67 L;  3MXQ A;  2PAV P;  4PM9 A;  2FFY A;  4WEL A;  2PR5 A;  3WS4 A;  2EX6 A;  2OLV A;  2ZQ7 A;  2XFT A;  3N8R A;  3EGX C;  1S66 L;  3TOI A;  4C3Q A;  1FSW A;  4CQH A;  5EVI B;  1ERO A;  1K55 A;  3A3I A;  3ZHH A;  3W2Z A;  4A5R A;  4CLC A;  3T1X A;  2HJ9 C;  1J3W A;  1TS6 A;  3T50 A;  5F68 A;  1ZKJ A;  1ERM A;  2Z2L B;  3GDI A;  1PZO A;  2XR0 A;  5FEF A;  4ETX A;  3WS1 A;  2HDS A;  3EQU A;  2JKR I;  5TFQ A;  5HWV A;  1N9B A;  3S7N A;  1LI9 A;  1P0Z A;  4I3A A;  3G4P A;  2VX8 A;  3P09 A;  3T1S A;  3UNW A;  2Y2P A;  3MR0 A;  1K55 C;  4G3W A;  3HRE A;  4IUK A;  4XT2 B;  2ACG A;  3CZD A;  5CRF A;  4EEP A;  1W63 Q;  4EUZ A;  1BYW A;  5FAP A;  4R23 A;  5A91 A;  1LSV A;  4L9E A;  2BLS A;  3C4O A;  5JYO A;  1S4R A;  4KQO A;  4PKY G;  2W0N A;  1GSW A;  4RQ9 A;  5E2F A;  3Q7Z A;  1L3L A;  1NRJ A;  4JXS A;  3CUE A;  1LT0 A;  3VE3 A;  1PWD A;  3GQZ A;  2X71 A;  5AQA A;  1Y28 A;  1NZU A;  4GOG A;  3LR0 A;  4E3I A;  2Y2J A;  4GS9 B;  1F2K A;  5EEC A;  4G3K A;  3S1Y A;  4GJ4 A;  3IS2 A;  3QP6 A;  1VHM A;  2Y2H A;  1ZHH B;  4B9O A;  4DMZ A;  2Y2L A;  1NYY A;  4BD0 A;  3BM6 A;  3RFB A;  4WUJ A;  1W5D A;  2Y79 A;  3UDX A;  4L0L A;  2VEA A;  3VFF A;  3BRM A;  5GLC A;  3LIE A;  4E3O A;  3VP3 A;  4GCZ A;  3CUE C;  2XRO A;  2A3U A;  4CJN A;  4LFU A;  3AGD A;  2VV6 A;  5HAR A;  3UPO A;  3T4J A;  2ZQC A;  3SW1 A;  3A3J A;  1KE0 A;  3CPT A;  4WN5 A;  2Y91 A;  4KQD A;  4LPZ A;  3MZE A;  2W27 A;  2IWC A;  2PR6 A;  2O9C A;  4N1X A;  1OPX A;  3G32 A;  5DF9 A;  1TS0 A;  3NOU C;  2XFS A;  2HP5 A;  1IFQ A;  5A90 A;  4WYY A;  3CPT B;  2Y2N A;  4DF6 A;  2ZC3 B;  5HAP A;  3G30 A;  5AVE A;  4S2P A;  1Z09 A;  1Q2P A;  1IOU A;  4QPR A;  4OLD A;  3PHY A;  2GJ3 A;  3DWZ A;  4N9L A;  1DJB A;  2VV7 A;  4PM6 A;  5DFX A;  2H0T A;  2Z2M B;  1FR6 A;  3S7Q A;  3L9K A;  1Z6F A;  1C3B A;  4X6T A;  2YKF A;  1PWG A;  5FAT A;  1DJC A;  1MKI A;  5FQJ A;  3VSK A;  1VM1 A;  5DF7 A;  1PNE A;  2EX2 A;  1HZO A;  1YMX A;  2ZQD A;  1NRF A;  4GS9 A;  4FUW A;  4GLQ A;  2FH5 A;  3UB5 P;  5J3W A;  3OPL A;  4F94 A;  3AGE A;  5M19 A;  1PIO A;  3O3V A;  3HLC A;  5AQB A;  2ZMF A;  1XPB A;  3SZT A;  1MWU A;  4HJ4 A;  3U2A A;  3B33 A;  1H8Z A;  3S22 A;  2BTF P;  3QP5 A;  1L0G A;  1CI9 A;  3DTI A;  3HVF A;  5HPI A;  4IED A;  3UB7 A;  4M3K A;  3MFX A;  3OCN A;  4BQM A;  1RGY A;  4Y7P A;  2WZX A;  2V1Z A;  4FH4 A;  1WA9 A;  2A24 B;  4I39 A;  2M7V A;  2ZM2 A;  3GRJ A;  3UMD A;  1IYQ A;  3UO9 A;  3NC8 A;  5L2F A;  1I2W A;  3BFC A;  2V0U A;  2ZQ8 A;  1KGE A;  2W1T B;  3NDE A;  2PYP A;  1XJ4 A;  4D60 A;  3MQQ A;  4WEJ A;  1PI4 A;  1PZP A;  4HJ6 A;  5TBM B;  5F83 A;  3G31 A;  3FWL A;  4X56 A;  3C38 A;  4DE2 A;  4NXB A;  4R6L A;  4PHT A;  5KSH A;  4KZ3 A;  5TR7 A;  2M7U A;  4UEY A;  1H0M A;  2OWJ A;  3JVV A;  2J80 A;  3NOP C;  2W3G A;  2Z6C A;  2XA7 M;  2KX6 A;  3FV7 A;  5EVI A;  3ICY A;  4E3K A;  4E6X A;  3LI9 A;  4OPR A;  2JN7 A;  3IF6 C;  5CHU A;  1D7E A;  1UWN X;  3N4I A;  4NEE D;  2A49 A;  2Y2O A;  4M4X A;  2J9P A;  3IXB A;  1KVM A;  1DP9 A;  4IVI A;  4NG2 A;  4ZJ2 A;  3PBO A;  1ES5 A;  2Q9M A;  4JBF A;  4P6Z S;  4QJG A;  4ME4 A;  4DJ3 A;  2WZZ A;  3IBJ A;  4PM7 A;  1S0W A;  3MZF A;  1NYM A;  3IF6 A;  3A0R A;  3IWO A;  3OLO A;  3MS6 A;  2OOL A;  3MFD A;  2Y4A A;  3EEH A;  4Y0O A;  2XH9 A;  5J7E A;  1G6O A;  3O86 A;  2K7S A;  1XX2 A;  5HL1 A;  5A92 A;  4LV3 A;  3QP2 A;  2VV8 A;  1CQA A;  5F1G A;  3VP2 A;  4LRZ E;  5EPH A;  2GX5 A;  1L0E A;  2Y8H A;  2WGW A;  3KSF A;  3RJU A;  2ZM0 A;  3NUL A;  3SS5 A;  4QHC A;  3BW6 A;  3D72 A;  3M2J A;  4OON A;  4OQI A;  3VOY A;  3FG8 A;  3GR2 A;  4RVA A;  5DJT A;  4GD8 A;  4ZJ3 A;  1L0D A;  1GA9 A;  3LIB A;  4B88 A;  2V9A A;  2B18 A;  5TBM A;  4HH2 A;  2INW A;  3LUQ A;  3UN7 A;  3W8K A;  1M6K A;  3BLS A;  3T12 B;  4GW9 A;  5FI2 A;  1EI5 A;  1VB6 A;  2G2U A;  2JC7 A;  3R4K A;  2DCF A;  1E25 A;  3DTE A;  4DDS A;  1ZC2 A;  2WKE A;  5EM1 A;  3BEC A;  2NUT C;  4KG5 A;  3LIF A;  1N9N A;  4UHU A;  5LBR A;  3NCK A;  4IHQ A;  3TSG A;  3KYQ A;  4LGW A;  3HLD A;  1DJA A;  4K0W A;  4EES A;  3E4Q A;  3IH8 A;  2VGL S;  1SDE A;  1XJ2 A;  2LB9 A;  5AVF A;  4U3T A;  4UQI S;  2ZL1 B;  4MN7 A;  4JGO A;  4H8R A;  1I2S A;  1JNU A;  2WGW B;  3ZVT A;  2XF3 A;  3SOI A;  4WBG A;  1MZU A;  1YKD A;  5DJU A;  2VK3 A;  4Y3I A;  3UE3 A;  1XA1 A;  3P98 A;  3U4L P;  3R7W A;  1SDN A;  2ZQA A;  4GDN A;  1G68 A;  1MWT A;  4C75 A;  4L9F A;  2VGL M;  1YPR A;  4KZ6 A;  4ZAM A;  1BSG A;  3E4O A;  3K2N A;  2HDQ A;  3PAG A;  4E3L A;  4O8G A;  5G4Z A;  4MLL A;  4ETZ A;  2K2N A;  1GA0 A;  1MWR A;  4R0Q A;  3O88 A;  3DW0 A;  1Y54 A;  1KE4 A;  1DP6 A;  3PBS A;  5MC7 A;  1FIL A;  4WM9 A;  3TW8 A;  4LCM A;  1W8Q A;  5KZH A;  2XGN A;  5HPF A;  2JKT I;  1JWZ A;  4C6Y A;  1N9L A;  2H5S A;  2R9X A;  3CIT A;  2NUP C;  1XGJ A;  1IEL A;  4RA7 A;  2Q9N A;  4MEZ A;  3V5M A;  1UWP X;  2QZ6 A;  3NBL A;  3IBR A;  2K31 A;  2KLI A;  3ZG5 A;  4HOI A;  1HD8 A;  1IYP A;  1ZTU A;  3QHY A;  2YKH A;  5EVE A;  2V8F A;  3QP4 A;  1P9R A;  4O0P A;  5FQI A;  1ES2 A;  5DKK A;  5FQ9 A;  4UA6 A;  3RTY A;  1QMF A;  4E04 A;  1DY6 A;  3A0S A;  1TEM A;  5HDD A;  2VZW A;  3LO7 A;  4MCW A;  2PU2 A;  3HLB A;  4Y13 A;  2B02 A;  3V67 A;  1OME A;  4HBT A;  3FPV A;  3E2K A;  1H3Q A;  3H9W A;  4HJ3 A;  5HD5 A;  1ES4 A;  2O9A A;  5AQ7 A;  1K54 A;  2EX8 A;  4OKP A;  3HBR A;  3NJA A;  3V50 A;  2PT7 A;  4HES A;  3HLW A;  1HTZ A;  2XRN A;  4BL3 A;  5FL3 A;  2AVX A;  1RP5 A;  3BEB A;  4HH3 A;  3IH9 A;  1BTL A;  2JCH A;  2WYX A;  2D01 A;  1KE3 A;  3N6I A;  3IF5 A;  2O0Y A;  1FCN A;  3GMW A;  3F1P B;  4YFM A;  1J9M A;  4X1M A;  5F82 A;  3F1O A;  2BAS A;  1TF1 A;  3F1N B;  1XJ3 A;  4OP5 A;  4OOY A;  1K54 C;  3Q1F A;  4YIN A;  1K6S A;  4EEU A;  3FPW A;  2QYB A;  4HY8 A;  1MPL A;  3FYZ A;  1NJ4 A;  3W4Q A;  1T1C A;  1KVL A;  4BBU A;  2VLG A;  5CHJ A;  2J3W A;  2RCX A;  3D9Y A;  3DBA A;  4S2J A;  2E8J A;  1AXB A;  1ACF A;  5J8X A;  3G2Y A;  3LEQ A;  3M2K A;  3V3R A;  1W79 A;  3B3X A;  1LL5 A;  2QJ5 A;  1OTE A;  1NY0 A;  2DRW A;  1T19 A;  4R70 A;  3O87 A;  4OH0 A;  4LV1 A;  4O7D A;  4LRX C;  3G6O A;  5CXW A;  4Y2F A;  5I94 A;  4HP4 A;  1YLZ A;  1BZA A;  4Y17 A;  5CED A;  4R38 A;  2Y2K A;  5DTS A;  2MJ6 A;  3ZGA B;  4PM8 A;  2QKP A;  4QD4 A;  3MKE A;  1ONG A;  3N7W A;  4O01 A;  1ESU A;  4JXG A;  3GTC A;  4KEN B;  5A8B A;  4EER A;  3C4P A;  4WZ4 A;  4ZBE A;  3MZD A;  2ZC5 B;  3SS4 A;  3LYX A;  2L1M A;  4WF0 A;  3NY4 A;  4P0M A;  3WS0 A;  1K56 D;  2WAE A;  2HDU A;  3LR3 A;  1N4O A;  3LFV A;  5FAQ A;  1YLY A;  2D02 A;  1ES3 A;  3PBQ A;  4ID4 A;  4CLC E;  2O99 A;  2XLN A;  3KSH A;  3TRC A;  5F5Y A;  3I7J A;  5TGF A;  2OLU A;  1IKG A;  1KDS A;  3VV4 A;  3T4S A;  3BFG A;  2Y2I A;  5IU1 A;  4JXW A;  3HLG A;  2ZMA A;  3UE6 A;  3JYI A;  1T1B A;  3H82 B;  2ZLY A;  3H82 A;  4IJG A;  2EXB A;  3T4T A;  4R1G A;  2KDK A;  3IWI A;  4DXB A;  1YM1 A;  3S7P A;  3E2L A;  1GCE A;  2P7J A;  4QWO A;  1P97 A;  4XT2 A;  2WKI A;  1NWZ A;  3LGO A;  1BLH A;  4WMC A;  4OOM A;  3GSG A;  5EVL A;  4S2L A;  3KSG A;  3B47 A;  3VOZ A;  3ZG0 A;  2A2L A;  1LSW A;  4MN6 A;  3IXG A;  1M40 A;  3BYD A;  2VGJ A;  3A3F A;  4P6B A;  3QP8 A;  1JWP A;  4KZ8 A;  3DWK A;  3SS3 A;  4FOF A;  3VFH A;  1NZO A;  3BJN A;  1PRQ A;  4X55 A;  5E2H A;  5L10 A;  4NET A;  4LV0 A;  3PYP A;  3WRT A;  2OAQ 1;  3UDF A;  3UB8 A;  5DKL A;  2J3T C;  4GHI B;  3VP4 A;  1SKO B;  1H8Y A;  4MNR A;  4HQA A;  5EOE A;  4GZB A;  1WE4 A;  2EXA A;  5BOH A;  5CTN A;  2G7U A;  4KZ7 A;  2JHE A;  2WKR A;  2DMW A;  3EOI A;  5JYP A;  2PD8 A;  3OOV A;  4JGQ A;  3VMA A;  4N1H A;  3SH9 A;  3E98 A;  3BLM A;  4DE0 A;  3LY4 A;  2JKR M;  4I5S A;  3BY9 A;  4ZRR A;  3V39 A;  2ZC6 B;  4EU0 A;  2JE5 A;  1OT6 A;  3G2Z A;  1X0O A;  3ZYT A;  1LSX A;  5FAS A;  1LHY A;  5GHZ A;  4S2N C;  3HJK A;  2KOI A;  2ZC7 A;  2ZMV A;  3ZNY A;  3RXX A;  3PR6 A;  3Q82 A;  2PBY A;  1JTG A;  1MY8 A;  3MBZ A;  4FH2 A;  4EBN A;  4ARZ A;  3ZVW A;  4ZTK A;  3TJZ C;  1O7E A;  2WGI A;  3F1N A;  1E3U D;  1SCW A;  1H5X A;  1K56 A;  3ZFZ A;  1XP4 A;  4MBF A;  5CGW A;  1OTB A;  4OQ0 A;  5HAI A;  2ZJ9 A;  1YLW A;  1GSX A;  3EWK A;  1LI0 A;  2IWD A;  3G35 A;  4RX3 A;  2P9V B;  4LRY C;  2L0W A;  4EQ1 A;  1G5U A;  2O9B A;  3VP1 A;  3OC2 A;  3S7O A;  3QNC A;  4XUZ A;  4LEN A;  3HLE A;  5DF8 A;  1D1J A;  4PKY A;  4KZA A;  5KMW A;  4Y0U A;  4U0T A;  2XD5 A;  3WS2 A;  5FSR A;  4I38 A;  1FQG A;  2DNS A;  2G2W A;  3AGF A;  5GLA A;  5EVI C;  5GHY A;  3BFD A;  4EXO A;  2OV5 A;  3HUN A;  3LIC A;  2C6W B;  1XFQ A;  1V9Y A;  1IKI A;  1K38 A;  2VGK A;  3KYE A;  4GNU A;  4JKT A;  4B93 A;  1W63 M;  2H0Y A;  3T4K A;  1WYB A;  4JXV A;  5HD3 A;  3T1R A;  1XXM A;  1CF0 A;  1TS7 A;  3KO6 A;  1YLT A;  3HL9 A;  3LR5 A;  2JKT M;  1PW8 A;  3H7W B;  5CGS A;  5GL9 A;  4KG2 A;  3A0V A;  4FSF A;  4AFI A;  2XQZ A;  1SZV A;  4E3N A;  1L0F A;  5E2G A;  4UA9 A;  1GHI A;  1PWC A;  1OJG A;  5I5L A;  2A24 A;  3CLO A;  4X1L A;  3LID A;  3OCL A;  1ZG4 A;  2OWH A;  4CLC D;  5EE8 A;  3BFF A;  4EQI A;  1CEF A;  4RYE A;  4OPQ A;  1HVB A;  1E4D A;  4I3J A;  3ZG7 B;  3IX4 A;  2WAF A;  3T1Q B;  1K0K A;  4FD8 A;  4MBH A;  4IBR A;  2QHK A;  2Y2Q A;  4KG6 A;  3F1O B;  1NLZ A;  1YSP A;  3BQA A;  4MN5 A;  5EV0 A;  1VEU B;  5FEG A;  3ZDJ A;  1OT9 A;  4HEF A;  4EET B;  2ZC4 B;  3MSH A;  2GZA A;  3ZCZ A;  4QY5 A;  3NHQ A;  4JPM A;  4ESP A;  5CHM A;  2Y59 A;  4MBK A;  3ZNT A;  2ZBB A;  4KUO A;  3D4F A;  4OLG A;  2FFF B;  4R4S A;  2X01 A;  5AJG A;  2QJ7 A;  4GB7 A;  3EEA A;  2P08 A;  4BBV A;  1RCJ A;  5FI6 A;  4Q8I A;  4EBL A;  1MWS A;  3WRZ A;  4HBU A;  2W3H A;  5C5K A;  4U0X A;  4B4Z A;  3A3D A;  4BWI A;  1G6A A;  4LV2 A;  1YSQ A;  4OP8 A;  3CWF A;  4PM5 A;  1EWZ A;  3PTE A;  3O5Y A;  4OVD A;  3IS2 B;  2J3T D;  5HAQ A;  1F9I A;  3IT9 A;  3VOL A;  4Y0T A;  4BLM A;  2J9O A;  2PD7 A;  2Z6D A;  3ITA A;  4Z1W A;  5F69 A;  4OQH A;  4XUX A;  5K5B A;  2OSU A;  4NXF A;  3N8S A;  1XGI A;  1ONH A;  3MKF A;  2UWX A;  5CER A;  4LCL A;  4IBX A;  1Q2Q A;  5FA7 A;  5EUA A;  5GLD A;  2XA7 S;  3FKV A;  3E0Y A;  4OQG A;  2JKF A;  2B95 A;  4E6W A;  5FI7 A;  1FCM A;  3ULF A;  2X02 A;  2WGV A;  1JTD A;  2HDR A;  3T4L A;  1MXO A;  1XFN A;  4NKP A;  3MMH A;  3CHW P;  3HCY A;  1S1Y A;  4CLC B;  3UB9 A;  1ESI A;  3TE8 A;  5A93 A;  3PXP A;  5FQM A;  5CGX A;  1TDG A;  1LLB A;  4Y5F A;  2WKQ A;  2IA2 A;  1CK3 A;  4FCF A;  5KSC A;  3C7V A;  1FSY A;  2HZ5 A;  2P9V A;  2XD1 A;  3KX0 X;  3L7H A;  4JF4 A;  3UY6 A;  1W7F A;  2I9V A;  2VA0 A;  3P7N A;  4KZ5 A;  5EFW A;  1NXY A;  5HX9 A;  1A0K A;  5DFY A;  3UME A;  4Q0J A;  3E4P A;  3NEC A;  2IWB A;  3P01 A;  2V0W A;  2HJE A;  4DRT A;  4X68 A;  1CEG A;  3CAX A;  1WYC A;  4Q0H A;  3MXR A;  4DE3 A;  4EV4 A;  2EA9 A;  3BY8 A;  2HF6 A;  1FCO A;  2ZM8 A;  4G3V A;  4K08 A;  1GHP A;  3C7U A;  3ZQ5 A;  4BBT A;  4HI4 A;  3M6H A;  4KQQ A;  5E2E A;  4KQR A;  2PU4 A;  1ODV A;  2Q0O A;  3IWQ A;  4WZ5 A;  5FQK A;  4GHI A;  4K91 A;  2UV0 E;  1OJ5 A;  1P9W A;  4NK3 A;  2Y2M A;  4DN0 A;  1BLC A;  2JKG A;  1CI8 A;  3H7W A;  3OPH A;  3IF6 B;  3IXH A;  1YT4 A;  5GHX A;  3HLF A;  3T4Q A;  1ALQ A;  4K0X A;  4ZJ1 A;  1K6R A;  3EGD C;  5L09 A;  2RL3 A;  3C2W A;  4P6Z M;  1K4E A;  3C8C A;  2Y55 A;  5HZH A;  4MMN A;  2XK1 A;  1W8Y A;  3LI8 A;  4DKI A;  1CJF A;  3LY3 A;  4ZDX A;  4CPK A;  4NXG A;  4WZ5 C;  1N9O A;  3CI6 A;  2EWW A;  5E43 A;  5G18 A;  3IHA A;  3Q07 A;  1T1A A;  3WS5 A;  3FZC A;  3MXS A;  4L9G A;  1IYO A;  5HDS A;  3NIA A;  4HP9 A;  4QU3 A;  4OOL A;  5U47 A;  4BMW A;  2XSS A;  1SHV A;  5HDC A;  3SH7 A;  3GEC A;  2PYR A;  2VJW A;  5FQQ A;  5D3O A;  4PAU A;  1JWV A;  3MJQ A;  1EW0 A;  3UE0 A;  3M6B A;  2GNX A;  3MQO A;  4GDB A;  1D06 A;  2VKS A;  3C30 A;  1MC0 A;  5FDH A;  3RXW A;  2GDN A;  3ISG A;  4R3A A;  1E3U A;  2E8I A;  5DTK A;  3JPU A;  4UQI M;  5L07 A;  2QMI A;  5J4E A;  1KGG A;  1VET B;  3PBN A;  4JLF A;  1BUE A;  4P87 A;  1BT5 A;  4GKU A;  5IT5 A;  3K3D A;  2EWV A;  2W3D A;  1TDL A;  2H28 A;  3TG9 A;  4EUV A;  4QY6 A;  1YMS A;  4YNR A;  1GHM A;  5FDS A;  5CEC A;  4D2O A;  1K4F A;  2HPB A;  3IQA A;  1KDW A;  3D3O A;  1S4S A;  3ZG8 B;  3W4P A;  3FKW A;  3FC7 A;  5HL6 A;  2ZOI A;  2PRF A;  1PYY A;  4MDZ A;  3NOT C;  4Y15 A;  2W1R A;  1PI5 A;  1XKZ A;  3DTM A;  4HHD A;  3KSI A;  1BUL A;  3UDI A;  3RH8 B;  4BEN A;  5HWT A;  1FR1 A;  3DAV A;  3QNB A;  4II7 A;  4N92 A;  4B4X A;  4DDY A;  3OZH A;  3V3S A;  2XDM A;  3GVB A;  1OTD A;  1YLP A;  4S2K A;  1FOF A;  3ITB A;  1JVJ A;  5G4Y A;  4BD1 A;  3F1P A;  2W3E A;  3PBR A;  4KUK A;  1AWI A;  2W3F A;  4N9K A;  1V9Z A;  4UAA A;  4UA7 A;  4EBP A;  3T4O A;  5F6A A;  4H6J B;  3VP0 A;  4E3J A;  1UGU A;  4XXR A;  4JGP A;  1VEU A;  3WWX A;  1PFL A;  4WLA A;  4X53 A;  2WK0 A;  2B5R A;  2HP9 A;  5TJJ A;  3C5A A;  1NLY A;  4X69 A;  2WAD A;  3NI9 A;  2WUQ A;  5HW3 A;  5CEB A;  3OBF A;  1F5M A;  2EX9 A;  4PPR A;  1MBL A;  2J8Y A;  2M1C A;  5EOO A;  3HUM A;  4EWF A;  5M18 A;  2W1T A;  1G28 A;  4ARZ B;  5HFO A;  5EVI D;  2L4R A;  2ZQ9 A;  3HJI A;  3N8L A;  2V1A A;  1FIK A;  2PHY A;  4E3M A;  2C5W B;  2CMN A;  1TS8 A;  3LR4 A;  5DVA A;  2PBD P;  2HP6 A;  2V2F F;  5HSQ A;  2WKP A;  1XJ6 A;  4KZB A;  1VET A;  3PAE A;  1TVF A;  1F98 A;  3UB6 A;  1SKF A;  4YWZ A;  5EM0 A;  1ZG6 A;  4S2I A;  2P04 A;  4Q0I A;  5GLB A;  1KGF A;  3PBT A;  2OAP 1;  4F3L A;  5L8M A;  3UE1 A;  1PW1 A;  3G34 A;  1IYS A;  2ZD8 A;  1STZ A;  2P74 A;  1QME A;  1HLU P;  3UPN A;  2LB5 A;  2ZL1 A;  4S2O A;  1Y4O A;  1BLS A;  3UPP A;  4BL2 A;  4OPZ A;  3S4X A;  2JBF A;  2BG1 A;  2J7V A;  1YQS A;  4JF6 A;  2R78 A;  3VE4 A;  1LL9 A;  2FZ0 A;  4KZ9 A;  2HGV A;  4FTX A;  4OPY A;  2R9W A;  4WEK A;  3K3C A;  1ERQ A;  3IHB A;  3SH8 A;  2EFX A;  3A3E A;  3KYZ A;  4IVK A;  3NDG A;  4BJP A;  1RGZ A;  1H8M A;  5HWW A;  2EFU A;  3IX8 A;  2HV1 A;  4RX2 A;  1K25 A;  4R3J A;  4DXC A;  4PMA A;  1S1Z A;  4R4R A;  3HUO A;  1T18 A;  3Q7V B;  4S2N A;  3W4O A;  1OTI A;  3OPP A;  5CX7 A;  3Q7V A;  4I3I A;  4NXE A;  3LIA A;  4LLO B;  1LL8 A;  5M1A A;  2I72 A;  2V8C A;  3IX3 A;  3EQV A;  5FAO A;  3GV9 A;  5F1F A;  2XEP A;  5DTT A;  2PDR A;  1L2S A;  4KZ4 A;  3BQ8 A;  4YOF A;  1YAX A;  1U60 A;  1IEM A;  3DTK A;  4JGR A;  4DJ2 A;  2WKH A;  4JF5 A;  4X25 A;  1O07 A;  3BFE A;  1GSV A;  2H10 A;  3B42 A;  4QB8 A;  1I5Q A;  5KIZ A;  5AQ9 A;  3OPR A;  3VSL A;  1K57 A;  3JVU A;  5CTM A;  4Z9Q A;  4R3B A;  1SKO A;  3R7W B;  1KOU A;  1MKM A;  3CJM A;  3CMZ A;  4WL9 A;  2QPN A;  3BWL A;  2ZOH A;  1TD5 A;  4HNB A;  3CG5 A;  3ZG9 B;  3LCE A;  2Y2G A;  1DP8 A;  4F3L B;  5IS1 A;  2V1B A;  4P85 A;  1XA7 A;  4WMC D;  4GN2 A;  3MQ0 A;  4HIA A;  1VQQ A;  4EW7 A;  3LEZ A;  3MF0 A;  4S2M A;  4CLC C;  5IHV A; 
#chains in the Genus database with same CATH homology
 1BLH A;  4WMC A;  1S6R A;  3Q81 A;  4OOM A;  2PU4 A;  3GSG A;  5EVL A;  4S2L A;  2CC1 A;  3IWQ A;  3VOZ A;  4WZ5 A;  5FQK A;  3ZG0 A;  3M2J A;  1K57 C;  4K91 A;  4OON A;  4NK3 A;  2Y2M A;  4OQI A;  3VOY A;  1BLP A;  3IXG A;  4GD6 A;  3GR2 A;  1BLC A;  3IXD A;  1M40 A;  4RVA A;  1CI8 A;  2V20 A;  1YLJ A;  4GD8 A;  4DE1 A;  3BYD A;  4ZJ3 A;  1L0D A;  1GA9 A;  3OPH A;  3IF6 B;  2VGJ A;  3A3F A;  4B88 A;  3IXH A;  1YT4 A;  4P6B A;  5GHX A;  3HLF A;  1JWP A;  1ALQ A;  4K0X A;  4KZ8 A;  3DWK A;  2FFY A;  4PM9 A;  1K6R A;  4WEL A;  4ZJ1 A;  2RL3 A;  3SS3 A;  3WS4 A;  3VFH A;  3UN7 A;  2EX6 A;  1NZO A;  2OLV A;  2ZQ7 A;  1K4E A;  1M6K A;  2XFT A;  3BLS A;  2Y55 A;  3N8R A;  3W8K A;  4X55 A;  5E2H A;  3TOI A;  2XK1 A;  4NET A;  4C3Q A;  1FSW A;  4LV0 A;  5FI2 A;  1W8Y A;  5EVI B;  1EI5 A;  3WRT A;  1ERO A;  1K55 A;  3UDF A;  2G2U A;  3A3I A;  2JC7 A;  4DKI A;  3LY3 A;  2DCF A;  3ZHH A;  1E25 A;  4ZDX A;  4A5R A;  3VP4 A;  4CPK A;  4DDS A;  1H8Y A;  1ZC2 A;  2WKE A;  3BEC A;  4MNR A;  4WZ5 C;  4GZB A;  5EOE A;  4KG5 A;  1WE4 A;  5E43 A;  5G18 A;  1ZKJ A;  1ERM A;  2EXA A;  2Z2L B;  3IHA A;  3Q07 A;  3WS5 A;  1PZO A;  5BOH A;  2XR0 A;  3FZC A;  5CTN A;  3MXS A;  4UHU A;  1IYO A;  4KZ7 A;  3WS1 A;  3NCK A;  3NIA A;  3TSG A;  4QU3 A;  2HDS A;  3HLD A;  5JYP A;  4OOL A;  3VMA A;  3EQU A;  4N1H A;  5U47 A;  5TFQ A;  1DJA A;  4K0W A;  3SH9 A;  3IH8 A;  1N9B A;  1SDE A;  1LI9 A;  3BLM A;  4DE0 A;  3G4P A;  3P09 A;  3LY4 A;  3UNW A;  1SHV A;  2Y2P A;  4U3T A;  3V39 A;  2ZC6 B;  2JE5 A;  3G2Z A;  1K55 C;  3SH7 A;  3HRE A;  4H8R A;  1I2S A;  2WGW B;  3CZD A;  5CRF A;  5FQQ A;  3ZVT A;  5D3O A;  5FAS A;  1JWV A;  2XF3 A;  1LHY A;  3SOI A;  5GHZ A;  4EUZ A;  4WBG A;  4S2N C;  5FAP A;  3UE0 A;  2ZC7 A;  3M6B A;  4R23 A;  4GDB A;  5A91 A;  3UE3 A;  3ZNY A;  3RXX A;  3Q82 A;  2PBY A;  1JTG A;  1XA1 A;  3P98 A;  1MY8 A;  3MBZ A;  4FH2 A;  2BLS A;  5FDH A;  3C4O A;  3RXW A;  1SDN A;  2GDN A;  5JYO A;  2ZQA A;  3ISG A;  4GDN A;  1E3U A;  4KQO A;  4EBN A;  2E8I A;  1G68 A;  3ZVW A;  5DTK A;  4ZTK A;  1MWT A;  4C75 A;  2QMI A;  5E2F A;  1O7E A;  4KZ6 A;  1KGG A;  2WGI A;  3Q7Z A;  1E3U D;  1SCW A;  1H5X A;  4ZAM A;  4JLF A;  3PBN A;  1BSG A;  1BUE A;  4JXS A;  4P87 A;  1K56 A;  2HDQ A;  3PAG A;  4E3L A;  3ZFZ A;  1XP4 A;  1BT5 A;  1PWD A;  4MBF A;  4GKU A;  3GQZ A;  5CGW A;  2X71 A;  5AQA A;  4MLL A;  4OQ0 A;  1NZU A;  2ZJ9 A;  1GA0 A;  5HAI A;  1YLW A;  1TDL A;  4GOG A;  1LI0 A;  1MWR A;  4R0Q A;  4E3I A;  2IWD A;  2Y2J A;  3G35 A;  4RX3 A;  2P9V B;  3TG9 A;  3O88 A;  3DW0 A;  1Y54 A;  5EEC A;  3S1Y A;  1KE4 A;  4QY6 A;  3VP1 A;  1YMS A;  3PBS A;  1GHM A;  3OC2 A;  3QNC A;  4XUZ A;  2Y2H A;  4LEN A;  5CEC A;  4WM9 A;  2Y2L A;  1NYY A;  1W8Q A;  1K4F A;  4LCM A;  2HPB A;  3BM6 A;  3HLE A;  3IQA A;  5DF8 A;  1KDW A;  4BD0 A;  5KZH A;  2XGN A;  3ZG8 B;  3W4P A;  3FKW A;  1W5D A;  1JWZ A;  4KZA A;  3UDX A;  4C6Y A;  4L0L A;  1PYY A;  5KMW A;  2H5S A;  2R9X A;  4Y0U A;  1XGJ A;  4U0T A;  1IEL A;  2XD5 A;  3VFF A;  3BRM A;  4RA7 A;  5GLC A;  1PI5 A;  1XKZ A;  2Q9N A;  5FSR A;  1FQG A;  3DTM A;  4MEZ A;  3V5M A;  3WS2 A;  4E3O A;  3VP3 A;  2DNS A;  1BUL A;  2G2W A;  3UDI A;  2QZ6 A;  3NBL A;  3AGF A;  4BEN A;  1FR1 A;  3QNB A;  5GLA A;  5EVI C;  5GHY A;  4N92 A;  2A3U A;  3ZG5 A;  4B4X A;  4CJN A;  4DDY A;  3BFD A;  3AGD A;  3OZH A;  5HAR A;  3V3S A;  1HD8 A;  2OV5 A;  3UPO A;  2XDM A;  2ZQC A;  3HUN A;  1IYP A;  2C6W B;  3GVB A;  3A3J A;  3QHY A;  4D2O A;  1KE0 A;  1IKI A;  2Y91 A;  1YLP A;  1K38 A;  4S2K A;  2VGK A;  5FQI A;  1FOF A;  3MZE A;  3ITB A;  4GNU A;  4JKT A;  1JVJ A;  4BD1 A;  2IWC A;  1ES2 A;  2H0Y A;  1WYB A;  3PBR A;  4JXV A;  4N1X A;  3G32 A;  5DF9 A;  1XXM A;  4N9K A;  1YLT A;  2XFS A;  2HP5 A;  5A90 A;  3HL9 A;  4UAA A;  4WYY A;  5FQ9 A;  4UA7 A;  2Y2N A;  4DF6 A;  1PW8 A;  4EBP A;  3VP0 A;  4E3J A;  5CGS A;  2ZC3 B;  4XXR A;  3G30 A;  5HAP A;  4UA6 A;  4S2P A;  5GL9 A;  3WWX A;  1Q2P A;  4KG2 A;  4X53 A;  2WK0 A;  1QMF A;  4OLD A;  4FSF A;  2B5R A;  3DWZ A;  2XQZ A;  2HP9 A;  4N9L A;  1DY6 A;  1DJB A;  1TEM A;  1L0F A;  4E3N A;  3C5A A;  3LO7 A;  4UA9 A;  5E2G A;  2PU2 A;  3HLB A;  1GHI A;  4PM6 A;  1PWC A;  2H0T A;  2Z2M B;  1OME A;  4X69 A;  1FR6 A;  2WAD A;  4HBT A;  3NI9 A;  2WUQ A;  3E2K A;  3OCL A;  1ZG4 A;  5HW3 A;  5EE8 A;  3BFF A;  5CEB A;  4EQI A;  1Z6F A;  1C3B A;  1CEF A;  4X6T A;  4OPQ A;  4RYE A;  1PWG A;  4PPR A;  2EX9 A;  1HVB A;  1ES4 A;  5FAT A;  1E4D A;  1MBL A;  2J8Y A;  5EOO A;  1DJC A;  1MKI A;  3HUM A;  5AQ7 A;  4EWF A;  5M18 A;  1K54 A;  5FQJ A;  2EX8 A;  3ZG7 B;  4OKP A;  2WAF A;  3HBR A;  5HFO A;  1VM1 A;  3VSK A;  5EVI D;  2ZQ9 A;  4FD8 A;  4IBR A;  3N8L A;  4MBH A;  5DF7 A;  2EX2 A;  3V50 A;  1HZO A;  2Y2Q A;  4HES A;  3HLW A;  4KG6 A;  1YMX A;  1HTZ A;  2ZQD A;  4E3M A;  1NRF A;  4BL3 A;  2C5W B;  3ZDJ A;  1RP5 A;  4HEF A;  3BEB A;  5DVA A;  2ZC4 B;  3IH9 A;  1BTL A;  3OPL A;  4F94 A;  3AGE A;  2HP6 A;  3ZCZ A;  2V2F F;  2JCH A;  2WYX A;  4QY5 A;  4JPM A;  1KE3 A;  1PIO A;  3N6I A;  3HLC A;  3IF5 A;  3O3V A;  4KZB A;  5AQB A;  5M19 A;  1XPB A;  1FCN A;  1MWU A;  5CHM A;  2Y59 A;  3GMW A;  3PAE A;  4YFM A;  1J9M A;  1TVF A;  5F82 A;  1SKF A;  4MBK A;  3ZNT A;  1H8Z A;  1ZG6 A;  4OP5 A;  3S22 A;  4OOY A;  4S2I A;  3D4F A;  4OLG A;  1L0G A;  2FFF B;  1CI9 A;  1K54 C;  3Q1F A;  4R4S A;  1KGF A;  3HVF A;  3PBT A;  5GLB A;  4YIN A;  2X01 A;  1K6S A;  4GB7 A;  1RCJ A;  4IED A;  5FI6 A;  4M3K A;  3OCN A;  1MPL A;  4Q8I A;  3UE1 A;  1PW1 A;  3G34 A;  4BQM A;  4EBL A;  1RGY A;  4Y7P A;  1IYS A;  1MWS A;  3FYZ A;  1NJ4 A;  3W4Q A;  3WRZ A;  4HBU A;  2WZX A;  1KVL A;  2V1Z A;  2ZD8 A;  5CHJ A;  4U0X A;  4FH4 A;  2P74 A;  2RCX A;  4B4Z A;  1QME A;  3A3D A;  4S2J A;  3UPN A;  2ZM2 A;  1AXB A;  3GRJ A;  1G6A A;  1IYQ A;  3G2Y A;  3UO9 A;  3M2K A;  3V3R A;  3UPP A;  1W79 A;  4LV2 A;  1BLS A;  3NC8 A;  4OP8 A;  4S2O A;  5L2F A;  1I2W A;  3B3X A;  3BFC A;  1LL5 A;  2ZQ8 A;  1KGE A;  1NY0 A;  3NDE A;  1EWZ A;  4BL2 A;  4PM5 A;  4OPZ A;  2JBF A;  3PTE A;  2BG1 A;  2DRW A;  2J7V A;  1YQS A;  4JF6 A;  4OVD A;  3S4X A;  4WEJ A;  1PI4 A;  5HAQ A;  1LL9 A;  4KZ9 A;  3IT9 A;  3O87 A;  1PZP A;  4OPY A;  2R9W A;  4Y0T A;  4OH0 A;  4BLM A;  2J9O A;  4WEK A;  3ITA A;  5F83 A;  3G31 A;  4OQH A;  3FWL A;  1ERQ A;  4XUX A;  2OSU A;  3IHB A;  4X56 A;  4LV1 A;  4O7D A;  3SH8 A;  2EFX A;  3N8S A;  4DE2 A;  5J8X A;  3A3E A;  1XGI A;  1ONH A;  5KSH A;  3MKF A;  2UWX A;  5CER A;  4LCL A;  5CXW A;  4IVK A;  4KZ3 A;  5TR7 A;  3NDG A;  4IBX A;  5I94 A;  1Q2Q A;  5FA7 A;  5EUA A;  1RGZ A;  5GLD A;  1YLZ A;  1BZA A;  3FKV A;  4BJP A;  5CED A;  4OQG A;  2Y2K A;  4E6W A;  5DTS A;  2EFU A;  5FI7 A;  3ZGA B;  4PM8 A;  4RX2 A;  4QD4 A;  1FCM A;  3MKE A;  3FV7 A;  1K25 A;  2X02 A;  5EVI A;  4E3K A;  4E6X A;  4R3J A;  2WGV A;  4OPR A;  4DXC A;  4PMA A;  1ONG A;  3N7W A;  3IF6 C;  1JTD A;  5CHU A;  2HDR A;  1ESU A;  1MXO A;  4JXG A;  3HUO A;  4R4R A;  3GTC A;  3N4I A;  3Q7V B;  4KEN B;  4S2N A;  3W4O A;  3OPP A;  2A49 A;  3C4P A;  3Q7V A;  4WZ4 A;  4ZBE A;  2Y2O A;  3MZD A;  2J9P A;  2ZC5 B;  3SS4 A;  3IXB A;  3NY4 A;  1KVM A;  4P0M A;  4IVI A;  5M1A A;  3WS0 A;  2I72 A;  1K56 D;  1ESI A;  4ZJ2 A;  3PBO A;  2WAE A;  2HDU A;  3EQV A;  5FAO A;  5A93 A;  1ES5 A;  2Q9M A;  4JBF A;  1N4O A;  5FQM A;  5CGX A;  5FAQ A;  3GV9 A;  5F1F A;  2XEP A;  1TDG A;  1LLB A;  5DTT A;  4QJG A;  1CK3 A;  1L2S A;  1YLY A;  4FCF A;  4KZ4 A;  5KSC A;  3C7V A;  1ES3 A;  3PBQ A;  4ID4 A;  1FSY A;  2P9V A;  2WZZ A;  2XD1 A;  2XLN A;  4PM7 A;  1U60 A;  3I7J A;  1S0W A;  1IEM A;  5TGF A;  4JF4 A;  3MZF A;  3UY6 A;  1W7F A;  2OLU A;  2WKH A;  1NYM A;  1O07 A;  3IF6 A;  4JF5 A;  1IKG A;  3BFE A;  2H10 A;  1KDS A;  4KZ5 A;  3IWO A;  1NXY A;  5HX9 A;  4QB8 A;  1I5Q A;  5AQ9 A;  3BFG A;  2Y2I A;  3OPR A;  3MFD A;  3VSL A;  1K57 A;  4JXW A;  2Y4A A;  3HLG A;  2ZMA A;  3JYI A;  5CTM A;  4Z9Q A;  2IWB A;  4R3B A;  4Y0O A;  2XH9 A;  4DRT A;  2ZLY A;  4X68 A;  1CEG A;  3O86 A;  1WYC A;  1XX2 A;  3CJM A;  5HL1 A;  5A92 A;  2EXB A;  3MXR A;  4DE3 A;  3CMZ A;  2QPN A;  4LV3 A;  4R1G A;  4EV4 A;  3CG5 A;  3IWI A;  3ZG9 B;  3LCE A;  2Y2G A;  4DXB A;  5F1G A;  1YM1 A;  3VP2 A;  3E2L A;  4P85 A;  1XA7 A;  1FCO A;  2ZM8 A;  1GCE A;  4GN2 A;  4WMC D;  1L0E A;  5EPH A;  2WGW A;  1VQQ A;  1GHP A;  3LEZ A;  3C7U A;  2WKI A;  3RJU A;  2ZM0 A;  3M6H A;  3SS5 A;  4KQQ A;  5E2E A;  4QHC A;  4S2M A;  4KQR A;  5IHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...