2IWBA

Mecr1 unbound extracellular antibiotic-sensor domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
246
Chain Sequence
DKYETNVSYKKLNQLAPYFKGFDGSFVLYNEREQAYSIYNEPESKQRYSPNSTYKIYLALMAFDQNLLSLNHTEQQWDKHQYPFKEWNQDQNLNSSMKYSVNWYYENLNKHLRQDEVKSYLDLIEYGNEEISGNENYWNESSLKISAIEQVNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEANGWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unbound and Acylated Structures of the Mecr1 Extracellular Antibiotic-Sensor Domain Provide Insights Into the Signal-Transduction System that Triggers Methicillin Resistance.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic resistance
molecule keywords METHICILLIN RESISTANCE MECR1 PROTEIN
total genus 90
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2006-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2iwbA00
1PIOA 3UE3A 1YQSA 4OQGA 3GSGA 1BLHA 1KE0A 3RJUA 5HAQA 4Y0OA 1J9MA 3C4PA 1ZG4A 2HDQA 1PI5A 3G30A 3G34A 4B4XA 5IHVA 2ZD8A 4WEKA 5EUAA 3MXSA 4RVAA 4DRTA 2Y2KA 2PU4A 3M6BA 4F94A 5EOOA 3TOIA 2Y2HA 2BLSA 4OLGA 4X56A 2WKIA 2VGJA 4WYYA 1IKGA 2ZQCA 5FQQA 4GZBA 3OZHA 4P87A 5TFQA 4Y7PA 1K55A 1ESUA 4QY6A 1EROA 1ONHA 4GD6A 4M3KA 1VQQA 3FYZA 3HLGA 4MEZA 1S0WA 1K25A 3E2KA 2ZJ9A 4OLDA 1HD8A 2XEPA 3IH9A 1IELA 3N4IA 3SH7A 3ISGA 5EOEA 1NJ4A 3UNWA 2P9VA 5HFOA 5F82A 5DVAA 4WM9A 5CGSA 1JWPA 4UA6A 1FSWA 3P09A 1ZC2A 4U0TA 4GKUA 1WYCA 5HW3A 5BOHA 4BENA 3ZHHA 2WGIA 1LHYA 3QNBA 3IXGA 5GLAA 4OQIA 4OOLA 1XPBA 4R3JA 1ERMA 2A49A 4BQMA 1K57C 3BRMA 1K54C 3IQAA 3NC8A 3MFDA 4JXWA 4OQ0A 5DF8A 5EVIB 3Q07A 1BSGA 4N92A 5CTMA 4MNRA 1GHPA 4N9LA 1K55C 3FKWA 4EBLA 4Z9QA 5GHZA 2WYXA 3C7VA 4JKTA 4JPMA 2C5WB 5GLCA 3V3SA 4DE2A 3BEBA 1NY0A 3SH9A 4X68A 2C6WB 4H8RA 3MZDA 3UO9A 4R4RA 1KVMA 2XD1A 3C5AA 3QNCA 4HBTA 2WKEA 2WGWB 3HLFA 2WGWA 4QB8A 5EE8A 5FATA 4E6WA 1LL9A 2OV5A 3W8KA 2QMIA 3HUMA 5E2EA 2JC7A 4JLFA 4K0XA 1KE4A 1KGEA 4DDYA 3PTEA 3WWXA 1ZKJA 3HLCA 2V2FF 3S22A 2ZC6B 5L2FA 1I2WA 2OSUA 4LV2A 4FH4A 4GOGA 3VOZA 2Q9MA 4FD8A 4KQQA 5AQBA 3ZVWA 3IHBA 4LV3A 1XA7A 4P85A 4KQRA 1YMSA 2UWXA 1K6RA 2WADA 2XFSA 1IYPA 1CEGA 1Y54A 2J9PA 2XF3A 4JXVA 3JYIA 4IEDA 2IWDA 3ZG9B 4OP8A 3FKVA 5CGXA 2Y2JA 3TG9A 3LEZA 4PM9A 1PZPA 1NZOA 2CC1A 2DRWA 2VGKA 3Q81A 3ZG7B 3ZCZA 3IF6C 1MWTA 2JBFA 1OMEA 1MWUA 3HL9A 1YLJA 4BD1A 4D2OA 3C7UA 3VP2A 4N1HA 3WS4A 5J8XA 1IKIA 1K4FA 3CMZA 5KSCA 4KZ4A 1S6RA 2IWBA 1PZOA 1PW8A 4B4ZA 5GHYA 5D3OA 3W4OA 4GN2A 1HVBA 1W5DA 3ZNTA 4MBKA 2EX9A 3GMWA 3G4PA 5CGWA 3TSGA 1FOFA 4P6BA 1H8YA 4DKIA 3PBQA 1TEMA 3LCEA 3UDIA 1H8ZA 5JYOA 3AGFA 3AGDA 4OQHA 1L0FA 3GRJA 5F1FA 3OC2A 2Y2LA 4IVKA 1FQGA 2OLVA 4IBRA 5FQKA 2Y59A 1AXBA 3MBZA 3NBLA 1LLBA 4K0WA 3OPPA 2X71A 3V3RA 4FCFA 1W8QA 2ZQDA 5A93A 2XFTA 3M2KA 1TDLA 5DF7A 1CI8A 1G68A 3W4QA 5JYPA 1PWDA 1FSYA 1ONGA 3FV7A 1TDGA 3EQUA 1N9BA 4WMCD 4C6YA 4X6TA 3MZFA 3VP0A 1BULA 5E2HA 1YLTA 4CPKA 4FH2A 3OCLA 3G2YA 5FAQA 3VP1A 1W7FA 1MWRA 5DTSA 2G2UA 5FSRA 3WS0A 3DWKA 4GDNA 4EQIA 2Y2PA 2JE5A 3Q82A 4EBPA 2QZ6A 2DNSA 4S2LA 3PBNA 1TVFA 2ZC4B 3B3XA 1ERQA 1YMXA 2XLNA 5EVLA 5FQJA 2EFXA 4DF6A 1ES4A 2DCFA 4NETA 4DE1A 3V39A 4R0QA 2XD5A 1XX2A 3HLDA 4JF4A 3P98A 2Y2OA 4DXCA 2WGVA 5AQ9A 4OPQA 5FDHA 3VP4A 1YLZA 1E3UD 4N9KA 4WZ4A 4XUXA 1IYSA 1PWCA 4R4SA 4S2KA 4BLMA 5FASA 1W79A 2E8IA 1GHIA 1XXMA 3PBRA 2HDRA 1DJAA 2H0TA 1BLSA 1GCEA 3BFDA 5DTKA 5E2FA 1LI0A 4JF5A 2EXAA 4EWFA 2OLUA 1RP5A 3BLMA 4PM7A 2A3UA 1C3BA 3HLWA 3NI9A 4DE0A 1JVJA 2HPBA 3GVBA 2X01A 4Q8IA 2X02A 4P0MA 1GA0A 4OP5A 4MLLA 4UHUA 4S2MA 1BTLA 1Q2PA 2ZQ9A 1KDWA 1FCOA 1H5XA 3IWOA 4KG2A 4JXGA 3Q7ZA 2WKHA 5HX9A 3BYDA 2EX6A 2HP6A 4BJPA 1FCMA 5CXWA 4JBFA 3ZGAB 1K4EA 4FSFA 2PU2A 2Q9NA 5GLDA 1K57A 2I72A 3IHAA 4WBGA 4Y0TA 1MBLA 4IVIA 3SH8A 5TGFA 5HAIA 1YLPA 3RXWA 3IXDA 5A91A 1K6SA 1L0EA 3BECA 4ZAMA 1ES2A 3NDGA 3UPNA 5HARA 3UPPA 1KDSA 2EXBA 3MKEA 4N1XA 3V50A 3HVFA 3ZNYA 3ZVTA 3PBOA 1L0GA 1ESIA 4KZ7A 4WZ5C 2ZLYA 4A5RA 3A3IA 1HZOA 1ZG6A 4U0XA 3S4XA 4R23A 4E3JA 2WZZA 4WMCA 5AQ7A 3ZG0A 4RYEA 5CERA 2R9XA 5FI6A 4E3KA 4RX3A 3UDXA 5EVID 4KZBA 3A3FA 3HBRA 1IYQA 3N8RA 4DE3A 3SS3A 1WYBA 1K54A 2Z2LB 4NK3A 2ZMAA 4BD0A 2R9WA 5AQAA 4UAAA 1SDEA 1PYYA 3PAGA 2V1ZA 1E3UA 2Y2GA 5CEBA 1YT4A 1N4OA 1K56A 4ID4A 4OPRA 3UPOA 3G2ZA 3LY3A 2HDUA 3UDFA 4RA7A 2HP9A 3O3VA 1NXYA 5GL9A 4ZDXA 1JWZA 1FR1A 1JTDA 2J7VA 3C4OA 4KZ8A 1BUEA 4ZTKA 3VFFA 4E6XA 3IXBA 3GTCA 1E25A 2IWCA 5FAPA 1NRFA 3V5MA 2G2WA 4YFMA 5EPHA 4GNUA 5DTTA 3CJMA 1VM1A 1IEMA 4KZ3A 1I2SA 2ZQ7A 3AGEA 5CHUA 1MKIA 2RCXA 4BL3A 3PBTA 1G6AA 4KENB 4DXBA 5FI2A 1BT5A 1Z6FA 4WELA 4QHCA 4JXSA 1BLPA 3HREA 1JWVA 3M6HA 3HUOA 4HBUA 2ZC5B 4MBHA 4XUZA 3VOYA 4C3QA 5KZHA 1CI9A 3G32A 2H10A 2WAEA 4PM8A 1O7EA 5FAOA 4UA7A 3S1YA 3UE1A 1Q2QA 1CK3A 2EX8A 2V20A 4E3LA 4R1GA 4PM6A 4LENA 1RGYA 1XGJA 5M18A 4OOMA 3WRZA 1IYOA 3GV9A 1NYMA 1LL5A 5E43A 5F1GA 4ZBEA 2XQZA 2ZC7A 4C75A 4QU3A 4XXRA 3OCNA 1XP4A 4ZJ2A 5CRFA 1CEFA 3G31A 3LY4A 4QJGA 1JTGA 1KGFA 1YLWA 2QPNA 2FFFB 3VMAA 4L0LA 3MZEA 5CECA 4HEFA 4IBXA 5M19A 5F83A 3PBSA 4DDSA 4E3NA 4ZJ1A 1KE3A 4EV4A 3BLSA 2WUQA 2Y2QA 3O86A 3BFGA 1SKFA 3ZFZA 1W8YA 3ZG5A 1O07A 4PMAA 1BLCA 4OONA 2J8YA 3N8SA 3A3JA 4QY5A 5FQ9A 4UA9A 3VP3A 1NZUA 4KZAA 3I7JA 3ZG8B 1ES5A 1K56D 4U3TA 2Y4AA 3SS4A 3ZDJA 4JF6A 3M2JA 1NYYA 3IT9A 1XA1A 3MKFA 4X55A 2XDMA 1FCNA 1RCJA 1DJCA 1E4DA 3HLBA 3NIAA 2P9VB 4O7DA 3QHYA 2Z2MB 3N7WA 3VSKA 3SOIA 3IWIA 3IF6A 3UE0A 3RXXA 4CJNA 1GHMA 4BL2A 5M1AA 4S2IA 3PAEA 5HAPA 3DW0A 5TR7A 3DTMA 1HTZA 4OPYA 5G18A 1DJBA 2ZM8A 3NCKA 3SS5A 1MWSA 3FWLA 4PPRA 5EVIC 4LV1A 1K38A 3BM6A 5FI7A 3N8LA 2P74A 4GDBA 1WE4A 3E2LA 4OKPA 1I5QA 3VSLA 1SCWA 3IF5A 2HDSA 4OH0A 5CHMA 5GLBA 4KG6A 2ZM2A 1EI5A 2H0YA 3WS2A 4ZJ3A 3ITBA 1M6KA 3HUNA 1SDNA 4K91A 4R3BA 1ALQA 3MXRA 2EX2A 2HP5A 2Y91A 3OPHA 2RL3A 3Q7VB 4KZ5A 1L2SA 4S2JA 4S2NA 5CEDA 3A3DA 3WS5A 5HL1A 2XK1A 3GQZA 3BFFA 1PI4A 1EWZA 5E2GA 5FQIA 4S2OA 4MBFA 1MXOA 3IH8A 2Y55A 3D4FA 5I94A 5CHJA 5FQMA 2FFYA 4EUZA 5KMWA 1LI9A 3BFCA 2Y2MA 3IXHA 2JCHA 3O87A 3WS1A 4LCLA 3ITAA 5A90A 1BZAA 1XGIA 2ZM0A 2ZQAA 2XH9A 4OPZA 4OOYA 4KQOA 4RX2A 5CTNA 5EVIA 1PW1A 2BG1A 1QMFA 3GR2A 3DWZA 2WZXA 1MPLA 1KVLA 3W4PA 1FR6A 2GDNA 2PBYA 3G35A 4HESA 3EQVA 5DF9A 2XGNA 4EBNA 3O88A 4S2NC 4WZ5A 1YLYA 4E3OA 3NY4A 5A92A 3OPLA 3Q7VA 3IF6B 3UY6A 3VFHA 3N6IA 1QMEA 2Y2NA 3OPRA 5GHXA 4X53A 4B88A 4LCMA 1PWGA 4KG5A 2XR0A 4Y0UA 5U47A 3UN7A 4KZ9A 4OVDA 2EFUA 3A3EA 4KZ6A 4E3IA 2WAFA 4QD4A 1RGZA 4YINA 3FZCA 2B5RA 2ZC3B 3Q1FA 3BFEA 5EECA 1XKZA 5KSHA 1DY6A 3CZDA 1KGGA 2Y2IA 3LO7A 3NDEA 4X69A 4E3MA 4LV0A 3HLEA 1U60A 1GA9A 2WK0A 3IWQA 1L0DA 4WEJA 1SHVA 4GB7A 1ES3A 4GD8A 4S2PA 5FA7A 3CG5A 2ZQ8A 4PM5A 2J9OA 2H5SA 1MY8A 1YM1A 3WRTA 1M40A
chains in the Genus database with same CATH superfamily
3CI6A 1KE0A 2P7JA 4RQ9A 1ZG4A 3G34A 5EM1A 2R78A 2ZD8A 5IHVA 4WEKA 5EUAA 3UB7A 4PHTA 3HCYA 4F94A 2W3HA 1P97A 4P87A 5TFQA 1P0ZA 1K55A 1ESUA 4I38A 4MEZA 1K25A 4I3JA 1HD8A 1F5MA 2W1RA 3UNWA 5HFOA 5DVAA 5CGSA 4UA6A 3P09A 1W63Q 1WYCA 1KOUA 1XFQA 3BY9A 3QNBA 4R3JA 2A49A 1K54C 4JXWA 3Q07A 4GLQA 1GHPA 4Z9QA 1OJGA 5GLCA 3V3SA 3ZYTA 3BEBA 3UO9A 3C5AA 4MN5A 3QNCA 1GSXA 5EE8A 2WGWA 2AVXA 2V8FA 4E6WA 3W8KA 5E2EA 1YSPA 2H28A 1KGEA 3ZQ5A 1GSVA 1ZKJA 3F1NB 2V2FF 5FL3A 1IOUA 5L2FA 1OPXA 4KQQA 5AQBA 3LGOA 3ZVWA 3IHBA 1XA7A 3E4OA 3CUEC 3PYPA 3LIBA 2V1BA 1CEGA 2XF3A 2IWDA 3HJIA 3ULFA 3FKVA 5CX7A 3LR3A 2DRWA 3Q81A 3ZG7B 3EEHA 2VV8A 1MWTA 4BD1A 3C7UA 3CITA 1OJ5A 4JGQA 3UE6A 1IKIA 5KSCA 3W4OA 2EX9A 3GMWA 3G4PA 3PR6A 1IFQA 2YKFA 4MDZA 4NG2A 3PBQA 1TEMA 2WKRA 4D60A 3B47A 2QKPA 4NXBA 2JKRM 3OC2A 4KQDA 4IVKA 3CHWP 1HLUP 4LRXC 3NBLA 1W8QA 2ZQDA 5A93A 1UWPX 1TDLA 4NXFA 5TBMB 1CI8A 1OT6A 1PWDA 1N9BA 4WMCD 4X6TA 3VP0A 4HNBA 1YLTA 2O9CA 2G2UA 4QPRA 4GHIA 2Y2PA 2JE5A 3Q82A 4HY8A 3PBNA 3B3XA 1ERQA 3GDIA 4KUKA 3LYXA 4IHQA 3V39A 4O0PA 2LB9A 4JF4A 2PBDP 3KSIA 4OPQA 5FDHA 1YLZA 3T4QA 1PWCA 4BLMA 5FASA 2G7UA 3PBRA 3QP2A 2EA9A 1DJAA 4GW9A 3NJAA 2H0TA 3BFDA 4LRZE 3VOLA 2I9VA 2OLUA 3NI9A 1JVJA 4P0MA 4S2MA 1Q2PA 1H5XA 4JXGA 3Q7ZA 2HP6A 4BJPA 3ZGAB 3H82A 4FSFA 2W3DA 2I72A 4MN7A 4PKYG 5HAIA 5HL6A 4EESA 4L9GA 2EWVA 2VGLS 3F1OB 4R23A 5DFYA 3ZG0A 5CERA 3HBRA 1IYQA 3UB9A 1CF0A 4MCWA 5AQAA 2V1ZA 1E3UA 5CEBA 3G2ZA 1FR1A 4XT2A 3VFFA 2IWCA 3OLOA 1IEMA 4KZ3A 3G6OA 3AGEA 3H9WA 5CHUA 1G6AA 2XSSA 1EW0A 4DXBA 4WELA 4R6LA 3M6HA 5KZHA 3VOYA 4C3QA 1O7EA 3S1YA 1MZUA 2Z6DA 3UMDA 4OOMA 1IYOA 4ZRRA 1YKDA 1VETA 4ZBEA 4YOFA 3KO6A 3NECA 3UB8A 3C8CA 1JTGA 3SW1A 1X0OA 4JGRA 3LI9A 5F83A 2XA7S 5IT5A 3PBSA 4DDSA 4ZJ1A 3BLSA 1SKFA 1O07A 3R4KA 2KDKA 4OONA 3N8SA 3A3JA 2P04A 4UA9A 2KX6A 1ES5A 1K56D 3ZDJA 4X55A 2JHEA 2JKRI 1DJCA 1E4DA 4H6JA 2W3FA 3VSKA 3IF6A 1YSQA 4BL2A 4S2IA 5TR7A 3DTMA 4LLOB 2ZM8A 1MWSA 1OTAA 4PPRA 1OT9A 3BM6A 2JKTI 2P74A 3T4SA 3NULA 3E2LA 3VSLA 1V9YA 1M6KA 4R3BA 4G3VA 2EX2A 4KZ5A 1L2SA 4S2JA 5CEDA 3A3DA 3GQZA 1MXOA 5I94A 3CPTB 2FFYA 5KMWA 1LI9A 3BFCA 3O87A 5J4EA 2ZM0A 3MR0A 4OOYA 5J3WA 2A24A 1ODVA 4KQOA 4O01A 3LIAA 3GR2A 1J3WA 3DWZA 2PBYA 4BBTA 4S2NC 4E3OA 5A92A 2ZBBA 3UY6A 3VFHA 1PWGA 4KG5A 3F1NA 3A3EA 4E3IA 2WAFA 5EECA 1DY6A 4MMNA 3HLEA 1U60A 4Y3IA 2K2NA 1L0DA 1UWNX 3FPWA 3CG5A 1YM1A 1PIOA 3UE3A 3VE3A 1BLHA 5HAQA 1J9MA 3U2AA 4B4XA 1XJ6A 3MXSA 1XJ4A 5HDCA 4X56A 1TD5A 2VGJA 5FQQA 3MQQA 3OZHA 5LBRA 5IS1A 1EROA 1ONHA 4GD6A 4M3KA 1VQQA 3E2KA 2BASA 4DMZA 2EWWA 5EOEA 3B33A 5F82A 4WM9A 1JWPA 3H7WA 1FSWA 4U0TA 1ZC2A 4GKUA 3ZHHA 2OWHA 1LHYA 5IU1A 3IXGA 4BQMA 3NC8A 5FEFA 3MFDA 5DF8A 3MS6A 1BSGA 3LEQA 1PNEA 2PT7A 4Q0HA 5GHZA 2WYXA 3C7VA 3SH9A 3QP6A 4X68A 3F1PB 4R4RA 4HBTA 2WKEA 2OV5A 1T1BA 2QMIA 3HUMA 1KE4A 4P6ZS 4DDYA 3HLCA 4ARZB 3S22A 1I2WA 3VOZA 4FD8A 1D1JA 2ACGA 4KQRA 2BTFP 3IS2A 5HWTA 1Y4OA 5DFXA 4K08A 3JPUA 4JXVA 3ZG9B 3KSGA 5CGXA 3LEZA 1FILA 2CC1A 1NZOA 2VGKA 3NOPC 4HQAA 1OMEA 3HL9A 1LSWA 3VP2A 3WS4A 4DN0A 4CLCB 3CMZA 1S6RA 1W5DA 3QP4A 4GCZA 4MBKA 3IBJA 4QWOA 5CGWA 1FOFA 5JYOA 3AGDA 1L0FA 2Y2LA 4IBRA 5FQKA 2Y59A 1AXBA 5L10A 1LLBA 2X71A 3V3RA 3PXPA 3TE8A 3M2KA 3T4OA 2VA0A 3T1RA 1ONGA 4P6ZM 1TDGA 4EUVA 4C6YA 3MZFA 4CLCC 5E2HA 4CPKA 4FOFA 5FAQA 3OCLA 3G2YA 3UB6A 1W7FA 1MWRA 3DWKA 4GHIB 2LB5A 4EQIA 1TVFA 5EVLA 1YMXA 5FQJA 2EFXA 2O99A 2J3TD 4NETA 3KSHA 3HLDA 3P98A 3EGDC 4Q0JA 4R4SA 5DKKA 2QJ7A 1GHIA 1XXMA 3MQ0A 5DTKA 4HI4A 3DBAA 2ZMFA 3BLMA 1H3QA 2A3UA 1C3BA 3HLWA 2HPBA 3GVBA 4Q8IA 4OP5A 4MLLA 1P9RA 2ZQ9A 2ZOHA 3IWOA 2WKHA 4PAUA 2XA7M 1K4EA 1PFLA 2PU2A 2Q9NA 4I39A 4Y0TA 1MBLA 4IVIA 2L1MA 4R3AA 3RXWA 3IXDA 3BECA 3NDGA 2GNXA 3UPNA 5HARA 2EXBA 3MKEA 3V50A 2M1CA 3ZVTA 3PBOA 1L0GA 1ESIA 4A5RA 2ZLYA 2PR5A 3A3IA 1HZOA 3IX8A 2JKFA 5FI6A 4RX3A 3A3FA 3N8RA 4DE3A 2INWA 2VK3A 1WYBA 1K54A 1G6OA 2ZMAA 1PYYA 2Y2GA 4LFUA 1YT4A 1TS6A 5F69A 3UPOA 1OTIA 2FH5A 3UDFA 4ZDXA 2GJ3A 2HJEA 1NXYA 2HP9A 2PYPA 4KUOA 4Y2FA 2J7VA 2ZL1B 4KZ8A 3IXBA 1NRFA 2QWSA 3CJMA 1VM1A 1I2SA 4NKPA 4FTXA 2RCXA 4KENB 3ICYA 4L9FA 4ETZA 3RFBA 5FI2A 3UMEA 1BLPA 2ZC5B 4MBHA 4GS9B 4XUZA 1CI9A 2H10A 3CUEA 3KYQA 4HOIA 4Y17A 3FG8A 4Y5FA 2EX8A 4WN5A 1XGJA 3GV9A 1DP8A 1NYMA 2MJ6A 5E43A 4ZJ2A 2UV0E 5CRFA 3KYEA 2QPNA 3MZEA 2Q0OA 4HEFA 4IBXA 1LSVA 4EV4A 2WUQA 2Y2QA 3ZG5A 4O8GA 2J8YA 2OWJA 1NZUA 2VLGA 3T4JA 2Y4AA 3SS4A 1RCJA 3HLBA 3PHYA 2FZ0A 2OAQ1 4O7DA 5EFWA 3V67A 2Z2MB 3N7WA 3LR0A 3UE0A 4UEYA 3RXXA 4CJNA 2O9BA 2VEAA 1DJBA 4HH2A 5EVIC 1CQAA 4LV1A 1K38A 1NLYA 3T4LA 2XROA 5GLBA 5CHMA 4KG6A 3T1QB 3IX3A 3WS2A 3ITBA 1ALQA 3OPHA 3RH8B 2RL3A 5I5LA 4S2NA 5HL1A 1EWZA 3D4FA 1SKOA 5CHJA 5FQMA 2Y2MA 3ITAA 3VV4A 4AFIA 4OPZA 3UB5P 2BG1A 2NUPC 3BJNA 2GDNA 3LICA 5DF9A 4EBNA 1F9IA 1STZA 3MQOA 3IF6B 2HZ5A 2D02A 4LCMA 3UN7A 4KZ9A 4OVDA 4KZ6A 4EERA 1S1YA 4QD4A 3Q1FA 5HPIA 4CLCA 1XKZA 3LO7A 1N9OA 3MFXA 4X69A 3LR4A 5FEGA 3IWQA 4F3LB 4WEJA 1SHVA 4GB7A 1ES3A 4S2PA 2WKPA 2ZQ8A 4PM5A 2J9OA 1M40A 3S7PA 1YQSA 3KX0X 3GSGA 2HJ9C 4Y0OA 3C4PA 1Y28A 3G30A 2PYRA 3BY8A 4RVAA 4DRTA 3TOIA 2Y2HA 4WYYA 5HPFA 2ZQCA 1ACFA 1WA9A 2V9AA 3L7HA 3GECA 5K5BA 4OLDA 2ZJ9A 3C38A 2XEPA 2W3GA 1IELA 3ISGA 3T1XA 5HW3A 2ZMVA 5GLAA 4OQIA 4OOLA 4GS9A 1S4RA 1ERMA 2K7SA 3BRMA 3IQAA 4OQ0A 1T19A 3HJKA 2A24B 4CQHA 4JGPA 2PR6A 1K55C 3KYZA 3FKWA 1F98A 2C6WB 4H8RA 2XD1A 5FATA 2WGWB 1LL9A 2Z6CA 3LUQA 4JLFA 4K0XA 2V0UA 3PTEA 3WWXA 4ARZA 5AJGA 4LV2A 4GOGA 5HWWA 1XJ2A 2UWXA 3EEAA 2XFSA 1TS8A 1Y54A 4HIAA 2PD7A 3TG9A 1XJ3A 4I3AA 2JBFA 4D2OA 3MSHA 2Y8HA 3QP8A 1PRQA 4B9OA 5GHYA 4GN2A 3ZNTA 4XT2B 2CMNA 3D72A 4IUHA 2VGLM 3TSGA 3UDIA 5DJUA 3GRJA 3T12B 1FQGA 4WF0A 3MBZA 4K0WA 3OPPA 2B02A 2J3TC 4X1LA 1G68A 1FSYA 4IUKA 3EQUA 5L09A 5DJTA 3T50A 3OOVA 4FH2A 1AWIA 3VP1A 5DTSA 5HDDA 2QZ6A 3LI8A 2DNSA 4S2LA 5KIZA 2ZC4B 2ZL1A 3EGXC 3K3DA 5AVFA 3IBRA 4DE1A 4R0QA 2XD5A 1XX2A 3DTIA 2Y2OA 4DXCA 3VP4A 4XUXA 4S2KA 2E8IA 2O0YA 2HDRA 2PHYA 4LPZA 5HWVA 5E2FA 3TW8A 2JKTM 4JF5A 3IX4A 1RP5A 1DP9A 4BBUA 2M7VA 2B18A 2M7UA 2X01A 2X02A 1GA0A 3RTYA 5AVEA 4UHUA 4BMWA 1BTLA 1FCOA 5HX9A 3BYDA 2EX6A 1FCMA 1YPRA 4JBFA 1L3LA 4JGOA 3SH8A 1YLPA 3R7WB 1NRJA 1BYWA 1UGUA 5A91A 1K6SA 1ES2A 3UPPA 1KDSA 4N1XA 5A8BA 3HVFA 1S4SA 3LIFA 4HP4A 2W3EA 3H7WB 4LRYC 2HF6A 5AQ7A 3TRCA 5EVID 3CLOA 2Z2LB 4UAAA 3H82B 3PAGA 3A0RA 3IS2B 1N4OA 5HD5A 2HDUA 2HV1A 3O3VA 1JWZA 3C4OA 3GTCA 1E25A 2G2WA 4YFMA 5G4ZA 4GNUA 2ZQ7A 1MKIA 4BL3A 4L9EA 4NXGA 3LR5A 4EW7A 1Z6FA 1G5UA 3S7NA 1JWVA 3HUOA 3NHQA 5F5YA 3EWKA 2WAEA 5FAOA 5J7EA 1Q2QA 1CK3A 4Y15A 4E3LA 4R1GA 4PM6A 5HSQA 1LL5A 1D7EA 5F1GA 2XQZA 3DAVA 4EQ1A 4QJGA 1XP4A 1CEFA 5HD3A 1YLWA 3VMAA 5CECA 5M19A 4I3IA 2JN7A 4HJ6A 3BFGA 4PMAA 1BLCA 2QJ5A 5FQ9A 3ZG8B 5EM0A 4JF6A 3LIEA 3M2JA 3IT9A 1XA1A 3MKFA 2XDMA 3E4QA 1FCNA 3VE4A 1LSXA 3QHYA 4X1MA 3SOIA 1FIKA 5M1AA 5HAPA 3DW0A 1HTZA 4OPYA 2VJWA 3NCKA 3SS5A 4HJ4A 2W1TA 4UQIM 3N8LA 4GDBA 4HP9A 1F2KA 4OKPA 1I5QA 1VB6A 4EEPA 1N9LA 2ZM2A 4ZJ3A 1SDNA 3NOUC 3MXRA 2Y91A 2GX5A 3WS5A 1D06A 1PI4A 1S67L 5E2GA 5FQIA 4S2OA 3IH8A 2Y55A 3D9YA 1V9ZA 3IXHA 3WS1A 4LCLA 1H8MA 2ZQAA 2XH9A 4RX2A 5CTNA 1ZHHB 1LL8A 1PW1A 2W27A 1QMFA 2WZXA 3K2NA 1KVLA 5G4YA 4HESA 1YAXA 1MC0A 1VEUA 3O88A 1YLYA 3T4KA 3OPLA 2QYBA 4WLAA 1XFNA 3N6IA 1QMEA 3OPRA 5GHXA 4X53A 3MJQA 3OBFA 2XR0A 2EFUA 2Y2IA 1T1CA 4I5SA 4E3MA 4EU0A 1GA9A 4LGWA 1DRMA 3BWLA 4MN6A 4BBVA 4PKYA 2H5SA 1MY8A 3WRTA 3BFEA 4OQGA 3TJZC 3RJUA 2W0NA 2HDQA 1PI5A 5HDSA 2E8JA 2Y2KA 2PU4A 3M6BA 5EOOA 2BLSA 4OLGA 1G28A 2WKIA 1IKGA 4GZBA 2V8CA 2PRFA 4Y7PA 4QY6A 2V1AA 3FC7A 3FYZA 3HLGA 1S0WA 2J80A 3F1PA 3IH9A 1TF1A 3N4IA 3SH7A 1NJ4A 2P9VA 2IA2A 3FPVA 4NXEA 5BOHA 4WL9A 4BENA 2WGIA 3LIDA 1OTEA 1XPBA 1K57C 4X25A 3CAXA 5EVIB 4N92A 5CTMA 4MNRA 1ZTUA 4N9LA 4EBLA 3K3CA 4JKTA 4JPMA 2C5WB 4DE2A 4H6JB 1NY0A 2O9AA 3MZDA 1KVMA 5TGFA 4QB8A 3HLFA 4Y13A 4GJ4A 2JC7A 4E04A 3CPTA 2ZC6B 2OSUA 4FH4A 2Q9MA 4LV3A 4P85A 3U4LP 1CJFA 1YMSA 1K6RA 2WADA 3O5YA 1Z09A 2OOLA 1IYPA 3BQAA 2J9PA 3JYIA 4IEDA 4OP8A 2Y2JA 4PM9A 1PZPA 3ZCZA 1VEUB 3IF6C 3E98A 1MWUA 1YLJA 4N1HA 3T4TA 5J8XA 1K4FA 4KZ4A 5FDSA 2IWBA 1PZOA 1PW8A 4B4ZA 5D3OA 1HVBA 1NLZA 4P6BA 4DKIA 1H8YA 4CLCD 3LCEA 1H8ZA 3AGFA 4OQHA 5F1FA 2OLVA 2V0WA 2QHKA 4FCFA 3JVVA 3T1SA 2XFTA 5DF7A 4DJ2A 3MXQA 3W4QA 5JYPA 2A2LA 3MF0A 3FV7A 3S7QA 1BULA 5F68A 5FSRA 3WS0A 5L07A 4GDNA 4EBPA 2K31A 1TS7A 2GZAA 2J3WA 2XLNA 4DF6A 1ES4A 2YKHA 2DCFA 1TS0A 4UQIS 2OAP1 5EVEA 3P7NA 4IJGA 2WGVA 5AQ9A 1E3UD 4N9KA 4WZ4A 1IYSA 1SKOB 1W79A 4ME4A 1BLSA 1GCEA 1LI0A 3C30A 2EXAA 4EWFA 4B93A 4YWZA 4BWIA 1VHMA 4PM7A 4DE0A 4Z1WA 3E4PA 5HZHA 4NEED 1KDWA 2D01A 4KG2A 2JKGA 5DKLA 5CXWA 4ETXA 3BW6A 3C2WA 2W1TB 1K57A 5GLDA 3IHAA 4WBGA 3QP5A 2KOIA 1L0EA 2HGVA 4ZAMA 3ZNYA 1GSWA 4KZ7A 4WZ5C 1ZG6A 4U0XA 1K0KA 3S4XA 4E3JA 2WZZA 4WMCA 4RYEA 2R9XA 1T1AA 4E3KA 3UDXA 3A0VA 4KZBA 1H0MA 5TJJA 2L4RA 3SS3A 3B42A 4NK3A 1W63M 4BD0A 2R9WA 2VV6A 1SDEA 2PDRA 4G3KA 2KLIA 4OPRA 1K56A 4ID4A 2XRNA 3LY3A 1NWZA 5GL9A 4RA7A 1P9WA 1JTDA 3E0YA 1OTDA 1BUEA 4ZTKA 2NUTC 4E6XA 4EXOA 2VKSA 5FAPA 3V5MA 5EPHA 5DTTA 4G3WA 4ESPA 3PBTA 3SZTA 1BT5A 5C5KA 4QHCA 4JXSA 3HREA 3S7OA 4HBUA 3G32A 4PM8A 4WUJA 4HHDA 4UA7A 3UE1A 3BQ8A 2DMWA 2V20A 2ZOIA 3L9KA 4LENA 1JNUA 1RGYA 5M18A 3DTEA 3WRZA 3MMHA 1DP6A 1VETB 2ZC7A 4C75A 4QU3A 4XXRA 3OCNA 2L0WA 3G31A 3LY4A 1KGFA 4EEUA 2FFFB 4L0LA 4R70A 4E3NA 1KE3A 3O86A 3ZFZA 1W8YA 4M4XA 2B95A 4HH3A 4QY5A 1N9NA 2VZWA 4Q0IA 3VP3A 4YNRA 4KZAA 3I7JA 4U3TA 1NYYA 3QP1A 1LT0A 1OTBA 3NIAA 3NOTC 2P9VB 3IWIA 3P01A 1GHMA 3W2ZA 3PAEA 3LFVA 3KSFA 5L8MA 5G18A 2PAVP 3FWLA 2PD8A 5FI7A 2VV7A 1WE4A 1T18A 3JVUA 1SCWA 3IF5A 2HDSA 4OH0A 4F3LA 1MKMA 1EI5A 3F1OA 2H0YA 4FUWA 3HUNA 4K91A 4EETB 4HJ3A 2HP5A 3Q7VB 1SZVA 4CLCE 2XK1A 3BFFA 4MBFA 5TBMA 4EUZA 4DJ3A 2JCHA 5A90A 1BZAA 1XGIA 5EV0A 3D3OA 5EVIA 3EOIA 1A0KA 1MPLA 3W4PA 1FR6A 3G35A 2P08A 3EQVA 2XGNA 4WZ5A 2WKQA 3NY4A 3Q7VA 2Y2NA 3DTKA 4B88A 5MC7A 3A0SA 4Y0UA 5U47A 2Y79A 1RGZA 2VX8A 3FZCA 2B5RA 2ZC3B 4R38A 4YINA 5KSHA 1S1ZA 3R7WA 3CZDA 1KGGA 3NDEA 4LV0A 2WK0A 3CWFA 4GD8A 5FA7A 5F6AA 4II7A 1S66L
chains in the Genus database with same CATH topology
1PIOA 3UE3A 1YQSA 4OQGA 3GSGA 1BLHA 1KE0A 3RJUA 5HAQA 4Y0OA 1J9MA 3C4PA 1ZG4A 2HDQA 1PI5A 3G30A 3G34A 4B4XA 5IHVA 2ZD8A 4WEKA 5EUAA 3MXSA 4RVAA 4DRTA 2Y2KA 2PU4A 3M6BA 4F94A 5EOOA 3TOIA 2Y2HA 2BLSA 4OLGA 4X56A 2WKIA 2VGJA 4WYYA 1IKGA 2ZQCA 5FQQA 4GZBA 3OZHA 4P87A 5TFQA 4Y7PA 1K55A 1ESUA 4QY6A 1EROA 1ONHA 4GD6A 4M3KA 1VQQA 3FYZA 3HLGA 4MEZA 1S0WA 1K25A 3E2KA 2ZJ9A 4OLDA 1HD8A 2XEPA 3IH9A 1IELA 3N4IA 3SH7A 3ISGA 5EOEA 1NJ4A 3UNWA 2P9VA 5HFOA 5F82A 5DVAA 4WM9A 5CGSA 1JWPA 4UA6A 1FSWA 3P09A 1ZC2A 4U0TA 4GKUA 1WYCA 5HW3A 5BOHA 4BENA 3ZHHA 2WGIA 1LHYA 3QNBA 3IXGA 5GLAA 4OQIA 4OOLA 1XPBA 4R3JA 1ERMA 2A49A 4BQMA 1K57C 3BRMA 1K54C 3IQAA 3NC8A 3MFDA 4JXWA 4OQ0A 5DF8A 5EVIB 3Q07A 1BSGA 4N92A 5CTMA 4MNRA 1GHPA 4N9LA 1K55C 3FKWA 4EBLA 4Z9QA 5GHZA 2WYXA 3C7VA 4JKTA 4JPMA 2C5WB 5GLCA 3V3SA 4DE2A 3BEBA 1NY0A 3SH9A 4X68A 2C6WB 4H8RA 3MZDA 3UO9A 4R4RA 1KVMA 2XD1A 3C5AA 3QNCA 4HBTA 2WKEA 2WGWB 3HLFA 2WGWA 4QB8A 5EE8A 5FATA 4E6WA 1LL9A 2OV5A 3W8KA 2QMIA 3HUMA 5E2EA 2JC7A 4JLFA 4K0XA 1KE4A 1KGEA 4DDYA 3PTEA 3WWXA 1ZKJA 3HLCA 2V2FF 3S22A 2ZC6B 5L2FA 1I2WA 2OSUA 4LV2A 4FH4A 4GOGA 3VOZA 2Q9MA 4FD8A 4KQQA 5AQBA 3ZVWA 3IHBA 4LV3A 1XA7A 4P85A 4KQRA 1YMSA 2UWXA 1K6RA 2WADA 2XFSA 1IYPA 1CEGA 1Y54A 2J9PA 2XF3A 4JXVA 3JYIA 4IEDA 2IWDA 3ZG9B 4OP8A 3FKVA 5CGXA 2Y2JA 3TG9A 3LEZA 4PM9A 1PZPA 1NZOA 2CC1A 2DRWA 2VGKA 3Q81A 3ZG7B 3ZCZA 3IF6C 1MWTA 2JBFA 1OMEA 1MWUA 3HL9A 1YLJA 4BD1A 4D2OA 3C7UA 3VP2A 4N1HA 3WS4A 5J8XA 1IKIA 1K4FA 3CMZA 5KSCA 4KZ4A 1S6RA 2IWBA 1PZOA 1PW8A 4B4ZA 5GHYA 5D3OA 3W4OA 4GN2A 1HVBA 1W5DA 3ZNTA 4MBKA 2EX9A 3GMWA 3G4PA 5CGWA 3TSGA 1FOFA 4P6BA 1H8YA 4DKIA 3PBQA 1TEMA 3LCEA 3UDIA 1H8ZA 5JYOA 3AGFA 3AGDA 4OQHA 1L0FA 3GRJA 5F1FA 3OC2A 2Y2LA 4IVKA 1FQGA 2OLVA 4IBRA 5FQKA 2Y59A 1AXBA 3MBZA 3NBLA 1LLBA 4K0WA 3OPPA 2X71A 3V3RA 4FCFA 1W8QA 2ZQDA 5A93A 2XFTA 3M2KA 1TDLA 5DF7A 1CI8A 1G68A 3W4QA 5JYPA 1PWDA 1FSYA 1ONGA 3FV7A 1TDGA 3EQUA 1N9BA 4WMCD 4C6YA 4X6TA 3MZFA 3VP0A 1BULA 5E2HA 1YLTA 4CPKA 4FH2A 3OCLA 3G2YA 5FAQA 3VP1A 1W7FA 1MWRA 5DTSA 2G2UA 5FSRA 3WS0A 3DWKA 4GDNA 4EQIA 2Y2PA 2JE5A 3Q82A 4EBPA 2QZ6A 2DNSA 4S2LA 3PBNA 1TVFA 2ZC4B 3B3XA 1ERQA 1YMXA 2XLNA 5EVLA 5FQJA 2EFXA 4DF6A 1ES4A 2DCFA 4NETA 4DE1A 3V39A 4R0QA 2XD5A 1XX2A 3HLDA 4JF4A 3P98A 2Y2OA 4DXCA 2WGVA 5AQ9A 4OPQA 5FDHA 3VP4A 1YLZA 1E3UD 4N9KA 4WZ4A 4XUXA 1IYSA 1PWCA 4R4SA 4S2KA 4BLMA 5FASA 1W79A 2E8IA 1GHIA 1XXMA 3PBRA 2HDRA 1DJAA 2H0TA 1BLSA 1GCEA 3BFDA 5DTKA 5E2FA 1LI0A 4JF5A 2EXAA 4EWFA 2OLUA 1RP5A 3BLMA 4PM7A 2A3UA 1C3BA 3HLWA 3NI9A 4DE0A 1JVJA 2HPBA 3GVBA 2X01A 4Q8IA 2X02A 4P0MA 1GA0A 4OP5A 4MLLA 4UHUA 4S2MA 1BTLA 1Q2PA 2ZQ9A 1KDWA 1FCOA 1H5XA 3IWOA 4KG2A 4JXGA 3Q7ZA 2WKHA 5HX9A 3BYDA 2EX6A 2HP6A 4BJPA 1FCMA 5CXWA 4JBFA 3ZGAB 1K4EA 4FSFA 2PU2A 2Q9NA 5GLDA 1K57A 2I72A 3IHAA 4WBGA 4Y0TA 1MBLA 4IVIA 3SH8A 5TGFA 5HAIA 1YLPA 3RXWA 3IXDA 5A91A 1K6SA 1L0EA 3BECA 4ZAMA 1ES2A 3NDGA 3UPNA 5HARA 3UPPA 1KDSA 2EXBA 3MKEA 4N1XA 3V50A 3HVFA 3ZNYA 3ZVTA 3PBOA 1L0GA 1ESIA 4KZ7A 4WZ5C 2ZLYA 4A5RA 3A3IA 1HZOA 1ZG6A 4U0XA 3S4XA 4R23A 4E3JA 2WZZA 4WMCA 5AQ7A 3ZG0A 4RYEA 5CERA 2R9XA 5FI6A 4E3KA 4RX3A 3UDXA 5EVID 4KZBA 3A3FA 3HBRA 1IYQA 3N8RA 4DE3A 3SS3A 1WYBA 1K54A 2Z2LB 4NK3A 2ZMAA 4BD0A 2R9WA 5AQAA 4UAAA 1SDEA 1PYYA 3PAGA 2V1ZA 1E3UA 2Y2GA 5CEBA 1YT4A 1N4OA 1K56A 4ID4A 4OPRA 3UPOA 3G2ZA 3LY3A 2HDUA 3UDFA 4RA7A 2HP9A 3O3VA 1NXYA 5GL9A 4ZDXA 1JWZA 1FR1A 1JTDA 2J7VA 3C4OA 4KZ8A 1BUEA 4ZTKA 3VFFA 4E6XA 3IXBA 3GTCA 1E25A 2IWCA 5FAPA 1NRFA 3V5MA 2G2WA 4YFMA 5EPHA 4GNUA 5DTTA 3CJMA 1VM1A 1IEMA 4KZ3A 1I2SA 2ZQ7A 3AGEA 5CHUA 1MKIA 2RCXA 4BL3A 3PBTA 1G6AA 4KENB 4DXBA 5FI2A 1BT5A 1Z6FA 4WELA 4QHCA 4JXSA 1BLPA 3HREA 1JWVA 3M6HA 3HUOA 4HBUA 2ZC5B 4MBHA 4XUZA 3VOYA 4C3QA 5KZHA 1CI9A 3G32A 2H10A 2WAEA 4PM8A 1O7EA 5FAOA 4UA7A 3S1YA 3UE1A 1Q2QA 1CK3A 2EX8A 2V20A 4E3LA 4R1GA 4PM6A 4LENA 1RGYA 1XGJA 5M18A 4OOMA 3WRZA 1IYOA 3GV9A 1NYMA 1LL5A 5E43A 5F1GA 4ZBEA 2XQZA 2ZC7A 4C75A 4QU3A 4XXRA 3OCNA 1XP4A 4ZJ2A 5CRFA 1CEFA 3G31A 3LY4A 4QJGA 1JTGA 1KGFA 1YLWA 2QPNA 2FFFB 3VMAA 4L0LA 3MZEA 5CECA 4HEFA 4IBXA 5M19A 5F83A 3PBSA 4DDSA 4E3NA 4ZJ1A 1KE3A 4EV4A 3BLSA 2WUQA 2Y2QA 3O86A 3BFGA 1SKFA 3ZFZA 1W8YA 3ZG5A 1O07A 4PMAA 1BLCA 4OONA 2J8YA 3N8SA 3A3JA 4QY5A 5FQ9A 4UA9A 3VP3A 1NZUA 4KZAA 3I7JA 3ZG8B 1ES5A 1K56D 4U3TA 2Y4AA 3SS4A 3ZDJA 4JF6A 3M2JA 1NYYA 3IT9A 1XA1A 3MKFA 4X55A 2XDMA 1FCNA 1RCJA 1DJCA 1E4DA 3HLBA 3NIAA 2P9VB 4O7DA 3QHYA 2Z2MB 3N7WA 3VSKA 3SOIA 3IWIA 3IF6A 3UE0A 3RXXA 4CJNA 1GHMA 4BL2A 5M1AA 4S2IA 3PAEA 5HAPA 3DW0A 5TR7A 3DTMA 1HTZA 4OPYA 5G18A 1DJBA 2ZM8A 3NCKA 3SS5A 1MWSA 3FWLA 4PPRA 5EVIC 4LV1A 1K38A 3BM6A 5FI7A 3N8LA 2P74A 4GDBA 1WE4A 3E2LA 4OKPA 1I5QA 3VSLA 1SCWA 3IF5A 2HDSA 4OH0A 5CHMA 5GLBA 4KG6A 2ZM2A 1EI5A 2H0YA 3WS2A 4ZJ3A 3ITBA 1M6KA 3HUNA 1SDNA 4K91A 4R3BA 1ALQA 3MXRA 2EX2A 2HP5A 2Y91A 3OPHA 2RL3A 3Q7VB 4KZ5A 1L2SA 4S2JA 4S2NA 5CEDA 3A3DA 3WS5A 5HL1A 2XK1A 3GQZA 3BFFA 1PI4A 1EWZA 5E2GA 5FQIA 4S2OA 4MBFA 1MXOA 3IH8A 2Y55A 3D4FA 5I94A 5CHJA 5FQMA 2FFYA 4EUZA 5KMWA 1LI9A 3BFCA 2Y2MA 3IXHA 2JCHA 3O87A 3WS1A 4LCLA 3ITAA 5A90A 1BZAA 1XGIA 2ZM0A 2ZQAA 2XH9A 4OPZA 4OOYA 4KQOA 4RX2A 5CTNA 5EVIA 1PW1A 2BG1A 1QMFA 3GR2A 3DWZA 2WZXA 1MPLA 1KVLA 3W4PA 1FR6A 2GDNA 2PBYA 3G35A 4HESA 3EQVA 5DF9A 2XGNA 4EBNA 3O88A 4S2NC 4WZ5A 1YLYA 4E3OA 3NY4A 5A92A 3OPLA 3Q7VA 3IF6B 3UY6A 3VFHA 3N6IA 1QMEA 2Y2NA 3OPRA 5GHXA 4X53A 4B88A 4LCMA 1PWGA 4KG5A 2XR0A 4Y0UA 5U47A 3UN7A 4KZ9A 4OVDA 2EFUA 3A3EA 4KZ6A 4E3IA 2WAFA 4QD4A 1RGZA 4YINA 3FZCA 2B5RA 2ZC3B 3Q1FA 3BFEA 5EECA 1XKZA 5KSHA 1DY6A 3CZDA 1KGGA 2Y2IA 3LO7A 3NDEA 4X69A 4E3MA 4LV0A 3HLEA 1U60A 1GA9A 2WK0A 3IWQA 1L0DA 4WEJA 1SHVA 4GB7A 1ES3A 4GD8A 4S2PA 5FA7A 3CG5A 2ZQ8A 4PM5A 2J9OA 2H5SA 1MY8A 1YM1A 3WRTA 1M40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIO A;  3UE3 A;  1YQS A;  4OQG A;  3GSG A;  1BLH A;  1KE0 A;  3RJU A;  5HAQ A;  4Y0O A;  1J9M A;  3C4P A;  1ZG4 A;  2HDQ A;  1PI5 A;  3G30 A;  3G34 A;  4B4X A;  5IHV A;  2ZD8 A;  4WEK A;  5EUA A;  3MXS A;  4RVA A;  4DRT A;  2Y2K A;  2PU4 A;  3M6B A;  4F94 A;  5EOO A;  3TOI A;  2Y2H A;  2BLS A;  4OLG A;  4X56 A;  2WKI A;  2VGJ A;  4WYY A;  1IKG A;  2ZQC A;  5FQQ A;  4GZB A;  3OZH A;  4P87 A;  5TFQ A;  4Y7P A;  1K55 A;  1ESU A;  4QY6 A;  1ERO A;  1ONH A;  4GD6 A;  4M3K A;  1VQQ A;  3FYZ A;  3HLG A;  4MEZ A;  1S0W A;  1K25 A;  3E2K A;  2ZJ9 A;  4OLD A;  1HD8 A;  2XEP A;  3IH9 A;  1IEL A;  3N4I A;  3SH7 A;  3ISG A;  5EOE A;  1NJ4 A;  3UNW A;  2P9V A;  5HFO A;  5F82 A;  5DVA A;  4WM9 A;  5CGS A;  1JWP A;  4UA6 A;  1FSW A;  3P09 A;  1ZC2 A;  4U0T A;  4GKU A;  1WYC A;  5HW3 A;  5BOH A;  4BEN A;  3ZHH A;  2WGI A;  1LHY A;  3QNB A;  3IXG A;  5GLA A;  4OQI A;  4OOL A;  1XPB A;  4R3J A;  1ERM A;  2A49 A;  4BQM A;  1K57 C;  3BRM A;  1K54 C;  3IQA A;  3NC8 A;  3MFD A;  4JXW A;  4OQ0 A;  5DF8 A;  5EVI B;  3Q07 A;  1BSG A;  4N92 A;  5CTM A;  4MNR A;  1GHP A;  4N9L A;  1K55 C;  3FKW A;  4EBL A;  4Z9Q A;  5GHZ A;  2WYX A;  3C7V A;  4JKT A;  4JPM A;  2C5W B;  5GLC A;  3V3S A;  4DE2 A;  3BEB A;  1NY0 A;  3SH9 A;  4X68 A;  2C6W B;  4H8R A;  3MZD A;  3UO9 A;  4R4R A;  1KVM A;  2XD1 A;  3C5A A;  3QNC A;  4HBT A;  2WKE A;  2WGW B;  3HLF A;  2WGW A;  4QB8 A;  5EE8 A;  5FAT A;  4E6W A;  1LL9 A;  2OV5 A;  3W8K A;  2QMI A;  3HUM A;  5E2E A;  2JC7 A;  4JLF A;  4K0X A;  1KE4 A;  1KGE A;  4DDY A;  3PTE A;  3WWX A;  1ZKJ A;  3HLC A;  2V2F F;  3S22 A;  2ZC6 B;  5L2F A;  1I2W A;  2OSU A;  4LV2 A;  4FH4 A;  4GOG A;  3VOZ A;  2Q9M A;  4FD8 A;  4KQQ A;  5AQB A;  3ZVW A;  3IHB A;  4LV3 A;  1XA7 A;  4P85 A;  4KQR A;  1YMS A;  2UWX A;  1K6R A;  2WAD A;  2XFS A;  1IYP A;  1CEG A;  1Y54 A;  2J9P A;  2XF3 A;  4JXV A;  3JYI A;  4IED A;  2IWD A;  3ZG9 B;  4OP8 A;  3FKV A;  5CGX A;  2Y2J A;  3TG9 A;  3LEZ A;  4PM9 A;  1PZP A;  1NZO A;  2CC1 A;  2DRW A;  2VGK A;  3Q81 A;  3ZG7 B;  3ZCZ A;  3IF6 C;  1MWT A;  2JBF A;  1OME A;  1MWU A;  3HL9 A;  1YLJ A;  4BD1 A;  4D2O A;  3C7U A;  3VP2 A;  4N1H A;  3WS4 A;  5J8X A;  1IKI A;  1K4F A;  3CMZ A;  5KSC A;  4KZ4 A;  1S6R A;  2IWB A;  1PZO A;  1PW8 A;  4B4Z A;  5GHY A;  5D3O A;  3W4O A;  4GN2 A;  1HVB A;  1W5D A;  3ZNT A;  4MBK A;  2EX9 A;  3GMW A;  3G4P A;  5CGW A;  3TSG A;  1FOF A;  4P6B A;  1H8Y A;  4DKI A;  3PBQ A;  1TEM A;  3LCE A;  3UDI A;  1H8Z A;  5JYO A;  3AGF A;  3AGD A;  4OQH A;  1L0F A;  3GRJ A;  5F1F A;  3OC2 A;  2Y2L A;  4IVK A;  1FQG A;  2OLV A;  4IBR A;  5FQK A;  2Y59 A;  1AXB A;  3MBZ A;  3NBL A;  1LLB A;  4K0W A;  3OPP A;  2X71 A;  3V3R A;  4FCF A;  1W8Q A;  2ZQD A;  5A93 A;  2XFT A;  3M2K A;  1TDL A;  5DF7 A;  1CI8 A;  1G68 A;  3W4Q A;  5JYP A;  1PWD A;  1FSY A;  1ONG A;  3FV7 A;  1TDG A;  3EQU A;  1N9B A;  4WMC D;  4C6Y A;  4X6T A;  3MZF A;  3VP0 A;  1BUL A;  5E2H A;  1YLT A;  4CPK A;  4FH2 A;  3OCL A;  3G2Y A;  5FAQ A;  3VP1 A;  1W7F A;  1MWR A;  5DTS A;  2G2U A;  5FSR A;  3WS0 A;  3DWK A;  4GDN A;  4EQI A;  2Y2P A;  2JE5 A;  3Q82 A;  4EBP A;  2QZ6 A;  2DNS A;  4S2L A;  3PBN A;  1TVF A;  2ZC4 B;  3B3X A;  1ERQ A;  1YMX A;  2XLN A;  5EVL A;  5FQJ A;  2EFX A;  4DF6 A;  1ES4 A;  2DCF A;  4NET A;  4DE1 A;  3V39 A;  4R0Q A;  2XD5 A;  1XX2 A;  3HLD A;  4JF4 A;  3P98 A;  2Y2O A;  4DXC A;  2WGV A;  5AQ9 A;  4OPQ A;  5FDH A;  3VP4 A;  1YLZ A;  1E3U D;  4N9K A;  4WZ4 A;  4XUX A;  1IYS A;  1PWC A;  4R4S A;  4S2K A;  4BLM A;  5FAS A;  1W79 A;  2E8I A;  1GHI A;  1XXM A;  3PBR A;  2HDR A;  1DJA A;  2H0T A;  1BLS A;  1GCE A;  3BFD A;  5DTK A;  5E2F A;  1LI0 A;  4JF5 A;  2EXA A;  4EWF A;  2OLU A;  1RP5 A;  3BLM A;  4PM7 A;  2A3U A;  1C3B A;  3HLW A;  3NI9 A;  4DE0 A;  1JVJ A;  2HPB A;  3GVB A;  2X01 A;  4Q8I A;  2X02 A;  4P0M A;  1GA0 A;  4OP5 A;  4MLL A;  4UHU A;  4S2M A;  1BTL A;  1Q2P A;  2ZQ9 A;  1KDW A;  1FCO A;  1H5X A;  3IWO A;  4KG2 A;  4JXG A;  3Q7Z A;  2WKH A;  5HX9 A;  3BYD A;  2EX6 A;  2HP6 A;  4BJP A;  1FCM A;  5CXW A;  4JBF A;  3ZGA B;  1K4E A;  4FSF A;  2PU2 A;  2Q9N A;  5GLD A;  1K57 A;  2I72 A;  3IHA A;  4WBG A;  4Y0T A;  1MBL A;  4IVI A;  3SH8 A;  5TGF A;  5HAI A;  1YLP A;  3RXW A;  3IXD A;  5A91 A;  1K6S A;  1L0E A;  3BEC A;  4ZAM A;  1ES2 A;  3NDG A;  3UPN A;  5HAR A;  3UPP A;  1KDS A;  2EXB A;  3MKE A;  4N1X A;  3V50 A;  3HVF A;  3ZNY A;  3ZVT A;  3PBO A;  1L0G A;  1ESI A;  4KZ7 A;  4WZ5 C;  2ZLY A;  4A5R A;  3A3I A;  1HZO A;  1ZG6 A;  4U0X A;  3S4X A;  4R23 A;  4E3J A;  2WZZ A;  4WMC A;  5AQ7 A;  3ZG0 A;  4RYE A;  5CER A;  2R9X A;  5FI6 A;  4E3K A;  4RX3 A;  3UDX A;  5EVI D;  4KZB A;  3A3F A;  3HBR A;  1IYQ A;  3N8R A;  4DE3 A;  3SS3 A;  1WYB A;  1K54 A;  2Z2L B;  4NK3 A;  2ZMA A;  4BD0 A;  2R9W A;  5AQA A;  4UAA A;  1SDE A;  1PYY A;  3PAG A;  2V1Z A;  1E3U A;  2Y2G A;  5CEB A;  1YT4 A;  1N4O A;  1K56 A;  4ID4 A;  4OPR A;  3UPO A;  3G2Z A;  3LY3 A;  2HDU A;  3UDF A;  4RA7 A;  2HP9 A;  3O3V A;  1NXY A;  5GL9 A;  4ZDX A;  1JWZ A;  1FR1 A;  1JTD A;  2J7V A;  3C4O A;  4KZ8 A;  1BUE A;  4ZTK A;  3VFF A;  4E6X A;  3IXB A;  3GTC A;  1E25 A;  2IWC A;  5FAP A;  1NRF A;  3V5M A;  2G2W A;  4YFM A;  5EPH A;  4GNU A;  5DTT A;  3CJM A;  1VM1 A;  1IEM A;  4KZ3 A;  1I2S A;  2ZQ7 A;  3AGE A;  5CHU A;  1MKI A;  2RCX A;  4BL3 A;  3PBT A;  1G6A A;  4KEN B;  4DXB A;  5FI2 A;  1BT5 A;  1Z6F A;  4WEL A;  4QHC A;  4JXS A;  1BLP A;  3HRE A;  1JWV A;  3M6H A;  3HUO A;  4HBU A;  2ZC5 B;  4MBH A;  4XUZ A;  3VOY A;  4C3Q A;  5KZH A;  1CI9 A;  3G32 A;  2H10 A;  2WAE A;  4PM8 A;  1O7E A;  5FAO A;  4UA7 A;  3S1Y A;  3UE1 A;  1Q2Q A;  1CK3 A;  2EX8 A;  2V20 A;  4E3L A;  4R1G A;  4PM6 A;  4LEN A;  1RGY A;  1XGJ A;  5M18 A;  4OOM A;  3WRZ A;  1IYO A;  3GV9 A;  1NYM A;  1LL5 A;  5E43 A;  5F1G A;  4ZBE A;  2XQZ A;  2ZC7 A;  4C75 A;  4QU3 A;  4XXR A;  3OCN A;  1XP4 A;  4ZJ2 A;  5CRF A;  1CEF A;  3G31 A;  3LY4 A;  4QJG A;  1JTG A;  1KGF A;  1YLW A;  2QPN A;  2FFF B;  3VMA A;  4L0L A;  3MZE A;  5CEC A;  4HEF A;  4IBX A;  5M19 A;  5F83 A;  3PBS A;  4DDS A;  4E3N A;  4ZJ1 A;  1KE3 A;  4EV4 A;  3BLS A;  2WUQ A;  2Y2Q A;  3O86 A;  3BFG A;  1SKF A;  3ZFZ A;  1W8Y A;  3ZG5 A;  1O07 A;  4PMA A;  1BLC A;  4OON A;  2J8Y A;  3N8S A;  3A3J A;  4QY5 A;  5FQ9 A;  4UA9 A;  3VP3 A;  1NZU A;  4KZA A;  3I7J A;  3ZG8 B;  1ES5 A;  1K56 D;  4U3T A;  2Y4A A;  3SS4 A;  3ZDJ A;  4JF6 A;  3M2J A;  1NYY A;  3IT9 A;  1XA1 A;  3MKF A;  4X55 A;  2XDM A;  1FCN A;  1RCJ A;  1DJC A;  1E4D A;  3HLB A;  3NIA A;  2P9V B;  4O7D A;  3QHY A;  2Z2M B;  3N7W A;  3VSK A;  3SOI A;  3IWI A;  3IF6 A;  3UE0 A;  3RXX A;  4CJN A;  1GHM A;  4BL2 A;  5M1A A;  4S2I A;  3PAE A;  5HAP A;  3DW0 A;  5TR7 A;  3DTM A;  1HTZ A;  4OPY A;  5G18 A;  1DJB A;  2ZM8 A;  3NCK A;  3SS5 A;  1MWS A;  3FWL A;  4PPR A;  5EVI C;  4LV1 A;  1K38 A;  3BM6 A;  5FI7 A;  3N8L A;  2P74 A;  4GDB A;  1WE4 A;  3E2L A;  4OKP A;  1I5Q A;  3VSL A;  1SCW A;  3IF5 A;  2HDS A;  4OH0 A;  5CHM A;  5GLB A;  4KG6 A;  2ZM2 A;  1EI5 A;  2H0Y A;  3WS2 A;  4ZJ3 A;  3ITB A;  1M6K A;  3HUN A;  1SDN A;  4K91 A;  4R3B A;  1ALQ A;  3MXR A;  2EX2 A;  2HP5 A;  2Y91 A;  3OPH A;  2RL3 A;  3Q7V B;  4KZ5 A;  1L2S A;  4S2J A;  4S2N A;  5CED A;  3A3D A;  3WS5 A;  5HL1 A;  2XK1 A;  3GQZ A;  3BFF A;  1PI4 A;  1EWZ A;  5E2G A;  5FQI A;  4S2O A;  4MBF A;  1MXO A;  3IH8 A;  2Y55 A;  3D4F A;  5I94 A;  5CHJ A;  5FQM A;  2FFY A;  4EUZ A;  5KMW A;  1LI9 A;  3BFC A;  2Y2M A;  3IXH A;  2JCH A;  3O87 A;  3WS1 A;  4LCL A;  3ITA A;  5A90 A;  1BZA A;  1XGI A;  2ZM0 A;  2ZQA A;  2XH9 A;  4OPZ A;  4OOY A;  4KQO A;  4RX2 A;  5CTN A;  5EVI A;  1PW1 A;  2BG1 A;  1QMF A;  3GR2 A;  3DWZ A;  2WZX A;  1MPL A;  1KVL A;  3W4P A;  1FR6 A;  2GDN A;  2PBY A;  3G35 A;  4HES A;  3EQV A;  5DF9 A;  2XGN A;  4EBN A;  3O88 A;  4S2N C;  4WZ5 A;  1YLY A;  4E3O A;  3NY4 A;  5A92 A;  3OPL A;  3Q7V A;  3IF6 B;  3UY6 A;  3VFH A;  3N6I A;  1QME A;  2Y2N A;  3OPR A;  5GHX A;  4X53 A;  4B88 A;  4LCM A;  1PWG A;  4KG5 A;  2XR0 A;  4Y0U A;  5U47 A;  3UN7 A;  4KZ9 A;  4OVD A;  2EFU A;  3A3E A;  4KZ6 A;  4E3I A;  2WAF A;  4QD4 A;  1RGZ A;  4YIN A;  3FZC A;  2B5R A;  2ZC3 B;  3Q1F A;  3BFE A;  5EEC A;  1XKZ A;  5KSH A;  1DY6 A;  3CZD A;  1KGG A;  2Y2I A;  3LO7 A;  3NDE A;  4X69 A;  4E3M A;  4LV0 A;  3HLE A;  1U60 A;  1GA9 A;  2WK0 A;  3IWQ A;  1L0D A;  4WEJ A;  1SHV A;  4GB7 A;  1ES3 A;  4GD8 A;  4S2P A;  5FA7 A;  3CG5 A;  2ZQ8 A;  4PM5 A;  2J9O A;  2H5S A;  1MY8 A;  1YM1 A;  3WRT A;  1M40 A; 
#chains in the Genus database with same CATH topology
 3CI6 A;  1KE0 A;  2P7J A;  4RQ9 A;  1ZG4 A;  3G34 A;  5EM1 A;  2R78 A;  2ZD8 A;  5IHV A;  4WEK A;  5EUA A;  3UB7 A;  4PHT A;  3HCY A;  4F94 A;  2W3H A;  1P97 A;  4P87 A;  5TFQ A;  1P0Z A;  1K55 A;  1ESU A;  4I38 A;  4MEZ A;  1K25 A;  4I3J A;  1HD8 A;  1F5M A;  2W1R A;  3UNW A;  5HFO A;  5DVA A;  5CGS A;  4UA6 A;  3P09 A;  1W63 Q;  1WYC A;  1KOU A;  1XFQ A;  3BY9 A;  3QNB A;  4R3J A;  2A49 A;  1K54 C;  4JXW A;  3Q07 A;  4GLQ A;  1GHP A;  4Z9Q A;  1OJG A;  5GLC A;  3V3S A;  3ZYT A;  3BEB A;  3UO9 A;  3C5A A;  4MN5 A;  3QNC A;  1GSX A;  5EE8 A;  2WGW A;  2AVX A;  2V8F A;  4E6W A;  3W8K A;  5E2E A;  1YSP A;  2H28 A;  1KGE A;  3ZQ5 A;  1GSV A;  1ZKJ A;  3F1N B;  2V2F F;  5FL3 A;  1IOU A;  5L2F A;  1OPX A;  4KQQ A;  5AQB A;  3LGO A;  3ZVW A;  3IHB A;  1XA7 A;  3E4O A;  3CUE C;  3PYP A;  3LIB A;  2V1B A;  1CEG A;  2XF3 A;  2IWD A;  3HJI A;  3ULF A;  3FKV A;  5CX7 A;  3LR3 A;  2DRW A;  3Q81 A;  3ZG7 B;  3EEH A;  2VV8 A;  1MWT A;  4BD1 A;  3C7U A;  3CIT A;  1OJ5 A;  4JGQ A;  3UE6 A;  1IKI A;  5KSC A;  3W4O A;  2EX9 A;  3GMW A;  3G4P A;  3PR6 A;  1IFQ A;  2YKF A;  4MDZ A;  4NG2 A;  3PBQ A;  1TEM A;  2WKR A;  4D60 A;  3B47 A;  2QKP A;  4NXB A;  2JKR M;  3OC2 A;  4KQD A;  4IVK A;  3CHW P;  1HLU P;  4LRX C;  3NBL A;  1W8Q A;  2ZQD A;  5A93 A;  1UWP X;  1TDL A;  4NXF A;  5TBM B;  1CI8 A;  1OT6 A;  1PWD A;  1N9B A;  4WMC D;  4X6T A;  3VP0 A;  4HNB A;  1YLT A;  2O9C A;  2G2U A;  4QPR A;  4GHI A;  2Y2P A;  2JE5 A;  3Q82 A;  4HY8 A;  3PBN A;  3B3X A;  1ERQ A;  3GDI A;  4KUK A;  3LYX A;  4IHQ A;  3V39 A;  4O0P A;  2LB9 A;  4JF4 A;  2PBD P;  3KSI A;  4OPQ A;  5FDH A;  1YLZ A;  3T4Q A;  1PWC A;  4BLM A;  5FAS A;  2G7U A;  3PBR A;  3QP2 A;  2EA9 A;  1DJA A;  4GW9 A;  3NJA A;  2H0T A;  3BFD A;  4LRZ E;  3VOL A;  2I9V A;  2OLU A;  3NI9 A;  1JVJ A;  4P0M A;  4S2M A;  1Q2P A;  1H5X A;  4JXG A;  3Q7Z A;  2HP6 A;  4BJP A;  3ZGA B;  3H82 A;  4FSF A;  2W3D A;  2I72 A;  4MN7 A;  4PKY G;  5HAI A;  5HL6 A;  4EES A;  4L9G A;  2EWV A;  2VGL S;  3F1O B;  4R23 A;  5DFY A;  3ZG0 A;  5CER A;  3HBR A;  1IYQ A;  3UB9 A;  1CF0 A;  4MCW A;  5AQA A;  2V1Z A;  1E3U A;  5CEB A;  3G2Z A;  1FR1 A;  4XT2 A;  3VFF A;  2IWC A;  3OLO A;  1IEM A;  4KZ3 A;  3G6O A;  3AGE A;  3H9W A;  5CHU A;  1G6A A;  2XSS A;  1EW0 A;  4DXB A;  4WEL A;  4R6L A;  3M6H A;  5KZH A;  3VOY A;  4C3Q A;  1O7E A;  3S1Y A;  1MZU A;  2Z6D A;  3UMD A;  4OOM A;  1IYO A;  4ZRR A;  1YKD A;  1VET A;  4ZBE A;  4YOF A;  3KO6 A;  3NEC A;  3UB8 A;  3C8C A;  1JTG A;  3SW1 A;  1X0O A;  4JGR A;  3LI9 A;  5F83 A;  2XA7 S;  5IT5 A;  3PBS A;  4DDS A;  4ZJ1 A;  3BLS A;  1SKF A;  1O07 A;  3R4K A;  2KDK A;  4OON A;  3N8S A;  3A3J A;  2P04 A;  4UA9 A;  2KX6 A;  1ES5 A;  1K56 D;  3ZDJ A;  4X55 A;  2JHE A;  2JKR I;  1DJC A;  1E4D A;  4H6J A;  2W3F A;  3VSK A;  3IF6 A;  1YSQ A;  4BL2 A;  4S2I A;  5TR7 A;  3DTM A;  4LLO B;  2ZM8 A;  1MWS A;  1OTA A;  4PPR A;  1OT9 A;  3BM6 A;  2JKT I;  2P74 A;  3T4S A;  3NUL A;  3E2L A;  3VSL A;  1V9Y A;  1M6K A;  4R3B A;  4G3V A;  2EX2 A;  4KZ5 A;  1L2S A;  4S2J A;  5CED A;  3A3D A;  3GQZ A;  1MXO A;  5I94 A;  3CPT B;  2FFY A;  5KMW A;  1LI9 A;  3BFC A;  3O87 A;  5J4E A;  2ZM0 A;  3MR0 A;  4OOY A;  5J3W A;  2A24 A;  1ODV A;  4KQO A;  4O01 A;  3LIA A;  3GR2 A;  1J3W A;  3DWZ A;  2PBY A;  4BBT A;  4S2N C;  4E3O A;  5A92 A;  2ZBB A;  3UY6 A;  3VFH A;  1PWG A;  4KG5 A;  3F1N A;  3A3E A;  4E3I A;  2WAF A;  5EEC A;  1DY6 A;  4MMN A;  3HLE A;  1U60 A;  4Y3I A;  2K2N A;  1L0D A;  1UWN X;  3FPW A;  3CG5 A;  1YM1 A;  1PIO A;  3UE3 A;  3VE3 A;  1BLH A;  5HAQ A;  1J9M A;  3U2A A;  4B4X A;  1XJ6 A;  3MXS A;  1XJ4 A;  5HDC A;  4X56 A;  1TD5 A;  2VGJ A;  5FQQ A;  3MQQ A;  3OZH A;  5LBR A;  5IS1 A;  1ERO A;  1ONH A;  4GD6 A;  4M3K A;  1VQQ A;  3E2K A;  2BAS A;  4DMZ A;  2EWW A;  5EOE A;  3B33 A;  5F82 A;  4WM9 A;  1JWP A;  3H7W A;  1FSW A;  4U0T A;  1ZC2 A;  4GKU A;  3ZHH A;  2OWH A;  1LHY A;  5IU1 A;  3IXG A;  4BQM A;  3NC8 A;  5FEF A;  3MFD A;  5DF8 A;  3MS6 A;  1BSG A;  3LEQ A;  1PNE A;  2PT7 A;  4Q0H A;  5GHZ A;  2WYX A;  3C7V A;  3SH9 A;  3QP6 A;  4X68 A;  3F1P B;  4R4R A;  4HBT A;  2WKE A;  2OV5 A;  1T1B A;  2QMI A;  3HUM A;  1KE4 A;  4P6Z S;  4DDY A;  3HLC A;  4ARZ B;  3S22 A;  1I2W A;  3VOZ A;  4FD8 A;  1D1J A;  2ACG A;  4KQR A;  2BTF P;  3IS2 A;  5HWT A;  1Y4O A;  5DFX A;  4K08 A;  3JPU A;  4JXV A;  3ZG9 B;  3KSG A;  5CGX A;  3LEZ A;  1FIL A;  2CC1 A;  1NZO A;  2VGK A;  3NOP C;  4HQA A;  1OME A;  3HL9 A;  1LSW A;  3VP2 A;  3WS4 A;  4DN0 A;  4CLC B;  3CMZ A;  1S6R A;  1W5D A;  3QP4 A;  4GCZ A;  4MBK A;  3IBJ A;  4QWO A;  5CGW A;  1FOF A;  5JYO A;  3AGD A;  1L0F A;  2Y2L A;  4IBR A;  5FQK A;  2Y59 A;  1AXB A;  5L10 A;  1LLB A;  2X71 A;  3V3R A;  3PXP A;  3TE8 A;  3M2K A;  3T4O A;  2VA0 A;  3T1R A;  1ONG A;  4P6Z M;  1TDG A;  4EUV A;  4C6Y A;  3MZF A;  4CLC C;  5E2H A;  4CPK A;  4FOF A;  5FAQ A;  3OCL A;  3G2Y A;  3UB6 A;  1W7F A;  1MWR A;  3DWK A;  4GHI B;  2LB5 A;  4EQI A;  1TVF A;  5EVL A;  1YMX A;  5FQJ A;  2EFX A;  2O99 A;  2J3T D;  4NET A;  3KSH A;  3HLD A;  3P98 A;  3EGD C;  4Q0J A;  4R4S A;  5DKK A;  2QJ7 A;  1GHI A;  1XXM A;  3MQ0 A;  5DTK A;  4HI4 A;  3DBA A;  2ZMF A;  3BLM A;  1H3Q A;  2A3U A;  1C3B A;  3HLW A;  2HPB A;  3GVB A;  4Q8I A;  4OP5 A;  4MLL A;  1P9R A;  2ZQ9 A;  2ZOH A;  3IWO A;  2WKH A;  4PAU A;  2XA7 M;  1K4E A;  1PFL A;  2PU2 A;  2Q9N A;  4I39 A;  4Y0T A;  1MBL A;  4IVI A;  2L1M A;  4R3A A;  3RXW A;  3IXD A;  3BEC A;  3NDG A;  2GNX A;  3UPN A;  5HAR A;  2EXB A;  3MKE A;  3V50 A;  2M1C A;  3ZVT A;  3PBO A;  1L0G A;  1ESI A;  4A5R A;  2ZLY A;  2PR5 A;  3A3I A;  1HZO A;  3IX8 A;  2JKF A;  5FI6 A;  4RX3 A;  3A3F A;  3N8R A;  4DE3 A;  2INW A;  2VK3 A;  1WYB A;  1K54 A;  1G6O A;  2ZMA A;  1PYY A;  2Y2G A;  4LFU A;  1YT4 A;  1TS6 A;  5F69 A;  3UPO A;  1OTI A;  2FH5 A;  3UDF A;  4ZDX A;  2GJ3 A;  2HJE A;  1NXY A;  2HP9 A;  2PYP A;  4KUO A;  4Y2F A;  2J7V A;  2ZL1 B;  4KZ8 A;  3IXB A;  1NRF A;  2QWS A;  3CJM A;  1VM1 A;  1I2S A;  4NKP A;  4FTX A;  2RCX A;  4KEN B;  3ICY A;  4L9F A;  4ETZ A;  3RFB A;  5FI2 A;  3UME A;  1BLP A;  2ZC5 B;  4MBH A;  4GS9 B;  4XUZ A;  1CI9 A;  2H10 A;  3CUE A;  3KYQ A;  4HOI A;  4Y17 A;  3FG8 A;  4Y5F A;  2EX8 A;  4WN5 A;  1XGJ A;  3GV9 A;  1DP8 A;  1NYM A;  2MJ6 A;  5E43 A;  4ZJ2 A;  2UV0 E;  5CRF A;  3KYE A;  2QPN A;  3MZE A;  2Q0O A;  4HEF A;  4IBX A;  1LSV A;  4EV4 A;  2WUQ A;  2Y2Q A;  3ZG5 A;  4O8G A;  2J8Y A;  2OWJ A;  1NZU A;  2VLG A;  3T4J A;  2Y4A A;  3SS4 A;  1RCJ A;  3HLB A;  3PHY A;  2FZ0 A;  2OAQ 1;  4O7D A;  5EFW A;  3V67 A;  2Z2M B;  3N7W A;  3LR0 A;  3UE0 A;  4UEY A;  3RXX A;  4CJN A;  2O9B A;  2VEA A;  1DJB A;  4HH2 A;  5EVI C;  1CQA A;  4LV1 A;  1K38 A;  1NLY A;  3T4L A;  2XRO A;  5GLB A;  5CHM A;  4KG6 A;  3T1Q B;  3IX3 A;  3WS2 A;  3ITB A;  1ALQ A;  3OPH A;  3RH8 B;  2RL3 A;  5I5L A;  4S2N A;  5HL1 A;  1EWZ A;  3D4F A;  1SKO A;  5CHJ A;  5FQM A;  2Y2M A;  3ITA A;  3VV4 A;  4AFI A;  4OPZ A;  3UB5 P;  2BG1 A;  2NUP C;  3BJN A;  2GDN A;  3LIC A;  5DF9 A;  4EBN A;  1F9I A;  1STZ A;  3MQO A;  3IF6 B;  2HZ5 A;  2D02 A;  4LCM A;  3UN7 A;  4KZ9 A;  4OVD A;  4KZ6 A;  4EER A;  1S1Y A;  4QD4 A;  3Q1F A;  5HPI A;  4CLC A;  1XKZ A;  3LO7 A;  1N9O A;  3MFX A;  4X69 A;  3LR4 A;  5FEG A;  3IWQ A;  4F3L B;  4WEJ A;  1SHV A;  4GB7 A;  1ES3 A;  4S2P A;  2WKP A;  2ZQ8 A;  4PM5 A;  2J9O A;  1M40 A;  3S7P A;  1YQS A;  3KX0 X;  3GSG A;  2HJ9 C;  4Y0O A;  3C4P A;  1Y28 A;  3G30 A;  2PYR A;  3BY8 A;  4RVA A;  4DRT A;  3TOI A;  2Y2H A;  4WYY A;  5HPF A;  2ZQC A;  1ACF A;  1WA9 A;  2V9A A;  3L7H A;  3GEC A;  5K5B A;  4OLD A;  2ZJ9 A;  3C38 A;  2XEP A;  2W3G A;  1IEL A;  3ISG A;  3T1X A;  5HW3 A;  2ZMV A;  5GLA A;  4OQI A;  4OOL A;  4GS9 A;  1S4R A;  1ERM A;  2K7S A;  3BRM A;  3IQA A;  4OQ0 A;  1T19 A;  3HJK A;  2A24 B;  4CQH A;  4JGP A;  2PR6 A;  1K55 C;  3KYZ A;  3FKW A;  1F98 A;  2C6W B;  4H8R A;  2XD1 A;  5FAT A;  2WGW B;  1LL9 A;  2Z6C A;  3LUQ A;  4JLF A;  4K0X A;  2V0U A;  3PTE A;  3WWX A;  4ARZ A;  5AJG A;  4LV2 A;  4GOG A;  5HWW A;  1XJ2 A;  2UWX A;  3EEA A;  2XFS A;  1TS8 A;  1Y54 A;  4HIA A;  2PD7 A;  3TG9 A;  1XJ3 A;  4I3A A;  2JBF A;  4D2O A;  3MSH A;  2Y8H A;  3QP8 A;  1PRQ A;  4B9O A;  5GHY A;  4GN2 A;  3ZNT A;  4XT2 B;  2CMN A;  3D72 A;  4IUH A;  2VGL M;  3TSG A;  3UDI A;  5DJU A;  3GRJ A;  3T12 B;  1FQG A;  4WF0 A;  3MBZ A;  4K0W A;  3OPP A;  2B02 A;  2J3T C;  4X1L A;  1G68 A;  1FSY A;  4IUK A;  3EQU A;  5L09 A;  5DJT A;  3T50 A;  3OOV A;  4FH2 A;  1AWI A;  3VP1 A;  5DTS A;  5HDD A;  2QZ6 A;  3LI8 A;  2DNS A;  4S2L A;  5KIZ A;  2ZC4 B;  2ZL1 A;  3EGX C;  3K3D A;  5AVF A;  3IBR A;  4DE1 A;  4R0Q A;  2XD5 A;  1XX2 A;  3DTI A;  2Y2O A;  4DXC A;  3VP4 A;  4XUX A;  4S2K A;  2E8I A;  2O0Y A;  2HDR A;  2PHY A;  4LPZ A;  5HWV A;  5E2F A;  3TW8 A;  2JKT M;  4JF5 A;  3IX4 A;  1RP5 A;  1DP9 A;  4BBU A;  2M7V A;  2B18 A;  2M7U A;  2X01 A;  2X02 A;  1GA0 A;  3RTY A;  5AVE A;  4UHU A;  4BMW A;  1BTL A;  1FCO A;  5HX9 A;  3BYD A;  2EX6 A;  1FCM A;  1YPR A;  4JBF A;  1L3L A;  4JGO A;  3SH8 A;  1YLP A;  3R7W B;  1NRJ A;  1BYW A;  1UGU A;  5A91 A;  1K6S A;  1ES2 A;  3UPP A;  1KDS A;  4N1X A;  5A8B A;  3HVF A;  1S4S A;  3LIF A;  4HP4 A;  2W3E A;  3H7W B;  4LRY C;  2HF6 A;  5AQ7 A;  3TRC A;  5EVI D;  3CLO A;  2Z2L B;  4UAA A;  3H82 B;  3PAG A;  3A0R A;  3IS2 B;  1N4O A;  5HD5 A;  2HDU A;  2HV1 A;  3O3V A;  1JWZ A;  3C4O A;  3GTC A;  1E25 A;  2G2W A;  4YFM A;  5G4Z A;  4GNU A;  2ZQ7 A;  1MKI A;  4BL3 A;  4L9E A;  4NXG A;  3LR5 A;  4EW7 A;  1Z6F A;  1G5U A;  3S7N A;  1JWV A;  3HUO A;  3NHQ A;  5F5Y A;  3EWK A;  2WAE A;  5FAO A;  5J7E A;  1Q2Q A;  1CK3 A;  4Y15 A;  4E3L A;  4R1G A;  4PM6 A;  5HSQ A;  1LL5 A;  1D7E A;  5F1G A;  2XQZ A;  3DAV A;  4EQ1 A;  4QJG A;  1XP4 A;  1CEF A;  5HD3 A;  1YLW A;  3VMA A;  5CEC A;  5M19 A;  4I3I A;  2JN7 A;  4HJ6 A;  3BFG A;  4PMA A;  1BLC A;  2QJ5 A;  5FQ9 A;  3ZG8 B;  5EM0 A;  4JF6 A;  3LIE A;  3M2J A;  3IT9 A;  1XA1 A;  3MKF A;  2XDM A;  3E4Q A;  1FCN A;  3VE4 A;  1LSX A;  3QHY A;  4X1M A;  3SOI A;  1FIK A;  5M1A A;  5HAP A;  3DW0 A;  1HTZ A;  4OPY A;  2VJW A;  3NCK A;  3SS5 A;  4HJ4 A;  2W1T A;  4UQI M;  3N8L A;  4GDB A;  4HP9 A;  1F2K A;  4OKP A;  1I5Q A;  1VB6 A;  4EEP A;  1N9L A;  2ZM2 A;  4ZJ3 A;  1SDN A;  3NOU C;  3MXR A;  2Y91 A;  2GX5 A;  3WS5 A;  1D06 A;  1PI4 A;  1S67 L;  5E2G A;  5FQI A;  4S2O A;  3IH8 A;  2Y55 A;  3D9Y A;  1V9Z A;  3IXH A;  3WS1 A;  4LCL A;  1H8M A;  2ZQA A;  2XH9 A;  4RX2 A;  5CTN A;  1ZHH B;  1LL8 A;  1PW1 A;  2W27 A;  1QMF A;  2WZX A;  3K2N A;  1KVL A;  5G4Y A;  4HES A;  1YAX A;  1MC0 A;  1VEU A;  3O88 A;  1YLY A;  3T4K A;  3OPL A;  2QYB A;  4WLA A;  1XFN A;  3N6I A;  1QME A;  3OPR A;  5GHX A;  4X53 A;  3MJQ A;  3OBF A;  2XR0 A;  2EFU A;  2Y2I A;  1T1C A;  4I5S A;  4E3M A;  4EU0 A;  1GA9 A;  4LGW A;  1DRM A;  3BWL A;  4MN6 A;  4BBV A;  4PKY A;  2H5S A;  1MY8 A;  3WRT A;  3BFE A;  4OQG A;  3TJZ C;  3RJU A;  2W0N A;  2HDQ A;  1PI5 A;  5HDS A;  2E8J A;  2Y2K A;  2PU4 A;  3M6B A;  5EOO A;  2BLS A;  4OLG A;  1G28 A;  2WKI A;  1IKG A;  4GZB A;  2V8C A;  2PRF A;  4Y7P A;  4QY6 A;  2V1A A;  3FC7 A;  3FYZ A;  3HLG A;  1S0W A;  2J80 A;  3F1P A;  3IH9 A;  1TF1 A;  3N4I A;  3SH7 A;  1NJ4 A;  2P9V A;  2IA2 A;  3FPV A;  4NXE A;  5BOH A;  4WL9 A;  4BEN A;  2WGI A;  3LID A;  1OTE A;  1XPB A;  1K57 C;  4X25 A;  3CAX A;  5EVI B;  4N92 A;  5CTM A;  4MNR A;  1ZTU A;  4N9L A;  4EBL A;  3K3C A;  4JKT A;  4JPM A;  2C5W B;  4DE2 A;  4H6J B;  1NY0 A;  2O9A A;  3MZD A;  1KVM A;  5TGF A;  4QB8 A;  3HLF A;  4Y13 A;  4GJ4 A;  2JC7 A;  4E04 A;  3CPT A;  2ZC6 B;  2OSU A;  4FH4 A;  2Q9M A;  4LV3 A;  4P85 A;  3U4L P;  1CJF A;  1YMS A;  1K6R A;  2WAD A;  3O5Y A;  1Z09 A;  2OOL A;  1IYP A;  3BQA A;  2J9P A;  3JYI A;  4IED A;  4OP8 A;  2Y2J A;  4PM9 A;  1PZP A;  3ZCZ A;  1VEU B;  3IF6 C;  3E98 A;  1MWU A;  1YLJ A;  4N1H A;  3T4T A;  5J8X A;  1K4F A;  4KZ4 A;  5FDS A;  2IWB A;  1PZO A;  1PW8 A;  4B4Z A;  5D3O A;  1HVB A;  1NLZ A;  4P6B A;  4DKI A;  1H8Y A;  4CLC D;  3LCE A;  1H8Z A;  3AGF A;  4OQH A;  5F1F A;  2OLV A;  2V0W A;  2QHK A;  4FCF A;  3JVV A;  3T1S A;  2XFT A;  5DF7 A;  4DJ2 A;  3MXQ A;  3W4Q A;  5JYP A;  2A2L A;  3MF0 A;  3FV7 A;  3S7Q A;  1BUL A;  5F68 A;  5FSR A;  3WS0 A;  5L07 A;  4GDN A;  4EBP A;  2K31 A;  1TS7 A;  2GZA A;  2J3W A;  2XLN A;  4DF6 A;  1ES4 A;  2YKH A;  2DCF A;  1TS0 A;  4UQI S;  2OAP 1;  5EVE A;  3P7N A;  4IJG A;  2WGV A;  5AQ9 A;  1E3U D;  4N9K A;  4WZ4 A;  1IYS A;  1SKO B;  1W79 A;  4ME4 A;  1BLS A;  1GCE A;  1LI0 A;  3C30 A;  2EXA A;  4EWF A;  4B93 A;  4YWZ A;  4BWI A;  1VHM A;  4PM7 A;  4DE0 A;  4Z1W A;  3E4P A;  5HZH A;  4NEE D;  1KDW A;  2D01 A;  4KG2 A;  2JKG A;  5DKL A;  5CXW A;  4ETX A;  3BW6 A;  3C2W A;  2W1T B;  1K57 A;  5GLD A;  3IHA A;  4WBG A;  3QP5 A;  2KOI A;  1L0E A;  2HGV A;  4ZAM A;  3ZNY A;  1GSW A;  4KZ7 A;  4WZ5 C;  1ZG6 A;  4U0X A;  1K0K A;  3S4X A;  4E3J A;  2WZZ A;  4WMC A;  4RYE A;  2R9X A;  1T1A A;  4E3K A;  3UDX A;  3A0V A;  4KZB A;  1H0M A;  5TJJ A;  2L4R A;  3SS3 A;  3B42 A;  4NK3 A;  1W63 M;  4BD0 A;  2R9W A;  2VV6 A;  1SDE A;  2PDR A;  4G3K A;  2KLI A;  4OPR A;  1K56 A;  4ID4 A;  2XRN A;  3LY3 A;  1NWZ A;  5GL9 A;  4RA7 A;  1P9W A;  1JTD A;  3E0Y A;  1OTD A;  1BUE A;  4ZTK A;  2NUT C;  4E6X A;  4EXO A;  2VKS A;  5FAP A;  3V5M A;  5EPH A;  5DTT A;  4G3W A;  4ESP A;  3PBT A;  3SZT A;  1BT5 A;  5C5K A;  4QHC A;  4JXS A;  3HRE A;  3S7O A;  4HBU A;  3G32 A;  4PM8 A;  4WUJ A;  4HHD A;  4UA7 A;  3UE1 A;  3BQ8 A;  2DMW A;  2V20 A;  2ZOI A;  3L9K A;  4LEN A;  1JNU A;  1RGY A;  5M18 A;  3DTE A;  3WRZ A;  3MMH A;  1DP6 A;  1VET B;  2ZC7 A;  4C75 A;  4QU3 A;  4XXR A;  3OCN A;  2L0W A;  3G31 A;  3LY4 A;  1KGF A;  4EEU A;  2FFF B;  4L0L A;  4R70 A;  4E3N A;  1KE3 A;  3O86 A;  3ZFZ A;  1W8Y A;  4M4X A;  2B95 A;  4HH3 A;  4QY5 A;  1N9N A;  2VZW A;  4Q0I A;  3VP3 A;  4YNR A;  4KZA A;  3I7J A;  4U3T A;  1NYY A;  3QP1 A;  1LT0 A;  1OTB A;  3NIA A;  3NOT C;  2P9V B;  3IWI A;  3P01 A;  1GHM A;  3W2Z A;  3PAE A;  3LFV A;  3KSF A;  5L8M A;  5G18 A;  2PAV P;  3FWL A;  2PD8 A;  5FI7 A;  2VV7 A;  1WE4 A;  1T18 A;  3JVU A;  1SCW A;  3IF5 A;  2HDS A;  4OH0 A;  4F3L A;  1MKM A;  1EI5 A;  3F1O A;  2H0Y A;  4FUW A;  3HUN A;  4K91 A;  4EET B;  4HJ3 A;  2HP5 A;  3Q7V B;  1SZV A;  4CLC E;  2XK1 A;  3BFF A;  4MBF A;  5TBM A;  4EUZ A;  4DJ3 A;  2JCH A;  5A90 A;  1BZA A;  1XGI A;  5EV0 A;  3D3O A;  5EVI A;  3EOI A;  1A0K A;  1MPL A;  3W4P A;  1FR6 A;  3G35 A;  2P08 A;  3EQV A;  2XGN A;  4WZ5 A;  2WKQ A;  3NY4 A;  3Q7V A;  2Y2N A;  3DTK A;  4B88 A;  5MC7 A;  3A0S A;  4Y0U A;  5U47 A;  2Y79 A;  1RGZ A;  2VX8 A;  3FZC A;  2B5R A;  2ZC3 B;  4R38 A;  4YIN A;  5KSH A;  1S1Z A;  3R7W A;  3CZD A;  1KGG A;  3NDE A;  4LV0 A;  2WK0 A;  3CWF A;  4GD8 A;  5FA7 A;  5F6A A;  4II7 A;  1S66 L; 
#chains in the Genus database with same CATH homology
 1PIO A;  3UE3 A;  1YQS A;  4OQG A;  3GSG A;  1BLH A;  1KE0 A;  3RJU A;  5HAQ A;  4Y0O A;  1J9M A;  3C4P A;  1ZG4 A;  2HDQ A;  1PI5 A;  3G30 A;  3G34 A;  4B4X A;  5IHV A;  2ZD8 A;  4WEK A;  5EUA A;  3MXS A;  4RVA A;  4DRT A;  2Y2K A;  2PU4 A;  3M6B A;  4F94 A;  5EOO A;  3TOI A;  2Y2H A;  2BLS A;  4OLG A;  4X56 A;  2WKI A;  2VGJ A;  4WYY A;  1IKG A;  2ZQC A;  5FQQ A;  4GZB A;  3OZH A;  4P87 A;  5TFQ A;  4Y7P A;  1K55 A;  1ESU A;  4QY6 A;  1ERO A;  1ONH A;  4GD6 A;  4M3K A;  1VQQ A;  3FYZ A;  3HLG A;  4MEZ A;  1S0W A;  1K25 A;  3E2K A;  2ZJ9 A;  4OLD A;  1HD8 A;  2XEP A;  3IH9 A;  1IEL A;  3N4I A;  3SH7 A;  3ISG A;  5EOE A;  1NJ4 A;  3UNW A;  2P9V A;  5HFO A;  5F82 A;  5DVA A;  4WM9 A;  5CGS A;  1JWP A;  4UA6 A;  1FSW A;  3P09 A;  1ZC2 A;  4U0T A;  4GKU A;  1WYC A;  5HW3 A;  5BOH A;  4BEN A;  3ZHH A;  2WGI A;  1LHY A;  3QNB A;  3IXG A;  5GLA A;  4OQI A;  4OOL A;  1XPB A;  4R3J A;  1ERM A;  2A49 A;  4BQM A;  1K57 C;  3BRM A;  1K54 C;  3IQA A;  3NC8 A;  3MFD A;  4JXW A;  4OQ0 A;  5DF8 A;  5EVI B;  3Q07 A;  1BSG A;  4N92 A;  5CTM A;  4MNR A;  1GHP A;  4N9L A;  1K55 C;  3FKW A;  4EBL A;  4Z9Q A;  5GHZ A;  2WYX A;  3C7V A;  4JKT A;  4JPM A;  2C5W B;  5GLC A;  3V3S A;  4DE2 A;  3BEB A;  1NY0 A;  3SH9 A;  4X68 A;  2C6W B;  4H8R A;  3MZD A;  3UO9 A;  4R4R A;  1KVM A;  2XD1 A;  3C5A A;  3QNC A;  4HBT A;  2WKE A;  2WGW B;  3HLF A;  2WGW A;  4QB8 A;  5EE8 A;  5FAT A;  4E6W A;  1LL9 A;  2OV5 A;  3W8K A;  2QMI A;  3HUM A;  5E2E A;  2JC7 A;  4JLF A;  4K0X A;  1KE4 A;  1KGE A;  4DDY A;  3PTE A;  3WWX A;  1ZKJ A;  3HLC A;  2V2F F;  3S22 A;  2ZC6 B;  5L2F A;  1I2W A;  2OSU A;  4LV2 A;  4FH4 A;  4GOG A;  3VOZ A;  2Q9M A;  4FD8 A;  4KQQ A;  5AQB A;  3ZVW A;  3IHB A;  4LV3 A;  1XA7 A;  4P85 A;  4KQR A;  1YMS A;  2UWX A;  1K6R A;  2WAD A;  2XFS A;  1IYP A;  1CEG A;  1Y54 A;  2J9P A;  2XF3 A;  4JXV A;  3JYI A;  4IED A;  2IWD A;  3ZG9 B;  4OP8 A;  3FKV A;  5CGX A;  2Y2J A;  3TG9 A;  3LEZ A;  4PM9 A;  1PZP A;  1NZO A;  2CC1 A;  2DRW A;  2VGK A;  3Q81 A;  3ZG7 B;  3ZCZ A;  3IF6 C;  1MWT A;  2JBF A;  1OME A;  1MWU A;  3HL9 A;  1YLJ A;  4BD1 A;  4D2O A;  3C7U A;  3VP2 A;  4N1H A;  3WS4 A;  5J8X A;  1IKI A;  1K4F A;  3CMZ A;  5KSC A;  4KZ4 A;  1S6R A;  2IWB A;  1PZO A;  1PW8 A;  4B4Z A;  5GHY A;  5D3O A;  3W4O A;  4GN2 A;  1HVB A;  1W5D A;  3ZNT A;  4MBK A;  2EX9 A;  3GMW A;  3G4P A;  5CGW A;  3TSG A;  1FOF A;  4P6B A;  1H8Y A;  4DKI A;  3PBQ A;  1TEM A;  3LCE A;  3UDI A;  1H8Z A;  5JYO A;  3AGF A;  3AGD A;  4OQH A;  1L0F A;  3GRJ A;  5F1F A;  3OC2 A;  2Y2L A;  4IVK A;  1FQG A;  2OLV A;  4IBR A;  5FQK A;  2Y59 A;  1AXB A;  3MBZ A;  3NBL A;  1LLB A;  4K0W A;  3OPP A;  2X71 A;  3V3R A;  4FCF A;  1W8Q A;  2ZQD A;  5A93 A;  2XFT A;  3M2K A;  1TDL A;  5DF7 A;  1CI8 A;  1G68 A;  3W4Q A;  5JYP A;  1PWD A;  1FSY A;  1ONG A;  3FV7 A;  1TDG A;  3EQU A;  1N9B A;  4WMC D;  4C6Y A;  4X6T A;  3MZF A;  3VP0 A;  1BUL A;  5E2H A;  1YLT A;  4CPK A;  4FH2 A;  3OCL A;  3G2Y A;  5FAQ A;  3VP1 A;  1W7F A;  1MWR A;  5DTS A;  2G2U A;  5FSR A;  3WS0 A;  3DWK A;  4GDN A;  4EQI A;  2Y2P A;  2JE5 A;  3Q82 A;  4EBP A;  2QZ6 A;  2DNS A;  4S2L A;  3PBN A;  1TVF A;  2ZC4 B;  3B3X A;  1ERQ A;  1YMX A;  2XLN A;  5EVL A;  5FQJ A;  2EFX A;  4DF6 A;  1ES4 A;  2DCF A;  4NET A;  4DE1 A;  3V39 A;  4R0Q A;  2XD5 A;  1XX2 A;  3HLD A;  4JF4 A;  3P98 A;  2Y2O A;  4DXC A;  2WGV A;  5AQ9 A;  4OPQ A;  5FDH A;  3VP4 A;  1YLZ A;  1E3U D;  4N9K A;  4WZ4 A;  4XUX A;  1IYS A;  1PWC A;  4R4S A;  4S2K A;  4BLM A;  5FAS A;  1W79 A;  2E8I A;  1GHI A;  1XXM A;  3PBR A;  2HDR A;  1DJA A;  2H0T A;  1BLS A;  1GCE A;  3BFD A;  5DTK A;  5E2F A;  1LI0 A;  4JF5 A;  2EXA A;  4EWF A;  2OLU A;  1RP5 A;  3BLM A;  4PM7 A;  2A3U A;  1C3B A;  3HLW A;  3NI9 A;  4DE0 A;  1JVJ A;  2HPB A;  3GVB A;  2X01 A;  4Q8I A;  2X02 A;  4P0M A;  1GA0 A;  4OP5 A;  4MLL A;  4UHU A;  4S2M A;  1BTL A;  1Q2P A;  2ZQ9 A;  1KDW A;  1FCO A;  1H5X A;  3IWO A;  4KG2 A;  4JXG A;  3Q7Z A;  2WKH A;  5HX9 A;  3BYD A;  2EX6 A;  2HP6 A;  4BJP A;  1FCM A;  5CXW A;  4JBF A;  3ZGA B;  1K4E A;  4FSF A;  2PU2 A;  2Q9N A;  5GLD A;  1K57 A;  2I72 A;  3IHA A;  4WBG A;  4Y0T A;  1MBL A;  4IVI A;  3SH8 A;  5TGF A;  5HAI A;  1YLP A;  3RXW A;  3IXD A;  5A91 A;  1K6S A;  1L0E A;  3BEC A;  4ZAM A;  1ES2 A;  3NDG A;  3UPN A;  5HAR A;  3UPP A;  1KDS A;  2EXB A;  3MKE A;  4N1X A;  3V50 A;  3HVF A;  3ZNY A;  3ZVT A;  3PBO A;  1L0G A;  1ESI A;  4KZ7 A;  4WZ5 C;  2ZLY A;  4A5R A;  3A3I A;  1HZO A;  1ZG6 A;  4U0X A;  3S4X A;  4R23 A;  4E3J A;  2WZZ A;  4WMC A;  5AQ7 A;  3ZG0 A;  4RYE A;  5CER A;  2R9X A;  5FI6 A;  4E3K A;  4RX3 A;  3UDX A;  5EVI D;  4KZB A;  3A3F A;  3HBR A;  1IYQ A;  3N8R A;  4DE3 A;  3SS3 A;  1WYB A;  1K54 A;  2Z2L B;  4NK3 A;  2ZMA A;  4BD0 A;  2R9W A;  5AQA A;  4UAA A;  1SDE A;  1PYY A;  3PAG A;  2V1Z A;  1E3U A;  2Y2G A;  5CEB A;  1YT4 A;  1N4O A;  1K56 A;  4ID4 A;  4OPR A;  3UPO A;  3G2Z A;  3LY3 A;  2HDU A;  3UDF A;  4RA7 A;  2HP9 A;  3O3V A;  1NXY A;  5GL9 A;  4ZDX A;  1JWZ A;  1FR1 A;  1JTD A;  2J7V A;  3C4O A;  4KZ8 A;  1BUE A;  4ZTK A;  3VFF A;  4E6X A;  3IXB A;  3GTC A;  1E25 A;  2IWC A;  5FAP A;  1NRF A;  3V5M A;  2G2W A;  4YFM A;  5EPH A;  4GNU A;  5DTT A;  3CJM A;  1VM1 A;  1IEM A;  4KZ3 A;  1I2S A;  2ZQ7 A;  3AGE A;  5CHU A;  1MKI A;  2RCX A;  4BL3 A;  3PBT A;  1G6A A;  4KEN B;  4DXB A;  5FI2 A;  1BT5 A;  1Z6F A;  4WEL A;  4QHC A;  4JXS A;  1BLP A;  3HRE A;  1JWV A;  3M6H A;  3HUO A;  4HBU A;  2ZC5 B;  4MBH A;  4XUZ A;  3VOY A;  4C3Q A;  5KZH A;  1CI9 A;  3G32 A;  2H10 A;  2WAE A;  4PM8 A;  1O7E A;  5FAO A;  4UA7 A;  3S1Y A;  3UE1 A;  1Q2Q A;  1CK3 A;  2EX8 A;  2V20 A;  4E3L A;  4R1G A;  4PM6 A;  4LEN A;  1RGY A;  1XGJ A;  5M18 A;  4OOM A;  3WRZ A;  1IYO A;  3GV9 A;  1NYM A;  1LL5 A;  5E43 A;  5F1G A;  4ZBE A;  2XQZ A;  2ZC7 A;  4C75 A;  4QU3 A;  4XXR A;  3OCN A;  1XP4 A;  4ZJ2 A;  5CRF A;  1CEF A;  3G31 A;  3LY4 A;  4QJG A;  1JTG A;  1KGF A;  1YLW A;  2QPN A;  2FFF B;  3VMA A;  4L0L A;  3MZE A;  5CEC A;  4HEF A;  4IBX A;  5M19 A;  5F83 A;  3PBS A;  4DDS A;  4E3N A;  4ZJ1 A;  1KE3 A;  4EV4 A;  3BLS A;  2WUQ A;  2Y2Q A;  3O86 A;  3BFG A;  1SKF A;  3ZFZ A;  1W8Y A;  3ZG5 A;  1O07 A;  4PMA A;  1BLC A;  4OON A;  2J8Y A;  3N8S A;  3A3J A;  4QY5 A;  5FQ9 A;  4UA9 A;  3VP3 A;  1NZU A;  4KZA A;  3I7J A;  3ZG8 B;  1ES5 A;  1K56 D;  4U3T A;  2Y4A A;  3SS4 A;  3ZDJ A;  4JF6 A;  3M2J A;  1NYY A;  3IT9 A;  1XA1 A;  3MKF A;  4X55 A;  2XDM A;  1FCN A;  1RCJ A;  1DJC A;  1E4D A;  3HLB A;  3NIA A;  2P9V B;  4O7D A;  3QHY A;  2Z2M B;  3N7W A;  3VSK A;  3SOI A;  3IWI A;  3IF6 A;  3UE0 A;  3RXX A;  4CJN A;  1GHM A;  4BL2 A;  5M1A A;  4S2I A;  3PAE A;  5HAP A;  3DW0 A;  5TR7 A;  3DTM A;  1HTZ A;  4OPY A;  5G18 A;  1DJB A;  2ZM8 A;  3NCK A;  3SS5 A;  1MWS A;  3FWL A;  4PPR A;  5EVI C;  4LV1 A;  1K38 A;  3BM6 A;  5FI7 A;  3N8L A;  2P74 A;  4GDB A;  1WE4 A;  3E2L A;  4OKP A;  1I5Q A;  3VSL A;  1SCW A;  3IF5 A;  2HDS A;  4OH0 A;  5CHM A;  5GLB A;  4KG6 A;  2ZM2 A;  1EI5 A;  2H0Y A;  3WS2 A;  4ZJ3 A;  3ITB A;  1M6K A;  3HUN A;  1SDN A;  4K91 A;  4R3B A;  1ALQ A;  3MXR A;  2EX2 A;  2HP5 A;  2Y91 A;  3OPH A;  2RL3 A;  3Q7V B;  4KZ5 A;  1L2S A;  4S2J A;  4S2N A;  5CED A;  3A3D A;  3WS5 A;  5HL1 A;  2XK1 A;  3GQZ A;  3BFF A;  1PI4 A;  1EWZ A;  5E2G A;  5FQI A;  4S2O A;  4MBF A;  1MXO A;  3IH8 A;  2Y55 A;  3D4F A;  5I94 A;  5CHJ A;  5FQM A;  2FFY A;  4EUZ A;  5KMW A;  1LI9 A;  3BFC A;  2Y2M A;  3IXH A;  2JCH A;  3O87 A;  3WS1 A;  4LCL A;  3ITA A;  5A90 A;  1BZA A;  1XGI A;  2ZM0 A;  2ZQA A;  2XH9 A;  4OPZ A;  4OOY A;  4KQO A;  4RX2 A;  5CTN A;  5EVI A;  1PW1 A;  2BG1 A;  1QMF A;  3GR2 A;  3DWZ A;  2WZX A;  1MPL A;  1KVL A;  3W4P A;  1FR6 A;  2GDN A;  2PBY A;  3G35 A;  4HES A;  3EQV A;  5DF9 A;  2XGN A;  4EBN A;  3O88 A;  4S2N C;  4WZ5 A;  1YLY A;  4E3O A;  3NY4 A;  5A92 A;  3OPL A;  3Q7V A;  3IF6 B;  3UY6 A;  3VFH A;  3N6I A;  1QME A;  2Y2N A;  3OPR A;  5GHX A;  4X53 A;  4B88 A;  4LCM A;  1PWG A;  4KG5 A;  2XR0 A;  4Y0U A;  5U47 A;  3UN7 A;  4KZ9 A;  4OVD A;  2EFU A;  3A3E A;  4KZ6 A;  4E3I A;  2WAF A;  4QD4 A;  1RGZ A;  4YIN A;  3FZC A;  2B5R A;  2ZC3 B;  3Q1F A;  3BFE A;  5EEC A;  1XKZ A;  5KSH A;  1DY6 A;  3CZD A;  1KGG A;  2Y2I A;  3LO7 A;  3NDE A;  4X69 A;  4E3M A;  4LV0 A;  3HLE A;  1U60 A;  1GA9 A;  2WK0 A;  3IWQ A;  1L0D A;  4WEJ A;  1SHV A;  4GB7 A;  1ES3 A;  4GD8 A;  4S2P A;  5FA7 A;  3CG5 A;  2ZQ8 A;  4PM5 A;  2J9O A;  2H5S A;  1MY8 A;  1YM1 A;  3WRT A;  1M40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...