2IWBA

Mecr1 unbound extracellular antibiotic-sensor domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
246
Chain Sequence
DKYETNVSYKKLNQLAPYFKGFDGSFVLYNEREQAYSIYNEPESKQRYSPNSTYKIYLALMAFDQNLLSLNHTEQQWDKHQYPFKEWNQDQNLNSSMKYSVNWYYENLNKHLRQDEVKSYLDLIEYGNEEISGNENYWNESSLKISAIEQVNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEANGWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords METHICILLIN RESISTANCE MECR1 PROTEIN
publication title Unbound and Acylated Structures of the Mecr1 Extracellular Antibiotic-Sensor Domain Provide Insights Into the Signal-Transduction System that Triggers Methicillin Resistance.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic resistance
total genus 90
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2006-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2iwbA00
2FFFB 3BECA 3C4PA 3IXBA 2Y2KA 4WMCD 1RP5A 4QB8A 3IHBA 4ZDXA 1IELA 3GTCA 3V39A 3ZDJA 1L0EA 1YLPA 3BFDA 3HUNA 1BLSA 1K57C 1GA9A 2ZM0A 4GN2A 3N8SA 4U0TA 4C3QA 3CZDA 4EBPA 4E6WA 2EX8A 2V2FF 5GLDA 1PWGA 4Y0TA 3W4PA 4PM5A 2WK0A 1E3UD 3C4OA 4JBFA 2XFSA 5DTSA 5GLAA 3VP1A 2ZQAA 2X01A 2ZC4B 3G34A 3HLEA 1JWPA 4IBXA 3VP4A 5E43A 2ZQDA 4JF4A 4OVDA 4DE2A 3DWKA 2G2UA 4E3LA 3ZHHA 2HPBA 3E2KA 3ZVTA 2FFYA 1RGZA 3HBRA 5FAOA 3EQUA 5CEDA 4HEFA 4KZ8A 5FQMA 5HAQA 2RCXA 5TR7A 4QD4A 4MLLA 3BEBA 3BLMA 1NZUA 4ID4A 3FV7A 3IWIA 4LV2A 5GLCA 4MBFA 3UE1A 3TSGA 3GVBA 2HDRA 3SS5A 1VQQA 1YT4A 4R1GA 1I2WA 5FQ9A 5FI7A 2JE5A 5EPHA 4RVAA 3ITAA 4JF5A 5FSRA 5FASA 5M18A 2JC7A 3ZNTA 4EBNA 3IT9A 1XPBA 4OONA 2C5WB 1K6RA 2Y2PA 3ZGAB 4ZJ1A 3M6HA 3S22A 3O86A 3VFFA 3IXGA 4DDYA 4R3BA 4FD8A 1GHMA 1YMXA 2H10A 2OLUA 3G2ZA 5M1AA 1PWCA 4JPMA 4KQRA 1BT5A 2V20A 1K4FA 2EFXA 3I7JA 3LO7A 4HESA 1G68A 4E3JA 2IWBA 3V3SA 4GKUA 1AXBA 1IYPA 2ZQ9A 3ZVWA 3Q7VA 1I5QA 1KDWA 2EFUA 5EOOA 1BZAA 4Q8IA 5HAIA 1K4EA 1E25A 1LHYA 2XQZA 4OQGA 5EVIB 4BJPA 3RXXA 1ONGA 3NCKA 1KGEA 2JBFA 2ZQ7A 3S1YA 2IWDA 4OQ0A 4WBGA 3PBSA 4OLDA 3CG5A 5KSHA 1SKFA 2R9WA 3D4FA 4S2KA 5EOEA 1HZOA 2WKIA 5FQJA 4OOYA 5CEBA 3VSLA 1PZOA 2G2WA 5JYPA 1OMEA 3OCLA 4JXSA 4R23A 4R4SA 4Y0UA 5G18A 5F83A 2WAEA 3ZFZA 1G6AA 4DE1A 3FKWA 5DTTA 3CMZA 4EWFA 1NYMA 1PWDA 4RX2A 4FCFA 4C75A 2HP5A 1K56D 1XX2A 2Y2HA 3LY3A 4GB7A 4X53A 1EWZA 5HAPA 1WYCA 2X02A 1JTGA 4BENA 1YQSA 4M3KA 2Q9NA 4ZJ2A 2WGWA 2WYXA 5AQBA 1IKGA 1NY0A 2HP9A 3GV9A 4XXRA 2ZC6B 2R9XA 5CTMA 4IBRA 5EECA 5F82A 3Q82A 1BSGA 3W4OA 3UPNA 4FSFA 4NETA 1GA0A 3UPOA 3NY4A 1LL5A 1KVLA 2XR0A 4E6XA 3VP2A 1MKIA 4RX3A 4X6TA 2XDMA 2XH9A 1GHIA 2Y59A 5KZHA 1ZG6A 4S2IA 4RYEA 4DXBA 4MBKA 4S2LA 2ZC7A 3V3RA 1JTDA 3Q7ZA 4JF6A 4DE0A 5IHVA 1K25A 1PYYA 2WGWB 4BLMA 4UHUA 3PBQA 3GQZA 5CGXA 2ZLYA 1ZG4A 4OQIA 4S2JA 1XA7A 1KDSA 1L0FA 4KZBA 4UA6A 3W8KA 2P74A 2XD5A 4P85A 1IYOA 4N9KA 2X71A 4JXVA 2E8IA 3PBRA 2XFTA 2I72A 2J8YA 3WS0A 4HBTA 2HDSA 3MBZA 3SH8A 3OPPA 5CHJA 1FSYA 2J9PA 1DJCA 2ZJ9A 3N8RA 2QPNA 3VP0A 1FQGA 3ZG9B 3S4XA 3Q07A 4KZAA 3PTEA 4GZBA 3LCEA 5AQ7A 3GMWA 4FH2A 3E2LA 1MXOA 1SHVA 1ES5A 5CRFA 1MY8A 1ESUA 4R4RA 1CK3A 2H5SA 2C6WB 2Y2LA 3ZG7B 1YLZA 1SDEA 2CC1A 4HBUA 2EXBA 4UAAA 1NXYA 4ZBEA 1FCMA 1FCOA 4GNUA 5I94A 3A3IA 1EROA 5EUAA 2BG1A 2XEPA 1XP4A 4GD6A 2Y4AA 1H8YA 3C7VA 5GHZA 3O3VA 3M2KA 3C7UA 4BD1A 4OPZA 4WMCA 4OQHA 3VOZA 3BRMA 4KZ6A 4RA7A 2V1ZA 5E2EA 3BFFA 3V50A 4R3JA 5FQIA 1PI4A 4U3TA 2Z2LB 5A93A 3HLGA 4KG5A 5FI6A 5GHXA 4YINA 1KE4A 2B5RA 1W79A 4XUXA 4MEZA 3SOIA 3G32A 1U60A 2OV5A 3BFGA 3G2YA 1JWZA 2WUQA 5EVLA 3DW0A 3IF6C 2ZQCA 4NK3A 4WEKA 1NYYA 5KMWA 5EVID 1E3UA 4GD8A 3P98A 4OPYA 3IHAA 4B4XA 5HX9A 3GSGA 1IYSA 5E2FA 3DTMA 4WYYA 1H5XA 4KZ3A 4IVIA 4OLGA 4LV3A 1K54C 2EX2A 5JYOA 3VSKA 1JWVA 4LCMA 3UDXA 1O07A 1TDLA 3NBLA 4ZJ3A 5DF7A 4JXWA 5EE8A 2WZXA 4GOGA 3VOYA 2VGJA 1MBLA 2Y2GA 3N8LA 1M40A 4E3MA 4X68A 2IWCA 3CJMA 5D3OA 1TDGA 4PM8A 4UA9A 4U0XA 3UE0A 2Y2NA 3AGDA 3MZFA 1YLTA 1RGYA 1KGGA 4K0WA 3MXSA 2A3UA 1BLHA 3AGEA 4QU3A 1H8ZA 3PAGA 5FI2A 4BL3A 1BUEA 5A91A 4WZ5C 3NDEA 2J9OA 4BD0A 3PAEA 3PBOA 1SDNA 1J9MA 4MBHA 5FAQA 3P09A 3OPRA 4LV1A 2XGNA 1YMSA 1Z6FA 3C5AA 1BULA 3UDIA 3LEZA 4MNRA 1E4DA 2ZD8A 3TG9A 2ZQ8A 3Q7VB 3SS3A 3ZG0A 3UN7A 1NJ4A 2WGIA 3FKVA 4K91A 3G4PA 1BTLA 4N1XA 5FQKA 4F94A 4LCLA 4IVKA 1JVJA 1LL9A 2Y55A 2DRWA 1LI0A 3A3FA 1ERMA 2Y2OA 1ZC2A 4S2NA 3EQVA 4IEDA 1WYBA 3HLDA 3WS1A 4E3OA 3IXHA 1FR1A 1CEFA 1FR6A 3TOIA 2QMIA 5F1FA 4OP5A 5L2FA 3OPLA 3IF6A 4QY5A 4EQIA 4N92A 4OOMA 4O7DA 3HVFA 4QY6A 3BYDA 4KZ7A 1DY6A 5FAPA 4P87A 1BLPA 1KE3A 5CGWA 3A3JA 1K56A 5DTKA 1K54A 4LENA 1XGJA 2EX6A 1CEGA 2DNSA 4OOLA 4UA7A 3G30A 1IYQA 2ZM2A 4DXCA 2RL3A 3GR2A 3IF6B 2XK1A 4R0QA 1HVBA 1ONHA 4PM9A 4WEJA 2Y2MA 5CHMA 4OPQA 1TVFA 4N9LA 5DF8A 2XLNA 3UO9A 3WS2A 4X56A 3Q1FA 5TFQA 4EV4A 3V5MA 4CPKA 3G31A 3HUMA 4D2OA 3GRJA 1PZPA 1DJBA 1YLWA 2WZZA 4OPRA 3OZHA 4WZ5A 1CI8A 1LI9A 4WZ4A 4L0LA 4A5RA 4KZ4A 1NRFA 4KG2A 1QMEA 3BLSA 3HLWA 3SS4A 4DE3A 3IH9A 3JYIA 1N9BA 1WE4A 3MZDA 2PBYA 3IWOA 3PBNA 3NC8A 3UY6A 3HREA 4S2MA 4QHCA 3HUOA 3B3XA 2ZM8A 5GL9A 1K55C 1XGIA 3WWXA 2GDNA 1PIOA 2PU4A 3HL9A 3O87A 3UDFA 3VP3A 4S2OA 1YLJA 4Y7PA 3OC2A 5DVAA 4B88A 2DCFA 4S2NC 1FOFA 3WRZA 3SH9A 2J7VA 3IQAA 3RJUA 1K38A 1XXMA 2HDQA 4PM7A 3ZG8B 4E3IA 5E2HA 3QNCA 2Y2QA 1NZOA 1ES2A 3QHYA 4PM6A 5CXWA 4KQOA 3IWQA 2WAFA 1O7EA 1Q2PA 3N7WA 2EXAA 1XKZA 1ES3A 2BLSA 4ZAMA 1L2SA 3M2JA 3N6IA 5HL1A 2H0YA 3M6BA 3W4QA 5CECA 3DWZA 3MFDA 3FYZA 3NDGA 3WS5A 3LY4A 3WS4A 3RXWA 3PBTA 4E3NA 5CGSA 3NI9A 1KE0A 3OPHA 5CERA 4GDNA 1YM1A 1EI5A 2JCHA 1L0GA 4Z9QA 1MWTA 3HLBA 1C3BA 5GHYA 4DF6A 5HARA 3MKEA 4OP8A 3FZCA 3UPPA 2Z2MB 3ZG5A 4DKIA 1BLCA 3SH7A 4KENB 2ZMAA 2OLVA 4KZ5A 4P0MA 3G35A 5M19A 5FQQA 1MWRA 2XF3A 1W8QA 5EVIA 1SCWA 1YLYA 4DDSA 1W5DA 1L0DA 2UWXA 3FWLA 1M6KA 2Y2IA 4KQQA 1XA1A 5CTNA 4C6YA 4OH0A 2PU2A 3MKFA 1S6RA 1ES4A 2WGVA 3VFHA 1ESIA 5A92A 2HP6A 2ZC3B 3AGFA 1N4OA 3MZEA 2XD1A 4DRTA 4X69A 3HLFA 5FATA 1K55A 2EX9A 3ITBA 1KVMA 1PW8A 5A90A 1K57A 2WKHA 1HTZA 1W8YA 3NIAA 4P6BA 4JLFA 5U47A 5J8XA 4X55A 2P9VA 3A3EA 3BFEA 5FA7A 3BM6A 3IH8A 1Y54A 2Y2JA 3HLCA 2A49A 1PW1A 4E3KA 4LV0A 4JKTA 4B4ZA 3IF5A 1MPLA 5AQAA 4BL2A 4JXGA 1QMFA 2WADA 5CHUA 1KGFA 3A3DA 4YFMA 3ZNYA 4WM9A 5AQ9A 1GCEA 1VM1A 1ALQA 3Q81A 2VGKA 2P9VB 3WRTA 5BOHA 1ZKJA 1LLBA 4S2PA 4QJGA 1FSWA 2Y91A 1PI5A 3OCNA 4N1HA 4PPRA 4XUZA 5TGFA 3QNBA 5HW3A 5E2GA 3UE3A 1I2SA 5HFOA 3IXDA 3O88A 4KZ9A 5DF9A 4CJNA 4FH4A 1S0WA 4BQMA 3VMAA 5KSCA 1MWUA 4GDBA 4EUZA 4KG6A 2Q9MA 1FCNA 4Y0OA 2OSUA 1IEMA 5F1GA 5FDHA 4WELA 5EVIC 2WKEA 5GLBA 3MXRA 1K6SA 2HDUA 2H0TA 1ERQA 1Q2QA 4PMAA 4ZTKA 4H8RA 2ZC5B 1GHPA 1RCJA 1MWSA 3UNWA 1TEMA 4EBLA 3ISGA 3N4IA 1HD8A 3BFCA 4K0XA 1DJAA 1CI9A 1IKIA 1W7FA 3ZCZA 4OKPA 2QZ6A
chains in the Genus database with same CATH superfamily
2Y2KA 5TBMB 1VETA 1Z09A 3ZDJA 1L0EA 3HUNA 1BLSA 1V9YA 4U0TA 4E6WA 1K0KA 4Y0TA 3W4PA 5KIZA 2WK0A 1T18A 3JVUA 2ZQAA 2X01A 1VETB 3G34A 4JF4A 4DE2A 3ZVTA 2HPBA 3T4JA 2HJ9C 5FAOA 4HEFA 5TR7A 4HOIA 2PRFA 1NZUA 4ID4A 4IUKA 3GVBA 3SS5A 1YT4A 3KYQA 1I2WA 2P08A 5FI7A 5EPHA 3ITAA 1Y4OA 1XPBA 2HGVA 1K6RA 3ZGAB 5HD3A 1JNUA 3O86A 3VFFA 1H0MA 1GHMA 2H10A 5M1AA 1PWCA 4JPMA 1BT5A 3I7JA 3LO7A 2FZ0A 2PBDP 2IWBA 4GKUA 1AXBA 1BZAA 5HAIA 2E8JA 4EU0A 2KOIA 2M7VA 1E25A 1LHYA 2VZWA 4EERA 3CG5A 5KSHA 1SKFA 3D4FA 4S2KA 5FQJA 4L9EA 3VV4A 5CEBA 3VSLA 5JYPA 3LYXA 5F83A 1G6AA 4DE1A 1UGUA 4RX2A 1K56D 1ZTUA 1MKMA 4XT2A 1EWZA 1WYCA 4ZJ2A 4I38A 2WGWA 4E04A 5AQBA 1IKGA 1NY0A 4GJ4A 4QWOA 4MN5A 3UPNA 3C2WA 4I3AA 4MCWA 1KVLA 5K5BA 3CITA 1GHIA 4S2IA 5DFXA 4DXBA 1J3WA 1JTDA 4DE0A 5IHVA 1K25A 2WGWB 3KSFA 3PBQA 3GQZA 3ZQ5A 2ZLYA 1NWZA 3CLOA 3CAXA 4KZBA 2EWWA 4P85A 2XFTA 3DAVA 3ZG9B 1DJCA 2ZJ9A 1P0ZA 3N8RA 3S4XA 3Q07A 4GZBA 4P6ZS 1MXOA 2BTFP 5CRFA 1MY8A 4R4RA 2H5SA 3ZG7B 1SDEA 4HJ3A 4HBUA 2EXBA 3R4KA 1NXYA 1FCMA 1EROA 5EUAA 2Y4AA 5GHZA 3O3VA 3M2KA 3C7UA 4BD1A 4WMCA 3VOZA 3BRMA 5E2EA 5IU1A 1PI4A 3TW8A 4I39A 2ZMVA 5GHXA 2B5RA 3SOIA 3G32A 5EV0A 2D02A 2WUQA 5EVLA 3DW0A 3IF6C 1NYYA 5KMWA 4OPYA 1S4SA 1IYSA 2VEAA 4IVIA 4OLGA 4LV3A 5JYOA 1JWVA 3RH8B 2YKFA 3NBLA 2XROA 4JXWA 2VGJA 1MBLA 2KLIA 1M40A 4E3MA 1A0KA 3H82B 3U4LP 1TDGA 2JKGA 3UE0A 1BYWA 3AGDA 4NXEA 3DBAA 3MXSA 2A3UA 3AGEA 4BL3A 2VV8A 1YAXA 3PAEA 3PBOA 2IA2A 1J9MA 1OT9A 2B18A 3LIDA 2VKSA 3ZG0A 3FKVA 3QP1A 3GDIA 4IVKA 2DRWA 3F1NA 1ERMA 1ZC2A 2JKRM 3HLDA 1CEFA 3K2NA 5F1FA 2WKRA 3OPLA 4EQIA 2W1TA 4Y15A 2ZL1A 1S4RA 2HJEA 4KZ7A 1KE3A 4AFIA 2M1CA 3A3JA 1H8MA 1K54A 4LENA 3CUEA 4OOLA 2DNSA 3G30A 4Q0IA 2XK1A 4OPQA 1TVFA 2W1TB 4EQ1A 2ZL1B 4DJ3A 4EV4A 3HUMA 4D2OA 1PZPA 4YNRA 2WZZA 1IOUA 1TF1A 2Z6DA 4WZ5A 1CI8A 4A5RA 4KZ4A 3HLWA 4DE3A 3IH9A 3IBJA 3LIBA 5A8BA 1ZHHB 3NC8A 3HREA 2GDNA 2PU4A 3O87A 4S2OA 1YLJA 3PHYA 3OC2A 5DVAA 2DCFA 4S2NC 1F5MA 2VA0A 3T1QB 2K7SA 3ZG8B 1LL8A 1YSQA 3QNCA 1ES2A 3QHYA 1DP9A 2WAFA 1XKZA 1ES3A 4ZAMA 1L2SA 3M6BA 2GJ3A 3FYZA 3WS5A 3LY4A 2OOLA 3RXWA 4GDNA 4CQHA 3R7WA 1OT6A 3HLBA 5C5KA 3ZYTA 3JVVA 5HARA 1G6OA 3MKEA 1UWPX 5EM0A 2CMNA 3ZG5A 3SH7A 1S67L 1N9LA 2ZMAA 4P0MA 5FQQA 1MWRA 2XF3A 3FWLA 2UWXA 5L09A 5CTNA 1T1BA 3R7WB 1S6RA 2WGVA 4KUKA 4DRTA 3HLFA 5F6AA 2EX9A 1HTZA 4P6BA 1VEUA 3TJZC 3BFEA 2O9BA 3BM6A 4E3KA 4B93A 4JXGA 1QMFA 4LFUA 3A3DA 2PDRA 5AQ9A 1VEUB 1ALQA 2VGKA 3WRTA 1LLBA 3OCNA 4PPRA 5TGFA 3EGDC 5HFOA 4FH4A 3VMAA 4GDBA 4DMZA 1XJ2A 1YPRA 4WN5A 1IFQA 1TS6A 1LSXA 1NRJA 1Q2QA 1T19A 4PMAA 3UNWA 1GHPA 3IS2A 3K3DA 1TEMA 3N4IA 3BFCA 4K0XA 5HPIA 3C4PA 1RP5A 4QB8A 3DTIA 1IELA 3GTCA 2EWVA 2PD7A 3BFDA 1K57C 1GA9A 2VJWA 3CHWP 3CZDA 3PXPA 4EBPA 3IS2B 2EX8A 5DJTA 4JBFA 2XFSA 5DTSA 5DFYA 3VP1A 2ZC4B 3VP4A 5EFWA 5E43A 2ZQDA 4LLOB 3UMDA 4E3LA 3MFXA 5CEDA 3W2ZA 3FV7A 4LV2A 5GLCA 4MBFA 5HWWA 4R1GA 1EW0A 2JE5A 1NLYA 5LBRA 3ZNTA 3IT9A 4JGRA 3S22A 2L1MA 2B95A 4D60A 1ODVA 1G68A 3ZVWA 4K08A 3Q7VA 2EFUA 5EOOA 4O01A 4Q8IA 5EVIB 1KGEA 2JBFA 4BWIA 2G2WA 1OMEA 3OCLA 3E4PA 3VOLA 4Y0UA 5G18A 4CLCA 2JHEA 1T1CA 3LEQA 2G7UA 2KX6A 4C75A 2GX5A 1ACFA 1OTIA 4PAUA 4X53A 4Z1WA 5HAPA 2VV6A 1AWIA 2WYXA 3W4OA 2R9XA 5EECA 5F82A 3Q82A 4CLCB 4NETA 1GA0A 1LL5A 4E6XA 3VP2A 4EEUA 2VV7A 2XDMA 4MBKA 3V3RA 2ZC7A 3OBFA 3Q7ZA 1PYYA 4UHUA 4S2JA 1KDSA 1L0FA 3W8KA 4UA6A 5J7EA 4GS9A 4HI4A 1IYOA 1P9RA 4N9KA 2X71A 4JXVA 3PBRA 4FOFA 2I72A 3WS0A 4P6ZM 3MBZA 3OPPA 1FSYA 2PYRA 3B42A 3MQ0A 2MJ6A 4KZAA 3LCEA 1ESUA 2CC1A 2YKHA 4GS9B 4UAAA 2J3WA 3A3IA 2BG1A 1F98A 1H8YA 4OPZA 3F1PA 4KZ6A 2V1ZA 3EOIA 4KG5A 2W3EA 5FI6A 4YINA 1VB6A 2J3TC 1G28A 3B33A 3CI6A 3G2YA 1JWZA 2ZOIA 4WF0A 5EVID 1E3UA 3P98A 4HJ4A 2B02A 3IHAA 4LRZE 4B4XA 3F1PB 2Y8HA 3DTMA 4WYYA 1OTAA 2GNXA 4O8GA 1K54C 3CUEC 3VSKA 3LGOA 1O07A 5DF7A 4GOGA 3VOYA 4I3JA 2VK3A 5AVFA 3N8LA 2IWCA 2Y2NA 1RGYA 1GSXA 4LGWA 5FI2A 1N9OA 4WZ5C 1V9ZA 3P09A 4NEED 1YMSA 1BULA 3LEZA 1OTBA 2ZD8A 3SS3A 3LUQA 2WGIA 2OWJA 4K91A 3G4PA 1BTLA 4N1XA 1JVJA 3OLOA 1LI0A 3T4QA 1XFNA 2Y2OA 3IX3A 3EQVA 3T4KA 3LI9A 4IEDA 4E3OA 3IXHA 1FR1A 5TJJA 3T1SA 3KX0X 4N92A 4O7DA 3BYDA 1LT0A 3T1RA 1DY6A 2O9AA 4P87A 4XT2B 1BLPA 2ZBBA 5HWTA 5CGWA 4UQIM 1CEGA 4UA7A 1HLUP 4DXCA 4HNBA 4BMWA 4R0QA 4WEJA 1ONHA 5CHMA 4N9LA 2XLNA 3KSIA 3MR0A 3Q1FA 2W3FA 3V5MA 3G31A 3OZHA 3SS4A 4KG2A 1QMEA 3S7NA 2P7JA 3B47A 3MZDA 2PBYA 4S2MA 3HUOA 5GL9A 3H7WA 1PIOA 3HL9A 3UB6A 2NUPC 4B88A 1FOFA 3D72A 3DTEA 4E3IA 3N7WA 2EXAA 2KDKA 2W3HA 3GECA 3KYEA 3H7WB 3N6IA 2H0YA 3W4QA 4PHTA 5F69A 3NDGA 4E3NA 5CGSA 1KE0A 3BQAA 1EI5A 2JCHA 4DJ2A 1C3BA 4OP8A 1WA9A 1SKOA 4KZ5A 3LIFA 1W8QA 4DDSA 1L0DA 5HZHA 2Y2IA 4OH0A 2I9VA 3BY8A 3VFHA 1ESIA 4EETB 4H6JA 2HP6A 1Y28A 3MZEA 1MZUA 1PFLA 4X69A 1K55A 1SKOB 3ITBA 2QKPA 5A90A 2WKHA 1TS0A 1W8YA 5U47A 4JGPA 2K2NA 3IH8A 5FL3A 1OPXA 2QWSA 2A49A 1PW1A 4BBVA 4B4ZA 1MPLA 5AQAA 1F9IA 2LB9A 3P7NA 3BWLA 2W3GA 3F1NB 1VM1A 3Q81A 4G3VA 1FIKA 2ZMFA 5BOHA 3PR6A 1ZKJA 1DRMA 4HQAA 5EM1A 3QNBA 2LB5A 3UE3A 5IS1A 3QP2A 3IXDA 4KZ9A 4CJNA 1MWUA 4PKYG 2Q9MA 1P97A 1IEMA 5F1GA 4WELA 5EVIC 1K6SA 4ME4A 3NULA 4ZTKA 3DTKA 4EBLA 3ISGA 1HD8A 1IKIA 1W7FA 3ZCZA 2QZ6A 2FFFB 3BECA 4WMCD 4ZDXA 1D7EA 4Y5FA 3V39A 1YLPA 2PAVP 5HWVA 1SZVA 3VE4A 4IJGA 2ZOHA 5GLDA 4PM5A 1H3QA 2A24A 5GLAA 3G6OA 4CLCC 2QYBA 4OVDA 2G2UA 3ZHHA 2JKTI 4WUJA 1YKDA 1TS8A 3EQUA 5FQMA 2RCXA 4MLLA 3BLMA 4EXOA 1TD5A 4NXBA 2A24B 5FQ9A 3T50A 4RVAA 4JF5A 5FSRA 2ACGA 2JC7A 4HHDA 1KOUA 2Y2PA 4DN0A 3EEAA 5EVEA 1G5UA 1D06A 2FH5A 3IXGA 3LR0A 5HL6A 3G2ZA 2V20A 1K4FA 2EFXA 4HH2A 5HDSA 4E3JA 5MC7A 3V3SA 1IYPA 5FDSA 4LRXC 3D3OA 4OQGA 3T12B 2J3TD 4BJPA 3NCKA 4OQ0A 3PBSA 4OLDA 1HZOA 4R3AA 4R23A 2WKPA 3QP6A 3CMZA 2AVXA 3QP4A 4EWFA 1PWDA 4FCFA 3LIAA 1XX2A 2Y2HA 3LY3A 2HZ5A 3NOTC 3E0YA 2X02A 4BENA 2W27A 3EEHA 3SZTA 4XXRA 2ZC6B 3ICYA 4IBRA 4FUWA 1BSGA 4FSFA 3EGXC 4EW7A 1MKIA 4RX3A 4X6TA 2XH9A 2Y59A 4IHQA 1ZG6A 2O0YA 4JF6A 3KYZA 4BLMA 3L9KA 3LICA 5HD5A 3L7HA 4NG2A 4BBUA 2XD5A 5L07A 2J8YA 4HBTA 3SH8A 5CHJA 5FEGA 4Y17A 3VP0A 2QPNA 5F68A 1GSVA 5AQ7A 3VE3A 3KO6A 4FH2A 1SHVA 1ES5A 2Y2LA 3U2AA 5I94A 4GNUA 1XP4A 4GD6A 3C7VA 4R38A 3C30A 4OQHA 5FEFA 5HPFA 3BFFA 3QP5A 3S7QA 2Z2LB 1KE4A 3T4LA 4XUXA 4MEZA 3MQQA 3T4SA 1STZA 2ZQCA 5J4EA 1S66L 3EWKA 1LSVA 5HX9A 3RTYA 4KZ3A 2EX2A 3E98A 4LCMA 4JGOA 1TDLA 3MMHA 2WZXA 3UMEA 4X68A 5D3OA 4YWZA 4UA9A 4U0XA 1YSPA 3FPVA 4K0WA 1KGGA 4QU3A 1H8ZA 1BUEA 3FC7A 2J9OA 4MBHA 3T1XA 3OPRA 2XGNA 1Z6FA 5AVEA 3NOPC 5J3WA 3UDIA 4MNRA 1E4DA 2D01A 3TG9A 3Q7VB 3UN7A 5FQKA 2O9CA 4F94A 3MS6A 4LCLA 1LL9A 3BJNA 3OOVA 3UB9A 4CLCE 4S2NA 3WS1A 1FR6A 3TOIA 2QMIA 4OP5A 5L2FA 4MMNA 4QY5A 4M4XA 3HCYA 4OOMA 3MJQA 4L9GA 4X25A 2L0WA 4HP9A 3BQ8A 1K56A 2EX6A 4JGQA 1IYQA 1NLZA 2UV0E 3GR2A 4B9OA 3F1OA 5DF8A 3UO9A 3WS2A 3E4OA 4CPKA 2VGLS 3SW1A 3GRJA 4OPRA 2PD8A 3LI8A 1LI9A 4WZ4A 4Y2FA 2PHYA 4L0LA 1NRFA 2QHKA 1X0OA 3H9WA 1WE4A 3PBNA 4QHCA 1K55C 1XGIA 3UDFA 4Y7PA 3SH9A 2PYPA 5I5LA 3IQAA 3RJUA 1K38A 2HDQA 4PM7A 1NZOA 4PM6A 4KQOA 3IWQA 1O7EA 3QP8A 3FG8A 2BLSA 1UWNX 5CECA 3DWZA 3LR5A 3WS4A 3PBTA 3NI9A 2QJ5A 1YM1A 4MN6A 5L8MA 2JN7A 3JPUA 4Z9QA 5AJGA 2WKQA 5GHYA 5HDCA 3RFBA 3FZCA 3UPPA 2Z2MB 1BLCA 3ULFA 3G35A 1YLYA 1MC0A 2PR6A 4GLQA 4KQQA 1XJ3A 3CPTA 3MKFA 2V1BA 4CLCD 1ES4A 1N9NA 5A92A 3AGFA 1N4OA 3A0SA 4II7A 3NJAA 2EA9A 3S7OA 1PW8A 1K57A 3NIAA 3PYPA 4X55A 3CPTB 2P9VA 2JKFA 2Y2JA 4LV0A 3T4TA 4JKTA 3FPWA 4EESA 4BL2A 2WADA 1KGFA 2GZAA 4WM9A 1GCEA 2W3DA 2P9VB 4G3KA 4S2PA 4QJGA 1FSWA 3BY9A 5HW3A 5E2GA 1I2SA 3TRCA 4MDZA 3O88A 5KSCA 1S0WA 2QJ7A 4EUZA 1FCNA 2DMWA 2OSUA 3IX4A 5FDHA 2WKEA 3MXRA 2HDUA 2H0TA 1ERQA 3A0VA 4OKPA 2XA7S 3IXBA 3IHBA 2ZM0A 4GN2A 3N8SA 2JKRI 4C3QA 5F5YA 4HY8A 2V2FF 2W1RA 1PWGA 1XJ4A 1E3UD 3C4OA 1TS7A 4IBXA 3HLEA 1JWPA 2BASA 5DKLA 3DWKA 2OAQ1 4HH3A 3E2KA 2FFYA 1RGZA 3HBRA 1DP6A 4X1LA 3P01A 4KZ8A 2V8FA 5HAQA 4NXFA 4QD4A 3BEBA 3IWIA 1OJ5A 3UE1A 3TSGA 2HDRA 1VQQA 2PR5A 3H82A 5FASA 5M18A 4EBNA 4OONA 2C5WB 4ZJ1A 3LR4A 3M6HA 4DDYA 4R3BA 4FD8A 1YMXA 2OLUA 3HJKA 4KQRA 4ESPA 4HESA 2ZQ9A 1I5QA 1KDWA 4Y3IA 1K4EA 2XQZA 3RXXA 1ONGA 2ZQ7A 3S1YA 2L4RA 2IWDA 4WBGA 2R9WA 5EOEA 2WKIA 4OOYA 1PZOA 4H6JB 4JXSA 4R4SA 3ZFZA 2WAEA 3FKWA 5DTTA 1NYMA 1OTEA 4GW9A 2HP5A 2V1AA 2HV1A 4GB7A 3NHQA 3UB5P 1JTGA 1YQSA 4M3KA 2Q9NA 2HP9A 3GV9A 5CTMA 5A91A 2VLGA 3MXQA 3KSHA 3UPOA 3NY4A 2XR0A 4NXGA 5KZHA 2PT7A 4RYEA 4S2LA 3KSGA 2V0WA 5CGXA 4OQIA 1ZG4A 4UQIS 1XA7A 3IX8A 2P74A 3UB7A 2E8IA 3HJIA 2HDSA 2J9PA 4WL9A 1FQGA 3PTEA 1OTDA 3GMWA 3E2LA 4KUOA 1VHMA 1CK3A 2C6WB 1YLZA 3C38A 4ZBEA 1LSWA 1FCOA 2Y79A 3T4OA 2XEPA 3MQOA 4RA7A 5DKKA 3V50A 4R3JA 5FQIA 4U3TA 5A93A 3HLGA 3UB8A 1W79A 5G4ZA 1U60A 2OV5A 3BFGA 5HSQA 4NK3A 1S1ZA 4WEKA 2XSSA 4GD8A 1CF0A 3GSGA 2Q0OA 5E2FA 1H5XA 1GSWA 2H28A 2Z6CA 4IUHA 3UDXA 4ZJ3A 4EUVA 5EE8A 2Y2GA 5L10A 3CJMA 4PM8A 4LPZA 4YOFA 2A2LA 3MZFA 1FILA 1YLTA 1BLHA 3PAGA 3NDEA 1T1AA 4BD0A 4HJ6A 1SDNA 2M7UA 1S1YA 5FAQA 4R70A 4FTXA 4LV1A 3C5AA 4G3WA 4ARZA 4HIAA 2ZQ8A 4MN7A 1D1JA 1NJ4A 4EEPA 1DP8A 4ZRRA 2Y55A 3A3FA 3IBRA 1WYBA 4ETXA 4ARZB 2V0UA 3IF6A 4NKPA 3HVFA 4QY6A 3CWFA 4ETZA 5FAPA 1CJFA 3MF0A 2JKTM 3NECA 5DTKA 1XGJA 2ZM2A 3V67A 1OJGA 2RL3A 3IF6B 1HVBA 4PM9A 2Y2MA 2VGLM 4Q0HA 4X56A 5TFQA 1DJBA 1YLWA 4UEYA 3D9YA 2HF6A 3BLSA 3JYIA 2P04A 4QPRA 2INWA 1XJ6A 1N9BA 4RQ9A 3IWOA 3UY6A 3C8CA 3B3XA 2ZM8A 3WWXA 2R78A 3VP3A 3WRZA 2J7VA 4X1MA 1XXMA 5E2HA 2Y2QA 1PRQA 4WLAA 5CXWA 1Q2PA 2OAP1 4GHIA 1P9WA 1CQAA 4LRYC 3LR3A 2V8CA 2W0NA 3M2JA 3O5YA 4F3LA 5HL1A 3MFDA 3OPHA 5CERA 4BBTA 1L0GA 1MWTA 4DF6A 3A0RA 4GHIB 2V9AA 4DKIA 5DJUA 4KENB 4F3LB 2OWHA 2OLVA 5M19A 3LIEA 5EVIA 1SCWA 1W5DA 4R6LA 1M6KA 3TE8A 1XA1A 4C6YA 2PU2A 4I3IA 2ZC3B 3LFVA 2XD1A 1W63M 3S7PA 5FATA 1KVMA 5IT5A 4L9FA 4Y13A 4I5SA 4JLFA 4Q0JA 3E4QA 5J8XA 3A3EA 4PKYA 5CX7A 5FA7A 1Y54A 3HLCA 4HP4A 1XFQA 2NUTC 3IF5A 5G4YA 5CHUA 4YFMA 3ZNYA 2O99A 1W63Q 3K3CA 4KQDA 3MSHA 2Y91A 1PI5A 4N1HA 4XUZA 1PNEA 5HDDA 5DF9A 3UE6A 5TBMA 4BQMA 1F2KA 2K31A 4KG6A 1L3LA 4Y0OA 2VX8A 3BW6A 5GLBA 2J80A 2XA7M 4H8RA 2ZC5B 4O0PA 1RCJA 1MWSA 3NOUC 2XRNA 4GCZA 1DJAA 1CI9A 3F1OB
chains in the Genus database with same CATH topology
2FFFB 3BECA 3C4PA 3IXBA 2Y2KA 4WMCD 1RP5A 4QB8A 3IHBA 4ZDXA 1IELA 3GTCA 3V39A 3ZDJA 1L0EA 1YLPA 3BFDA 3HUNA 1BLSA 1K57C 1GA9A 2ZM0A 4GN2A 3N8SA 4U0TA 4C3QA 3CZDA 4EBPA 4E6WA 2EX8A 2V2FF 5GLDA 1PWGA 4Y0TA 3W4PA 4PM5A 2WK0A 1E3UD 3C4OA 4JBFA 2XFSA 5DTSA 5GLAA 3VP1A 2ZQAA 2X01A 2ZC4B 3G34A 3HLEA 1JWPA 4IBXA 3VP4A 5E43A 2ZQDA 4JF4A 4OVDA 4DE2A 3DWKA 2G2UA 4E3LA 3ZHHA 2HPBA 3E2KA 3ZVTA 2FFYA 1RGZA 3HBRA 5FAOA 3EQUA 5CEDA 4HEFA 4KZ8A 5FQMA 5HAQA 2RCXA 5TR7A 4QD4A 4MLLA 3BEBA 3BLMA 1NZUA 4ID4A 3FV7A 3IWIA 4LV2A 5GLCA 4MBFA 3UE1A 3TSGA 3GVBA 2HDRA 3SS5A 1VQQA 1YT4A 4R1GA 1I2WA 5FQ9A 5FI7A 2JE5A 5EPHA 4RVAA 3ITAA 4JF5A 5FSRA 5FASA 5M18A 2JC7A 3ZNTA 4EBNA 3IT9A 1XPBA 4OONA 2C5WB 1K6RA 2Y2PA 3ZGAB 4ZJ1A 3M6HA 3S22A 3O86A 3VFFA 3IXGA 4DDYA 4R3BA 4FD8A 1GHMA 1YMXA 2H10A 2OLUA 3G2ZA 5M1AA 1PWCA 4JPMA 4KQRA 1BT5A 2V20A 1K4FA 2EFXA 3I7JA 3LO7A 4HESA 1G68A 4E3JA 2IWBA 3V3SA 4GKUA 1AXBA 1IYPA 2ZQ9A 3ZVWA 3Q7VA 1I5QA 1KDWA 2EFUA 5EOOA 1BZAA 4Q8IA 5HAIA 1K4EA 1E25A 1LHYA 2XQZA 4OQGA 5EVIB 4BJPA 3RXXA 1ONGA 3NCKA 1KGEA 2JBFA 2ZQ7A 3S1YA 2IWDA 4OQ0A 4WBGA 3PBSA 4OLDA 3CG5A 5KSHA 1SKFA 2R9WA 3D4FA 4S2KA 5EOEA 1HZOA 2WKIA 5FQJA 4OOYA 5CEBA 3VSLA 1PZOA 2G2WA 5JYPA 1OMEA 3OCLA 4JXSA 4R23A 4R4SA 4Y0UA 5G18A 5F83A 2WAEA 3ZFZA 1G6AA 4DE1A 3FKWA 5DTTA 3CMZA 4EWFA 1NYMA 1PWDA 4RX2A 4FCFA 4C75A 2HP5A 1K56D 1XX2A 2Y2HA 3LY3A 4GB7A 4X53A 1EWZA 5HAPA 1WYCA 2X02A 1JTGA 4BENA 1YQSA 4M3KA 2Q9NA 4ZJ2A 2WGWA 2WYXA 5AQBA 1IKGA 1NY0A 2HP9A 3GV9A 4XXRA 2ZC6B 2R9XA 5CTMA 4IBRA 5EECA 5F82A 3Q82A 1BSGA 3W4OA 3UPNA 4FSFA 4NETA 1GA0A 3UPOA 3NY4A 1LL5A 1KVLA 2XR0A 4E6XA 3VP2A 1MKIA 4RX3A 4X6TA 2XDMA 2XH9A 1GHIA 2Y59A 5KZHA 1ZG6A 4S2IA 4RYEA 4DXBA 4MBKA 4S2LA 2ZC7A 3V3RA 1JTDA 3Q7ZA 4JF6A 4DE0A 5IHVA 1K25A 1PYYA 2WGWB 4BLMA 4UHUA 3PBQA 3GQZA 5CGXA 2ZLYA 1ZG4A 4OQIA 4S2JA 1XA7A 1KDSA 1L0FA 4KZBA 4UA6A 3W8KA 2P74A 2XD5A 4P85A 1IYOA 4N9KA 2X71A 4JXVA 2E8IA 3PBRA 2XFTA 2I72A 2J8YA 3WS0A 4HBTA 2HDSA 3MBZA 3SH8A 3OPPA 5CHJA 1FSYA 2J9PA 1DJCA 2ZJ9A 3N8RA 2QPNA 3VP0A 1FQGA 3ZG9B 3S4XA 3Q07A 4KZAA 3PTEA 4GZBA 3LCEA 5AQ7A 3GMWA 4FH2A 3E2LA 1MXOA 1SHVA 1ES5A 5CRFA 1MY8A 1ESUA 4R4RA 1CK3A 2H5SA 2C6WB 2Y2LA 3ZG7B 1YLZA 1SDEA 2CC1A 4HBUA 2EXBA 4UAAA 1NXYA 4ZBEA 1FCMA 1FCOA 4GNUA 5I94A 3A3IA 1EROA 5EUAA 2BG1A 2XEPA 1XP4A 4GD6A 2Y4AA 1H8YA 3C7VA 5GHZA 3O3VA 3M2KA 3C7UA 4BD1A 4OPZA 4WMCA 4OQHA 3VOZA 3BRMA 4KZ6A 4RA7A 2V1ZA 5E2EA 3BFFA 3V50A 4R3JA 5FQIA 1PI4A 4U3TA 2Z2LB 5A93A 3HLGA 4KG5A 5FI6A 5GHXA 4YINA 1KE4A 2B5RA 1W79A 4XUXA 4MEZA 3SOIA 3G32A 1U60A 2OV5A 3BFGA 3G2YA 1JWZA 2WUQA 5EVLA 3DW0A 3IF6C 2ZQCA 4NK3A 4WEKA 1NYYA 5KMWA 5EVID 1E3UA 4GD8A 3P98A 4OPYA 3IHAA 4B4XA 5HX9A 3GSGA 1IYSA 5E2FA 3DTMA 4WYYA 1H5XA 4KZ3A 4IVIA 4OLGA 4LV3A 1K54C 2EX2A 5JYOA 3VSKA 1JWVA 4LCMA 3UDXA 1O07A 1TDLA 3NBLA 4ZJ3A 5DF7A 4JXWA 5EE8A 2WZXA 4GOGA 3VOYA 2VGJA 1MBLA 2Y2GA 3N8LA 1M40A 4E3MA 4X68A 2IWCA 3CJMA 5D3OA 1TDGA 4PM8A 4UA9A 4U0XA 3UE0A 2Y2NA 3AGDA 3MZFA 1YLTA 1RGYA 1KGGA 4K0WA 3MXSA 2A3UA 1BLHA 3AGEA 4QU3A 1H8ZA 3PAGA 5FI2A 4BL3A 1BUEA 5A91A 4WZ5C 3NDEA 2J9OA 4BD0A 3PAEA 3PBOA 1SDNA 1J9MA 4MBHA 5FAQA 3P09A 3OPRA 4LV1A 2XGNA 1YMSA 1Z6FA 3C5AA 1BULA 3UDIA 3LEZA 4MNRA 1E4DA 2ZD8A 3TG9A 2ZQ8A 3Q7VB 3SS3A 3ZG0A 3UN7A 1NJ4A 2WGIA 3FKVA 4K91A 3G4PA 1BTLA 4N1XA 5FQKA 4F94A 4LCLA 4IVKA 1JVJA 1LL9A 2Y55A 2DRWA 1LI0A 3A3FA 1ERMA 2Y2OA 1ZC2A 4S2NA 3EQVA 4IEDA 1WYBA 3HLDA 3WS1A 4E3OA 3IXHA 1FR1A 1CEFA 1FR6A 3TOIA 2QMIA 5F1FA 4OP5A 5L2FA 3OPLA 3IF6A 4QY5A 4EQIA 4N92A 4OOMA 4O7DA 3HVFA 4QY6A 3BYDA 4KZ7A 1DY6A 5FAPA 4P87A 1BLPA 1KE3A 5CGWA 3A3JA 1K56A 5DTKA 1K54A 4LENA 1XGJA 2EX6A 1CEGA 2DNSA 4OOLA 4UA7A 3G30A 1IYQA 2ZM2A 4DXCA 2RL3A 3GR2A 3IF6B 2XK1A 4R0QA 1HVBA 1ONHA 4PM9A 4WEJA 2Y2MA 5CHMA 4OPQA 1TVFA 4N9LA 5DF8A 2XLNA 3UO9A 3WS2A 4X56A 3Q1FA 5TFQA 4EV4A 3V5MA 4CPKA 3G31A 3HUMA 4D2OA 3GRJA 1PZPA 1DJBA 1YLWA 2WZZA 4OPRA 3OZHA 4WZ5A 1CI8A 1LI9A 4WZ4A 4L0LA 4A5RA 4KZ4A 1NRFA 4KG2A 1QMEA 3BLSA 3HLWA 3SS4A 4DE3A 3IH9A 3JYIA 1N9BA 1WE4A 3MZDA 2PBYA 3IWOA 3PBNA 3NC8A 3UY6A 3HREA 4S2MA 4QHCA 3HUOA 3B3XA 2ZM8A 5GL9A 1K55C 1XGIA 3WWXA 2GDNA 1PIOA 2PU4A 3HL9A 3O87A 3UDFA 3VP3A 4S2OA 1YLJA 4Y7PA 3OC2A 5DVAA 4B88A 2DCFA 4S2NC 1FOFA 3WRZA 3SH9A 2J7VA 3IQAA 3RJUA 1K38A 1XXMA 2HDQA 4PM7A 3ZG8B 4E3IA 5E2HA 3QNCA 2Y2QA 1NZOA 1ES2A 3QHYA 4PM6A 5CXWA 4KQOA 3IWQA 2WAFA 1O7EA 1Q2PA 3N7WA 2EXAA 1XKZA 1ES3A 2BLSA 4ZAMA 1L2SA 3M2JA 3N6IA 5HL1A 2H0YA 3M6BA 3W4QA 5CECA 3DWZA 3MFDA 3FYZA 3NDGA 3WS5A 3LY4A 3WS4A 3RXWA 3PBTA 4E3NA 5CGSA 3NI9A 1KE0A 3OPHA 5CERA 4GDNA 1YM1A 1EI5A 2JCHA 1L0GA 4Z9QA 1MWTA 3HLBA 1C3BA 5GHYA 4DF6A 5HARA 3MKEA 4OP8A 3FZCA 3UPPA 2Z2MB 3ZG5A 4DKIA 1BLCA 3SH7A 4KENB 2ZMAA 2OLVA 4KZ5A 4P0MA 3G35A 5M19A 5FQQA 1MWRA 2XF3A 1W8QA 5EVIA 1SCWA 1YLYA 4DDSA 1W5DA 1L0DA 2UWXA 3FWLA 1M6KA 2Y2IA 4KQQA 1XA1A 5CTNA 4C6YA 4OH0A 2PU2A 3MKFA 1S6RA 1ES4A 2WGVA 3VFHA 1ESIA 5A92A 2HP6A 2ZC3B 3AGFA 1N4OA 3MZEA 2XD1A 4DRTA 4X69A 3HLFA 5FATA 1K55A 2EX9A 3ITBA 1KVMA 1PW8A 5A90A 1K57A 2WKHA 1HTZA 1W8YA 3NIAA 4P6BA 4JLFA 5U47A 5J8XA 4X55A 2P9VA 3A3EA 3BFEA 5FA7A 3BM6A 3IH8A 1Y54A 2Y2JA 3HLCA 2A49A 1PW1A 4E3KA 4LV0A 4JKTA 4B4ZA 3IF5A 1MPLA 5AQAA 4BL2A 4JXGA 1QMFA 2WADA 5CHUA 1KGFA 3A3DA 4YFMA 3ZNYA 4WM9A 5AQ9A 1GCEA 1VM1A 1ALQA 3Q81A 2VGKA 2P9VB 3WRTA 5BOHA 1ZKJA 1LLBA 4S2PA 4QJGA 1FSWA 2Y91A 1PI5A 3OCNA 4N1HA 4PPRA 4XUZA 5TGFA 3QNBA 5HW3A 5E2GA 3UE3A 1I2SA 5HFOA 3IXDA 3O88A 4KZ9A 5DF9A 4CJNA 4FH4A 1S0WA 4BQMA 3VMAA 5KSCA 1MWUA 4GDBA 4EUZA 4KG6A 2Q9MA 1FCNA 4Y0OA 2OSUA 1IEMA 5F1GA 5FDHA 4WELA 5EVIC 2WKEA 5GLBA 3MXRA 1K6SA 2HDUA 2H0TA 1ERQA 1Q2QA 4PMAA 4ZTKA 4H8RA 2ZC5B 1GHPA 1RCJA 1MWSA 3UNWA 1TEMA 4EBLA 3ISGA 3N4IA 1HD8A 3BFCA 4K0XA 1DJAA 1CI9A 1IKIA 1W7FA 3ZCZA 4OKPA 2QZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFF B;  3BEC A;  3C4P A;  3IXB A;  2Y2K A;  4WMC D;  1RP5 A;  4QB8 A;  3IHB A;  4ZDX A;  1IEL A;  3GTC A;  3V39 A;  3ZDJ A;  1L0E A;  1YLP A;  3BFD A;  3HUN A;  1BLS A;  1K57 C;  1GA9 A;  2ZM0 A;  4GN2 A;  3N8S A;  4U0T A;  4C3Q A;  3CZD A;  4EBP A;  4E6W A;  2EX8 A;  2V2F F;  5GLD A;  1PWG A;  4Y0T A;  3W4P A;  4PM5 A;  2WK0 A;  1E3U D;  3C4O A;  4JBF A;  2XFS A;  5DTS A;  5GLA A;  3VP1 A;  2ZQA A;  2X01 A;  2ZC4 B;  3G34 A;  3HLE A;  1JWP A;  4IBX A;  3VP4 A;  5E43 A;  2ZQD A;  4JF4 A;  4OVD A;  4DE2 A;  3DWK A;  2G2U A;  4E3L A;  3ZHH A;  2HPB A;  3E2K A;  3ZVT A;  2FFY A;  1RGZ A;  3HBR A;  5FAO A;  3EQU A;  5CED A;  4HEF A;  4KZ8 A;  5FQM A;  5HAQ A;  2RCX A;  5TR7 A;  4QD4 A;  4MLL A;  3BEB A;  3BLM A;  1NZU A;  4ID4 A;  3FV7 A;  3IWI A;  4LV2 A;  5GLC A;  4MBF A;  3UE1 A;  3TSG A;  3GVB A;  2HDR A;  3SS5 A;  1VQQ A;  1YT4 A;  4R1G A;  1I2W A;  5FQ9 A;  5FI7 A;  2JE5 A;  5EPH A;  4RVA A;  3ITA A;  4JF5 A;  5FSR A;  5FAS A;  5M18 A;  2JC7 A;  3ZNT A;  4EBN A;  3IT9 A;  1XPB A;  4OON A;  2C5W B;  1K6R A;  2Y2P A;  3ZGA B;  4ZJ1 A;  3M6H A;  3S22 A;  3O86 A;  3VFF A;  3IXG A;  4DDY A;  4R3B A;  4FD8 A;  1GHM A;  1YMX A;  2H10 A;  2OLU A;  3G2Z A;  5M1A A;  1PWC A;  4JPM A;  4KQR A;  1BT5 A;  2V20 A;  1K4F A;  2EFX A;  3I7J A;  3LO7 A;  4HES A;  1G68 A;  4E3J A;  2IWB A;  3V3S A;  4GKU A;  1AXB A;  1IYP A;  2ZQ9 A;  3ZVW A;  3Q7V A;  1I5Q A;  1KDW A;  2EFU A;  5EOO A;  1BZA A;  4Q8I A;  5HAI A;  1K4E A;  1E25 A;  1LHY A;  2XQZ A;  4OQG A;  5EVI B;  4BJP A;  3RXX A;  1ONG A;  3NCK A;  1KGE A;  2JBF A;  2ZQ7 A;  3S1Y A;  2IWD A;  4OQ0 A;  4WBG A;  3PBS A;  4OLD A;  3CG5 A;  5KSH A;  1SKF A;  2R9W A;  3D4F A;  4S2K A;  5EOE A;  1HZO A;  2WKI A;  5FQJ A;  4OOY A;  5CEB A;  3VSL A;  1PZO A;  2G2W A;  5JYP A;  1OME A;  3OCL A;  4JXS A;  4R23 A;  4R4S A;  4Y0U A;  5G18 A;  5F83 A;  2WAE A;  3ZFZ A;  1G6A A;  4DE1 A;  3FKW A;  5DTT A;  3CMZ A;  4EWF A;  1NYM A;  1PWD A;  4RX2 A;  4FCF A;  4C75 A;  2HP5 A;  1K56 D;  1XX2 A;  2Y2H A;  3LY3 A;  4GB7 A;  4X53 A;  1EWZ A;  5HAP A;  1WYC A;  2X02 A;  1JTG A;  4BEN A;  1YQS A;  4M3K A;  2Q9N A;  4ZJ2 A;  2WGW A;  2WYX A;  5AQB A;  1IKG A;  1NY0 A;  2HP9 A;  3GV9 A;  4XXR A;  2ZC6 B;  2R9X A;  5CTM A;  4IBR A;  5EEC A;  5F82 A;  3Q82 A;  1BSG A;  3W4O A;  3UPN A;  4FSF A;  4NET A;  1GA0 A;  3UPO A;  3NY4 A;  1LL5 A;  1KVL A;  2XR0 A;  4E6X A;  3VP2 A;  1MKI A;  4RX3 A;  4X6T A;  2XDM A;  2XH9 A;  1GHI A;  2Y59 A;  5KZH A;  1ZG6 A;  4S2I A;  4RYE A;  4DXB A;  4MBK A;  4S2L A;  2ZC7 A;  3V3R A;  1JTD A;  3Q7Z A;  4JF6 A;  4DE0 A;  5IHV A;  1K25 A;  1PYY A;  2WGW B;  4BLM A;  4UHU A;  3PBQ A;  3GQZ A;  5CGX A;  2ZLY A;  1ZG4 A;  4OQI A;  4S2J A;  1XA7 A;  1KDS A;  1L0F A;  4KZB A;  4UA6 A;  3W8K A;  2P74 A;  2XD5 A;  4P85 A;  1IYO A;  4N9K A;  2X71 A;  4JXV A;  2E8I A;  3PBR A;  2XFT A;  2I72 A;  2J8Y A;  3WS0 A;  4HBT A;  2HDS A;  3MBZ A;  3SH8 A;  3OPP A;  5CHJ A;  1FSY A;  2J9P A;  1DJC A;  2ZJ9 A;  3N8R A;  2QPN A;  3VP0 A;  1FQG A;  3ZG9 B;  3S4X A;  3Q07 A;  4KZA A;  3PTE A;  4GZB A;  3LCE A;  5AQ7 A;  3GMW A;  4FH2 A;  3E2L A;  1MXO A;  1SHV A;  1ES5 A;  5CRF A;  1MY8 A;  1ESU A;  4R4R A;  1CK3 A;  2H5S A;  2C6W B;  2Y2L A;  3ZG7 B;  1YLZ A;  1SDE A;  2CC1 A;  4HBU A;  2EXB A;  4UAA A;  1NXY A;  4ZBE A;  1FCM A;  1FCO A;  4GNU A;  5I94 A;  3A3I A;  1ERO A;  5EUA A;  2BG1 A;  2XEP A;  1XP4 A;  4GD6 A;  2Y4A A;  1H8Y A;  3C7V A;  5GHZ A;  3O3V A;  3M2K A;  3C7U A;  4BD1 A;  4OPZ A;  4WMC A;  4OQH A;  3VOZ A;  3BRM A;  4KZ6 A;  4RA7 A;  2V1Z A;  5E2E A;  3BFF A;  3V50 A;  4R3J A;  5FQI A;  1PI4 A;  4U3T A;  2Z2L B;  5A93 A;  3HLG A;  4KG5 A;  5FI6 A;  5GHX A;  4YIN A;  1KE4 A;  2B5R A;  1W79 A;  4XUX A;  4MEZ A;  3SOI A;  3G32 A;  1U60 A;  2OV5 A;  3BFG A;  3G2Y A;  1JWZ A;  2WUQ A;  5EVL A;  3DW0 A;  3IF6 C;  2ZQC A;  4NK3 A;  4WEK A;  1NYY A;  5KMW A;  5EVI D;  1E3U A;  4GD8 A;  3P98 A;  4OPY A;  3IHA A;  4B4X A;  5HX9 A;  3GSG A;  1IYS A;  5E2F A;  3DTM A;  4WYY A;  1H5X A;  4KZ3 A;  4IVI A;  4OLG A;  4LV3 A;  1K54 C;  2EX2 A;  5JYO A;  3VSK A;  1JWV A;  4LCM A;  3UDX A;  1O07 A;  1TDL A;  3NBL A;  4ZJ3 A;  5DF7 A;  4JXW A;  5EE8 A;  2WZX A;  4GOG A;  3VOY A;  2VGJ A;  1MBL A;  2Y2G A;  3N8L A;  1M40 A;  4E3M A;  4X68 A;  2IWC A;  3CJM A;  5D3O A;  1TDG A;  4PM8 A;  4UA9 A;  4U0X A;  3UE0 A;  2Y2N A;  3AGD A;  3MZF A;  1YLT A;  1RGY A;  1KGG A;  4K0W A;  3MXS A;  2A3U A;  1BLH A;  3AGE A;  4QU3 A;  1H8Z A;  3PAG A;  5FI2 A;  4BL3 A;  1BUE A;  5A91 A;  4WZ5 C;  3NDE A;  2J9O A;  4BD0 A;  3PAE A;  3PBO A;  1SDN A;  1J9M A;  4MBH A;  5FAQ A;  3P09 A;  3OPR A;  4LV1 A;  2XGN A;  1YMS A;  1Z6F A;  3C5A A;  1BUL A;  3UDI A;  3LEZ A;  4MNR A;  1E4D A;  2ZD8 A;  3TG9 A;  2ZQ8 A;  3Q7V B;  3SS3 A;  3ZG0 A;  3UN7 A;  1NJ4 A;  2WGI A;  3FKV A;  4K91 A;  3G4P A;  1BTL A;  4N1X A;  5FQK A;  4F94 A;  4LCL A;  4IVK A;  1JVJ A;  1LL9 A;  2Y55 A;  2DRW A;  1LI0 A;  3A3F A;  1ERM A;  2Y2O A;  1ZC2 A;  4S2N A;  3EQV A;  4IED A;  1WYB A;  3HLD A;  3WS1 A;  4E3O A;  3IXH A;  1FR1 A;  1CEF A;  1FR6 A;  3TOI A;  2QMI A;  5F1F A;  4OP5 A;  5L2F A;  3OPL A;  3IF6 A;  4QY5 A;  4EQI A;  4N92 A;  4OOM A;  4O7D A;  3HVF A;  4QY6 A;  3BYD A;  4KZ7 A;  1DY6 A;  5FAP A;  4P87 A;  1BLP A;  1KE3 A;  5CGW A;  3A3J A;  1K56 A;  5DTK A;  1K54 A;  4LEN A;  1XGJ A;  2EX6 A;  1CEG A;  2DNS A;  4OOL A;  4UA7 A;  3G30 A;  1IYQ A;  2ZM2 A;  4DXC A;  2RL3 A;  3GR2 A;  3IF6 B;  2XK1 A;  4R0Q A;  1HVB A;  1ONH A;  4PM9 A;  4WEJ A;  2Y2M A;  5CHM A;  4OPQ A;  1TVF A;  4N9L A;  5DF8 A;  2XLN A;  3UO9 A;  3WS2 A;  4X56 A;  3Q1F A;  5TFQ A;  4EV4 A;  3V5M A;  4CPK A;  3G31 A;  3HUM A;  4D2O A;  3GRJ A;  1PZP A;  1DJB A;  1YLW A;  2WZZ A;  4OPR A;  3OZH A;  4WZ5 A;  1CI8 A;  1LI9 A;  4WZ4 A;  4L0L A;  4A5R A;  4KZ4 A;  1NRF A;  4KG2 A;  1QME A;  3BLS A;  3HLW A;  3SS4 A;  4DE3 A;  3IH9 A;  3JYI A;  1N9B A;  1WE4 A;  3MZD A;  2PBY A;  3IWO A;  3PBN A;  3NC8 A;  3UY6 A;  3HRE A;  4S2M A;  4QHC A;  3HUO A;  3B3X A;  2ZM8 A;  5GL9 A;  1K55 C;  1XGI A;  3WWX A;  2GDN A;  1PIO A;  2PU4 A;  3HL9 A;  3O87 A;  3UDF A;  3VP3 A;  4S2O A;  1YLJ A;  4Y7P A;  3OC2 A;  5DVA A;  4B88 A;  2DCF A;  4S2N C;  1FOF A;  3WRZ A;  3SH9 A;  2J7V A;  3IQA A;  3RJU A;  1K38 A;  1XXM A;  2HDQ A;  4PM7 A;  3ZG8 B;  4E3I A;  5E2H A;  3QNC A;  2Y2Q A;  1NZO A;  1ES2 A;  3QHY A;  4PM6 A;  5CXW A;  4KQO A;  3IWQ A;  2WAF A;  1O7E A;  1Q2P A;  3N7W A;  2EXA A;  1XKZ A;  1ES3 A;  2BLS A;  4ZAM A;  1L2S A;  3M2J A;  3N6I A;  5HL1 A;  2H0Y A;  3M6B A;  3W4Q A;  5CEC A;  3DWZ A;  3MFD A;  3FYZ A;  3NDG A;  3WS5 A;  3LY4 A;  3WS4 A;  3RXW A;  3PBT A;  4E3N A;  5CGS A;  3NI9 A;  1KE0 A;  3OPH A;  5CER A;  4GDN A;  1YM1 A;  1EI5 A;  2JCH A;  1L0G A;  4Z9Q A;  1MWT A;  3HLB A;  1C3B A;  5GHY A;  4DF6 A;  5HAR A;  3MKE A;  4OP8 A;  3FZC A;  3UPP A;  2Z2M B;  3ZG5 A;  4DKI A;  1BLC A;  3SH7 A;  4KEN B;  2ZMA A;  2OLV A;  4KZ5 A;  4P0M A;  3G35 A;  5M19 A;  5FQQ A;  1MWR A;  2XF3 A;  1W8Q A;  5EVI A;  1SCW A;  1YLY A;  4DDS A;  1W5D A;  1L0D A;  2UWX A;  3FWL A;  1M6K A;  2Y2I A;  4KQQ A;  1XA1 A;  5CTN A;  4C6Y A;  4OH0 A;  2PU2 A;  3MKF A;  1S6R A;  1ES4 A;  2WGV A;  3VFH A;  1ESI A;  5A92 A;  2HP6 A;  2ZC3 B;  3AGF A;  1N4O A;  3MZE A;  2XD1 A;  4DRT A;  4X69 A;  3HLF A;  5FAT A;  1K55 A;  2EX9 A;  3ITB A;  1KVM A;  1PW8 A;  5A90 A;  1K57 A;  2WKH A;  1HTZ A;  1W8Y A;  3NIA A;  4P6B A;  4JLF A;  5U47 A;  5J8X A;  4X55 A;  2P9V A;  3A3E A;  3BFE A;  5FA7 A;  3BM6 A;  3IH8 A;  1Y54 A;  2Y2J A;  3HLC A;  2A49 A;  1PW1 A;  4E3K A;  4LV0 A;  4JKT A;  4B4Z A;  3IF5 A;  1MPL A;  5AQA A;  4BL2 A;  4JXG A;  1QMF A;  2WAD A;  5CHU A;  1KGF A;  3A3D A;  4YFM A;  3ZNY A;  4WM9 A;  5AQ9 A;  1GCE A;  1VM1 A;  1ALQ A;  3Q81 A;  2VGK A;  2P9V B;  3WRT A;  5BOH A;  1ZKJ A;  1LLB A;  4S2P A;  4QJG A;  1FSW A;  2Y91 A;  1PI5 A;  3OCN A;  4N1H A;  4PPR A;  4XUZ A;  5TGF A;  3QNB A;  5HW3 A;  5E2G A;  3UE3 A;  1I2S A;  5HFO A;  3IXD A;  3O88 A;  4KZ9 A;  5DF9 A;  4CJN A;  4FH4 A;  1S0W A;  4BQM A;  3VMA A;  5KSC A;  1MWU A;  4GDB A;  4EUZ A;  4KG6 A;  2Q9M A;  1FCN A;  4Y0O A;  2OSU A;  1IEM A;  5F1G A;  5FDH A;  4WEL A;  5EVI C;  2WKE A;  5GLB A;  3MXR A;  1K6S A;  2HDU A;  2H0T A;  1ERQ A;  1Q2Q A;  4PMA A;  4ZTK A;  4H8R A;  2ZC5 B;  1GHP A;  1RCJ A;  1MWS A;  3UNW A;  1TEM A;  4EBL A;  3ISG A;  3N4I A;  1HD8 A;  3BFC A;  4K0X A;  1DJA A;  1CI9 A;  1IKI A;  1W7F A;  3ZCZ A;  4OKP A;  2QZ6 A; 
#chains in the Genus database with same CATH topology
 2Y2K A;  5TBM B;  1VET A;  1Z09 A;  3ZDJ A;  1L0E A;  3HUN A;  1BLS A;  1V9Y A;  4U0T A;  4E6W A;  1K0K A;  4Y0T A;  3W4P A;  5KIZ A;  2WK0 A;  1T18 A;  3JVU A;  2ZQA A;  2X01 A;  1VET B;  3G34 A;  4JF4 A;  4DE2 A;  3ZVT A;  2HPB A;  3T4J A;  2HJ9 C;  5FAO A;  4HEF A;  5TR7 A;  4HOI A;  2PRF A;  1NZU A;  4ID4 A;  4IUK A;  3GVB A;  3SS5 A;  1YT4 A;  3KYQ A;  1I2W A;  2P08 A;  5FI7 A;  5EPH A;  3ITA A;  1Y4O A;  1XPB A;  2HGV A;  1K6R A;  3ZGA B;  5HD3 A;  1JNU A;  3O86 A;  3VFF A;  1H0M A;  1GHM A;  2H10 A;  5M1A A;  1PWC A;  4JPM A;  1BT5 A;  3I7J A;  3LO7 A;  2FZ0 A;  2PBD P;  2IWB A;  4GKU A;  1AXB A;  1BZA A;  5HAI A;  2E8J A;  4EU0 A;  2KOI A;  2M7V A;  1E25 A;  1LHY A;  2VZW A;  4EER A;  3CG5 A;  5KSH A;  1SKF A;  3D4F A;  4S2K A;  5FQJ A;  4L9E A;  3VV4 A;  5CEB A;  3VSL A;  5JYP A;  3LYX A;  5F83 A;  1G6A A;  4DE1 A;  1UGU A;  4RX2 A;  1K56 D;  1ZTU A;  1MKM A;  4XT2 A;  1EWZ A;  1WYC A;  4ZJ2 A;  4I38 A;  2WGW A;  4E04 A;  5AQB A;  1IKG A;  1NY0 A;  4GJ4 A;  4QWO A;  4MN5 A;  3UPN A;  3C2W A;  4I3A A;  4MCW A;  1KVL A;  5K5B A;  3CIT A;  1GHI A;  4S2I A;  5DFX A;  4DXB A;  1J3W A;  1JTD A;  4DE0 A;  5IHV A;  1K25 A;  2WGW B;  3KSF A;  3PBQ A;  3GQZ A;  3ZQ5 A;  2ZLY A;  1NWZ A;  3CLO A;  3CAX A;  4KZB A;  2EWW A;  4P85 A;  2XFT A;  3DAV A;  3ZG9 B;  1DJC A;  2ZJ9 A;  1P0Z A;  3N8R A;  3S4X A;  3Q07 A;  4GZB A;  4P6Z S;  1MXO A;  2BTF P;  5CRF A;  1MY8 A;  4R4R A;  2H5S A;  3ZG7 B;  1SDE A;  4HJ3 A;  4HBU A;  2EXB A;  3R4K A;  1NXY A;  1FCM A;  1ERO A;  5EUA A;  2Y4A A;  5GHZ A;  3O3V A;  3M2K A;  3C7U A;  4BD1 A;  4WMC A;  3VOZ A;  3BRM A;  5E2E A;  5IU1 A;  1PI4 A;  3TW8 A;  4I39 A;  2ZMV A;  5GHX A;  2B5R A;  3SOI A;  3G32 A;  5EV0 A;  2D02 A;  2WUQ A;  5EVL A;  3DW0 A;  3IF6 C;  1NYY A;  5KMW A;  4OPY A;  1S4S A;  1IYS A;  2VEA A;  4IVI A;  4OLG A;  4LV3 A;  5JYO A;  1JWV A;  3RH8 B;  2YKF A;  3NBL A;  2XRO A;  4JXW A;  2VGJ A;  1MBL A;  2KLI A;  1M40 A;  4E3M A;  1A0K A;  3H82 B;  3U4L P;  1TDG A;  2JKG A;  3UE0 A;  1BYW A;  3AGD A;  4NXE A;  3DBA A;  3MXS A;  2A3U A;  3AGE A;  4BL3 A;  2VV8 A;  1YAX A;  3PAE A;  3PBO A;  2IA2 A;  1J9M A;  1OT9 A;  2B18 A;  3LID A;  2VKS A;  3ZG0 A;  3FKV A;  3QP1 A;  3GDI A;  4IVK A;  2DRW A;  3F1N A;  1ERM A;  1ZC2 A;  2JKR M;  3HLD A;  1CEF A;  3K2N A;  5F1F A;  2WKR A;  3OPL A;  4EQI A;  2W1T A;  4Y15 A;  2ZL1 A;  1S4R A;  2HJE A;  4KZ7 A;  1KE3 A;  4AFI A;  2M1C A;  3A3J A;  1H8M A;  1K54 A;  4LEN A;  3CUE A;  4OOL A;  2DNS A;  3G30 A;  4Q0I A;  2XK1 A;  4OPQ A;  1TVF A;  2W1T B;  4EQ1 A;  2ZL1 B;  4DJ3 A;  4EV4 A;  3HUM A;  4D2O A;  1PZP A;  4YNR A;  2WZZ A;  1IOU A;  1TF1 A;  2Z6D A;  4WZ5 A;  1CI8 A;  4A5R A;  4KZ4 A;  3HLW A;  4DE3 A;  3IH9 A;  3IBJ A;  3LIB A;  5A8B A;  1ZHH B;  3NC8 A;  3HRE A;  2GDN A;  2PU4 A;  3O87 A;  4S2O A;  1YLJ A;  3PHY A;  3OC2 A;  5DVA A;  2DCF A;  4S2N C;  1F5M A;  2VA0 A;  3T1Q B;  2K7S A;  3ZG8 B;  1LL8 A;  1YSQ A;  3QNC A;  1ES2 A;  3QHY A;  1DP9 A;  2WAF A;  1XKZ A;  1ES3 A;  4ZAM A;  1L2S A;  3M6B A;  2GJ3 A;  3FYZ A;  3WS5 A;  3LY4 A;  2OOL A;  3RXW A;  4GDN A;  4CQH A;  3R7W A;  1OT6 A;  3HLB A;  5C5K A;  3ZYT A;  3JVV A;  5HAR A;  1G6O A;  3MKE A;  1UWP X;  5EM0 A;  2CMN A;  3ZG5 A;  3SH7 A;  1S67 L;  1N9L A;  2ZMA A;  4P0M A;  5FQQ A;  1MWR A;  2XF3 A;  3FWL A;  2UWX A;  5L09 A;  5CTN A;  1T1B A;  3R7W B;  1S6R A;  2WGV A;  4KUK A;  4DRT A;  3HLF A;  5F6A A;  2EX9 A;  1HTZ A;  4P6B A;  1VEU A;  3TJZ C;  3BFE A;  2O9B A;  3BM6 A;  4E3K A;  4B93 A;  4JXG A;  1QMF A;  4LFU A;  3A3D A;  2PDR A;  5AQ9 A;  1VEU B;  1ALQ A;  2VGK A;  3WRT A;  1LLB A;  3OCN A;  4PPR A;  5TGF A;  3EGD C;  5HFO A;  4FH4 A;  3VMA A;  4GDB A;  4DMZ A;  1XJ2 A;  1YPR A;  4WN5 A;  1IFQ A;  1TS6 A;  1LSX A;  1NRJ A;  1Q2Q A;  1T19 A;  4PMA A;  3UNW A;  1GHP A;  3IS2 A;  3K3D A;  1TEM A;  3N4I A;  3BFC A;  4K0X A;  5HPI A;  3C4P A;  1RP5 A;  4QB8 A;  3DTI A;  1IEL A;  3GTC A;  2EWV A;  2PD7 A;  3BFD A;  1K57 C;  1GA9 A;  2VJW A;  3CHW P;  3CZD A;  3PXP A;  4EBP A;  3IS2 B;  2EX8 A;  5DJT A;  4JBF A;  2XFS A;  5DTS A;  5DFY A;  3VP1 A;  2ZC4 B;  3VP4 A;  5EFW A;  5E43 A;  2ZQD A;  4LLO B;  3UMD A;  4E3L A;  3MFX A;  5CED A;  3W2Z A;  3FV7 A;  4LV2 A;  5GLC A;  4MBF A;  5HWW A;  4R1G A;  1EW0 A;  2JE5 A;  1NLY A;  5LBR A;  3ZNT A;  3IT9 A;  4JGR A;  3S22 A;  2L1M A;  2B95 A;  4D60 A;  1ODV A;  1G68 A;  3ZVW A;  4K08 A;  3Q7V A;  2EFU A;  5EOO A;  4O01 A;  4Q8I A;  5EVI B;  1KGE A;  2JBF A;  4BWI A;  2G2W A;  1OME A;  3OCL A;  3E4P A;  3VOL A;  4Y0U A;  5G18 A;  4CLC A;  2JHE A;  1T1C A;  3LEQ A;  2G7U A;  2KX6 A;  4C75 A;  2GX5 A;  1ACF A;  1OTI A;  4PAU A;  4X53 A;  4Z1W A;  5HAP A;  2VV6 A;  1AWI A;  2WYX A;  3W4O A;  2R9X A;  5EEC A;  5F82 A;  3Q82 A;  4CLC B;  4NET A;  1GA0 A;  1LL5 A;  4E6X A;  3VP2 A;  4EEU A;  2VV7 A;  2XDM A;  4MBK A;  3V3R A;  2ZC7 A;  3OBF A;  3Q7Z A;  1PYY A;  4UHU A;  4S2J A;  1KDS A;  1L0F A;  3W8K A;  4UA6 A;  5J7E A;  4GS9 A;  4HI4 A;  1IYO A;  1P9R A;  4N9K A;  2X71 A;  4JXV A;  3PBR A;  4FOF A;  2I72 A;  3WS0 A;  4P6Z M;  3MBZ A;  3OPP A;  1FSY A;  2PYR A;  3B42 A;  3MQ0 A;  2MJ6 A;  4KZA A;  3LCE A;  1ESU A;  2CC1 A;  2YKH A;  4GS9 B;  4UAA A;  2J3W A;  3A3I A;  2BG1 A;  1F98 A;  1H8Y A;  4OPZ A;  3F1P A;  4KZ6 A;  2V1Z A;  3EOI A;  4KG5 A;  2W3E A;  5FI6 A;  4YIN A;  1VB6 A;  2J3T C;  1G28 A;  3B33 A;  3CI6 A;  3G2Y A;  1JWZ A;  2ZOI A;  4WF0 A;  5EVI D;  1E3U A;  3P98 A;  4HJ4 A;  2B02 A;  3IHA A;  4LRZ E;  4B4X A;  3F1P B;  2Y8H A;  3DTM A;  4WYY A;  1OTA A;  2GNX A;  4O8G A;  1K54 C;  3CUE C;  3VSK A;  3LGO A;  1O07 A;  5DF7 A;  4GOG A;  3VOY A;  4I3J A;  2VK3 A;  5AVF A;  3N8L A;  2IWC A;  2Y2N A;  1RGY A;  1GSX A;  4LGW A;  5FI2 A;  1N9O A;  4WZ5 C;  1V9Z A;  3P09 A;  4NEE D;  1YMS A;  1BUL A;  3LEZ A;  1OTB A;  2ZD8 A;  3SS3 A;  3LUQ A;  2WGI A;  2OWJ A;  4K91 A;  3G4P A;  1BTL A;  4N1X A;  1JVJ A;  3OLO A;  1LI0 A;  3T4Q A;  1XFN A;  2Y2O A;  3IX3 A;  3EQV A;  3T4K A;  3LI9 A;  4IED A;  4E3O A;  3IXH A;  1FR1 A;  5TJJ A;  3T1S A;  3KX0 X;  4N92 A;  4O7D A;  3BYD A;  1LT0 A;  3T1R A;  1DY6 A;  2O9A A;  4P87 A;  4XT2 B;  1BLP A;  2ZBB A;  5HWT A;  5CGW A;  4UQI M;  1CEG A;  4UA7 A;  1HLU P;  4DXC A;  4HNB A;  4BMW A;  4R0Q A;  4WEJ A;  1ONH A;  5CHM A;  4N9L A;  2XLN A;  3KSI A;  3MR0 A;  3Q1F A;  2W3F A;  3V5M A;  3G31 A;  3OZH A;  3SS4 A;  4KG2 A;  1QME A;  3S7N A;  2P7J A;  3B47 A;  3MZD A;  2PBY A;  4S2M A;  3HUO A;  5GL9 A;  3H7W A;  1PIO A;  3HL9 A;  3UB6 A;  2NUP C;  4B88 A;  1FOF A;  3D72 A;  3DTE A;  4E3I A;  3N7W A;  2EXA A;  2KDK A;  2W3H A;  3GEC A;  3KYE A;  3H7W B;  3N6I A;  2H0Y A;  3W4Q A;  4PHT A;  5F69 A;  3NDG A;  4E3N A;  5CGS A;  1KE0 A;  3BQA A;  1EI5 A;  2JCH A;  4DJ2 A;  1C3B A;  4OP8 A;  1WA9 A;  1SKO A;  4KZ5 A;  3LIF A;  1W8Q A;  4DDS A;  1L0D A;  5HZH A;  2Y2I A;  4OH0 A;  2I9V A;  3BY8 A;  3VFH A;  1ESI A;  4EET B;  4H6J A;  2HP6 A;  1Y28 A;  3MZE A;  1MZU A;  1PFL A;  4X69 A;  1K55 A;  1SKO B;  3ITB A;  2QKP A;  5A90 A;  2WKH A;  1TS0 A;  1W8Y A;  5U47 A;  4JGP A;  2K2N A;  3IH8 A;  5FL3 A;  1OPX A;  2QWS A;  2A49 A;  1PW1 A;  4BBV A;  4B4Z A;  1MPL A;  5AQA A;  1F9I A;  2LB9 A;  3P7N A;  3BWL A;  2W3G A;  3F1N B;  1VM1 A;  3Q81 A;  4G3V A;  1FIK A;  2ZMF A;  5BOH A;  3PR6 A;  1ZKJ A;  1DRM A;  4HQA A;  5EM1 A;  3QNB A;  2LB5 A;  3UE3 A;  5IS1 A;  3QP2 A;  3IXD A;  4KZ9 A;  4CJN A;  1MWU A;  4PKY G;  2Q9M A;  1P97 A;  1IEM A;  5F1G A;  4WEL A;  5EVI C;  1K6S A;  4ME4 A;  3NUL A;  4ZTK A;  3DTK A;  4EBL A;  3ISG A;  1HD8 A;  1IKI A;  1W7F A;  3ZCZ A;  2QZ6 A;  2FFF B;  3BEC A;  4WMC D;  4ZDX A;  1D7E A;  4Y5F A;  3V39 A;  1YLP A;  2PAV P;  5HWV A;  1SZV A;  3VE4 A;  4IJG A;  2ZOH A;  5GLD A;  4PM5 A;  1H3Q A;  2A24 A;  5GLA A;  3G6O A;  4CLC C;  2QYB A;  4OVD A;  2G2U A;  3ZHH A;  2JKT I;  4WUJ A;  1YKD A;  1TS8 A;  3EQU A;  5FQM A;  2RCX A;  4MLL A;  3BLM A;  4EXO A;  1TD5 A;  4NXB A;  2A24 B;  5FQ9 A;  3T50 A;  4RVA A;  4JF5 A;  5FSR A;  2ACG A;  2JC7 A;  4HHD A;  1KOU A;  2Y2P A;  4DN0 A;  3EEA A;  5EVE A;  1G5U A;  1D06 A;  2FH5 A;  3IXG A;  3LR0 A;  5HL6 A;  3G2Z A;  2V20 A;  1K4F A;  2EFX A;  4HH2 A;  5HDS A;  4E3J A;  5MC7 A;  3V3S A;  1IYP A;  5FDS A;  4LRX C;  3D3O A;  4OQG A;  3T12 B;  2J3T D;  4BJP A;  3NCK A;  4OQ0 A;  3PBS A;  4OLD A;  1HZO A;  4R3A A;  4R23 A;  2WKP A;  3QP6 A;  3CMZ A;  2AVX A;  3QP4 A;  4EWF A;  1PWD A;  4FCF A;  3LIA A;  1XX2 A;  2Y2H A;  3LY3 A;  2HZ5 A;  3NOT C;  3E0Y A;  2X02 A;  4BEN A;  2W27 A;  3EEH A;  3SZT A;  4XXR A;  2ZC6 B;  3ICY A;  4IBR A;  4FUW A;  1BSG A;  4FSF A;  3EGX C;  4EW7 A;  1MKI A;  4RX3 A;  4X6T A;  2XH9 A;  2Y59 A;  4IHQ A;  1ZG6 A;  2O0Y A;  4JF6 A;  3KYZ A;  4BLM A;  3L9K A;  3LIC A;  5HD5 A;  3L7H A;  4NG2 A;  4BBU A;  2XD5 A;  5L07 A;  2J8Y A;  4HBT A;  3SH8 A;  5CHJ A;  5FEG A;  4Y17 A;  3VP0 A;  2QPN A;  5F68 A;  1GSV A;  5AQ7 A;  3VE3 A;  3KO6 A;  4FH2 A;  1SHV A;  1ES5 A;  2Y2L A;  3U2A A;  5I94 A;  4GNU A;  1XP4 A;  4GD6 A;  3C7V A;  4R38 A;  3C30 A;  4OQH A;  5FEF A;  5HPF A;  3BFF A;  3QP5 A;  3S7Q A;  2Z2L B;  1KE4 A;  3T4L A;  4XUX A;  4MEZ A;  3MQQ A;  3T4S A;  1STZ A;  2ZQC A;  5J4E A;  1S66 L;  3EWK A;  1LSV A;  5HX9 A;  3RTY A;  4KZ3 A;  2EX2 A;  3E98 A;  4LCM A;  4JGO A;  1TDL A;  3MMH A;  2WZX A;  3UME A;  4X68 A;  5D3O A;  4YWZ A;  4UA9 A;  4U0X A;  1YSP A;  3FPV A;  4K0W A;  1KGG A;  4QU3 A;  1H8Z A;  1BUE A;  3FC7 A;  2J9O A;  4MBH A;  3T1X A;  3OPR A;  2XGN A;  1Z6F A;  5AVE A;  3NOP C;  5J3W A;  3UDI A;  4MNR A;  1E4D A;  2D01 A;  3TG9 A;  3Q7V B;  3UN7 A;  5FQK A;  2O9C A;  4F94 A;  3MS6 A;  4LCL A;  1LL9 A;  3BJN A;  3OOV A;  3UB9 A;  4CLC E;  4S2N A;  3WS1 A;  1FR6 A;  3TOI A;  2QMI A;  4OP5 A;  5L2F A;  4MMN A;  4QY5 A;  4M4X A;  3HCY A;  4OOM A;  3MJQ A;  4L9G A;  4X25 A;  2L0W A;  4HP9 A;  3BQ8 A;  1K56 A;  2EX6 A;  4JGQ A;  1IYQ A;  1NLZ A;  2UV0 E;  3GR2 A;  4B9O A;  3F1O A;  5DF8 A;  3UO9 A;  3WS2 A;  3E4O A;  4CPK A;  2VGL S;  3SW1 A;  3GRJ A;  4OPR A;  2PD8 A;  3LI8 A;  1LI9 A;  4WZ4 A;  4Y2F A;  2PHY A;  4L0L A;  1NRF A;  2QHK A;  1X0O A;  3H9W A;  1WE4 A;  3PBN A;  4QHC A;  1K55 C;  1XGI A;  3UDF A;  4Y7P A;  3SH9 A;  2PYP A;  5I5L A;  3IQA A;  3RJU A;  1K38 A;  2HDQ A;  4PM7 A;  1NZO A;  4PM6 A;  4KQO A;  3IWQ A;  1O7E A;  3QP8 A;  3FG8 A;  2BLS A;  1UWN X;  5CEC A;  3DWZ A;  3LR5 A;  3WS4 A;  3PBT A;  3NI9 A;  2QJ5 A;  1YM1 A;  4MN6 A;  5L8M A;  2JN7 A;  3JPU A;  4Z9Q A;  5AJG A;  2WKQ A;  5GHY A;  5HDC A;  3RFB A;  3FZC A;  3UPP A;  2Z2M B;  1BLC A;  3ULF A;  3G35 A;  1YLY A;  1MC0 A;  2PR6 A;  4GLQ A;  4KQQ A;  1XJ3 A;  3CPT A;  3MKF A;  2V1B A;  4CLC D;  1ES4 A;  1N9N A;  5A92 A;  3AGF A;  1N4O A;  3A0S A;  4II7 A;  3NJA A;  2EA9 A;  3S7O A;  1PW8 A;  1K57 A;  3NIA A;  3PYP A;  4X55 A;  3CPT B;  2P9V A;  2JKF A;  2Y2J A;  4LV0 A;  3T4T A;  4JKT A;  3FPW A;  4EES A;  4BL2 A;  2WAD A;  1KGF A;  2GZA A;  4WM9 A;  1GCE A;  2W3D A;  2P9V B;  4G3K A;  4S2P A;  4QJG A;  1FSW A;  3BY9 A;  5HW3 A;  5E2G A;  1I2S A;  3TRC A;  4MDZ A;  3O88 A;  5KSC A;  1S0W A;  2QJ7 A;  4EUZ A;  1FCN A;  2DMW A;  2OSU A;  3IX4 A;  5FDH A;  2WKE A;  3MXR A;  2HDU A;  2H0T A;  1ERQ A;  3A0V A;  4OKP A;  2XA7 S;  3IXB A;  3IHB A;  2ZM0 A;  4GN2 A;  3N8S A;  2JKR I;  4C3Q A;  5F5Y A;  4HY8 A;  2V2F F;  2W1R A;  1PWG A;  1XJ4 A;  1E3U D;  3C4O A;  1TS7 A;  4IBX A;  3HLE A;  1JWP A;  2BAS A;  5DKL A;  3DWK A;  2OAQ 1;  4HH3 A;  3E2K A;  2FFY A;  1RGZ A;  3HBR A;  1DP6 A;  4X1L A;  3P01 A;  4KZ8 A;  2V8F A;  5HAQ A;  4NXF A;  4QD4 A;  3BEB A;  3IWI A;  1OJ5 A;  3UE1 A;  3TSG A;  2HDR A;  1VQQ A;  2PR5 A;  3H82 A;  5FAS A;  5M18 A;  4EBN A;  4OON A;  2C5W B;  4ZJ1 A;  3LR4 A;  3M6H A;  4DDY A;  4R3B A;  4FD8 A;  1YMX A;  2OLU A;  3HJK A;  4KQR A;  4ESP A;  4HES A;  2ZQ9 A;  1I5Q A;  1KDW A;  4Y3I A;  1K4E A;  2XQZ A;  3RXX A;  1ONG A;  2ZQ7 A;  3S1Y A;  2L4R A;  2IWD A;  4WBG A;  2R9W A;  5EOE A;  2WKI A;  4OOY A;  1PZO A;  4H6J B;  4JXS A;  4R4S A;  3ZFZ A;  2WAE A;  3FKW A;  5DTT A;  1NYM A;  1OTE A;  4GW9 A;  2HP5 A;  2V1A A;  2HV1 A;  4GB7 A;  3NHQ A;  3UB5 P;  1JTG A;  1YQS A;  4M3K A;  2Q9N A;  2HP9 A;  3GV9 A;  5CTM A;  5A91 A;  2VLG A;  3MXQ A;  3KSH A;  3UPO A;  3NY4 A;  2XR0 A;  4NXG A;  5KZH A;  2PT7 A;  4RYE A;  4S2L A;  3KSG A;  2V0W A;  5CGX A;  4OQI A;  1ZG4 A;  4UQI S;  1XA7 A;  3IX8 A;  2P74 A;  3UB7 A;  2E8I A;  3HJI A;  2HDS A;  2J9P A;  4WL9 A;  1FQG A;  3PTE A;  1OTD A;  3GMW A;  3E2L A;  4KUO A;  1VHM A;  1CK3 A;  2C6W B;  1YLZ A;  3C38 A;  4ZBE A;  1LSW A;  1FCO A;  2Y79 A;  3T4O A;  2XEP A;  3MQO A;  4RA7 A;  5DKK A;  3V50 A;  4R3J A;  5FQI A;  4U3T A;  5A93 A;  3HLG A;  3UB8 A;  1W79 A;  5G4Z A;  1U60 A;  2OV5 A;  3BFG A;  5HSQ A;  4NK3 A;  1S1Z A;  4WEK A;  2XSS A;  4GD8 A;  1CF0 A;  3GSG A;  2Q0O A;  5E2F A;  1H5X A;  1GSW A;  2H28 A;  2Z6C A;  4IUH A;  3UDX A;  4ZJ3 A;  4EUV A;  5EE8 A;  2Y2G A;  5L10 A;  3CJM A;  4PM8 A;  4LPZ A;  4YOF A;  2A2L A;  3MZF A;  1FIL A;  1YLT A;  1BLH A;  3PAG A;  3NDE A;  1T1A A;  4BD0 A;  4HJ6 A;  1SDN A;  2M7U A;  1S1Y A;  5FAQ A;  4R70 A;  4FTX A;  4LV1 A;  3C5A A;  4G3W A;  4ARZ A;  4HIA A;  2ZQ8 A;  4MN7 A;  1D1J A;  1NJ4 A;  4EEP A;  1DP8 A;  4ZRR A;  2Y55 A;  3A3F A;  3IBR A;  1WYB A;  4ETX A;  4ARZ B;  2V0U A;  3IF6 A;  4NKP A;  3HVF A;  4QY6 A;  3CWF A;  4ETZ A;  5FAP A;  1CJF A;  3MF0 A;  2JKT M;  3NEC A;  5DTK A;  1XGJ A;  2ZM2 A;  3V67 A;  1OJG A;  2RL3 A;  3IF6 B;  1HVB A;  4PM9 A;  2Y2M A;  2VGL M;  4Q0H A;  4X56 A;  5TFQ A;  1DJB A;  1YLW A;  4UEY A;  3D9Y A;  2HF6 A;  3BLS A;  3JYI A;  2P04 A;  4QPR A;  2INW A;  1XJ6 A;  1N9B A;  4RQ9 A;  3IWO A;  3UY6 A;  3C8C A;  3B3X A;  2ZM8 A;  3WWX A;  2R78 A;  3VP3 A;  3WRZ A;  2J7V A;  4X1M A;  1XXM A;  5E2H A;  2Y2Q A;  1PRQ A;  4WLA A;  5CXW A;  1Q2P A;  2OAP 1;  4GHI A;  1P9W A;  1CQA A;  4LRY C;  3LR3 A;  2V8C A;  2W0N A;  3M2J A;  3O5Y A;  4F3L A;  5HL1 A;  3MFD A;  3OPH A;  5CER A;  4BBT A;  1L0G A;  1MWT A;  4DF6 A;  3A0R A;  4GHI B;  2V9A A;  4DKI A;  5DJU A;  4KEN B;  4F3L B;  2OWH A;  2OLV A;  5M19 A;  3LIE A;  5EVI A;  1SCW A;  1W5D A;  4R6L A;  1M6K A;  3TE8 A;  1XA1 A;  4C6Y A;  2PU2 A;  4I3I A;  2ZC3 B;  3LFV A;  2XD1 A;  1W63 M;  3S7P A;  5FAT A;  1KVM A;  5IT5 A;  4L9F A;  4Y13 A;  4I5S A;  4JLF A;  4Q0J A;  3E4Q A;  5J8X A;  3A3E A;  4PKY A;  5CX7 A;  5FA7 A;  1Y54 A;  3HLC A;  4HP4 A;  1XFQ A;  2NUT C;  3IF5 A;  5G4Y A;  5CHU A;  4YFM A;  3ZNY A;  2O99 A;  1W63 Q;  3K3C A;  4KQD A;  3MSH A;  2Y91 A;  1PI5 A;  4N1H A;  4XUZ A;  1PNE A;  5HDD A;  5DF9 A;  3UE6 A;  5TBM A;  4BQM A;  1F2K A;  2K31 A;  4KG6 A;  1L3L A;  4Y0O A;  2VX8 A;  3BW6 A;  5GLB A;  2J80 A;  2XA7 M;  4H8R A;  2ZC5 B;  4O0P A;  1RCJ A;  1MWS A;  3NOU C;  2XRN A;  4GCZ A;  1DJA A;  1CI9 A;  3F1O B; 
#chains in the Genus database with same CATH homology
 2FFF B;  3BEC A;  3C4P A;  3IXB A;  2Y2K A;  4WMC D;  1RP5 A;  4QB8 A;  3IHB A;  4ZDX A;  1IEL A;  3GTC A;  3V39 A;  3ZDJ A;  1L0E A;  1YLP A;  3BFD A;  3HUN A;  1BLS A;  1K57 C;  1GA9 A;  2ZM0 A;  4GN2 A;  3N8S A;  4U0T A;  4C3Q A;  3CZD A;  4EBP A;  4E6W A;  2EX8 A;  2V2F F;  5GLD A;  1PWG A;  4Y0T A;  3W4P A;  4PM5 A;  2WK0 A;  1E3U D;  3C4O A;  4JBF A;  2XFS A;  5DTS A;  5GLA A;  3VP1 A;  2ZQA A;  2X01 A;  2ZC4 B;  3G34 A;  3HLE A;  1JWP A;  4IBX A;  3VP4 A;  5E43 A;  2ZQD A;  4JF4 A;  4OVD A;  4DE2 A;  3DWK A;  2G2U A;  4E3L A;  3ZHH A;  2HPB A;  3E2K A;  3ZVT A;  2FFY A;  1RGZ A;  3HBR A;  5FAO A;  3EQU A;  5CED A;  4HEF A;  4KZ8 A;  5FQM A;  5HAQ A;  2RCX A;  5TR7 A;  4QD4 A;  4MLL A;  3BEB A;  3BLM A;  1NZU A;  4ID4 A;  3FV7 A;  3IWI A;  4LV2 A;  5GLC A;  4MBF A;  3UE1 A;  3TSG A;  3GVB A;  2HDR A;  3SS5 A;  1VQQ A;  1YT4 A;  4R1G A;  1I2W A;  5FQ9 A;  5FI7 A;  2JE5 A;  5EPH A;  4RVA A;  3ITA A;  4JF5 A;  5FSR A;  5FAS A;  5M18 A;  2JC7 A;  3ZNT A;  4EBN A;  3IT9 A;  1XPB A;  4OON A;  2C5W B;  1K6R A;  2Y2P A;  3ZGA B;  4ZJ1 A;  3M6H A;  3S22 A;  3O86 A;  3VFF A;  3IXG A;  4DDY A;  4R3B A;  4FD8 A;  1GHM A;  1YMX A;  2H10 A;  2OLU A;  3G2Z A;  5M1A A;  1PWC A;  4JPM A;  4KQR A;  1BT5 A;  2V20 A;  1K4F A;  2EFX A;  3I7J A;  3LO7 A;  4HES A;  1G68 A;  4E3J A;  2IWB A;  3V3S A;  4GKU A;  1AXB A;  1IYP A;  2ZQ9 A;  3ZVW A;  3Q7V A;  1I5Q A;  1KDW A;  2EFU A;  5EOO A;  1BZA A;  4Q8I A;  5HAI A;  1K4E A;  1E25 A;  1LHY A;  2XQZ A;  4OQG A;  5EVI B;  4BJP A;  3RXX A;  1ONG A;  3NCK A;  1KGE A;  2JBF A;  2ZQ7 A;  3S1Y A;  2IWD A;  4OQ0 A;  4WBG A;  3PBS A;  4OLD A;  3CG5 A;  5KSH A;  1SKF A;  2R9W A;  3D4F A;  4S2K A;  5EOE A;  1HZO A;  2WKI A;  5FQJ A;  4OOY A;  5CEB A;  3VSL A;  1PZO A;  2G2W A;  5JYP A;  1OME A;  3OCL A;  4JXS A;  4R23 A;  4R4S A;  4Y0U A;  5G18 A;  5F83 A;  2WAE A;  3ZFZ A;  1G6A A;  4DE1 A;  3FKW A;  5DTT A;  3CMZ A;  4EWF A;  1NYM A;  1PWD A;  4RX2 A;  4FCF A;  4C75 A;  2HP5 A;  1K56 D;  1XX2 A;  2Y2H A;  3LY3 A;  4GB7 A;  4X53 A;  1EWZ A;  5HAP A;  1WYC A;  2X02 A;  1JTG A;  4BEN A;  1YQS A;  4M3K A;  2Q9N A;  4ZJ2 A;  2WGW A;  2WYX A;  5AQB A;  1IKG A;  1NY0 A;  2HP9 A;  3GV9 A;  4XXR A;  2ZC6 B;  2R9X A;  5CTM A;  4IBR A;  5EEC A;  5F82 A;  3Q82 A;  1BSG A;  3W4O A;  3UPN A;  4FSF A;  4NET A;  1GA0 A;  3UPO A;  3NY4 A;  1LL5 A;  1KVL A;  2XR0 A;  4E6X A;  3VP2 A;  1MKI A;  4RX3 A;  4X6T A;  2XDM A;  2XH9 A;  1GHI A;  2Y59 A;  5KZH A;  1ZG6 A;  4S2I A;  4RYE A;  4DXB A;  4MBK A;  4S2L A;  2ZC7 A;  3V3R A;  1JTD A;  3Q7Z A;  4JF6 A;  4DE0 A;  5IHV A;  1K25 A;  1PYY A;  2WGW B;  4BLM A;  4UHU A;  3PBQ A;  3GQZ A;  5CGX A;  2ZLY A;  1ZG4 A;  4OQI A;  4S2J A;  1XA7 A;  1KDS A;  1L0F A;  4KZB A;  4UA6 A;  3W8K A;  2P74 A;  2XD5 A;  4P85 A;  1IYO A;  4N9K A;  2X71 A;  4JXV A;  2E8I A;  3PBR A;  2XFT A;  2I72 A;  2J8Y A;  3WS0 A;  4HBT A;  2HDS A;  3MBZ A;  3SH8 A;  3OPP A;  5CHJ A;  1FSY A;  2J9P A;  1DJC A;  2ZJ9 A;  3N8R A;  2QPN A;  3VP0 A;  1FQG A;  3ZG9 B;  3S4X A;  3Q07 A;  4KZA A;  3PTE A;  4GZB A;  3LCE A;  5AQ7 A;  3GMW A;  4FH2 A;  3E2L A;  1MXO A;  1SHV A;  1ES5 A;  5CRF A;  1MY8 A;  1ESU A;  4R4R A;  1CK3 A;  2H5S A;  2C6W B;  2Y2L A;  3ZG7 B;  1YLZ A;  1SDE A;  2CC1 A;  4HBU A;  2EXB A;  4UAA A;  1NXY A;  4ZBE A;  1FCM A;  1FCO A;  4GNU A;  5I94 A;  3A3I A;  1ERO A;  5EUA A;  2BG1 A;  2XEP A;  1XP4 A;  4GD6 A;  2Y4A A;  1H8Y A;  3C7V A;  5GHZ A;  3O3V A;  3M2K A;  3C7U A;  4BD1 A;  4OPZ A;  4WMC A;  4OQH A;  3VOZ A;  3BRM A;  4KZ6 A;  4RA7 A;  2V1Z A;  5E2E A;  3BFF A;  3V50 A;  4R3J A;  5FQI A;  1PI4 A;  4U3T A;  2Z2L B;  5A93 A;  3HLG A;  4KG5 A;  5FI6 A;  5GHX A;  4YIN A;  1KE4 A;  2B5R A;  1W79 A;  4XUX A;  4MEZ A;  3SOI A;  3G32 A;  1U60 A;  2OV5 A;  3BFG A;  3G2Y A;  1JWZ A;  2WUQ A;  5EVL A;  3DW0 A;  3IF6 C;  2ZQC A;  4NK3 A;  4WEK A;  1NYY A;  5KMW A;  5EVI D;  1E3U A;  4GD8 A;  3P98 A;  4OPY A;  3IHA A;  4B4X A;  5HX9 A;  3GSG A;  1IYS A;  5E2F A;  3DTM A;  4WYY A;  1H5X A;  4KZ3 A;  4IVI A;  4OLG A;  4LV3 A;  1K54 C;  2EX2 A;  5JYO A;  3VSK A;  1JWV A;  4LCM A;  3UDX A;  1O07 A;  1TDL A;  3NBL A;  4ZJ3 A;  5DF7 A;  4JXW A;  5EE8 A;  2WZX A;  4GOG A;  3VOY A;  2VGJ A;  1MBL A;  2Y2G A;  3N8L A;  1M40 A;  4E3M A;  4X68 A;  2IWC A;  3CJM A;  5D3O A;  1TDG A;  4PM8 A;  4UA9 A;  4U0X A;  3UE0 A;  2Y2N A;  3AGD A;  3MZF A;  1YLT A;  1RGY A;  1KGG A;  4K0W A;  3MXS A;  2A3U A;  1BLH A;  3AGE A;  4QU3 A;  1H8Z A;  3PAG A;  5FI2 A;  4BL3 A;  1BUE A;  5A91 A;  4WZ5 C;  3NDE A;  2J9O A;  4BD0 A;  3PAE A;  3PBO A;  1SDN A;  1J9M A;  4MBH A;  5FAQ A;  3P09 A;  3OPR A;  4LV1 A;  2XGN A;  1YMS A;  1Z6F A;  3C5A A;  1BUL A;  3UDI A;  3LEZ A;  4MNR A;  1E4D A;  2ZD8 A;  3TG9 A;  2ZQ8 A;  3Q7V B;  3SS3 A;  3ZG0 A;  3UN7 A;  1NJ4 A;  2WGI A;  3FKV A;  4K91 A;  3G4P A;  1BTL A;  4N1X A;  5FQK A;  4F94 A;  4LCL A;  4IVK A;  1JVJ A;  1LL9 A;  2Y55 A;  2DRW A;  1LI0 A;  3A3F A;  1ERM A;  2Y2O A;  1ZC2 A;  4S2N A;  3EQV A;  4IED A;  1WYB A;  3HLD A;  3WS1 A;  4E3O A;  3IXH A;  1FR1 A;  1CEF A;  1FR6 A;  3TOI A;  2QMI A;  5F1F A;  4OP5 A;  5L2F A;  3OPL A;  3IF6 A;  4QY5 A;  4EQI A;  4N92 A;  4OOM A;  4O7D A;  3HVF A;  4QY6 A;  3BYD A;  4KZ7 A;  1DY6 A;  5FAP A;  4P87 A;  1BLP A;  1KE3 A;  5CGW A;  3A3J A;  1K56 A;  5DTK A;  1K54 A;  4LEN A;  1XGJ A;  2EX6 A;  1CEG A;  2DNS A;  4OOL A;  4UA7 A;  3G30 A;  1IYQ A;  2ZM2 A;  4DXC A;  2RL3 A;  3GR2 A;  3IF6 B;  2XK1 A;  4R0Q A;  1HVB A;  1ONH A;  4PM9 A;  4WEJ A;  2Y2M A;  5CHM A;  4OPQ A;  1TVF A;  4N9L A;  5DF8 A;  2XLN A;  3UO9 A;  3WS2 A;  4X56 A;  3Q1F A;  5TFQ A;  4EV4 A;  3V5M A;  4CPK A;  3G31 A;  3HUM A;  4D2O A;  3GRJ A;  1PZP A;  1DJB A;  1YLW A;  2WZZ A;  4OPR A;  3OZH A;  4WZ5 A;  1CI8 A;  1LI9 A;  4WZ4 A;  4L0L A;  4A5R A;  4KZ4 A;  1NRF A;  4KG2 A;  1QME A;  3BLS A;  3HLW A;  3SS4 A;  4DE3 A;  3IH9 A;  3JYI A;  1N9B A;  1WE4 A;  3MZD A;  2PBY A;  3IWO A;  3PBN A;  3NC8 A;  3UY6 A;  3HRE A;  4S2M A;  4QHC A;  3HUO A;  3B3X A;  2ZM8 A;  5GL9 A;  1K55 C;  1XGI A;  3WWX A;  2GDN A;  1PIO A;  2PU4 A;  3HL9 A;  3O87 A;  3UDF A;  3VP3 A;  4S2O A;  1YLJ A;  4Y7P A;  3OC2 A;  5DVA A;  4B88 A;  2DCF A;  4S2N C;  1FOF A;  3WRZ A;  3SH9 A;  2J7V A;  3IQA A;  3RJU A;  1K38 A;  1XXM A;  2HDQ A;  4PM7 A;  3ZG8 B;  4E3I A;  5E2H A;  3QNC A;  2Y2Q A;  1NZO A;  1ES2 A;  3QHY A;  4PM6 A;  5CXW A;  4KQO A;  3IWQ A;  2WAF A;  1O7E A;  1Q2P A;  3N7W A;  2EXA A;  1XKZ A;  1ES3 A;  2BLS A;  4ZAM A;  1L2S A;  3M2J A;  3N6I A;  5HL1 A;  2H0Y A;  3M6B A;  3W4Q A;  5CEC A;  3DWZ A;  3MFD A;  3FYZ A;  3NDG A;  3WS5 A;  3LY4 A;  3WS4 A;  3RXW A;  3PBT A;  4E3N A;  5CGS A;  3NI9 A;  1KE0 A;  3OPH A;  5CER A;  4GDN A;  1YM1 A;  1EI5 A;  2JCH A;  1L0G A;  4Z9Q A;  1MWT A;  3HLB A;  1C3B A;  5GHY A;  4DF6 A;  5HAR A;  3MKE A;  4OP8 A;  3FZC A;  3UPP A;  2Z2M B;  3ZG5 A;  4DKI A;  1BLC A;  3SH7 A;  4KEN B;  2ZMA A;  2OLV A;  4KZ5 A;  4P0M A;  3G35 A;  5M19 A;  5FQQ A;  1MWR A;  2XF3 A;  1W8Q A;  5EVI A;  1SCW A;  1YLY A;  4DDS A;  1W5D A;  1L0D A;  2UWX A;  3FWL A;  1M6K A;  2Y2I A;  4KQQ A;  1XA1 A;  5CTN A;  4C6Y A;  4OH0 A;  2PU2 A;  3MKF A;  1S6R A;  1ES4 A;  2WGV A;  3VFH A;  1ESI A;  5A92 A;  2HP6 A;  2ZC3 B;  3AGF A;  1N4O A;  3MZE A;  2XD1 A;  4DRT A;  4X69 A;  3HLF A;  5FAT A;  1K55 A;  2EX9 A;  3ITB A;  1KVM A;  1PW8 A;  5A90 A;  1K57 A;  2WKH A;  1HTZ A;  1W8Y A;  3NIA A;  4P6B A;  4JLF A;  5U47 A;  5J8X A;  4X55 A;  2P9V A;  3A3E A;  3BFE A;  5FA7 A;  3BM6 A;  3IH8 A;  1Y54 A;  2Y2J A;  3HLC A;  2A49 A;  1PW1 A;  4E3K A;  4LV0 A;  4JKT A;  4B4Z A;  3IF5 A;  1MPL A;  5AQA A;  4BL2 A;  4JXG A;  1QMF A;  2WAD A;  5CHU A;  1KGF A;  3A3D A;  4YFM A;  3ZNY A;  4WM9 A;  5AQ9 A;  1GCE A;  1VM1 A;  1ALQ A;  3Q81 A;  2VGK A;  2P9V B;  3WRT A;  5BOH A;  1ZKJ A;  1LLB A;  4S2P A;  4QJG A;  1FSW A;  2Y91 A;  1PI5 A;  3OCN A;  4N1H A;  4PPR A;  4XUZ A;  5TGF A;  3QNB A;  5HW3 A;  5E2G A;  3UE3 A;  1I2S A;  5HFO A;  3IXD A;  3O88 A;  4KZ9 A;  5DF9 A;  4CJN A;  4FH4 A;  1S0W A;  4BQM A;  3VMA A;  5KSC A;  1MWU A;  4GDB A;  4EUZ A;  4KG6 A;  2Q9M A;  1FCN A;  4Y0O A;  2OSU A;  1IEM A;  5F1G A;  5FDH A;  4WEL A;  5EVI C;  2WKE A;  5GLB A;  3MXR A;  1K6S A;  2HDU A;  2H0T A;  1ERQ A;  1Q2Q A;  4PMA A;  4ZTK A;  4H8R A;  2ZC5 B;  1GHP A;  1RCJ A;  1MWS A;  3UNW A;  1TEM A;  4EBL A;  3ISG A;  3N4I A;  1HD8 A;  3BFC A;  4K0X A;  1DJA A;  1CI9 A;  1IKI A;  1W7F A;  3ZCZ A;  4OKP A;  2QZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...