2IWBA

Mecr1 unbound extracellular antibiotic-sensor domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
246
Chain Sequence
b'DKYETNVSYKKLNQLAPYFKGFDGSFVLYNEREQAYSIYNEPESKQRYSPNSTYKIYLALMAFDQNLLSLNHTEQQWDKHQYPFKEWNQDQNLNSSMKYSVNWYYENLNKHLRQDEVKSYLDLIEYGNEEISGNENYWNESSLKISAIEQVNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEANGWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords METHICILLIN RESISTANCE MECR1 PROTEIN
publication title Unbound and Acylated Structures of the Mecr1 Extracellular Antibiotic-Sensor Domain Provide Insights Into the Signal-Transduction System that Triggers Methicillin Resistance.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic resistance
total genus 90
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2006-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2iwbA00
3WS5A 4OPYA 4BL2A 3W8KA 3N8RA 3SH8A 2C6WB 5FQQA 3M2KA 5FI6A 1XP4A 1GA0A 4N1HA 4DE3A 3LO7A 4MNRA 3GV9A 1SDEA 1BTLA 4OONA 4X69A 2H10A 1CK3A 5CGSA 2I72A 2XFSA 5CEDA 2WZXA 3HLWA 4Y7PA 4S2NC 5TFQA 1K55C 3UN7A 1RCJA 5FASA 2WGVA 3VSLA 3WS0A 2ZQDA 2B5RA 3BFFA 4JPMA 3HUOA 3ZDJA 4Y0OA 3IXBA 3GTCA 5FSRA 1H5XA 2ZJ9A 2EFXA 4HBTA 4PM6A 4K91A 5FQKA 1HZOA 5CTNA 1DJBA 3N4IA 1K38A 1GHMA 1ES3A 1MPLA 4RX2A 1CI9A 2Z2MB 1GCEA 1JWZA 5I94A 1U60A 2UWXA 3DWZA 4QY5A 5HAPA 3UE0A 5CTMA 1YLJA 2X71A 1KGEA 2C5WB 4R23A 3S22A 1GHPA 3P09A 3PBRA 1RGZA 5FAPA 1PWCA 5A91A 2XEPA 4ZDXA 4WZ5C 2XLNA 2E8IA 3MXSA 3MZDA 3M6HA 3UE3A 3HREA 3UNWA 3W4OA 5HAIA 1I2WA 1KDSA 1FCOA 3TSGA 3PAGA 3ZG9B 3C4OA 4JF6A 1GHIA 2A49A 2OSUA 4KENB 1SDNA 1Q2PA 2DRWA 5EVLA 5TR7A 1PWGA 4OP5A 1WYCA 4LENA 3V3SA 5HFOA 4E3MA 1ES5A 1FOFA 1K57A 1G6AA 4GD6A 5DF7A 3LY3A 1IELA 2Y2HA 2JCHA 3VP0A 4E3LA 4S2IA 4KZ8A 3BLSA 3MKFA 4Y0UA 3IH9A 4WELA 1PZPA 5DF8A 5G18A 4JXGA 2R9XA 3NIAA 3MKEA 1L2SA 3HVFA 4DXBA 2JE5A 1XA7A 4X55A 4GN2A 4HESA 4OPQA 4YFMA 3O88A 1FCNA 3FV7A 1MXOA 5A90A 4RA7A 1K56A 4ZJ3A 5KMWA 1KGFA 5KSHA 3V5MA 2Q9MA 2WYXA 3WS2A 4OQ0A 4QY6A 5GL9A 2A3UA 1SHVA 4BJPA 3OZHA 5FQJA 1KGGA 3SS4A 2Y2JA 4U3TA 2Y2GA 4E3JA 1EWZA 3Q7ZA 3HUMA 5CEBA 4WM9A 5DTTA 4JBFA 5GHXA 5CGWA 4BD1A 4KQRA 3VOZA 3CJMA 5JYOA 2P74A 1FR6A 3C4PA 5F1GA 4PM5A 4BL3A 3A3FA 2EX2A 3Q1FA 1BLHA 3AGFA 3IHAA 2Y2NA 4OOMA 4ZJ1A 4WEJA 1XGIA 1TDGA 1BT5A 3GQZA 1M40A 4OQIA 4K0XA 1L0DA 1MY8A 4ZAMA 2XF3A 4B4XA 1CEGA 1KVMA 5J8XA 1ZG6A 3IF6C 2ZM0A 3QHYA 3QNCA 4KG2A 4S2NA 1K55A 1HTZA 1E3UA 2IWBA 1YMSA 3JYIA 3WRZA 3ITAA 4OH0A 1K25A 5HX9A 1MWRA 2WZZA 3IT9A 3BRMA 1KE3A 2WAEA 5EVID 3RXWA 4QD4A 4L0LA 3TOIA 1XPBA 4MBFA 4KZ6A 1QMEA 1FCMA 2HP5A 3I7JA 5E2HA 5GLBA 4BENA 4DDSA 4EWFA 4B88A 4BD0A 3G4PA 3SS3A 5EE8A 5DTSA 1W79A 4DDYA 3ZG0A 4ZBEA 3UO9A 2BLSA 3ZVWA 2ZQ8A 1YLPA 2DNSA 4KZ9A 3M2JA 1KVLA 5BOHA 4WZ5A 4EBNA 4BLMA 3OPPA 2OV5A 1BUEA 2Y59A 1W7FA 3NI9A 1BSGA 1LI0A 3E2LA 4LV1A 5E2FA 3S4XA 3AGDA 5EECA 3V39A 3VP3A 1I2SA 3DW0A 1BLCA 4OQGA 4E3IA 1ERMA 4WMCD 1JTGA 4C3QA 1PWDA 2HDQA 3IHBA 3UPOA 4KG5A 3IQAA 3G34A 3CG5A 2HPBA 2IWCA 4OP8A 4X56A 5U47A 1TVFA 1PI4A 2H5SA 1ESIA 4N1XA 1NYYA 2ZC5B 2G2WA 3N8SA 1DJCA 4FH2A 3IXGA 3ITBA 4IVKA 1MWSA 3FKVA 1XKZA 5A92A 2PU4A 3IWOA 3C7UA 3OPHA 4Z9QA 4IEDA 3VP1A 3EQUA 3O86A 2XD1A 4E3KA 4RX3A 5GLAA 2ZQCA 4E3OA 1ESUA 4OKPA 4CJNA 3OPLA 3G30A 3DWKA 2Y4AA 2Y2PA 1YLTA 3VOYA 5KZHA 3MZEA 5JYPA 1K4EA 1GA9A 1JWVA 3O87A 3Q82A 5FDHA 3VP2A 5L2FA 3HLGA 1MWUA 2ZQ9A 3EQVA 1PYYA 2Y2KA 4GOGA 4A5RA 4BQMA 2J9PA 4LV0A 1E25A 4KG6A 4EUZA 2ZC7A 3OC2A 4EQIA 4OPRA 4KZ3A 5FQ9A 3MFDA 1ES4A 1LHYA 5E43A 4JF5A 5E2EA 4FD8A 4DF6A 1EI5A 3HL9A 2ZMAA 1LL9A 5CXWA 3MZFA 2EXBA 3HLDA 3AGEA 3N8LA 1S0WA 4LV3A 3BECA 5KSCA 3OPRA 3HLCA 1YLWA 4KZBA 1TDLA 4KZ4A 2VGJA 2Y55A 3OCLA 4GD8A 1HVBA 1WYBA 2XFTA 2Y2LA 2VGKA 2H0TA 2DCFA 3LEZA 3O3VA 2RCXA 1BLPA 4WEKA 3IWQA 3IF6A 1K4FA 1JTDA 1PIOA 1DY6A 3A3EA 3SS5A 4KQOA 1IYSA 3BFEA 1ONGA 3PBTA 4C75A 3FZCA 3SOIA 1K6RA 4PMAA 4HEFA 1AXBA 2WKIA 4S2LA 3ZG8B 2G2UA 3ZNYA 3MXRA 1N4OA 1CEFA 4JKTA 3W4PA 4GKUA 4JLFA 2FFFB 1FSWA 4RYEA 1NYMA 3Q81A 4WBGA 1NZUA 4X53A 1XA1A 4P87A 1CI8A 5CRFA 3BLMA 4PM7A 5CHUA 4ZTKA 1TEMA 5GLDA 3ZG5A 5HL1A 3Q7VA 2WGWA 4PM8A 4KZ5A 4GNUA 1NJ4A 3IXHA 5EVIC 3V50A 1XX2A 2Z2LB 4XXRA 1PZOA 3G32A 3NY4A 4DRTA 1OMEA 1MBLA 3C7VA 5FI2A 1H8YA 3G35A 3PBNA 3UY6A 4UHUA 4JXVA 2HP6A 1MWTA 2J9OA 4IVIA 4E6WA 4WYYA 5F1FA 4KQQA 4XUXA 1SCWA 4MBKA 3V3RA 1FR1A 5CECA 3PBOA 3GR2A 4N9KA 2HDUA 4JXWA 3NDEA 3VSKA 2V20A 1K54C 2JC7A 3GMWA 1Y54A 5D3OA 2Y2IA 2QPNA 3HLEA 3S1YA 2RL3A 3UPNA 4X6TA 1YMXA 3LCEA 3QNBA 4QU3A 1J9MA 3VP4A 5HW3A 2PBYA 2ZM8A 1WE4A 3IF6B 1XGJA 1FSYA 2FFYA 3NDGA 3PAEA 1YLYA 3E2KA 4MBHA 1K56D 2XDMA 1SKFA 5EOOA 5A93A 2H0YA 1Z6FA 3HUNA 1NZOA 4Q8IA 2WGIA 4IBRA 2XD5A 3A3DA 5M18A 1L0GA 4R1GA 1EROA 3NC8A 4N92A 4R4RA 4MLLA 4N9LA 5GHZA 1H8ZA 5GHYA 2PU2A 4RVAA 1BLSA 1MKIA 3HLFA 5FI7A 5DVAA 5FA7A 4P85A 2ZC3B 5AQBA 5CERA 4P0MA 1LLBA 1FQGA 5DTKA 1I5QA 5TGFA 2IWDA 3TG9A 4KZAA 3Q7VB 2EX6A 2WGWB 2Q9NA 4DE1A 2XGNA 4D2OA 2WKEA 1BULA 1RP5A 2Y2OA 4EBPA 3FKWA 1ES2A 4EBLA 1YLZA 4MEZA 1RGYA 1JVJA 3B3XA 3CZDA 5AQ7A 3A3IA 5DF9A 2QZ6A 2P9VA 5FQMA 3SH9A 3WWXA 2V1ZA 2V2FF 4O7DA 1E3UD 4OQHA 2WUQA 3FYZA 2CC1A 5FAOA 3G2ZA 4S2JA 2WADA 4WZ4A 3NCKA 4UAAA 3HLBA 3G2YA 2OLUA 4E3NA 1C3BA 4OVDA 3WS1A 5F82A 1KE0A 1ZKJA 4ID4A 1ERQA 5M1AA 5FATA 4R3BA 2Y2QA 4U0TA 5AQAA 1PW8A 2X01A 3RJUA 3GRJA 5EOEA 2QMIA 5CHMA 1Q2QA 3N7WA 3FWLA 4UA7A 4XUZA 4YINA 4FH4A 4QHCA 3A3JA 1K6SA 3IXDA 2EX8A 3MBZA 4NK3A 5E2GA 4QB8A 4K0WA 2EX9A 2XK1A 3W4QA 3ZVTA 2EXAA 4JF4A 4FCFA 2GDNA 3UDFA 5EVIA 2WKHA 5GLCA 1HD8A 2JBFA 3PBSA 3CMZA 3ZG7B 1O7EA 2HDSA 4S2PA 3ZNTA 1QMFA 4E6XA 4S2MA 4LV2A 1NY0A 1YT4A 4QJGA 1KDWA 3GSGA 2BG1A 2WAFA 4PPRA 3IWIA 1XXMA 4R0QA 2Y91A 4U0XA 3BFDA 1M6KA 2Y2MA 4M3KA 1E4DA 4DKIA 2ZQAA 4LCLA 3Q07A 1S6RA 1K54A 2ZD8A 2ZC6B 3RXXA 3ZGAB 2XR0A 3BM6A 4ZJ2A 4OOYA 2J8YA 1ZC2A 5HAQA 3G31A 3ZHHA 1IYPA 2P9VB 3BEBA 3M6BA 4WMCA 4GB7A 4X68A 1VM1A 1IKIA 2WK0A 2XQZA 3N6IA 1W5DA 1DJAA 3BFCA 3NBLA 1K57C 4C6YA 3WRTA 4NETA 4GZBA 1G68A 1ONHA 4S2OA 4DE0A 1L0EA 3BYDA 3DTMA 3UDXA 1O07A 3VMAA 4EV4A 4OPZA 1VQQA 5FQIA 3IH8A 1IEMA 4OLDA 3VFHA 1IKGA 4P6BA 3ZFZA 4IBXA 4PM9A 4R4SA 1LL5A 4UA9A 4R3JA 4B4ZA 4S2KA 4DXCA 2HP9A 1PW1A 2R9WA 3C5AA 3D4FA 2ZLYA 5CHJA 3IF5A 4GDNA 4OOLA 1W8QA 1L0FA 4JXSA 1LI9A 2XH9A 1YM1A 4HBUA 1ZG4A 1YQSA 5EUAA 1JWPA 2HDRA 2EFUA 1NRFA 3PBQA 4GDBA 2X02A 5AQ9A 5FAQA 3ZCZA 1BZAA 3P98A 3BFGA 5EVIB 1KE4A 3ISGA 3OCNA 2OLVA 3HBRA 4OLGA 3VFFA 3UE1A 5CGXA 5IHVA 1ALQA 4UA6A 3SH7A 4FSFA 1W8YA 4F94A 1NXYA 4Y0TA 3UDIA 1IYOA 2ZC4B 4LCMA 5HARA 5M19A 5F83A 3UPPA 2ZQ7A 2J7VA 4CPKA 2ZM2A 3LY4A 3WS4A 4KZ7A 5EPHA 1PI5A 3GVBA 1IYQA 1N9BA 3PTEA 4DE2A 4H8RA
chains in the Genus database with same CATH superfamily
4OPYA 3EEAA 5I5LA 2C6WB 5FQQA 3M2KA 5FI6A 4DE3A 1BTLA 4OONA 1P9WA 2I72A 1WA9A 1K55C 2ZQDA 3HUOA 4Y0OA 4F3LB 5FQKA 4PM6A 1HZOA 5CTNA 1GHMA 1ES3A 4RX2A 2QYBA 2Z2MB 1XJ2A 1JWZA 1U60A 4BBUA 1H3QA 3DWZA 4QY5A 2W1RA 3UE0A 5CTMA 3LIAA 1GHPA 3PBRA 4FUWA 4ZDXA 2K31A 4GCZA 3IS2A 1I2WA 2R78A 5FEGA 3PAGA 4HH3A 5L8MA 1Y4OA 2A49A 1SDNA 1Q2PA 4HIAA 4CLCD 3V3SA 4LENA 3HJIA 4GD6A 3VP0A 4HQAA 4EERA 3MKFA 4Y0UA 5DF8A 2R9XA 3RFBA 3MKEA 4DXBA 1XA7A 2J3TD 3TE8A 4YFMA 3O88A 4EW7A 1FCNA 3NECA 2O9AA 4XT2B 3WS2A 2PD7A 1SHVA 2XROA 1X0OA 4U3TA 2NUTC 4WM9A 4JBFA 5C5KA 3VOZA 5JYOA 5F1GA 2EX2A 1BLHA 2Y2NA 1TDGA 1L0DA 3LI9A 4B4XA 2XF3A 5HWWA 1CEGA 2ZM0A 4S2NA 2IWBA 1YMSA 3WRZA 3ITAA 1K25A 1G6OA 1YKDA 5L09A 3TOIA 1XPBA 1QMEA 2HP5A 4DDSA 1CJFA 4BD0A 5EE8A 5DTSA 3ZG0A 2W3HA 2VZWA 4I3JA 3PXPA 2PHYA 4HOIA 1KVLA 5BOHA 4ETXA 3CHWP 4KUKA 3EWKA 4LV1A 5IS1A 4G3KA 2DMWA 3VP3A 4WMCD 3PR6A 1DRMA 4C3QA 3T12B 3IQAA 3G34A 4X56A 2KX6A 5U47A 4PAUA 3N8SA 2G2WA 3ITBA 3D9YA 3C7UA 1SKOB 3OPHA 3O5YA 3EQUA 4I39A 4LPZA 4RX3A 4E3KA 5GLAA 4OKPA 3KYQA 3MZEA 1GA9A 1JWVA 2Y2KA 4M4XA 2ZC7A 4IUHA 4UQIM 4FOFA 4JF5A 5HDCA 2ZMAA 5CXWA 3A0RA 5CX7A 4WN5A 3FG8A 4KZ4A 1TDLA 4Q0JA 2Y55A 1OJ5A 4GD8A 4E04A 1HVBA 5F6AA 4R3AA 2RCXA 3D72A 3IF6A 4WL9A 1Y28A 2VKSA 2KLIA 5DKKA 4C75A 3R4KA 2K7SA 2B95A 2G2UA 1N4OA 1CEFA 4WBGA 4LRXC 4MN6A 1CI8A 3BLMA 5GLDA 3BJNA 2WGWA 2P08A 1NJ4A 5EVIC 3V50A 1VEUA 1EW0A 4XXRA 3NY4A 3MFXA 1MBLA 3C7VA 4ZRRA 1H8YA 2JN7A 2W0NA 4UHUA 2NUPC 5FDSA 1ZHHB 4XUXA 4MBKA 5CECA 2AVXA 2JKRM 4JXWA 1K54C 2JC7A 3GMWA 3P7NA 5D3OA 2Y2IA 2QPNA 3HLEA 2RL3A 3UPNA 3TJZC 3LI8A 3QNBA 2HV1A 3OBFA 2E8JA 3PAEA 3MSHA 2XDMA 1SKFA 3HUNA 2WGIA 3CUEA 5HPIA 4R1GA 1FIKA 2YKFA 3UB8A 4RVAA 4JGQA 3FPVA 5DVAA 4GS9A 1VB6A 1YSQA 1I5QA 2W1TA 2EX6A 4DE1A 3VE4A 2WKEA 2L1MA 4HNBA 2Y2OA 3FKWA 1ES2A 2M1CA 1RGYA 3B3XA 2WUQA 4S2JA 2WADA 2V8CA 4UAAA 3H7WA 1C3BA 2JKGA 3WS1A 3H82A 2M7UA 4PKYG 3A0VA 1ZKJA 1A0KA 2QJ7A 5AQAA 4U0TA 4GHIA 5EOEA 5CHMA 5TBMA 3FWLA 3A3JA 5AVFA 2EX8A 2EX9A 2L0WA 3ZVTA 2EXAA 4FCFA 3PBSA 3ZG7B 1O7EA 1XXMA 2OAQ1 3MQOA 4LRYC 2QJ5A 2PAVP 5KIZA 4DKIA 2ZQAA 4LCLA 1UWNX 3RXXA 3S7PA 2ZC6B 1VETB 3ZGAB 1MZUA 3BM6A 1XJ3A 4ZJ2A 5HAQA 1IKIA 1XJ6A 1W5DA 1K57C 4UQIS 4DMZA 3BYDA 3UDXA 3VMAA 1VQQA 5FQIA 3EGDC 4F3LA 3DTEA 3VFHA 2G7UA 2HP9A 2MJ6A 3C5AA 5CHJA 4OOLA 4I3AA 5EUAA 1JWPA 2HDRA 1NRFA 2X02A 3B47A 3A0SA 2PDRA 1ALQA 4UA6A 1NXYA 5HARA 2ZC4B 5F83A 4NEED 1UGUA 2ZQ7A 3GVBA 3PTEA 2INWA 4H8RA 3CWFA 3SH8A 1STZA 2XRNA 4MNRA 4X69A 2H10A 5CGSA 1YSPA 2XFSA 5CEDA 4Y7PA 1P9RA 3UN7A 5FASA 2WGVA 1S1ZA 2B5RA 3ZDJA 3GTCA 5FSRA 2ZJ9A 4XT2A 4HBTA 3E4OA 5TJJA 2VEAA 1GCEA 2V1BA 3BWLA 1OT9A 1PNEA 2O99A 2Z6CA 1YLJA 1JNUA 1KGEA 5HWVA 3P09A 3KO6A 2XLNA 3MZDA 3M6HA 3UE3A 3HREA 3ZQ5A 1F98A 1HLUP 3ZG9B 3CUEC 4PKYA 1WYCA 4LLOB 2GZAA 1ACFA 3LY3A 2JCHA 1GSWA 4S2IA 1P0ZA 4JXGA 3NIAA 4GN2A 3BQ8A 2HZ5A 2V0WA 1Z09A 3FV7A 4RA7A 3KSGA 4ZJ3A 4O01A 5KSHA 5GL9A 1KGGA 3HUMA 5GHXA 4BD1A 4KQRA 4EETB 5HDDA 3KSFA 2JKFA 3CJMA 2P74A 3C4PA 3DTIA 1T19A 3A3FA 3Q1FA 3AGFA 4ZJ1A 4OOMA 5DFYA 4R38A 1XGIA 2EWVA 2PR6A 4K0XA 1MY8A 1SKOA 3T4KA 1T1CA 2BTFP 4LGWA 3T50A 2ZOIA 3IT9A 3CI6A 3BRMA 4NKPA 1KE3A 2WAEA 4QD4A 4Y5FA 5GLBA 4BENA 2OWHA 4PHTA 3T4TA 4ZBEA 3UO9A 2BLSA 3MXQA 2ZQ8A 5FEFA 4KZ9A 4WZ5A 4EBNA 2V0UA 3L7HA 1BYWA 2Y59A 1LI0A 5E2FA 3GECA 3AGDA 5EECA 3V39A 3T1XA 3DW0A 2EWWA 4K08A 1PWDA 4KG5A 3K2NA 2QHKA 2W3FA 4HJ4A 2HPBA 4FTXA 1NLZA 4OP8A 1PI4A 2H5SA 1ESIA 4GW9A 3LR4A 4O8GA 1NYYA 1DJCA 3IXGA 3OLOA 4IVKA 3TW8A 2IA2A 4Y3IA 3IWOA 4Z9QA 4IEDA 3O86A 1ESUA 4CJNA 4CLCC 4LRZE 5KZHA 4CLCE 3O87A 4A5RA 4LV0A 4KG6A 3DAVA 1LL8A 4KZ3A 3MFDA 1T18A 1L3LA 5E2EA 3CAXA 2O9BA 1EI5A 1LL9A 2WKRA 3MZFA 1ZTUA 2J3TC 5F69A 3MR0A 5KSCA 3OPRA 3HLCA 1YLWA 4KZBA 4HP4A 3JVVA 3OCLA 1T1BA 3BY9A 1NWZA 1S4RA 3W2ZA 2VGKA 2DCFA 1K4FA 1DY6A 4HH2A 2KOIA 3BFEA 3FZCA 3SOIA 1K6RA 4HEFA 1AXBA 4S2LA 3LYXA 3W4PA 2VX8A 4ME4A 4EXOA 5HD3A 4R70A 4RYEA 1NYMA 4GLQA 1XA1A 4JGRA 5HPFA 4ZTKA 3ZG5A 5HL1A 4MCWA 3G32A 4EESA 3PBNA 3UY6A 4IVIA 1SCWA 2O0YA 1NLYA 3GR2A 2HDUA 3G6OA 4DJ3A 3NDEA 2V20A 1Y54A 4X6TA 3LCEA 3VP4A 1J9MA 4BBTA 1FSYA 3NDGA 3E2KA 1G5UA 5EOOA 5A93A 4RQ9A 4Q8IA 3A3DA 4ARZB 3NC8A 3JPUA 5IU1A 1H8ZA 2OWJA 1MKIA 4P85A 5DTKA 1FQGA 3KYZA 3Q7VB 2Q9NA 4D2OA 1PRQA 3T1RA 4EBPA 1VETA 4MN7A 4G3WA 4AFIA 4EBLA 4MEZA 1JVJA 4II7A 3MS6A 2QZ6A 4HJ3A 3SH9A 3WWXA 3FYZA 1XFQA 2CC1A 3G2ZA 4GJ4A 3UMEA 2HJEA 4WZ4A 2OLUA 4B93A 4OVDA 1KE0A 5M1AA 4R3BA 2VLGA 2Y2QA 2X01A 1PW8A 3GRJA 3DTKA 1Q2QA 4YINA 4FH4A 1K6SA 3IXDA 4Q0HA 1D06A 2JBFA 2PRFA 1KOUA 4BBVA 3ZNTA 1QMFA 3LIEA 4S2MA 1YT4A 1KDWA 3GSGA 2BG1A 2WAFA 4PPRA 3IWIA 5F68A 1TS7A 4U0XA 1E4DA 2HGVA 1MC0A 3Q07A 3IX8A 2J8YA 1ZC2A 4L9GA 3ZHHA 2P9VB 1OPXA 5IT5A 4Y17A 4X68A 4YWZA 1VM1A 2WK0A 2XQZA 2PD8A 3BFCA 4HI4A 2GJ3A 4D60A 4S2OA 1ONHA 1O07A 3E4PA 1IEMA 2JKRI 3UB6A 1OTBA 2ZLYA 3IF5A 4R6LA 3MF0A 1YM1A 2EFUA 3PBQA 4GDBA 3ZCZA 1BZAA 3QP4A 4MMNA 3BFGA 5EVIB 3ISGA 3OCNA 3HBRA 3UE1A 5IHVA 3SH7A 4F94A 4LCMA 1K0KA 1MKMA 5M19A 3UPPA 3C38A 3LR0A 2W3GA 1LSXA 2QKPA 1IYQA 3F1PB 3KX0X 4BL2A 2PYPA 1XP4A 1GA0A 1CK3A 4NXBA 3U2AA 2WZXA 4LFUA 4S2NC 2L4RA 5TFQA 1RCJA 1IOUA 3WS0A 4NXEA 1XFNA 3BFFA 2UV0E 3KSIA 1H5XA 2EFXA 4K91A 5DFXA 1DJBA 1MPLA 1CI9A 4X25A 2PYRA 5I94A 2UWXA 3T1QB 5HAPA 3F1OB 2C5WB 4R23A 3S22A 5FAPA 3R7WB 3VV4A 4ETZA 2E8IA 3MXSA 3UNWA 5HAIA 1FCOA 3TSGA 3C4OA 4JF6A 2V8FA 3LEQA 3LFVA 5EVLA 4OP5A 1UWPX 5HFOA 3LR3A 2Y2HA 4G3VA 4E3LA 4KZ8A 5EM1A 2ZBBA 3IH9A 4WELA 5G18A 1L2SA 2J3WA 2JE5A 4I5SA 1GSVA 4X55A 2W27A 5DJUA 1K56A 5KMWA 1KGFA 3V5MA 2WYXA 4QY6A 4BJPA 3OZHA 3SS4A 4E3JA 2Y2JA 1EWZA 3UB5P 2XA7M 4EU0A 5CGWA 3L9KA 4BL3A 1FILA 3H9WA 4WEJA 3QP8A 1BT5A 2XSSA 3GQZA 1M40A 2V9AA 2VV8A 2WKQA 4OQIA 3TRCA 2FZ0A 4EUVA 1KVMA 1ZG6A 3IF6C 3QNCA 2ZMFA 1K55A 1E3UA 3LIFA 4I3IA 4OH0A 2WZZA 3RXWA 4L0LA 2Q0OA 4KZ6A 1D1JA 2HJ9C 4B88A 3MQQA 3SS3A 1H8MA 3FC7A 1W79A 4DDYA 3ZVWA 3IBRA 5F5YA 5HD5A 2ACGA 2VV7A 2P7JA 3OPPA 3E0YA 1BUEA 3PHYA 1W7FA 3NI9A 1BSGA 3E2LA 1I2SA 4IHQA 3IHBA 3UPOA 4NXGA 3CG5A 4L9FA 3BY8A 1NRJA 2ZC5B 2OAP1 3FKVA 1XKZA 2Y8HA 2VV6A 2XD1A 5HWTA 4EEPA 2EA9A 3OPLA 3DWKA 2Y4AA 2Y2PA 1YLTA 5JYPA 3Q82A 5FDHA 3VP2A 5L2FA 1N9OA 3HLGA 2ZQ9A 3EQVA 4GOGA 1PYYA 5HSQA 1E25A 4EUZA 3OC2A 4EQIA 4OPRA 3E4QA 3LUQA 4EEUA 1TS6A 3AGEA 1S0WA 4LV3A 3BECA 3MMHA 4X1MA 4HJ6A 1OJGA 1TS8A 2H0TA 2JHEA 3O3VA 1BLPA 4WEKA 3P01A 1JTDA 1PIOA 3A3EA 3SS5A 2PBDP 1IYSA 1ONGA 3IBJA 4UEYA 1V9ZA 3VE3A 3ZG8B 4ARZA 3BQAA 3MXRA 4GKUA 4JLFA 2FFFB 3DBAA 1FSWA 5AVEA 4X53A 4P87A 4DN0A 4PM7A 1TEMA 3Q7VA 3SZTA 5K5BA 2Z2LB 2ZL1B 4DRTA 1TD5A 5FI2A 3HCYA 4JXVA 2HP6A 1MWTA 2J9OA 5F1FA 4HY8A 4KQQA 3V3RA 1FR1A 2B02A 2ZMVA 5HDSA 4H6JB 4WLAA 4MN5A 1YMXA 3CLOA 1T1AA 2A24B 4QU3A 5HL6A 5MC7A 1D7EA 2ZM8A 1WE4A 1XGJA 2FFYA 1K56D 2JKTM 2H0YA 2XA7S 2KDKA 5M18A 2XD5A 4B9OA 1L0GA 4N92A 4MLLA 1TF1A 2M7VA 1OTDA 1DP9A 2PT7A 1BLSA 3EOIA 5FI7A 2ZC3B 5CERA 1LLBA 5G4YA 5TGFA 2IWDA 3SW1A 1RP5A 1YLZA 2O9CA 3CZDA 3QP2A 3A3IA 2P9VA 5FQMA 2V1ZA 4O7DA 1E3UD 4OQHA 5FAOA 4P6ZM 1ERQA 2YKHA 4WF0A 4CLCB 2QMIA 4UA7A 4XUZA 4NK3A 4K0WA 2CMNA 4JF4A 3UDFA 2GDNA 5EVIA 2WKHA 5GLCA 4S2PA 5L07A 3F1NB 4E6XA 1NY0A 4MDZA 3IX4A 3UB7A 2W3DA 4NXFA 3BFDA 2Y2MA 4M3KA 1W63M 3F1PA 1S6RA 1K54A 2J80A 2XR0A 4IJGA 3IX3A 4OOYA 1S66L 3T4QA 3G31A 1IYPA 3M6BA 4GB7A 3PYPA 3N6IA 1DJAA 3NBLA 3BW6A 3LICA 4C6YA 3WRTA 2GX5A 1CQAA 5FL3A 3UE6A 4EV4A 4OPZA 4P6BA 4IBXA 4PM9A 4B4ZA 1LL5A 4DXCA 4R3JA 2HF6A 1PW1A 2H28A 1W8QA 5L10A 2XH9A 1ZG4A 3F1OA 1YQSA 4HP9A 3R7WA 2WKPA 3QP1A 3VFFA 2OLVA 3C2WA 4FSFA 3UDIA 4NG2A 2J7VA 2ZM2A 3LY4A 3WS4A 5EPHA 1PI5A 3K3DA 1N9BA 4DE2A 3WS5A 4Y2FA 3W8KA 3N8RA 3LIDA 4N1HA 3LO7A 3GV9A 1SDEA 4YNRA 3HLWA 3NOUC 2Y79A 5EVEA 3T4OA 3VSLA 4JPMA 1OTIA 3IXBA 4Z1WA 3N4IA 1K38A 4JGPA 4WUJA 4QWOA 1S67L 4BMWA 2VJWA 2X71A 5J4EA 1RGZA 1PWCA 5A91A 2XEPA 4WZ5C 3W4OA 1KDSA 5DJTA 3U4LP 5EFWA 1GHIA 2OSUA 4KENB 3CPTB 3S7OA 3QP6A 4KUOA 2DRWA 5TR7A 1PWGA 4E3MA 1ES5A 1FOFA 1K57A 4Y13A 1G6AA 5DF7A 1IELA 3B42A 3BLSA 1DP6A 1XJ4A 1PZPA 2OOLA 1P97A 1N9LA 2VGLM 2K2NA 3HVFA 2A2LA 1GSXA 4KQDA 4HESA 4OPQA 2D01A 4ESPA 1MXOA 5A90A 1TS0A 2Q9MA 4OQ0A 2A3UA 5FQJA 2Y2GA 3Q7ZA 4YOFA 5CEBA 5DTTA 1H0MA 5LBRA 1S4SA 1FR6A 4PM5A 3IS2B 4P6ZS 5DKLA 3IHAA 1IFQA 3NOPC 4ZAMA 3S7NA 3T4JA 5J8XA 3QHYA 3V67A 4KG2A 3NOTC 1HTZA 4Y15A 3EEHA 3JYIA 5EM0A 5HX9A 1MWRA 5EVID 5A8BA 4MBFA 4EWFA 3I7JA 1FCMA 5E2HA 2B18A 3G4PA 3KSHA 1J3WA 1YLPA 2V1AA 2DNSA 3M2JA 5J7EA 4BLMA 2GNXA 2OV5A 3S4XA 4OQGA 1BLCA 4E3IA 1ERMA 1JTGA 2HDQA 1YPRA 1DP8A 2IWCA 1TVFA 2P04A 4N1XA 2W3EA 3LR5A 4FH2A 1MWSA 5A92A 2PU4A 3VP1A 2ZQCA 4E3OA 4BWIA 3G30A 3VOYA 1K4EA 2BASA 1OT6A 3VOLA 4EQ1A 1MWUA 3KYEA 1N9NA 1CF0A 4BQMA 2J9PA 4L9EA 2I9VA 5FQ9A 3T4SA 1ES4A 1YAXA 1LHYA 2ZL1A 5E43A 4FD8A 4DF6A 3HL9A 2EXBA 3HLDA 5AJGA 3N8LA 2VGJA 1WYBA 2XFTA 2Y2LA 4H6JA 3LEZA 3NHQA 1OTEA 2A24A 3B33A 1SZVA 3IWQA 2D02A 4KQOA 3PBTA 3NULA 3QP5A 4DJ2A 4PMAA 2ZOHA 2WKIA 3ZNYA 4JKTA 3Q81A 2Z6DA 1NZUA 3C8CA 5CRFA 3ZYTA 3OOVA 5CHUA 3K3CA 5HZHA 4X1LA 3E98A 4PM8A 4KZ5A 4GNUA 3IXHA 1XX2A 1PZOA 1OMEA 3G35A 1OTAA 4E6WA 4WYYA 2LB5A 2FH5A 2VGLS 3PBOA 4N9KA 3VSKA 3FPWA 3S1YA 5HW3A 2PBYA 3IF6B 3EGXC 5J3WA 4CLCA 1YLYA 1LSWA 3RH8B 4MBHA 4HHDA 1Z6FA 1NZOA 4IBRA 3T4LA 1EROA 4R4RA 1G28A 4N9LA 5GHZA 5GHYA 2PU2A 1F5MA 3HLFA 3F1NA 1LSVA 5FA7A 5AQBA 4P0MA 1AWIA 3TG9A 4KZAA 2WGWB 2VK3A 2XGNA 1BULA 4QPRA 1VEUB 5AQ7A 5DF9A 1LT0A 3UB9A 3S7QA 2V2FF 4CQHA 3D3OA 3NCKA 3HLBA 3G2YA 4E3NA 3NJAA 5F82A 4ID4A 5FATA 3UMDA 3RJUA 3N7WA 4QHCA 3MBZA 5E2GA 4QB8A 3W4QA 2XK1A 1HD8A 3CMZA 3LGOA 4Q0IA 2HDSA 2LB9A 3MQ0A 4LV2A 4O0PA 4GS9B 5EV0A 3JVUA 4QJGA 2VA0A 2W1TB 4R0QA 4JGOA 2Y91A 1M6KA 3T1SA 2ZD8A 3BEBA 1W63Q 4WMCA 3MJQA 4IUKA 1PFLA 4NETA 4GZBA 1G68A 4DE0A 1L0EA 3H7WB 3DTMA 5G4ZA 3IH8A 3H82B 3ZFZA 4OLDA 1F2KA 1IKGA 4UA9A 4R4SA 3HJKA 4S2KA 3CITA 2R9WA 3D4FA 4GDNA 1L0FA 4JXSA 1ODVA 4GHIB 1LI9A 5TBMB 4HBUA 3GDIA 5FAQA 5AQ9A 3ULFA 3P98A 4I38A 2JKTI 3RTYA 1KE4A 4OLGA 1VHMA 3LIBA 5CGXA 4Y0TA 1W8YA 1IYOA 1S1YA 1F9IA 3CPTA 4CPKA 2PR5A 2QWSA 4KZ7A 3C30A 1V9YA 3ICYA
chains in the Genus database with same CATH topology
3WS5A 4OPYA 4BL2A 3W8KA 3N8RA 3SH8A 2C6WB 5FQQA 3M2KA 5FI6A 1XP4A 1GA0A 4N1HA 4DE3A 3LO7A 4MNRA 3GV9A 1SDEA 1BTLA 4OONA 4X69A 2H10A 1CK3A 5CGSA 2I72A 2XFSA 5CEDA 2WZXA 3HLWA 4Y7PA 4S2NC 5TFQA 1K55C 3UN7A 1RCJA 5FASA 2WGVA 3VSLA 3WS0A 2ZQDA 2B5RA 3BFFA 4JPMA 3HUOA 3ZDJA 4Y0OA 3IXBA 3GTCA 5FSRA 1H5XA 2ZJ9A 2EFXA 4HBTA 4PM6A 4K91A 5FQKA 1HZOA 5CTNA 1DJBA 3N4IA 1K38A 1GHMA 1ES3A 1MPLA 4RX2A 1CI9A 2Z2MB 1GCEA 1JWZA 5I94A 1U60A 2UWXA 3DWZA 4QY5A 5HAPA 3UE0A 5CTMA 1YLJA 2X71A 1KGEA 2C5WB 4R23A 3S22A 1GHPA 3P09A 3PBRA 1RGZA 5FAPA 1PWCA 5A91A 2XEPA 4ZDXA 4WZ5C 2XLNA 2E8IA 3MXSA 3MZDA 3M6HA 3UE3A 3HREA 3UNWA 3W4OA 5HAIA 1I2WA 1KDSA 1FCOA 3TSGA 3PAGA 3ZG9B 3C4OA 4JF6A 1GHIA 2A49A 2OSUA 4KENB 1SDNA 1Q2PA 2DRWA 5EVLA 5TR7A 1PWGA 4OP5A 1WYCA 4LENA 3V3SA 5HFOA 4E3MA 1ES5A 1FOFA 1K57A 1G6AA 4GD6A 5DF7A 3LY3A 1IELA 2Y2HA 2JCHA 3VP0A 4E3LA 4S2IA 4KZ8A 3BLSA 3MKFA 4Y0UA 3IH9A 4WELA 1PZPA 5DF8A 5G18A 4JXGA 2R9XA 3NIAA 3MKEA 1L2SA 3HVFA 4DXBA 2JE5A 1XA7A 4X55A 4GN2A 4HESA 4OPQA 4YFMA 3O88A 1FCNA 3FV7A 1MXOA 5A90A 4RA7A 1K56A 4ZJ3A 5KMWA 1KGFA 5KSHA 3V5MA 2Q9MA 2WYXA 3WS2A 4OQ0A 4QY6A 5GL9A 2A3UA 1SHVA 4BJPA 3OZHA 5FQJA 1KGGA 3SS4A 2Y2JA 4U3TA 2Y2GA 4E3JA 1EWZA 3Q7ZA 3HUMA 5CEBA 4WM9A 5DTTA 4JBFA 5GHXA 5CGWA 4BD1A 4KQRA 3VOZA 3CJMA 5JYOA 2P74A 1FR6A 3C4PA 5F1GA 4PM5A 4BL3A 3A3FA 2EX2A 3Q1FA 1BLHA 3AGFA 3IHAA 2Y2NA 4OOMA 4ZJ1A 4WEJA 1XGIA 1TDGA 1BT5A 3GQZA 1M40A 4OQIA 4K0XA 1L0DA 1MY8A 4ZAMA 2XF3A 4B4XA 1CEGA 1KVMA 5J8XA 1ZG6A 3IF6C 2ZM0A 3QHYA 3QNCA 4KG2A 4S2NA 1K55A 1HTZA 1E3UA 2IWBA 1YMSA 3JYIA 3WRZA 3ITAA 4OH0A 1K25A 5HX9A 1MWRA 2WZZA 3IT9A 3BRMA 1KE3A 2WAEA 5EVID 3RXWA 4QD4A 4L0LA 3TOIA 1XPBA 4MBFA 4KZ6A 1QMEA 1FCMA 2HP5A 3I7JA 5E2HA 5GLBA 4BENA 4DDSA 4EWFA 4B88A 4BD0A 3G4PA 3SS3A 5EE8A 5DTSA 1W79A 4DDYA 3ZG0A 4ZBEA 3UO9A 2BLSA 3ZVWA 2ZQ8A 1YLPA 2DNSA 4KZ9A 3M2JA 1KVLA 5BOHA 4WZ5A 4EBNA 4BLMA 3OPPA 2OV5A 1BUEA 2Y59A 1W7FA 3NI9A 1BSGA 1LI0A 3E2LA 4LV1A 5E2FA 3S4XA 3AGDA 5EECA 3V39A 3VP3A 1I2SA 3DW0A 1BLCA 4OQGA 4E3IA 1ERMA 4WMCD 1JTGA 4C3QA 1PWDA 2HDQA 3IHBA 3UPOA 4KG5A 3IQAA 3G34A 3CG5A 2HPBA 2IWCA 4OP8A 4X56A 5U47A 1TVFA 1PI4A 2H5SA 1ESIA 4N1XA 1NYYA 2ZC5B 2G2WA 3N8SA 1DJCA 4FH2A 3IXGA 3ITBA 4IVKA 1MWSA 3FKVA 1XKZA 5A92A 2PU4A 3IWOA 3C7UA 3OPHA 4Z9QA 4IEDA 3VP1A 3EQUA 3O86A 2XD1A 4E3KA 4RX3A 5GLAA 2ZQCA 4E3OA 1ESUA 4OKPA 4CJNA 3OPLA 3G30A 3DWKA 2Y4AA 2Y2PA 1YLTA 3VOYA 5KZHA 3MZEA 5JYPA 1K4EA 1GA9A 1JWVA 3O87A 3Q82A 5FDHA 3VP2A 5L2FA 3HLGA 1MWUA 2ZQ9A 3EQVA 1PYYA 2Y2KA 4GOGA 4A5RA 4BQMA 2J9PA 4LV0A 1E25A 4KG6A 4EUZA 2ZC7A 3OC2A 4EQIA 4OPRA 4KZ3A 5FQ9A 3MFDA 1ES4A 1LHYA 5E43A 4JF5A 5E2EA 4FD8A 4DF6A 1EI5A 3HL9A 2ZMAA 1LL9A 5CXWA 3MZFA 2EXBA 3HLDA 3AGEA 3N8LA 1S0WA 4LV3A 3BECA 5KSCA 3OPRA 3HLCA 1YLWA 4KZBA 1TDLA 4KZ4A 2VGJA 2Y55A 3OCLA 4GD8A 1HVBA 1WYBA 2XFTA 2Y2LA 2VGKA 2H0TA 2DCFA 3LEZA 3O3VA 2RCXA 1BLPA 4WEKA 3IWQA 3IF6A 1K4FA 1JTDA 1PIOA 1DY6A 3A3EA 3SS5A 4KQOA 1IYSA 3BFEA 1ONGA 3PBTA 4C75A 3FZCA 3SOIA 1K6RA 4PMAA 4HEFA 1AXBA 2WKIA 4S2LA 3ZG8B 2G2UA 3ZNYA 3MXRA 1N4OA 1CEFA 4JKTA 3W4PA 4GKUA 4JLFA 2FFFB 1FSWA 4RYEA 1NYMA 3Q81A 4WBGA 1NZUA 4X53A 1XA1A 4P87A 1CI8A 5CRFA 3BLMA 4PM7A 5CHUA 4ZTKA 1TEMA 5GLDA 3ZG5A 5HL1A 3Q7VA 2WGWA 4PM8A 4KZ5A 4GNUA 1NJ4A 3IXHA 5EVIC 3V50A 1XX2A 2Z2LB 4XXRA 1PZOA 3G32A 3NY4A 4DRTA 1OMEA 1MBLA 3C7VA 5FI2A 1H8YA 3G35A 3PBNA 3UY6A 4UHUA 4JXVA 2HP6A 1MWTA 2J9OA 4IVIA 4E6WA 4WYYA 5F1FA 4KQQA 4XUXA 1SCWA 4MBKA 3V3RA 1FR1A 5CECA 3PBOA 3GR2A 4N9KA 2HDUA 4JXWA 3NDEA 3VSKA 2V20A 1K54C 2JC7A 3GMWA 1Y54A 5D3OA 2Y2IA 2QPNA 3HLEA 3S1YA 2RL3A 3UPNA 4X6TA 1YMXA 3LCEA 3QNBA 4QU3A 1J9MA 3VP4A 5HW3A 2PBYA 2ZM8A 1WE4A 3IF6B 1XGJA 1FSYA 2FFYA 3NDGA 3PAEA 1YLYA 3E2KA 4MBHA 1K56D 2XDMA 1SKFA 5EOOA 5A93A 2H0YA 1Z6FA 3HUNA 1NZOA 4Q8IA 2WGIA 4IBRA 2XD5A 3A3DA 5M18A 1L0GA 4R1GA 1EROA 3NC8A 4N92A 4R4RA 4MLLA 4N9LA 5GHZA 1H8ZA 5GHYA 2PU2A 4RVAA 1BLSA 1MKIA 3HLFA 5FI7A 5DVAA 5FA7A 4P85A 2ZC3B 5AQBA 5CERA 4P0MA 1LLBA 1FQGA 5DTKA 1I5QA 5TGFA 2IWDA 3TG9A 4KZAA 3Q7VB 2EX6A 2WGWB 2Q9NA 4DE1A 2XGNA 4D2OA 2WKEA 1BULA 1RP5A 2Y2OA 4EBPA 3FKWA 1ES2A 4EBLA 1YLZA 4MEZA 1RGYA 1JVJA 3B3XA 3CZDA 5AQ7A 3A3IA 5DF9A 2QZ6A 2P9VA 5FQMA 3SH9A 3WWXA 2V1ZA 2V2FF 4O7DA 1E3UD 4OQHA 2WUQA 3FYZA 2CC1A 5FAOA 3G2ZA 4S2JA 2WADA 4WZ4A 3NCKA 4UAAA 3HLBA 3G2YA 2OLUA 4E3NA 1C3BA 4OVDA 3WS1A 5F82A 1KE0A 1ZKJA 4ID4A 1ERQA 5M1AA 5FATA 4R3BA 2Y2QA 4U0TA 5AQAA 1PW8A 2X01A 3RJUA 3GRJA 5EOEA 2QMIA 5CHMA 1Q2QA 3N7WA 3FWLA 4UA7A 4XUZA 4YINA 4FH4A 4QHCA 3A3JA 1K6SA 3IXDA 2EX8A 3MBZA 4NK3A 5E2GA 4QB8A 4K0WA 2EX9A 2XK1A 3W4QA 3ZVTA 2EXAA 4JF4A 4FCFA 2GDNA 3UDFA 5EVIA 2WKHA 5GLCA 1HD8A 2JBFA 3PBSA 3CMZA 3ZG7B 1O7EA 2HDSA 4S2PA 3ZNTA 1QMFA 4E6XA 4S2MA 4LV2A 1NY0A 1YT4A 4QJGA 1KDWA 3GSGA 2BG1A 2WAFA 4PPRA 3IWIA 1XXMA 4R0QA 2Y91A 4U0XA 3BFDA 1M6KA 2Y2MA 4M3KA 1E4DA 4DKIA 2ZQAA 4LCLA 3Q07A 1S6RA 1K54A 2ZD8A 2ZC6B 3RXXA 3ZGAB 2XR0A 3BM6A 4ZJ2A 4OOYA 2J8YA 1ZC2A 5HAQA 3G31A 3ZHHA 1IYPA 2P9VB 3BEBA 3M6BA 4WMCA 4GB7A 4X68A 1VM1A 1IKIA 2WK0A 2XQZA 3N6IA 1W5DA 1DJAA 3BFCA 3NBLA 1K57C 4C6YA 3WRTA 4NETA 4GZBA 1G68A 1ONHA 4S2OA 4DE0A 1L0EA 3BYDA 3DTMA 3UDXA 1O07A 3VMAA 4EV4A 4OPZA 1VQQA 5FQIA 3IH8A 1IEMA 4OLDA 3VFHA 1IKGA 4P6BA 3ZFZA 4IBXA 4PM9A 4R4SA 1LL5A 4UA9A 4R3JA 4B4ZA 4S2KA 4DXCA 2HP9A 1PW1A 2R9WA 3C5AA 3D4FA 2ZLYA 5CHJA 3IF5A 4GDNA 4OOLA 1W8QA 1L0FA 4JXSA 1LI9A 2XH9A 1YM1A 4HBUA 1ZG4A 1YQSA 5EUAA 1JWPA 2HDRA 2EFUA 1NRFA 3PBQA 4GDBA 2X02A 5AQ9A 5FAQA 3ZCZA 1BZAA 3P98A 3BFGA 5EVIB 1KE4A 3ISGA 3OCNA 2OLVA 3HBRA 4OLGA 3VFFA 3UE1A 5CGXA 5IHVA 1ALQA 4UA6A 3SH7A 4FSFA 1W8YA 4F94A 1NXYA 4Y0TA 3UDIA 1IYOA 2ZC4B 4LCMA 5HARA 5M19A 5F83A 3UPPA 2ZQ7A 2J7VA 4CPKA 2ZM2A 3LY4A 3WS4A 4KZ7A 5EPHA 1PI5A 3GVBA 1IYQA 1N9BA 3PTEA 4DE2A 4H8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WS5 A;  4OPY A;  4BL2 A;  3W8K A;  3N8R A;  3SH8 A;  2C6W B;  5FQQ A;  3M2K A;  5FI6 A;  1XP4 A;  1GA0 A;  4N1H A;  4DE3 A;  3LO7 A;  4MNR A;  3GV9 A;  1SDE A;  1BTL A;  4OON A;  4X69 A;  2H10 A;  1CK3 A;  5CGS A;  2I72 A;  2XFS A;  5CED A;  2WZX A;  3HLW A;  4Y7P A;  4S2N C;  5TFQ A;  1K55 C;  3UN7 A;  1RCJ A;  5FAS A;  2WGV A;  3VSL A;  3WS0 A;  2ZQD A;  2B5R A;  3BFF A;  4JPM A;  3HUO A;  3ZDJ A;  4Y0O A;  3IXB A;  3GTC A;  5FSR A;  1H5X A;  2ZJ9 A;  2EFX A;  4HBT A;  4PM6 A;  4K91 A;  5FQK A;  1HZO A;  5CTN A;  1DJB A;  3N4I A;  1K38 A;  1GHM A;  1ES3 A;  1MPL A;  4RX2 A;  1CI9 A;  2Z2M B;  1GCE A;  1JWZ A;  5I94 A;  1U60 A;  2UWX A;  3DWZ A;  4QY5 A;  5HAP A;  3UE0 A;  5CTM A;  1YLJ A;  2X71 A;  1KGE A;  2C5W B;  4R23 A;  3S22 A;  1GHP A;  3P09 A;  3PBR A;  1RGZ A;  5FAP A;  1PWC A;  5A91 A;  2XEP A;  4ZDX A;  4WZ5 C;  2XLN A;  2E8I A;  3MXS A;  3MZD A;  3M6H A;  3UE3 A;  3HRE A;  3UNW A;  3W4O A;  5HAI A;  1I2W A;  1KDS A;  1FCO A;  3TSG A;  3PAG A;  3ZG9 B;  3C4O A;  4JF6 A;  1GHI A;  2A49 A;  2OSU A;  4KEN B;  1SDN A;  1Q2P A;  2DRW A;  5EVL A;  5TR7 A;  1PWG A;  4OP5 A;  1WYC A;  4LEN A;  3V3S A;  5HFO A;  4E3M A;  1ES5 A;  1FOF A;  1K57 A;  1G6A A;  4GD6 A;  5DF7 A;  3LY3 A;  1IEL A;  2Y2H A;  2JCH A;  3VP0 A;  4E3L A;  4S2I A;  4KZ8 A;  3BLS A;  3MKF A;  4Y0U A;  3IH9 A;  4WEL A;  1PZP A;  5DF8 A;  5G18 A;  4JXG A;  2R9X A;  3NIA A;  3MKE A;  1L2S A;  3HVF A;  4DXB A;  2JE5 A;  1XA7 A;  4X55 A;  4GN2 A;  4HES A;  4OPQ A;  4YFM A;  3O88 A;  1FCN A;  3FV7 A;  1MXO A;  5A90 A;  4RA7 A;  1K56 A;  4ZJ3 A;  5KMW A;  1KGF A;  5KSH A;  3V5M A;  2Q9M A;  2WYX A;  3WS2 A;  4OQ0 A;  4QY6 A;  5GL9 A;  2A3U A;  1SHV A;  4BJP A;  3OZH A;  5FQJ A;  1KGG A;  3SS4 A;  2Y2J A;  4U3T A;  2Y2G A;  4E3J A;  1EWZ A;  3Q7Z A;  3HUM A;  5CEB A;  4WM9 A;  5DTT A;  4JBF A;  5GHX A;  5CGW A;  4BD1 A;  4KQR A;  3VOZ A;  3CJM A;  5JYO A;  2P74 A;  1FR6 A;  3C4P A;  5F1G A;  4PM5 A;  4BL3 A;  3A3F A;  2EX2 A;  3Q1F A;  1BLH A;  3AGF A;  3IHA A;  2Y2N A;  4OOM A;  4ZJ1 A;  4WEJ A;  1XGI A;  1TDG A;  1BT5 A;  3GQZ A;  1M40 A;  4OQI A;  4K0X A;  1L0D A;  1MY8 A;  4ZAM A;  2XF3 A;  4B4X A;  1CEG A;  1KVM A;  5J8X A;  1ZG6 A;  3IF6 C;  2ZM0 A;  3QHY A;  3QNC A;  4KG2 A;  4S2N A;  1K55 A;  1HTZ A;  1E3U A;  2IWB A;  1YMS A;  3JYI A;  3WRZ A;  3ITA A;  4OH0 A;  1K25 A;  5HX9 A;  1MWR A;  2WZZ A;  3IT9 A;  3BRM A;  1KE3 A;  2WAE A;  5EVI D;  3RXW A;  4QD4 A;  4L0L A;  3TOI A;  1XPB A;  4MBF A;  4KZ6 A;  1QME A;  1FCM A;  2HP5 A;  3I7J A;  5E2H A;  5GLB A;  4BEN A;  4DDS A;  4EWF A;  4B88 A;  4BD0 A;  3G4P A;  3SS3 A;  5EE8 A;  5DTS A;  1W79 A;  4DDY A;  3ZG0 A;  4ZBE A;  3UO9 A;  2BLS A;  3ZVW A;  2ZQ8 A;  1YLP A;  2DNS A;  4KZ9 A;  3M2J A;  1KVL A;  5BOH A;  4WZ5 A;  4EBN A;  4BLM A;  3OPP A;  2OV5 A;  1BUE A;  2Y59 A;  1W7F A;  3NI9 A;  1BSG A;  1LI0 A;  3E2L A;  4LV1 A;  5E2F A;  3S4X A;  3AGD A;  5EEC A;  3V39 A;  3VP3 A;  1I2S A;  3DW0 A;  1BLC A;  4OQG A;  4E3I A;  1ERM A;  4WMC D;  1JTG A;  4C3Q A;  1PWD A;  2HDQ A;  3IHB A;  3UPO A;  4KG5 A;  3IQA A;  3G34 A;  3CG5 A;  2HPB A;  2IWC A;  4OP8 A;  4X56 A;  5U47 A;  1TVF A;  1PI4 A;  2H5S A;  1ESI A;  4N1X A;  1NYY A;  2ZC5 B;  2G2W A;  3N8S A;  1DJC A;  4FH2 A;  3IXG A;  3ITB A;  4IVK A;  1MWS A;  3FKV A;  1XKZ A;  5A92 A;  2PU4 A;  3IWO A;  3C7U A;  3OPH A;  4Z9Q A;  4IED A;  3VP1 A;  3EQU A;  3O86 A;  2XD1 A;  4E3K A;  4RX3 A;  5GLA A;  2ZQC A;  4E3O A;  1ESU A;  4OKP A;  4CJN A;  3OPL A;  3G30 A;  3DWK A;  2Y4A A;  2Y2P A;  1YLT A;  3VOY A;  5KZH A;  3MZE A;  5JYP A;  1K4E A;  1GA9 A;  1JWV A;  3O87 A;  3Q82 A;  5FDH A;  3VP2 A;  5L2F A;  3HLG A;  1MWU A;  2ZQ9 A;  3EQV A;  1PYY A;  2Y2K A;  4GOG A;  4A5R A;  4BQM A;  2J9P A;  4LV0 A;  1E25 A;  4KG6 A;  4EUZ A;  2ZC7 A;  3OC2 A;  4EQI A;  4OPR A;  4KZ3 A;  5FQ9 A;  3MFD A;  1ES4 A;  1LHY A;  5E43 A;  4JF5 A;  5E2E A;  4FD8 A;  4DF6 A;  1EI5 A;  3HL9 A;  2ZMA A;  1LL9 A;  5CXW A;  3MZF A;  2EXB A;  3HLD A;  3AGE A;  3N8L A;  1S0W A;  4LV3 A;  3BEC A;  5KSC A;  3OPR A;  3HLC A;  1YLW A;  4KZB A;  1TDL A;  4KZ4 A;  2VGJ A;  2Y55 A;  3OCL A;  4GD8 A;  1HVB A;  1WYB A;  2XFT A;  2Y2L A;  2VGK A;  2H0T A;  2DCF A;  3LEZ A;  3O3V A;  2RCX A;  1BLP A;  4WEK A;  3IWQ A;  3IF6 A;  1K4F A;  1JTD A;  1PIO A;  1DY6 A;  3A3E A;  3SS5 A;  4KQO A;  1IYS A;  3BFE A;  1ONG A;  3PBT A;  4C75 A;  3FZC A;  3SOI A;  1K6R A;  4PMA A;  4HEF A;  1AXB A;  2WKI A;  4S2L A;  3ZG8 B;  2G2U A;  3ZNY A;  3MXR A;  1N4O A;  1CEF A;  4JKT A;  3W4P A;  4GKU A;  4JLF A;  2FFF B;  1FSW A;  4RYE A;  1NYM A;  3Q81 A;  4WBG A;  1NZU A;  4X53 A;  1XA1 A;  4P87 A;  1CI8 A;  5CRF A;  3BLM A;  4PM7 A;  5CHU A;  4ZTK A;  1TEM A;  5GLD A;  3ZG5 A;  5HL1 A;  3Q7V A;  2WGW A;  4PM8 A;  4KZ5 A;  4GNU A;  1NJ4 A;  3IXH A;  5EVI C;  3V50 A;  1XX2 A;  2Z2L B;  4XXR A;  1PZO A;  3G32 A;  3NY4 A;  4DRT A;  1OME A;  1MBL A;  3C7V A;  5FI2 A;  1H8Y A;  3G35 A;  3PBN A;  3UY6 A;  4UHU A;  4JXV A;  2HP6 A;  1MWT A;  2J9O A;  4IVI A;  4E6W A;  4WYY A;  5F1F A;  4KQQ A;  4XUX A;  1SCW A;  4MBK A;  3V3R A;  1FR1 A;  5CEC A;  3PBO A;  3GR2 A;  4N9K A;  2HDU A;  4JXW A;  3NDE A;  3VSK A;  2V20 A;  1K54 C;  2JC7 A;  3GMW A;  1Y54 A;  5D3O A;  2Y2I A;  2QPN A;  3HLE A;  3S1Y A;  2RL3 A;  3UPN A;  4X6T A;  1YMX A;  3LCE A;  3QNB A;  4QU3 A;  1J9M A;  3VP4 A;  5HW3 A;  2PBY A;  2ZM8 A;  1WE4 A;  3IF6 B;  1XGJ A;  1FSY A;  2FFY A;  3NDG A;  3PAE A;  1YLY A;  3E2K A;  4MBH A;  1K56 D;  2XDM A;  1SKF A;  5EOO A;  5A93 A;  2H0Y A;  1Z6F A;  3HUN A;  1NZO A;  4Q8I A;  2WGI A;  4IBR A;  2XD5 A;  3A3D A;  5M18 A;  1L0G A;  4R1G A;  1ERO A;  3NC8 A;  4N92 A;  4R4R A;  4MLL A;  4N9L A;  5GHZ A;  1H8Z A;  5GHY A;  2PU2 A;  4RVA A;  1BLS A;  1MKI A;  3HLF A;  5FI7 A;  5DVA A;  5FA7 A;  4P85 A;  2ZC3 B;  5AQB A;  5CER A;  4P0M A;  1LLB A;  1FQG A;  5DTK A;  1I5Q A;  5TGF A;  2IWD A;  3TG9 A;  4KZA A;  3Q7V B;  2EX6 A;  2WGW B;  2Q9N A;  4DE1 A;  2XGN A;  4D2O A;  2WKE A;  1BUL A;  1RP5 A;  2Y2O A;  4EBP A;  3FKW A;  1ES2 A;  4EBL A;  1YLZ A;  4MEZ A;  1RGY A;  1JVJ A;  3B3X A;  3CZD A;  5AQ7 A;  3A3I A;  5DF9 A;  2QZ6 A;  2P9V A;  5FQM A;  3SH9 A;  3WWX A;  2V1Z A;  2V2F F;  4O7D A;  1E3U D;  4OQH A;  2WUQ A;  3FYZ A;  2CC1 A;  5FAO A;  3G2Z A;  4S2J A;  2WAD A;  4WZ4 A;  3NCK A;  4UAA A;  3HLB A;  3G2Y A;  2OLU A;  4E3N A;  1C3B A;  4OVD A;  3WS1 A;  5F82 A;  1KE0 A;  1ZKJ A;  4ID4 A;  1ERQ A;  5M1A A;  5FAT A;  4R3B A;  2Y2Q A;  4U0T A;  5AQA A;  1PW8 A;  2X01 A;  3RJU A;  3GRJ A;  5EOE A;  2QMI A;  5CHM A;  1Q2Q A;  3N7W A;  3FWL A;  4UA7 A;  4XUZ A;  4YIN A;  4FH4 A;  4QHC A;  3A3J A;  1K6S A;  3IXD A;  2EX8 A;  3MBZ A;  4NK3 A;  5E2G A;  4QB8 A;  4K0W A;  2EX9 A;  2XK1 A;  3W4Q A;  3ZVT A;  2EXA A;  4JF4 A;  4FCF A;  2GDN A;  3UDF A;  5EVI A;  2WKH A;  5GLC A;  1HD8 A;  2JBF A;  3PBS A;  3CMZ A;  3ZG7 B;  1O7E A;  2HDS A;  4S2P A;  3ZNT A;  1QMF A;  4E6X A;  4S2M A;  4LV2 A;  1NY0 A;  1YT4 A;  4QJG A;  1KDW A;  3GSG A;  2BG1 A;  2WAF A;  4PPR A;  3IWI A;  1XXM A;  4R0Q A;  2Y91 A;  4U0X A;  3BFD A;  1M6K A;  2Y2M A;  4M3K A;  1E4D A;  4DKI A;  2ZQA A;  4LCL A;  3Q07 A;  1S6R A;  1K54 A;  2ZD8 A;  2ZC6 B;  3RXX A;  3ZGA B;  2XR0 A;  3BM6 A;  4ZJ2 A;  4OOY A;  2J8Y A;  1ZC2 A;  5HAQ A;  3G31 A;  3ZHH A;  1IYP A;  2P9V B;  3BEB A;  3M6B A;  4WMC A;  4GB7 A;  4X68 A;  1VM1 A;  1IKI A;  2WK0 A;  2XQZ A;  3N6I A;  1W5D A;  1DJA A;  3BFC A;  3NBL A;  1K57 C;  4C6Y A;  3WRT A;  4NET A;  4GZB A;  1G68 A;  1ONH A;  4S2O A;  4DE0 A;  1L0E A;  3BYD A;  3DTM A;  3UDX A;  1O07 A;  3VMA A;  4EV4 A;  4OPZ A;  1VQQ A;  5FQI A;  3IH8 A;  1IEM A;  4OLD A;  3VFH A;  1IKG A;  4P6B A;  3ZFZ A;  4IBX A;  4PM9 A;  4R4S A;  1LL5 A;  4UA9 A;  4R3J A;  4B4Z A;  4S2K A;  4DXC A;  2HP9 A;  1PW1 A;  2R9W A;  3C5A A;  3D4F A;  2ZLY A;  5CHJ A;  3IF5 A;  4GDN A;  4OOL A;  1W8Q A;  1L0F A;  4JXS A;  1LI9 A;  2XH9 A;  1YM1 A;  4HBU A;  1ZG4 A;  1YQS A;  5EUA A;  1JWP A;  2HDR A;  2EFU A;  1NRF A;  3PBQ A;  4GDB A;  2X02 A;  5AQ9 A;  5FAQ A;  3ZCZ A;  1BZA A;  3P98 A;  3BFG A;  5EVI B;  1KE4 A;  3ISG A;  3OCN A;  2OLV A;  3HBR A;  4OLG A;  3VFF A;  3UE1 A;  5CGX A;  5IHV A;  1ALQ A;  4UA6 A;  3SH7 A;  4FSF A;  1W8Y A;  4F94 A;  1NXY A;  4Y0T A;  3UDI A;  1IYO A;  2ZC4 B;  4LCM A;  5HAR A;  5M19 A;  5F83 A;  3UPP A;  2ZQ7 A;  2J7V A;  4CPK A;  2ZM2 A;  3LY4 A;  3WS4 A;  4KZ7 A;  5EPH A;  1PI5 A;  3GVB A;  1IYQ A;  1N9B A;  3PTE A;  4DE2 A;  4H8R A; 
#chains in the Genus database with same CATH topology
 4OPY A;  3EEA A;  5I5L A;  2C6W B;  5FQQ A;  3M2K A;  5FI6 A;  4DE3 A;  1BTL A;  4OON A;  1P9W A;  2I72 A;  1WA9 A;  1K55 C;  2ZQD A;  3HUO A;  4Y0O A;  4F3L B;  5FQK A;  4PM6 A;  1HZO A;  5CTN A;  1GHM A;  1ES3 A;  4RX2 A;  2QYB A;  2Z2M B;  1XJ2 A;  1JWZ A;  1U60 A;  4BBU A;  1H3Q A;  3DWZ A;  4QY5 A;  2W1R A;  3UE0 A;  5CTM A;  3LIA A;  1GHP A;  3PBR A;  4FUW A;  4ZDX A;  2K31 A;  4GCZ A;  3IS2 A;  1I2W A;  2R78 A;  5FEG A;  3PAG A;  4HH3 A;  5L8M A;  1Y4O A;  2A49 A;  1SDN A;  1Q2P A;  4HIA A;  4CLC D;  3V3S A;  4LEN A;  3HJI A;  4GD6 A;  3VP0 A;  4HQA A;  4EER A;  3MKF A;  4Y0U A;  5DF8 A;  2R9X A;  3RFB A;  3MKE A;  4DXB A;  1XA7 A;  2J3T D;  3TE8 A;  4YFM A;  3O88 A;  4EW7 A;  1FCN A;  3NEC A;  2O9A A;  4XT2 B;  3WS2 A;  2PD7 A;  1SHV A;  2XRO A;  1X0O A;  4U3T A;  2NUT C;  4WM9 A;  4JBF A;  5C5K A;  3VOZ A;  5JYO A;  5F1G A;  2EX2 A;  1BLH A;  2Y2N A;  1TDG A;  1L0D A;  3LI9 A;  4B4X A;  2XF3 A;  5HWW A;  1CEG A;  2ZM0 A;  4S2N A;  2IWB A;  1YMS A;  3WRZ A;  3ITA A;  1K25 A;  1G6O A;  1YKD A;  5L09 A;  3TOI A;  1XPB A;  1QME A;  2HP5 A;  4DDS A;  1CJF A;  4BD0 A;  5EE8 A;  5DTS A;  3ZG0 A;  2W3H A;  2VZW A;  4I3J A;  3PXP A;  2PHY A;  4HOI A;  1KVL A;  5BOH A;  4ETX A;  3CHW P;  4KUK A;  3EWK A;  4LV1 A;  5IS1 A;  4G3K A;  2DMW A;  3VP3 A;  4WMC D;  3PR6 A;  1DRM A;  4C3Q A;  3T12 B;  3IQA A;  3G34 A;  4X56 A;  2KX6 A;  5U47 A;  4PAU A;  3N8S A;  2G2W A;  3ITB A;  3D9Y A;  3C7U A;  1SKO B;  3OPH A;  3O5Y A;  3EQU A;  4I39 A;  4LPZ A;  4RX3 A;  4E3K A;  5GLA A;  4OKP A;  3KYQ A;  3MZE A;  1GA9 A;  1JWV A;  2Y2K A;  4M4X A;  2ZC7 A;  4IUH A;  4UQI M;  4FOF A;  4JF5 A;  5HDC A;  2ZMA A;  5CXW A;  3A0R A;  5CX7 A;  4WN5 A;  3FG8 A;  4KZ4 A;  1TDL A;  4Q0J A;  2Y55 A;  1OJ5 A;  4GD8 A;  4E04 A;  1HVB A;  5F6A A;  4R3A A;  2RCX A;  3D72 A;  3IF6 A;  4WL9 A;  1Y28 A;  2VKS A;  2KLI A;  5DKK A;  4C75 A;  3R4K A;  2K7S A;  2B95 A;  2G2U A;  1N4O A;  1CEF A;  4WBG A;  4LRX C;  4MN6 A;  1CI8 A;  3BLM A;  5GLD A;  3BJN A;  2WGW A;  2P08 A;  1NJ4 A;  5EVI C;  3V50 A;  1VEU A;  1EW0 A;  4XXR A;  3NY4 A;  3MFX A;  1MBL A;  3C7V A;  4ZRR A;  1H8Y A;  2JN7 A;  2W0N A;  4UHU A;  2NUP C;  5FDS A;  1ZHH B;  4XUX A;  4MBK A;  5CEC A;  2AVX A;  2JKR M;  4JXW A;  1K54 C;  2JC7 A;  3GMW A;  3P7N A;  5D3O A;  2Y2I A;  2QPN A;  3HLE A;  2RL3 A;  3UPN A;  3TJZ C;  3LI8 A;  3QNB A;  2HV1 A;  3OBF A;  2E8J A;  3PAE A;  3MSH A;  2XDM A;  1SKF A;  3HUN A;  2WGI A;  3CUE A;  5HPI A;  4R1G A;  1FIK A;  2YKF A;  3UB8 A;  4RVA A;  4JGQ A;  3FPV A;  5DVA A;  4GS9 A;  1VB6 A;  1YSQ A;  1I5Q A;  2W1T A;  2EX6 A;  4DE1 A;  3VE4 A;  2WKE A;  2L1M A;  4HNB A;  2Y2O A;  3FKW A;  1ES2 A;  2M1C A;  1RGY A;  3B3X A;  2WUQ A;  4S2J A;  2WAD A;  2V8C A;  4UAA A;  3H7W A;  1C3B A;  2JKG A;  3WS1 A;  3H82 A;  2M7U A;  4PKY G;  3A0V A;  1ZKJ A;  1A0K A;  2QJ7 A;  5AQA A;  4U0T A;  4GHI A;  5EOE A;  5CHM A;  5TBM A;  3FWL A;  3A3J A;  5AVF A;  2EX8 A;  2EX9 A;  2L0W A;  3ZVT A;  2EXA A;  4FCF A;  3PBS A;  3ZG7 B;  1O7E A;  1XXM A;  2OAQ 1;  3MQO A;  4LRY C;  2QJ5 A;  2PAV P;  5KIZ A;  4DKI A;  2ZQA A;  4LCL A;  1UWN X;  3RXX A;  3S7P A;  2ZC6 B;  1VET B;  3ZGA B;  1MZU A;  3BM6 A;  1XJ3 A;  4ZJ2 A;  5HAQ A;  1IKI A;  1XJ6 A;  1W5D A;  1K57 C;  4UQI S;  4DMZ A;  3BYD A;  3UDX A;  3VMA A;  1VQQ A;  5FQI A;  3EGD C;  4F3L A;  3DTE A;  3VFH A;  2G7U A;  2HP9 A;  2MJ6 A;  3C5A A;  5CHJ A;  4OOL A;  4I3A A;  5EUA A;  1JWP A;  2HDR A;  1NRF A;  2X02 A;  3B47 A;  3A0S A;  2PDR A;  1ALQ A;  4UA6 A;  1NXY A;  5HAR A;  2ZC4 B;  5F83 A;  4NEE D;  1UGU A;  2ZQ7 A;  3GVB A;  3PTE A;  2INW A;  4H8R A;  3CWF A;  3SH8 A;  1STZ A;  2XRN A;  4MNR A;  4X69 A;  2H10 A;  5CGS A;  1YSP A;  2XFS A;  5CED A;  4Y7P A;  1P9R A;  3UN7 A;  5FAS A;  2WGV A;  1S1Z A;  2B5R A;  3ZDJ A;  3GTC A;  5FSR A;  2ZJ9 A;  4XT2 A;  4HBT A;  3E4O A;  5TJJ A;  2VEA A;  1GCE A;  2V1B A;  3BWL A;  1OT9 A;  1PNE A;  2O99 A;  2Z6C A;  1YLJ A;  1JNU A;  1KGE A;  5HWV A;  3P09 A;  3KO6 A;  2XLN A;  3MZD A;  3M6H A;  3UE3 A;  3HRE A;  3ZQ5 A;  1F98 A;  1HLU P;  3ZG9 B;  3CUE C;  4PKY A;  1WYC A;  4LLO B;  2GZA A;  1ACF A;  3LY3 A;  2JCH A;  1GSW A;  4S2I A;  1P0Z A;  4JXG A;  3NIA A;  4GN2 A;  3BQ8 A;  2HZ5 A;  2V0W A;  1Z09 A;  3FV7 A;  4RA7 A;  3KSG A;  4ZJ3 A;  4O01 A;  5KSH A;  5GL9 A;  1KGG A;  3HUM A;  5GHX A;  4BD1 A;  4KQR A;  4EET B;  5HDD A;  3KSF A;  2JKF A;  3CJM A;  2P74 A;  3C4P A;  3DTI A;  1T19 A;  3A3F A;  3Q1F A;  3AGF A;  4ZJ1 A;  4OOM A;  5DFY A;  4R38 A;  1XGI A;  2EWV A;  2PR6 A;  4K0X A;  1MY8 A;  1SKO A;  3T4K A;  1T1C A;  2BTF P;  4LGW A;  3T50 A;  2ZOI A;  3IT9 A;  3CI6 A;  3BRM A;  4NKP A;  1KE3 A;  2WAE A;  4QD4 A;  4Y5F A;  5GLB A;  4BEN A;  2OWH A;  4PHT A;  3T4T A;  4ZBE A;  3UO9 A;  2BLS A;  3MXQ A;  2ZQ8 A;  5FEF A;  4KZ9 A;  4WZ5 A;  4EBN A;  2V0U A;  3L7H A;  1BYW A;  2Y59 A;  1LI0 A;  5E2F A;  3GEC A;  3AGD A;  5EEC A;  3V39 A;  3T1X A;  3DW0 A;  2EWW A;  4K08 A;  1PWD A;  4KG5 A;  3K2N A;  2QHK A;  2W3F A;  4HJ4 A;  2HPB A;  4FTX A;  1NLZ A;  4OP8 A;  1PI4 A;  2H5S A;  1ESI A;  4GW9 A;  3LR4 A;  4O8G A;  1NYY A;  1DJC A;  3IXG A;  3OLO A;  4IVK A;  3TW8 A;  2IA2 A;  4Y3I A;  3IWO A;  4Z9Q A;  4IED A;  3O86 A;  1ESU A;  4CJN A;  4CLC C;  4LRZ E;  5KZH A;  4CLC E;  3O87 A;  4A5R A;  4LV0 A;  4KG6 A;  3DAV A;  1LL8 A;  4KZ3 A;  3MFD A;  1T18 A;  1L3L A;  5E2E A;  3CAX A;  2O9B A;  1EI5 A;  1LL9 A;  2WKR A;  3MZF A;  1ZTU A;  2J3T C;  5F69 A;  3MR0 A;  5KSC A;  3OPR A;  3HLC A;  1YLW A;  4KZB A;  4HP4 A;  3JVV A;  3OCL A;  1T1B A;  3BY9 A;  1NWZ A;  1S4R A;  3W2Z A;  2VGK A;  2DCF A;  1K4F A;  1DY6 A;  4HH2 A;  2KOI A;  3BFE A;  3FZC A;  3SOI A;  1K6R A;  4HEF A;  1AXB A;  4S2L A;  3LYX A;  3W4P A;  2VX8 A;  4ME4 A;  4EXO A;  5HD3 A;  4R70 A;  4RYE A;  1NYM A;  4GLQ A;  1XA1 A;  4JGR A;  5HPF A;  4ZTK A;  3ZG5 A;  5HL1 A;  4MCW A;  3G32 A;  4EES A;  3PBN A;  3UY6 A;  4IVI A;  1SCW A;  2O0Y A;  1NLY A;  3GR2 A;  2HDU A;  3G6O A;  4DJ3 A;  3NDE A;  2V20 A;  1Y54 A;  4X6T A;  3LCE A;  3VP4 A;  1J9M A;  4BBT A;  1FSY A;  3NDG A;  3E2K A;  1G5U A;  5EOO A;  5A93 A;  4RQ9 A;  4Q8I A;  3A3D A;  4ARZ B;  3NC8 A;  3JPU A;  5IU1 A;  1H8Z A;  2OWJ A;  1MKI A;  4P85 A;  5DTK A;  1FQG A;  3KYZ A;  3Q7V B;  2Q9N A;  4D2O A;  1PRQ A;  3T1R A;  4EBP A;  1VET A;  4MN7 A;  4G3W A;  4AFI A;  4EBL A;  4MEZ A;  1JVJ A;  4II7 A;  3MS6 A;  2QZ6 A;  4HJ3 A;  3SH9 A;  3WWX A;  3FYZ A;  1XFQ A;  2CC1 A;  3G2Z A;  4GJ4 A;  3UME A;  2HJE A;  4WZ4 A;  2OLU A;  4B93 A;  4OVD A;  1KE0 A;  5M1A A;  4R3B A;  2VLG A;  2Y2Q A;  2X01 A;  1PW8 A;  3GRJ A;  3DTK A;  1Q2Q A;  4YIN A;  4FH4 A;  1K6S A;  3IXD A;  4Q0H A;  1D06 A;  2JBF A;  2PRF A;  1KOU A;  4BBV A;  3ZNT A;  1QMF A;  3LIE A;  4S2M A;  1YT4 A;  1KDW A;  3GSG A;  2BG1 A;  2WAF A;  4PPR A;  3IWI A;  5F68 A;  1TS7 A;  4U0X A;  1E4D A;  2HGV A;  1MC0 A;  3Q07 A;  3IX8 A;  2J8Y A;  1ZC2 A;  4L9G A;  3ZHH A;  2P9V B;  1OPX A;  5IT5 A;  4Y17 A;  4X68 A;  4YWZ A;  1VM1 A;  2WK0 A;  2XQZ A;  2PD8 A;  3BFC A;  4HI4 A;  2GJ3 A;  4D60 A;  4S2O A;  1ONH A;  1O07 A;  3E4P A;  1IEM A;  2JKR I;  3UB6 A;  1OTB A;  2ZLY A;  3IF5 A;  4R6L A;  3MF0 A;  1YM1 A;  2EFU A;  3PBQ A;  4GDB A;  3ZCZ A;  1BZA A;  3QP4 A;  4MMN A;  3BFG A;  5EVI B;  3ISG A;  3OCN A;  3HBR A;  3UE1 A;  5IHV A;  3SH7 A;  4F94 A;  4LCM A;  1K0K A;  1MKM A;  5M19 A;  3UPP A;  3C38 A;  3LR0 A;  2W3G A;  1LSX A;  2QKP A;  1IYQ A;  3F1P B;  3KX0 X;  4BL2 A;  2PYP A;  1XP4 A;  1GA0 A;  1CK3 A;  4NXB A;  3U2A A;  2WZX A;  4LFU A;  4S2N C;  2L4R A;  5TFQ A;  1RCJ A;  1IOU A;  3WS0 A;  4NXE A;  1XFN A;  3BFF A;  2UV0 E;  3KSI A;  1H5X A;  2EFX A;  4K91 A;  5DFX A;  1DJB A;  1MPL A;  1CI9 A;  4X25 A;  2PYR A;  5I94 A;  2UWX A;  3T1Q B;  5HAP A;  3F1O B;  2C5W B;  4R23 A;  3S22 A;  5FAP A;  3R7W B;  3VV4 A;  4ETZ A;  2E8I A;  3MXS A;  3UNW A;  5HAI A;  1FCO A;  3TSG A;  3C4O A;  4JF6 A;  2V8F A;  3LEQ A;  3LFV A;  5EVL A;  4OP5 A;  1UWP X;  5HFO A;  3LR3 A;  2Y2H A;  4G3V A;  4E3L A;  4KZ8 A;  5EM1 A;  2ZBB A;  3IH9 A;  4WEL A;  5G18 A;  1L2S A;  2J3W A;  2JE5 A;  4I5S A;  1GSV A;  4X55 A;  2W27 A;  5DJU A;  1K56 A;  5KMW A;  1KGF A;  3V5M A;  2WYX A;  4QY6 A;  4BJP A;  3OZH A;  3SS4 A;  4E3J A;  2Y2J A;  1EWZ A;  3UB5 P;  2XA7 M;  4EU0 A;  5CGW A;  3L9K A;  4BL3 A;  1FIL A;  3H9W A;  4WEJ A;  3QP8 A;  1BT5 A;  2XSS A;  3GQZ A;  1M40 A;  2V9A A;  2VV8 A;  2WKQ A;  4OQI A;  3TRC A;  2FZ0 A;  4EUV A;  1KVM A;  1ZG6 A;  3IF6 C;  3QNC A;  2ZMF A;  1K55 A;  1E3U A;  3LIF A;  4I3I A;  4OH0 A;  2WZZ A;  3RXW A;  4L0L A;  2Q0O A;  4KZ6 A;  1D1J A;  2HJ9 C;  4B88 A;  3MQQ A;  3SS3 A;  1H8M A;  3FC7 A;  1W79 A;  4DDY A;  3ZVW A;  3IBR A;  5F5Y A;  5HD5 A;  2ACG A;  2VV7 A;  2P7J A;  3OPP A;  3E0Y A;  1BUE A;  3PHY A;  1W7F A;  3NI9 A;  1BSG A;  3E2L A;  1I2S A;  4IHQ A;  3IHB A;  3UPO A;  4NXG A;  3CG5 A;  4L9F A;  3BY8 A;  1NRJ A;  2ZC5 B;  2OAP 1;  3FKV A;  1XKZ A;  2Y8H A;  2VV6 A;  2XD1 A;  5HWT A;  4EEP A;  2EA9 A;  3OPL A;  3DWK A;  2Y4A A;  2Y2P A;  1YLT A;  5JYP A;  3Q82 A;  5FDH A;  3VP2 A;  5L2F A;  1N9O A;  3HLG A;  2ZQ9 A;  3EQV A;  4GOG A;  1PYY A;  5HSQ A;  1E25 A;  4EUZ A;  3OC2 A;  4EQI A;  4OPR A;  3E4Q A;  3LUQ A;  4EEU A;  1TS6 A;  3AGE A;  1S0W A;  4LV3 A;  3BEC A;  3MMH A;  4X1M A;  4HJ6 A;  1OJG A;  1TS8 A;  2H0T A;  2JHE A;  3O3V A;  1BLP A;  4WEK A;  3P01 A;  1JTD A;  1PIO A;  3A3E A;  3SS5 A;  2PBD P;  1IYS A;  1ONG A;  3IBJ A;  4UEY A;  1V9Z A;  3VE3 A;  3ZG8 B;  4ARZ A;  3BQA A;  3MXR A;  4GKU A;  4JLF A;  2FFF B;  3DBA A;  1FSW A;  5AVE A;  4X53 A;  4P87 A;  4DN0 A;  4PM7 A;  1TEM A;  3Q7V A;  3SZT A;  5K5B A;  2Z2L B;  2ZL1 B;  4DRT A;  1TD5 A;  5FI2 A;  3HCY A;  4JXV A;  2HP6 A;  1MWT A;  2J9O A;  5F1F A;  4HY8 A;  4KQQ A;  3V3R A;  1FR1 A;  2B02 A;  2ZMV A;  5HDS A;  4H6J B;  4WLA A;  4MN5 A;  1YMX A;  3CLO A;  1T1A A;  2A24 B;  4QU3 A;  5HL6 A;  5MC7 A;  1D7E A;  2ZM8 A;  1WE4 A;  1XGJ A;  2FFY A;  1K56 D;  2JKT M;  2H0Y A;  2XA7 S;  2KDK A;  5M18 A;  2XD5 A;  4B9O A;  1L0G A;  4N92 A;  4MLL A;  1TF1 A;  2M7V A;  1OTD A;  1DP9 A;  2PT7 A;  1BLS A;  3EOI A;  5FI7 A;  2ZC3 B;  5CER A;  1LLB A;  5G4Y A;  5TGF A;  2IWD A;  3SW1 A;  1RP5 A;  1YLZ A;  2O9C A;  3CZD A;  3QP2 A;  3A3I A;  2P9V A;  5FQM A;  2V1Z A;  4O7D A;  1E3U D;  4OQH A;  5FAO A;  4P6Z M;  1ERQ A;  2YKH A;  4WF0 A;  4CLC B;  2QMI A;  4UA7 A;  4XUZ A;  4NK3 A;  4K0W A;  2CMN A;  4JF4 A;  3UDF A;  2GDN A;  5EVI A;  2WKH A;  5GLC A;  4S2P A;  5L07 A;  3F1N B;  4E6X A;  1NY0 A;  4MDZ A;  3IX4 A;  3UB7 A;  2W3D A;  4NXF A;  3BFD A;  2Y2M A;  4M3K A;  1W63 M;  3F1P A;  1S6R A;  1K54 A;  2J80 A;  2XR0 A;  4IJG A;  3IX3 A;  4OOY A;  1S66 L;  3T4Q A;  3G31 A;  1IYP A;  3M6B A;  4GB7 A;  3PYP A;  3N6I A;  1DJA A;  3NBL A;  3BW6 A;  3LIC A;  4C6Y A;  3WRT A;  2GX5 A;  1CQA A;  5FL3 A;  3UE6 A;  4EV4 A;  4OPZ A;  4P6B A;  4IBX A;  4PM9 A;  4B4Z A;  1LL5 A;  4DXC A;  4R3J A;  2HF6 A;  1PW1 A;  2H28 A;  1W8Q A;  5L10 A;  2XH9 A;  1ZG4 A;  3F1O A;  1YQS A;  4HP9 A;  3R7W A;  2WKP A;  3QP1 A;  3VFF A;  2OLV A;  3C2W A;  4FSF A;  3UDI A;  4NG2 A;  2J7V A;  2ZM2 A;  3LY4 A;  3WS4 A;  5EPH A;  1PI5 A;  3K3D A;  1N9B A;  4DE2 A;  3WS5 A;  4Y2F A;  3W8K A;  3N8R A;  3LID A;  4N1H A;  3LO7 A;  3GV9 A;  1SDE A;  4YNR A;  3HLW A;  3NOU C;  2Y79 A;  5EVE A;  3T4O A;  3VSL A;  4JPM A;  1OTI A;  3IXB A;  4Z1W A;  3N4I A;  1K38 A;  4JGP A;  4WUJ A;  4QWO A;  1S67 L;  4BMW A;  2VJW A;  2X71 A;  5J4E A;  1RGZ A;  1PWC A;  5A91 A;  2XEP A;  4WZ5 C;  3W4O A;  1KDS A;  5DJT A;  3U4L P;  5EFW A;  1GHI A;  2OSU A;  4KEN B;  3CPT B;  3S7O A;  3QP6 A;  4KUO A;  2DRW A;  5TR7 A;  1PWG A;  4E3M A;  1ES5 A;  1FOF A;  1K57 A;  4Y13 A;  1G6A A;  5DF7 A;  1IEL A;  3B42 A;  3BLS A;  1DP6 A;  1XJ4 A;  1PZP A;  2OOL A;  1P97 A;  1N9L A;  2VGL M;  2K2N A;  3HVF A;  2A2L A;  1GSX A;  4KQD A;  4HES A;  4OPQ A;  2D01 A;  4ESP A;  1MXO A;  5A90 A;  1TS0 A;  2Q9M A;  4OQ0 A;  2A3U A;  5FQJ A;  2Y2G A;  3Q7Z A;  4YOF A;  5CEB A;  5DTT A;  1H0M A;  5LBR A;  1S4S A;  1FR6 A;  4PM5 A;  3IS2 B;  4P6Z S;  5DKL A;  3IHA A;  1IFQ A;  3NOP C;  4ZAM A;  3S7N A;  3T4J A;  5J8X A;  3QHY A;  3V67 A;  4KG2 A;  3NOT C;  1HTZ A;  4Y15 A;  3EEH A;  3JYI A;  5EM0 A;  5HX9 A;  1MWR A;  5EVI D;  5A8B A;  4MBF A;  4EWF A;  3I7J A;  1FCM A;  5E2H A;  2B18 A;  3G4P A;  3KSH A;  1J3W A;  1YLP A;  2V1A A;  2DNS A;  3M2J A;  5J7E A;  4BLM A;  2GNX A;  2OV5 A;  3S4X A;  4OQG A;  1BLC A;  4E3I A;  1ERM A;  1JTG A;  2HDQ A;  1YPR A;  1DP8 A;  2IWC A;  1TVF A;  2P04 A;  4N1X A;  2W3E A;  3LR5 A;  4FH2 A;  1MWS A;  5A92 A;  2PU4 A;  3VP1 A;  2ZQC A;  4E3O A;  4BWI A;  3G30 A;  3VOY A;  1K4E A;  2BAS A;  1OT6 A;  3VOL A;  4EQ1 A;  1MWU A;  3KYE A;  1N9N A;  1CF0 A;  4BQM A;  2J9P A;  4L9E A;  2I9V A;  5FQ9 A;  3T4S A;  1ES4 A;  1YAX A;  1LHY A;  2ZL1 A;  5E43 A;  4FD8 A;  4DF6 A;  3HL9 A;  2EXB A;  3HLD A;  5AJG A;  3N8L A;  2VGJ A;  1WYB A;  2XFT A;  2Y2L A;  4H6J A;  3LEZ A;  3NHQ A;  1OTE A;  2A24 A;  3B33 A;  1SZV A;  3IWQ A;  2D02 A;  4KQO A;  3PBT A;  3NUL A;  3QP5 A;  4DJ2 A;  4PMA A;  2ZOH A;  2WKI A;  3ZNY A;  4JKT A;  3Q81 A;  2Z6D A;  1NZU A;  3C8C A;  5CRF A;  3ZYT A;  3OOV A;  5CHU A;  3K3C A;  5HZH A;  4X1L A;  3E98 A;  4PM8 A;  4KZ5 A;  4GNU A;  3IXH A;  1XX2 A;  1PZO A;  1OME A;  3G35 A;  1OTA A;  4E6W A;  4WYY A;  2LB5 A;  2FH5 A;  2VGL S;  3PBO A;  4N9K A;  3VSK A;  3FPW A;  3S1Y A;  5HW3 A;  2PBY A;  3IF6 B;  3EGX C;  5J3W A;  4CLC A;  1YLY A;  1LSW A;  3RH8 B;  4MBH A;  4HHD A;  1Z6F A;  1NZO A;  4IBR A;  3T4L A;  1ERO A;  4R4R A;  1G28 A;  4N9L A;  5GHZ A;  5GHY A;  2PU2 A;  1F5M A;  3HLF A;  3F1N A;  1LSV A;  5FA7 A;  5AQB A;  4P0M A;  1AWI A;  3TG9 A;  4KZA A;  2WGW B;  2VK3 A;  2XGN A;  1BUL A;  4QPR A;  1VEU B;  5AQ7 A;  5DF9 A;  1LT0 A;  3UB9 A;  3S7Q A;  2V2F F;  4CQH A;  3D3O A;  3NCK A;  3HLB A;  3G2Y A;  4E3N A;  3NJA A;  5F82 A;  4ID4 A;  5FAT A;  3UMD A;  3RJU A;  3N7W A;  4QHC A;  3MBZ A;  5E2G A;  4QB8 A;  3W4Q A;  2XK1 A;  1HD8 A;  3CMZ A;  3LGO A;  4Q0I A;  2HDS A;  2LB9 A;  3MQ0 A;  4LV2 A;  4O0P A;  4GS9 B;  5EV0 A;  3JVU A;  4QJG A;  2VA0 A;  2W1T B;  4R0Q A;  4JGO A;  2Y91 A;  1M6K A;  3T1S A;  2ZD8 A;  3BEB A;  1W63 Q;  4WMC A;  3MJQ A;  4IUK A;  1PFL A;  4NET A;  4GZB A;  1G68 A;  4DE0 A;  1L0E A;  3H7W B;  3DTM A;  5G4Z A;  3IH8 A;  3H82 B;  3ZFZ A;  4OLD A;  1F2K A;  1IKG A;  4UA9 A;  4R4S A;  3HJK A;  4S2K A;  3CIT A;  2R9W A;  3D4F A;  4GDN A;  1L0F A;  4JXS A;  1ODV A;  4GHI B;  1LI9 A;  5TBM B;  4HBU A;  3GDI A;  5FAQ A;  5AQ9 A;  3ULF A;  3P98 A;  4I38 A;  2JKT I;  3RTY A;  1KE4 A;  4OLG A;  1VHM A;  3LIB A;  5CGX A;  4Y0T A;  1W8Y A;  1IYO A;  1S1Y A;  1F9I A;  3CPT A;  4CPK A;  2PR5 A;  2QWS A;  4KZ7 A;  3C30 A;  1V9Y A;  3ICY A; 
#chains in the Genus database with same CATH homology
 3WS5 A;  4OPY A;  4BL2 A;  3W8K A;  3N8R A;  3SH8 A;  2C6W B;  5FQQ A;  3M2K A;  5FI6 A;  1XP4 A;  1GA0 A;  4N1H A;  4DE3 A;  3LO7 A;  4MNR A;  3GV9 A;  1SDE A;  1BTL A;  4OON A;  4X69 A;  2H10 A;  1CK3 A;  5CGS A;  2I72 A;  2XFS A;  5CED A;  2WZX A;  3HLW A;  4Y7P A;  4S2N C;  5TFQ A;  1K55 C;  3UN7 A;  1RCJ A;  5FAS A;  2WGV A;  3VSL A;  3WS0 A;  2ZQD A;  2B5R A;  3BFF A;  4JPM A;  3HUO A;  3ZDJ A;  4Y0O A;  3IXB A;  3GTC A;  5FSR A;  1H5X A;  2ZJ9 A;  2EFX A;  4HBT A;  4PM6 A;  4K91 A;  5FQK A;  1HZO A;  5CTN A;  1DJB A;  3N4I A;  1K38 A;  1GHM A;  1ES3 A;  1MPL A;  4RX2 A;  1CI9 A;  2Z2M B;  1GCE A;  1JWZ A;  5I94 A;  1U60 A;  2UWX A;  3DWZ A;  4QY5 A;  5HAP A;  3UE0 A;  5CTM A;  1YLJ A;  2X71 A;  1KGE A;  2C5W B;  4R23 A;  3S22 A;  1GHP A;  3P09 A;  3PBR A;  1RGZ A;  5FAP A;  1PWC A;  5A91 A;  2XEP A;  4ZDX A;  4WZ5 C;  2XLN A;  2E8I A;  3MXS A;  3MZD A;  3M6H A;  3UE3 A;  3HRE A;  3UNW A;  3W4O A;  5HAI A;  1I2W A;  1KDS A;  1FCO A;  3TSG A;  3PAG A;  3ZG9 B;  3C4O A;  4JF6 A;  1GHI A;  2A49 A;  2OSU A;  4KEN B;  1SDN A;  1Q2P A;  2DRW A;  5EVL A;  5TR7 A;  1PWG A;  4OP5 A;  1WYC A;  4LEN A;  3V3S A;  5HFO A;  4E3M A;  1ES5 A;  1FOF A;  1K57 A;  1G6A A;  4GD6 A;  5DF7 A;  3LY3 A;  1IEL A;  2Y2H A;  2JCH A;  3VP0 A;  4E3L A;  4S2I A;  4KZ8 A;  3BLS A;  3MKF A;  4Y0U A;  3IH9 A;  4WEL A;  1PZP A;  5DF8 A;  5G18 A;  4JXG A;  2R9X A;  3NIA A;  3MKE A;  1L2S A;  3HVF A;  4DXB A;  2JE5 A;  1XA7 A;  4X55 A;  4GN2 A;  4HES A;  4OPQ A;  4YFM A;  3O88 A;  1FCN A;  3FV7 A;  1MXO A;  5A90 A;  4RA7 A;  1K56 A;  4ZJ3 A;  5KMW A;  1KGF A;  5KSH A;  3V5M A;  2Q9M A;  2WYX A;  3WS2 A;  4OQ0 A;  4QY6 A;  5GL9 A;  2A3U A;  1SHV A;  4BJP A;  3OZH A;  5FQJ A;  1KGG A;  3SS4 A;  2Y2J A;  4U3T A;  2Y2G A;  4E3J A;  1EWZ A;  3Q7Z A;  3HUM A;  5CEB A;  4WM9 A;  5DTT A;  4JBF A;  5GHX A;  5CGW A;  4BD1 A;  4KQR A;  3VOZ A;  3CJM A;  5JYO A;  2P74 A;  1FR6 A;  3C4P A;  5F1G A;  4PM5 A;  4BL3 A;  3A3F A;  2EX2 A;  3Q1F A;  1BLH A;  3AGF A;  3IHA A;  2Y2N A;  4OOM A;  4ZJ1 A;  4WEJ A;  1XGI A;  1TDG A;  1BT5 A;  3GQZ A;  1M40 A;  4OQI A;  4K0X A;  1L0D A;  1MY8 A;  4ZAM A;  2XF3 A;  4B4X A;  1CEG A;  1KVM A;  5J8X A;  1ZG6 A;  3IF6 C;  2ZM0 A;  3QHY A;  3QNC A;  4KG2 A;  4S2N A;  1K55 A;  1HTZ A;  1E3U A;  2IWB A;  1YMS A;  3JYI A;  3WRZ A;  3ITA A;  4OH0 A;  1K25 A;  5HX9 A;  1MWR A;  2WZZ A;  3IT9 A;  3BRM A;  1KE3 A;  2WAE A;  5EVI D;  3RXW A;  4QD4 A;  4L0L A;  3TOI A;  1XPB A;  4MBF A;  4KZ6 A;  1QME A;  1FCM A;  2HP5 A;  3I7J A;  5E2H A;  5GLB A;  4BEN A;  4DDS A;  4EWF A;  4B88 A;  4BD0 A;  3G4P A;  3SS3 A;  5EE8 A;  5DTS A;  1W79 A;  4DDY A;  3ZG0 A;  4ZBE A;  3UO9 A;  2BLS A;  3ZVW A;  2ZQ8 A;  1YLP A;  2DNS A;  4KZ9 A;  3M2J A;  1KVL A;  5BOH A;  4WZ5 A;  4EBN A;  4BLM A;  3OPP A;  2OV5 A;  1BUE A;  2Y59 A;  1W7F A;  3NI9 A;  1BSG A;  1LI0 A;  3E2L A;  4LV1 A;  5E2F A;  3S4X A;  3AGD A;  5EEC A;  3V39 A;  3VP3 A;  1I2S A;  3DW0 A;  1BLC A;  4OQG A;  4E3I A;  1ERM A;  4WMC D;  1JTG A;  4C3Q A;  1PWD A;  2HDQ A;  3IHB A;  3UPO A;  4KG5 A;  3IQA A;  3G34 A;  3CG5 A;  2HPB A;  2IWC A;  4OP8 A;  4X56 A;  5U47 A;  1TVF A;  1PI4 A;  2H5S A;  1ESI A;  4N1X A;  1NYY A;  2ZC5 B;  2G2W A;  3N8S A;  1DJC A;  4FH2 A;  3IXG A;  3ITB A;  4IVK A;  1MWS A;  3FKV A;  1XKZ A;  5A92 A;  2PU4 A;  3IWO A;  3C7U A;  3OPH A;  4Z9Q A;  4IED A;  3VP1 A;  3EQU A;  3O86 A;  2XD1 A;  4E3K A;  4RX3 A;  5GLA A;  2ZQC A;  4E3O A;  1ESU A;  4OKP A;  4CJN A;  3OPL A;  3G30 A;  3DWK A;  2Y4A A;  2Y2P A;  1YLT A;  3VOY A;  5KZH A;  3MZE A;  5JYP A;  1K4E A;  1GA9 A;  1JWV A;  3O87 A;  3Q82 A;  5FDH A;  3VP2 A;  5L2F A;  3HLG A;  1MWU A;  2ZQ9 A;  3EQV A;  1PYY A;  2Y2K A;  4GOG A;  4A5R A;  4BQM A;  2J9P A;  4LV0 A;  1E25 A;  4KG6 A;  4EUZ A;  2ZC7 A;  3OC2 A;  4EQI A;  4OPR A;  4KZ3 A;  5FQ9 A;  3MFD A;  1ES4 A;  1LHY A;  5E43 A;  4JF5 A;  5E2E A;  4FD8 A;  4DF6 A;  1EI5 A;  3HL9 A;  2ZMA A;  1LL9 A;  5CXW A;  3MZF A;  2EXB A;  3HLD A;  3AGE A;  3N8L A;  1S0W A;  4LV3 A;  3BEC A;  5KSC A;  3OPR A;  3HLC A;  1YLW A;  4KZB A;  1TDL A;  4KZ4 A;  2VGJ A;  2Y55 A;  3OCL A;  4GD8 A;  1HVB A;  1WYB A;  2XFT A;  2Y2L A;  2VGK A;  2H0T A;  2DCF A;  3LEZ A;  3O3V A;  2RCX A;  1BLP A;  4WEK A;  3IWQ A;  3IF6 A;  1K4F A;  1JTD A;  1PIO A;  1DY6 A;  3A3E A;  3SS5 A;  4KQO A;  1IYS A;  3BFE A;  1ONG A;  3PBT A;  4C75 A;  3FZC A;  3SOI A;  1K6R A;  4PMA A;  4HEF A;  1AXB A;  2WKI A;  4S2L A;  3ZG8 B;  2G2U A;  3ZNY A;  3MXR A;  1N4O A;  1CEF A;  4JKT A;  3W4P A;  4GKU A;  4JLF A;  2FFF B;  1FSW A;  4RYE A;  1NYM A;  3Q81 A;  4WBG A;  1NZU A;  4X53 A;  1XA1 A;  4P87 A;  1CI8 A;  5CRF A;  3BLM A;  4PM7 A;  5CHU A;  4ZTK A;  1TEM A;  5GLD A;  3ZG5 A;  5HL1 A;  3Q7V A;  2WGW A;  4PM8 A;  4KZ5 A;  4GNU A;  1NJ4 A;  3IXH A;  5EVI C;  3V50 A;  1XX2 A;  2Z2L B;  4XXR A;  1PZO A;  3G32 A;  3NY4 A;  4DRT A;  1OME A;  1MBL A;  3C7V A;  5FI2 A;  1H8Y A;  3G35 A;  3PBN A;  3UY6 A;  4UHU A;  4JXV A;  2HP6 A;  1MWT A;  2J9O A;  4IVI A;  4E6W A;  4WYY A;  5F1F A;  4KQQ A;  4XUX A;  1SCW A;  4MBK A;  3V3R A;  1FR1 A;  5CEC A;  3PBO A;  3GR2 A;  4N9K A;  2HDU A;  4JXW A;  3NDE A;  3VSK A;  2V20 A;  1K54 C;  2JC7 A;  3GMW A;  1Y54 A;  5D3O A;  2Y2I A;  2QPN A;  3HLE A;  3S1Y A;  2RL3 A;  3UPN A;  4X6T A;  1YMX A;  3LCE A;  3QNB A;  4QU3 A;  1J9M A;  3VP4 A;  5HW3 A;  2PBY A;  2ZM8 A;  1WE4 A;  3IF6 B;  1XGJ A;  1FSY A;  2FFY A;  3NDG A;  3PAE A;  1YLY A;  3E2K A;  4MBH A;  1K56 D;  2XDM A;  1SKF A;  5EOO A;  5A93 A;  2H0Y A;  1Z6F A;  3HUN A;  1NZO A;  4Q8I A;  2WGI A;  4IBR A;  2XD5 A;  3A3D A;  5M18 A;  1L0G A;  4R1G A;  1ERO A;  3NC8 A;  4N92 A;  4R4R A;  4MLL A;  4N9L A;  5GHZ A;  1H8Z A;  5GHY A;  2PU2 A;  4RVA A;  1BLS A;  1MKI A;  3HLF A;  5FI7 A;  5DVA A;  5FA7 A;  4P85 A;  2ZC3 B;  5AQB A;  5CER A;  4P0M A;  1LLB A;  1FQG A;  5DTK A;  1I5Q A;  5TGF A;  2IWD A;  3TG9 A;  4KZA A;  3Q7V B;  2EX6 A;  2WGW B;  2Q9N A;  4DE1 A;  2XGN A;  4D2O A;  2WKE A;  1BUL A;  1RP5 A;  2Y2O A;  4EBP A;  3FKW A;  1ES2 A;  4EBL A;  1YLZ A;  4MEZ A;  1RGY A;  1JVJ A;  3B3X A;  3CZD A;  5AQ7 A;  3A3I A;  5DF9 A;  2QZ6 A;  2P9V A;  5FQM A;  3SH9 A;  3WWX A;  2V1Z A;  2V2F F;  4O7D A;  1E3U D;  4OQH A;  2WUQ A;  3FYZ A;  2CC1 A;  5FAO A;  3G2Z A;  4S2J A;  2WAD A;  4WZ4 A;  3NCK A;  4UAA A;  3HLB A;  3G2Y A;  2OLU A;  4E3N A;  1C3B A;  4OVD A;  3WS1 A;  5F82 A;  1KE0 A;  1ZKJ A;  4ID4 A;  1ERQ A;  5M1A A;  5FAT A;  4R3B A;  2Y2Q A;  4U0T A;  5AQA A;  1PW8 A;  2X01 A;  3RJU A;  3GRJ A;  5EOE A;  2QMI A;  5CHM A;  1Q2Q A;  3N7W A;  3FWL A;  4UA7 A;  4XUZ A;  4YIN A;  4FH4 A;  4QHC A;  3A3J A;  1K6S A;  3IXD A;  2EX8 A;  3MBZ A;  4NK3 A;  5E2G A;  4QB8 A;  4K0W A;  2EX9 A;  2XK1 A;  3W4Q A;  3ZVT A;  2EXA A;  4JF4 A;  4FCF A;  2GDN A;  3UDF A;  5EVI A;  2WKH A;  5GLC A;  1HD8 A;  2JBF A;  3PBS A;  3CMZ A;  3ZG7 B;  1O7E A;  2HDS A;  4S2P A;  3ZNT A;  1QMF A;  4E6X A;  4S2M A;  4LV2 A;  1NY0 A;  1YT4 A;  4QJG A;  1KDW A;  3GSG A;  2BG1 A;  2WAF A;  4PPR A;  3IWI A;  1XXM A;  4R0Q A;  2Y91 A;  4U0X A;  3BFD A;  1M6K A;  2Y2M A;  4M3K A;  1E4D A;  4DKI A;  2ZQA A;  4LCL A;  3Q07 A;  1S6R A;  1K54 A;  2ZD8 A;  2ZC6 B;  3RXX A;  3ZGA B;  2XR0 A;  3BM6 A;  4ZJ2 A;  4OOY A;  2J8Y A;  1ZC2 A;  5HAQ A;  3G31 A;  3ZHH A;  1IYP A;  2P9V B;  3BEB A;  3M6B A;  4WMC A;  4GB7 A;  4X68 A;  1VM1 A;  1IKI A;  2WK0 A;  2XQZ A;  3N6I A;  1W5D A;  1DJA A;  3BFC A;  3NBL A;  1K57 C;  4C6Y A;  3WRT A;  4NET A;  4GZB A;  1G68 A;  1ONH A;  4S2O A;  4DE0 A;  1L0E A;  3BYD A;  3DTM A;  3UDX A;  1O07 A;  3VMA A;  4EV4 A;  4OPZ A;  1VQQ A;  5FQI A;  3IH8 A;  1IEM A;  4OLD A;  3VFH A;  1IKG A;  4P6B A;  3ZFZ A;  4IBX A;  4PM9 A;  4R4S A;  1LL5 A;  4UA9 A;  4R3J A;  4B4Z A;  4S2K A;  4DXC A;  2HP9 A;  1PW1 A;  2R9W A;  3C5A A;  3D4F A;  2ZLY A;  5CHJ A;  3IF5 A;  4GDN A;  4OOL A;  1W8Q A;  1L0F A;  4JXS A;  1LI9 A;  2XH9 A;  1YM1 A;  4HBU A;  1ZG4 A;  1YQS A;  5EUA A;  1JWP A;  2HDR A;  2EFU A;  1NRF A;  3PBQ A;  4GDB A;  2X02 A;  5AQ9 A;  5FAQ A;  3ZCZ A;  1BZA A;  3P98 A;  3BFG A;  5EVI B;  1KE4 A;  3ISG A;  3OCN A;  2OLV A;  3HBR A;  4OLG A;  3VFF A;  3UE1 A;  5CGX A;  5IHV A;  1ALQ A;  4UA6 A;  3SH7 A;  4FSF A;  1W8Y A;  4F94 A;  1NXY A;  4Y0T A;  3UDI A;  1IYO A;  2ZC4 B;  4LCM A;  5HAR A;  5M19 A;  5F83 A;  3UPP A;  2ZQ7 A;  2J7V A;  4CPK A;  2ZM2 A;  3LY4 A;  3WS4 A;  4KZ7 A;  5EPH A;  1PI5 A;  3GVB A;  1IYQ A;  1N9B A;  3PTE A;  4DE2 A;  4H8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...